F486272
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 939 | 417 | 939 | 153 |
Family's Representative Sequence
| Representative Sequence | 3300005327|Ga0070658_10011335|Ga0070658_100113354 |
| Length | 150 |
| Sequence | MSETGTLREYVTAEIGGELIGMPILRVQDVFIPESPTRVPLAPPEIAGVLNLRGRIVTLIDMRRRLGLSGGSDKASLAIGVELRGESYGLLIDAIGEVLKLDDDAREGNPVNLDPRLARVSTGIHRLNDRLLMVLDVDRVLDIAVQSIAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 3 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 4 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 5 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 6 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 7 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 8 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 9 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 10 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 11 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 12 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 13 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 14 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 15 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 16 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 17 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 18 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 19 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 21 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 29 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 33 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 64 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 69 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 72 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 80 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 82 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 83 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 84 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 86 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 87 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 88 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 89 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 90 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 91 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 92 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 93 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 94 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 95 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 96 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 97 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 99 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 100 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 101 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 102 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 103 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 105 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 106 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 107 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 108 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 109 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 110 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 111 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 113 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300012478 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 | Metagenome | Rhizosphere |
| 129 | 3300012480 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 | Metagenome | Rhizosphere |
| 130 | 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Metagenome | Rhizosphere |
| 131 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 132 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 133 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 134 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 135 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 151 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 152 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 230 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 234 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 235 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 236 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 237 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 238 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 239 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 240 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 241 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 242 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 243 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 244 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 245 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 246 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 247 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 248 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 249 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 250 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 251 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 252 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 253 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 254 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 255 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 256 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 257 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 258 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 259 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 260 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 261 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 262 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 263 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 264 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 265 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 266 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 267 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 268 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 269 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 270 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 271 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 272 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 273 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 274 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 275 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 276 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 277 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 278 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 279 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 280 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 281 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 282 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 283 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 284 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 285 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 286 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 287 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 288 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 289 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 290 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 291 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 292 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 293 | 3300038698 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 | Metagenome | Rhizosphere |
| 294 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 295 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 296 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 297 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 298 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 299 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 300 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 301 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 302 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 303 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 304 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 305 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 306 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 307 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 308 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 309 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 310 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 311 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 312 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 313 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 355 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 356 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 357 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 358 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 359 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 360 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 361 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 362 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 363 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 364 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 365 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 366 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 367 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 368 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 369 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 370 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 391 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 395 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 396 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 407 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 408 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 409 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 410 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 411 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 412 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 413 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 414 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 415 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 416 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 417 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.79 |
| Metatranscriptomes | 0.21 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.02 |
| Nodule | 0 |
| Rhizoplane | 6.39 |
| Rhizosphere | 91.27 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.32 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214544922 | 2209111006 | Bacteria | 19930 |
| 2 | ARcpr5oldR_c000056 | 3300000041 | Bacteria | 20790 |
| 3 | ARSoilYngRDRAFT_c00038 | 3300000042 | Bacteria | 20556 |
| 4 | ARcpr5yngRDRAFT_c000037 | 3300000043 | Bacteria | 20897 |
| 5 | ARSoilOldRDRAFT_c000060 | 3300000044 | Bacteria | 22426 |
| 6 | ARCol0oldRDRAFT_c00584 | 3300000045 | Bacteria | 3237 |
| 7 | ARCol0yngRDRAFT_1000282 | 3300000652 | Bacteria | 8006 |
| 8 | JGI24739J22299_10005110 | 3300001989 | Bacteria | 4996 |
| 9 | JGI24737J22298_10010531 | 3300001990 | Bacteria | 3050 |
| 10 | JGI24737J22298_10018489 | 3300001990 | Bacteria | 2237 |
| 11 | JGI24750J21931_1000905 | 3300002070 | Bacteria | 4030 |
| 12 | JGI24748J21848_1000368 | 3300002074 | Bacteria | 5120 |
| 13 | JGI24738J21930_10000907 | 3300002075 | Bacteria | 8520 |
| 14 | JGI24744J21845_10000074 | 3300002077 | Bacteria | 12517 |
| 15 | JGI24035J26624_1000024 | 3300002126 | Bacteria | 10977 |
| 16 | JGI24035J26624_1000069 | 3300002126 | Bacteria | 8293 |
| 17 | JGI24742J22300_10001012 | 3300002244 | Bacteria | 4326 |
| 18 | JGI24751J29686_10005292 | 3300002459 | Bacteria | 2625 |
| 19 | JGI25405J52794_10146540 | 3300003911 | Bacteria | 538 |
| 20 | Ga0065717_1001986 | 3300005276 | Bacteria | 4090 |
| 21 | Ga0065704_10075779 | 3300005289 | Bacteria | 5428 |
| 22 | Ga0065712_10009656 | 3300005290 | Bacteria | 2559 |
| 23 | Ga0065712_10078326 | 3300005290 | Bacteria | 3364 |
| 24 | Ga0065712_10080698 | 3300005290 | Bacteria | 3078 |
| 25 | Ga0065715_10020644 | 3300005293 | Bacteria | 3110 |
| 26 | Ga0070658_10011335 | 3300005327 | Bacteria | 7148 |
| 27 | Ga0070658_10445637 | 3300005327 | Bacteria | 1115 |
| 28 | Ga0070676_10000085 | 3300005328 | Bacteria | 32591 |
| 29 | Ga0070676_10164820 | 3300005328 | Bacteria | 1429 |
| 30 | Ga0070683_100003426 | 3300005329 | Bacteria | 12877 |
| 31 | Ga0070683_100010425 | 3300005329 | Bacteria | 7992 |
| 32 | Ga0070683_100179463 | 3300005329 | Bacteria | 2010 |
| 33 | Ga0070690_100023770 | 3300005330 | Bacteria | 3762 |
| 34 | Ga0070690_100217662 | 3300005330 | Bacteria | 1337 |
| 35 | Ga0070670_100045650 | 3300005331 | Bacteria | 3767 |
| 36 | Ga0070677_10000381 | 3300005333 | Bacteria | 15617 |
| 37 | Ga0068869_100000832 | 3300005334 | Bacteria | 17622 |
| 38 | Ga0070666_10050801 | 3300005335 | Bacteria | 2789 |
| 39 | Ga0070666_10154150 | 3300005335 | Bacteria | 1604 |
| 40 | Ga0070680_100005059 | 3300005336 | Bacteria | 9947 |
| 41 | Ga0070680_100008571 | 3300005336 | Bacteria | 7835 |
| 42 | Ga0070680_100270099 | 3300005336 | Bacteria | 1440 |
| 43 | Ga0070680_100865053 | 3300005336 | Bacteria | 779 |
| 44 | Ga0070682_100028237 | 3300005337 | Bacteria | 3374 |
| 45 | Ga0070682_100031073 | 3300005337 | Bacteria | 3229 |
| 46 | Ga0070682_100114322 | 3300005337 | Bacteria | 1804 |
| 47 | Ga0068868_100000495 | 3300005338 | Bacteria | 26269 |
| 48 | Ga0068868_100210301 | 3300005338 | Bacteria | 1625 |
| 49 | Ga0070660_100007071 | 3300005339 | Bacteria | 7798 |
| 50 | Ga0070660_100068323 | 3300005339 | Bacteria | 2769 |
| 51 | Ga0070660_100068984 | 3300005339 | Bacteria | 2756 |
| 52 | Ga0070660_100484773 | 3300005339 | Bacteria | 1028 |
| 53 | Ga0070660_100939211 | 3300005339 | Bacteria | 730 |
| 54 | Ga0070689_100064034 | 3300005340 | Bacteria | 2861 |
| 55 | Ga0070689_100297273 | 3300005340 | Bacteria | 1343 |
| 56 | Ga0070691_10002861 | 3300005341 | Bacteria | 7728 |
| 57 | Ga0070691_10101797 | 3300005341 | Bacteria | 1427 |
| 58 | Ga0070687_100001770 | 3300005343 | Bacteria | 7798 |
| 59 | Ga0070661_100000983 | 3300005344 | Bacteria | 20204 |
| 60 | Ga0070692_10002229 | 3300005345 | Bacteria | 7429 |
| 61 | Ga0070668_100005583 | 3300005347 | Bacteria | 9331 |
| 62 | Ga0070668_100099878 | 3300005347 | Bacteria | 2298 |
| 63 | Ga0070669_100002421 | 3300005353 | Bacteria | 13502 |
| 64 | Ga0070675_100001045 | 3300005354 | Bacteria | 19938 |
| 65 | Ga0070671_100000386 | 3300005355 | Bacteria | 30345 |
| 66 | Ga0070671_100028690 | 3300005355 | Bacteria | 4584 |
| 67 | Ga0070671_100167936 | 3300005355 | Bacteria | 1855 |
| 68 | Ga0070671_100737816 | 3300005355 | Bacteria | 855 |
| 69 | Ga0070674_100006162 | 3300005356 | Bacteria | 6974 |
| 70 | Ga0070674_100957957 | 3300005356 | Bacteria | 749 |
| 71 | Ga0070673_100009652 | 3300005364 | Bacteria | 6491 |
| 72 | Ga0070688_100033469 | 3300005365 | Bacteria | 3107 |
| 73 | Ga0070688_100125808 | 3300005365 | Bacteria | 1722 |
| 74 | Ga0070688_100126315 | 3300005365 | Bacteria | 1719 |
| 75 | Ga0070659_100007775 | 3300005366 | Bacteria | 7798 |
| 76 | Ga0070659_100222970 | 3300005366 | Bacteria | 1557 |
| 77 | Ga0070667_100296318 | 3300005367 | Bacteria | 1455 |
| 78 | Ga0070667_100657925 | 3300005367 | Bacteria | 967 |
| 79 | Ga0070703_10005487 | 3300005406 | Bacteria | 3548 |
| 80 | Ga0070709_10016725 | 3300005434 | Bacteria | 4193 |
| 81 | Ga0070709_10023290 | 3300005434 | Bacteria | 3633 |
| 82 | Ga0070709_10143939 | 3300005434 | Bacteria | 1640 |
| 83 | Ga0070709_10829887 | 3300005434 | Bacteria | 727 |
| 84 | Ga0070709_11070810 | 3300005434 | Bacteria | 644 |
| 85 | Ga0070714_100028926 | 3300005435 | Bacteria | 4603 |
| 86 | Ga0070714_100031838 | 3300005435 | Bacteria | 4402 |
| 87 | Ga0070714_100076629 | 3300005435 | Bacteria | 2904 |
| 88 | Ga0070714_100736146 | 3300005435 | Bacteria | 953 |
| 89 | Ga0070713_100028382 | 3300005436 | Bacteria | 4418 |
| 90 | Ga0070713_100242511 | 3300005436 | Bacteria | 1642 |
| 91 | Ga0070713_100833977 | 3300005436 | Bacteria | 885 |
| 92 | Ga0070713_100895097 | 3300005436 | Bacteria | 853 |
| 93 | Ga0070710_10034212 | 3300005437 | Bacteria | 2764 |
| 94 | Ga0070710_10050952 | 3300005437 | Bacteria | 2323 |
| 95 | Ga0070701_10000908 | 3300005438 | Bacteria | 10710 |
| 96 | Ga0070711_100011651 | 3300005439 | Bacteria | 5464 |
| 97 | Ga0070711_100054215 | 3300005439 | Bacteria | 2766 |
| 98 | Ga0070711_100125077 | 3300005439 | Bacteria | 1908 |
| 99 | Ga0070711_100214232 | 3300005439 | Bacteria | 1493 |
| 100 | Ga0070711_100245600 | 3300005439 | Bacteria | 1401 |
| 101 | Ga0070711_101677175 | 3300005439 | Bacteria | 557 |
| 102 | Ga0070705_100003404 | 3300005440 | Bacteria | 7798 |
| 103 | Ga0070705_100365850 | 3300005440 | Bacteria | 1056 |
| 104 | Ga0070705_100408374 | 3300005440 | Bacteria | 1007 |
| 105 | Ga0070700_100003334 | 3300005441 | Bacteria | 8278 |
| 106 | Ga0070700_101561241 | 3300005441 | Unclassified | 563 |
| 107 | Ga0070694_100005587 | 3300005444 | Bacteria | 7622 |
| 108 | Ga0070708_100064337 | 3300005445 | Bacteria | 3286 |
| 109 | Ga0070663_100012099 | 3300005455 | Bacteria | 5446 |
| 110 | Ga0070663_100150828 | 3300005455 | Bacteria | 1782 |
| 111 | Ga0070663_100240197 | 3300005455 | Bacteria | 1429 |
| 112 | Ga0070663_100733134 | 3300005455 | Bacteria | 842 |
| 113 | Ga0070678_100000260 | 3300005456 | Bacteria | 24374 |
| 114 | Ga0070678_100154027 | 3300005456 | Bacteria | 1855 |
| 115 | Ga0070678_100594102 | 3300005456 | Bacteria | 987 |
| 116 | Ga0070662_100084360 | 3300005457 | Bacteria | 2372 |
| 117 | Ga0070662_100414481 | 3300005457 | Bacteria | 1113 |
| 118 | Ga0070662_100497392 | 3300005457 | Bacteria | 1017 |
| 119 | Ga0070681_10003989 | 3300005458 | Bacteria | 13923 |
| 120 | Ga0070681_10035093 | 3300005458 | Bacteria | 5038 |
| 121 | Ga0070681_10071454 | 3300005458 | Bacteria | 3435 |
| 122 | Ga0070681_10405100 | 3300005458 | Bacteria | 1275 |
| 123 | Ga0068867_100002696 | 3300005459 | Bacteria | 12524 |
| 124 | Ga0068867_100107284 | 3300005459 | Bacteria | 2140 |
| 125 | Ga0070685_10007108 | 3300005466 | Bacteria | 5717 |
| 126 | Ga0070685_10023063 | 3300005466 | Bacteria | 3403 |
| 127 | Ga0070685_10149156 | 3300005466 | Bacteria | 1480 |
| 128 | Ga0070707_100222997 | 3300005468 | Bacteria | 1836 |
| 129 | Ga0070698_100733499 | 3300005471 | Bacteria | 931 |
| 130 | Ga0070699_100506441 | 3300005518 | Bacteria | 1097 |
| 131 | Ga0070679_100016998 | 3300005530 | Bacteria | 7032 |
| 132 | Ga0070679_100043302 | 3300005530 | Bacteria | 4483 |
| 133 | Ga0070679_100062508 | 3300005530 | Bacteria | 3712 |
| 134 | Ga0070679_100460335 | 3300005530 | Bacteria | 1216 |
| 135 | Ga0070679_100527303 | 3300005530 | Bacteria | 1125 |
| 136 | Ga0070679_100864914 | 3300005530 | Bacteria | 847 |
| 137 | Ga0070684_100002858 | 3300005535 | Bacteria | 12838 |
| 138 | Ga0070684_100029407 | 3300005535 | Bacteria | 4656 |
| 139 | Ga0070684_101135567 | 3300005535 | Bacteria | 734 |
| 140 | Ga0070684_101321803 | 3300005535 | Bacteria | 679 |
| 141 | Ga0070684_101622635 | 3300005535 | Unclassified | 610 |
| 142 | Ga0070697_100443608 | 3300005536 | Bacteria | 1130 |
| 143 | Ga0068853_100073074 | 3300005539 | Bacteria | 2989 |
| 144 | Ga0068853_100173730 | 3300005539 | Bacteria | 1950 |
| 145 | Ga0070672_100006644 | 3300005543 | Bacteria | 7790 |
| 146 | Ga0070686_100030263 | 3300005544 | Bacteria | 3300 |
| 147 | Ga0070686_100197802 | 3300005544 | Bacteria | 1439 |
| 148 | Ga0070695_100020350 | 3300005545 | Bacteria | 4051 |
| 149 | Ga0070695_100022315 | 3300005545 | Bacteria | 3882 |
| 150 | Ga0070696_100034090 | 3300005546 | Bacteria | 3501 |
| 151 | Ga0070696_100328134 | 3300005546 | Bacteria | 1179 |
| 152 | Ga0070696_101826230 | 3300005546 | Bacteria | 525 |
| 153 | Ga0070693_100000947 | 3300005547 | Bacteria | 12881 |
| 154 | Ga0070693_100024354 | 3300005547 | Bacteria | 3245 |
| 155 | Ga0070693_100027275 | 3300005547 | Bacteria | 3094 |
| 156 | Ga0070665_100355973 | 3300005548 | Bacteria | 1470 |
| 157 | Ga0070665_100718134 | 3300005548 | Bacteria | 1012 |
| 158 | Ga0070704_100239051 | 3300005549 | Bacteria | 1485 |
| 159 | Ga0068855_100147058 | 3300005563 | Bacteria | 2682 |
| 160 | Ga0068855_100216080 | 3300005563 | Bacteria | 2152 |
| 161 | Ga0068855_100261759 | 3300005563 | Bacteria | 1926 |
| 162 | Ga0068855_100417287 | 3300005563 | Bacteria | 1468 |
| 163 | Ga0070664_100002866 | 3300005564 | Bacteria | 13967 |
| 164 | Ga0070664_100701938 | 3300005564 | Bacteria | 943 |
| 165 | Ga0068857_100002854 | 3300005577 | Bacteria | 14200 |
| 166 | Ga0068857_100185441 | 3300005577 | Bacteria | 1894 |
| 167 | Ga0068854_100014002 | 3300005578 | Bacteria | 5277 |
| 168 | Ga0068854_100213516 | 3300005578 | Bacteria | 1523 |
| 169 | Ga0068854_100489761 | 3300005578 | Bacteria | 1034 |
| 170 | Ga0068856_100002432 | 3300005614 | Bacteria | 19156 |
| 171 | Ga0068856_100064883 | 3300005614 | Bacteria | 3608 |
| 172 | Ga0068856_100192582 | 3300005614 | Bacteria | 2053 |
| 173 | Ga0068856_100460879 | 3300005614 | Bacteria | 1292 |
| 174 | Ga0068856_100957560 | 3300005614 | Bacteria | 874 |
| 175 | Ga0070702_100001455 | 3300005615 | Bacteria | 9702 |
| 176 | Ga0068852_100022111 | 3300005616 | Bacteria | 5093 |
| 177 | Ga0068852_100426174 | 3300005616 | Bacteria | 1309 |
| 178 | Ga0068852_100580087 | 3300005616 | Bacteria | 1124 |
| 179 | Ga0068859_100268285 | 3300005617 | Bacteria | 1799 |
| 180 | Ga0068859_100402635 | 3300005617 | Bacteria | 1465 |
| 181 | Ga0068864_100003611 | 3300005618 | Bacteria | 12790 |
| 182 | Ga0068866_10000364 | 3300005718 | Bacteria | 21278 |
| 183 | Ga0068866_11110913 | 3300005718 | Bacteria | 567 |
| 184 | Ga0068861_100006781 | 3300005719 | Bacteria | 7824 |
| 185 | Ga0068861_100310779 | 3300005719 | Bacteria | 1369 |
| 186 | Ga0068851_10026178 | 3300005834 | Bacteria | 2864 |
| 187 | Ga0068851_10305352 | 3300005834 | Bacteria | 916 |
| 188 | Ga0068870_10000015 | 3300005840 | Bacteria | 63346 |
| 189 | Ga0068863_100000278 | 3300005841 | Bacteria | 53024 |
| 190 | Ga0068863_100043782 | 3300005841 | Bacteria | 4249 |
| 191 | Ga0068858_100042094 | 3300005842 | Bacteria | 4235 |
| 192 | Ga0068858_100357013 | 3300005842 | Bacteria | 1400 |
| 193 | Ga0068860_100005473 | 3300005843 | Bacteria | 12870 |
| 194 | Ga0068860_100196722 | 3300005843 | Bacteria | 1952 |
| 195 | Ga0068860_100374697 | 3300005843 | Bacteria | 1404 |
| 196 | Ga0068860_100422597 | 3300005843 | Bacteria | 1321 |
| 197 | Ga0068860_100976067 | 3300005843 | Unclassified | 865 |
| 198 | Ga0068862_100003784 | 3300005844 | Bacteria | 12895 |
| 199 | Ga0068862_100435980 | 3300005844 | Bacteria | 1232 |
| 200 | Ga0068862_101571878 | 3300005844 | Bacteria | 664 |
| 201 | Ga0081455_10001601 | 3300005937 | Bacteria | 27658 |
| 202 | Ga0081455_10082066 | 3300005937 | Bacteria | 2638 |
| 203 | Ga0070717_10144648 | 3300006028 | Bacteria | 2053 |
| 204 | Ga0075432_10240718 | 3300006058 | Bacteria | 731 |
| 205 | Ga0070715_10016578 | 3300006163 | Bacteria | 2771 |
| 206 | Ga0070716_100018193 | 3300006173 | Bacteria | 3656 |
| 207 | Ga0070716_100114391 | 3300006173 | Bacteria | 1678 |
| 208 | Ga0070716_100153419 | 3300006173 | Bacteria | 1484 |
| 209 | Ga0070712_100012900 | 3300006175 | Bacteria | 5324 |
| 210 | Ga0070712_100078211 | 3300006175 | Bacteria | 2387 |
| 211 | Ga0070712_100309321 | 3300006175 | Bacteria | 1281 |
| 212 | Ga0070712_100371284 | 3300006175 | Bacteria | 1175 |
| 213 | Ga0070712_100440913 | 3300006175 | Bacteria | 1083 |
| 214 | Ga0070712_100773489 | 3300006175 | Bacteria | 822 |
| 215 | Ga0075367_10035568 | 3300006178 | Bacteria | 2883 |
| 216 | Ga0097621_100009409 | 3300006237 | Bacteria | 7089 |
| 217 | Ga0097621_100019613 | 3300006237 | Bacteria | 5194 |
| 218 | Ga0097621_100252555 | 3300006237 | Bacteria | 1544 |
| 219 | Ga0075370_10041043 | 3300006353 | Bacteria | 2612 |
| 220 | Ga0075370_10116379 | 3300006353 | Bacteria | 1554 |
| 221 | Ga0068871_100005915 | 3300006358 | Bacteria | 8606 |
| 222 | Ga0068871_100088803 | 3300006358 | Bacteria | 2572 |
| 223 | Ga0068871_100153104 | 3300006358 | Bacteria | 1967 |
| 224 | Ga0075433_10088886 | 3300006852 | Bacteria | 2730 |
| 225 | Ga0075434_100011707 | 3300006871 | Bacteria | 8283 |
| 226 | Ga0075429_100543689 | 3300006880 | Bacteria | 1018 |
| 227 | Ga0068865_100046627 | 3300006881 | Bacteria | 2974 |
| 228 | Ga0075436_100144184 | 3300006914 | Bacteria | 1674 |
| 229 | Ga0097620_100268300 | 3300006931 | Bacteria | 1799 |
| 230 | Ga0097620_100402642 | 3300006931 | Bacteria | 1465 |
| 231 | Ga0075435_100307280 | 3300007076 | Bacteria | 1357 |
| 232 | Ga0075435_100434709 | 3300007076 | Bacteria | 1131 |
| 233 | Ga0075435_100491581 | 3300007076 | Bacteria | 1060 |
| 234 | Ga0105251_10079855 | 3300009011 | Bacteria | 1513 |
| 235 | Ga0105251_10284245 | 3300009011 | Bacteria | 748 |
| 236 | Ga0105244_10092970 | 3300009036 | Bacteria | 1482 |
| 237 | Ga0105250_10041851 | 3300009092 | Bacteria | 1836 |
| 238 | Ga0105250_10166071 | 3300009092 | Bacteria | 923 |
| 239 | Ga0111539_10022188 | 3300009094 | Bacteria | 7804 |
| 240 | Ga0111539_10080457 | 3300009094 | Bacteria | 3833 |
| 241 | Ga0111539_10121090 | 3300009094 | Bacteria | 3066 |
| 242 | Ga0105245_10003800 | 3300009098 | Bacteria | 13429 |
| 243 | Ga0105245_10158044 | 3300009098 | Bacteria | 2149 |
| 244 | Ga0105245_11102628 | 3300009098 | Bacteria | 840 |
| 245 | Ga0105245_11284263 | 3300009098 | Bacteria | 781 |
| 246 | Ga0105245_12090982 | 3300009098 | Bacteria | 620 |
| 247 | Ga0105247_10012563 | 3300009101 | Bacteria | 5087 |
| 248 | Ga0105247_10029045 | 3300009101 | Bacteria | 3348 |
| 249 | Ga0105247_10427843 | 3300009101 | Bacteria | 949 |
| 250 | Ga0105247_10978299 | 3300009101 | Bacteria | 659 |
| 251 | Ga0105243_10007557 | 3300009148 | Bacteria | 8357 |
| 252 | Ga0105243_10023375 | 3300009148 | Bacteria | 4707 |
| 253 | Ga0105243_10185610 | 3300009148 | Bacteria | 1812 |
| 254 | Ga0105241_10000982 | 3300009174 | Bacteria | 21606 |
| 255 | Ga0105241_10023898 | 3300009174 | Bacteria | 4536 |
| 256 | Ga0105241_10280611 | 3300009174 | Bacteria | 1423 |
| 257 | Ga0105241_10291363 | 3300009174 | Bacteria | 1398 |
| 258 | Ga0105242_10001299 | 3300009176 | Bacteria | 19749 |
| 259 | Ga0105242_10008924 | 3300009176 | Bacteria | 7694 |
| 260 | Ga0105242_10133517 | 3300009176 | Bacteria | 2146 |
| 261 | Ga0105248_10002736 | 3300009177 | Bacteria | 19584 |
| 262 | Ga0105248_10011811 | 3300009177 | Bacteria | 9634 |
| 263 | Ga0105248_10157656 | 3300009177 | Bacteria | 2561 |
| 264 | Ga0105248_10358083 | 3300009177 | Bacteria | 1643 |
| 265 | Ga0105237_10019497 | 3300009545 | Bacteria | 7004 |
| 266 | Ga0105237_10295171 | 3300009545 | Bacteria | 1624 |
| 267 | Ga0105237_10365882 | 3300009545 | Bacteria | 1447 |
| 268 | Ga0105237_10372078 | 3300009545 | Bacteria | 1433 |
| 269 | Ga0105237_11521316 | 3300009545 | Unclassified | 676 |
| 270 | Ga0105238_10040330 | 3300009551 | Bacteria | 4731 |
| 271 | Ga0105238_10278821 | 3300009551 | Bacteria | 1653 |
| 272 | Ga0105238_10545414 | 3300009551 | Bacteria | 1163 |
| 273 | Ga0105249_10003014 | 3300009553 | Bacteria | 14526 |
| 274 | Ga0105249_10087070 | 3300009553 | Bacteria | 2914 |
| 275 | Ga0105249_10114678 | 3300009553 | Bacteria | 2551 |
| 276 | Ga0105249_10420896 | 3300009553 | Bacteria | 1369 |
| 277 | Ga0105249_10540713 | 3300009553 | Bacteria | 1215 |
| 278 | Ga0105239_10015884 | 3300010375 | Bacteria | 8334 |
| 279 | Ga0105239_10101705 | 3300010375 | Bacteria | 3179 |
| 280 | Ga0105239_10350876 | 3300010375 | Bacteria | 1666 |
| 281 | Ga0105239_10634999 | 3300010375 | Bacteria | 1219 |
| 282 | Ga0105246_10004947 | 3300011119 | Bacteria | 8112 |
| 283 | Ga0105246_10158676 | 3300011119 | Bacteria | 1721 |
| 284 | Ga0157328_1001908 | 3300012478 | Bacteria | 947 |
| 285 | Ga0157346_1001147 | 3300012480 | Bacteria | 1230 |
| 286 | Ga0157343_1004982 | 3300012488 | Bacteria | 845 |
| 287 | Ga0157322_1001471 | 3300012490 | Bacteria | 1175 |
| 288 | Ga0157347_1011258 | 3300012502 | Bacteria | 948 |
| 289 | Ga0157342_1004570 | 3300012507 | Bacteria | 1235 |
| 290 | Ga0157315_1007302 | 3300012508 | Bacteria | 892 |
| 291 | Ga0157373_10017859 | 3300013100 | Bacteria | 5166 |
| 292 | Ga0157373_10065620 | 3300013100 | Bacteria | 2568 |
| 293 | Ga0157373_10178233 | 3300013100 | Bacteria | 1496 |
| 294 | Ga0157373_10481740 | 3300013100 | Bacteria | 895 |
| 295 | Ga0157371_10160695 | 3300013102 | Bacteria | 1604 |
| 296 | Ga0157371_10226602 | 3300013102 | Bacteria | 1343 |
| 297 | Ga0157370_10125769 | 3300013104 | Bacteria | 2392 |
| 298 | Ga0157370_10196656 | 3300013104 | Bacteria | 1871 |
| 299 | Ga0157369_10045190 | 3300013105 | Bacteria | 4792 |
| 300 | Ga0157369_10373571 | 3300013105 | Bacteria | 1480 |
| 301 | Ga0157369_11556141 | 3300013105 | Bacteria | 672 |
| 302 | Ga0157374_10009129 | 3300013296 | Bacteria | 8498 |
| 303 | Ga0157374_10091222 | 3300013296 | Bacteria | 2905 |
| 304 | Ga0157374_10487326 | 3300013296 | Bacteria | 1236 |
| 305 | Ga0157378_10004364 | 3300013297 | Bacteria | 12450 |
| 306 | Ga0157378_10042070 | 3300013297 | Bacteria | 4054 |
| 307 | Ga0157378_10474274 | 3300013297 | Bacteria | 1246 |
| 308 | Ga0163162_10011614 | 3300013306 | Bacteria | 8587 |
| 309 | Ga0163162_10087519 | 3300013306 | Bacteria | 3194 |
| 310 | Ga0163162_10341842 | 3300013306 | Bacteria | 1629 |
| 311 | Ga0157372_10195872 | 3300013307 | Bacteria | 2341 |
| 312 | Ga0157372_10249843 | 3300013307 | Bacteria | 2059 |
| 313 | Ga0157372_10611866 | 3300013307 | Bacteria | 1270 |
| 314 | Ga0157372_10618363 | 3300013307 | Bacteria | 1262 |
| 315 | Ga0157372_10721470 | 3300013307 | Bacteria | 1159 |
| 316 | Ga0157372_11798275 | 3300013307 | Bacteria | 705 |
| 317 | Ga0157375_10008586 | 3300013308 | Bacteria | 8945 |
| 318 | Ga0157375_10330690 | 3300013308 | Bacteria | 1689 |
| 319 | Ga0157375_10657776 | 3300013308 | Bacteria | 1204 |
| 320 | Ga0163163_10063140 | 3300014325 | Bacteria | 3672 |
| 321 | Ga0163163_10260337 | 3300014325 | Bacteria | 1786 |
| 322 | Ga0163163_10842531 | 3300014325 | Bacteria | 980 |
| 323 | Ga0163163_12583151 | 3300014325 | Unclassified | 565 |
| 324 | Ga0157380_10003889 | 3300014326 | Bacteria | 10302 |
| 325 | Ga0157380_10113220 | 3300014326 | Bacteria | 2284 |
| 326 | Ga0157380_11219269 | 3300014326 | Bacteria | 797 |
| 327 | Ga0157377_10000317 | 3300014745 | Bacteria | 22023 |
| 328 | Ga0157379_10000067 | 3300014968 | Bacteria | 66051 |
| 329 | Ga0157379_10018396 | 3300014968 | Bacteria | 6160 |
| 330 | Ga0157379_10516277 | 3300014968 | Bacteria | 1108 |
| 331 | Ga0157376_10005894 | 3300014969 | Bacteria | 8601 |
| 332 | Ga0157376_11634894 | 3300014969 | Bacteria | 679 |
| 333 | Ga0163161_10000693 | 3300017792 | Bacteria | 26852 |
| 334 | Ga0163161_10126818 | 3300017792 | Bacteria | 1922 |
| 335 | Ga0163161_11175856 | 3300017792 | Bacteria | 662 |
| 336 | Ga0206356_10272352 | 3300020070 | Bacteria | 918 |
| 337 | Ga0206356_11494623 | 3300020070 | Bacteria | 1061 |
| 338 | Ga0213876_10013750 | 3300021384 | Bacteria | 4289 |
| 339 | Ga0207666_1000681 | 3300025271 | Bacteria | 4075 |
| 340 | Ga0207666_1001215 | 3300025271 | Bacteria | 3027 |
| 341 | Ga0207673_1001404 | 3300025290 | Bacteria | 2624 |
| 342 | Ga0207697_10016607 | 3300025315 | Bacteria | 3031 |
| 343 | Ga0207697_10119883 | 3300025315 | Bacteria | 1131 |
| 344 | Ga0207653_10003762 | 3300025885 | Bacteria | 4774 |
| 345 | Ga0207653_10074057 | 3300025885 | Bacteria | 1168 |
| 346 | Ga0207682_10000264 | 3300025893 | Bacteria | 23612 |
| 347 | Ga0207692_10002735 | 3300025898 | Bacteria | 6804 |
| 348 | Ga0207642_10000834 | 3300025899 | Bacteria | 9610 |
| 349 | Ga0207642_10300214 | 3300025899 | Bacteria | 931 |
| 350 | Ga0207710_10005159 | 3300025900 | Bacteria | 5644 |
| 351 | Ga0207710_10025358 | 3300025900 | Bacteria | 2558 |
| 352 | Ga0207710_10087483 | 3300025900 | Bacteria | 1453 |
| 353 | Ga0207710_10379584 | 3300025900 | Bacteria | 723 |
| 354 | Ga0207688_10015833 | 3300025901 | Bacteria | 4091 |
| 355 | Ga0207688_10062252 | 3300025901 | Bacteria | 2103 |
| 356 | Ga0207680_10013218 | 3300025903 | Bacteria | 4233 |
| 357 | Ga0207647_10041608 | 3300025904 | Bacteria | 2888 |
| 358 | Ga0207685_10004366 | 3300025905 | Bacteria | 3586 |
| 359 | Ga0207685_10043609 | 3300025905 | Bacteria | 1691 |
| 360 | Ga0207699_10040119 | 3300025906 | Bacteria | 2696 |
| 361 | Ga0207699_10128144 | 3300025906 | Bacteria | 1651 |
| 362 | Ga0207699_10173029 | 3300025906 | Bacteria | 1446 |
| 363 | Ga0207699_10513252 | 3300025906 | Bacteria | 866 |
| 364 | Ga0207645_10000926 | 3300025907 | Bacteria | 24341 |
| 365 | Ga0207645_10222865 | 3300025907 | Bacteria | 1243 |
| 366 | Ga0207645_10451235 | 3300025907 | Bacteria | 868 |
| 367 | Ga0207643_10000004 | 3300025908 | Bacteria | 187006 |
| 368 | Ga0207705_11374108 | 3300025909 | Bacteria | 538 |
| 369 | Ga0207684_10096691 | 3300025910 | Bacteria | 2521 |
| 370 | Ga0207654_10000437 | 3300025911 | Bacteria | 23909 |
| 371 | Ga0207654_10872418 | 3300025911 | Unclassified | 652 |
| 372 | Ga0207707_10004519 | 3300025912 | Bacteria | 12230 |
| 373 | Ga0207707_10060140 | 3300025912 | Bacteria | 3305 |
| 374 | Ga0207707_11118437 | 3300025912 | Bacteria | 641 |
| 375 | Ga0207671_10010091 | 3300025914 | Bacteria | 7829 |
| 376 | Ga0207671_10283607 | 3300025914 | Bacteria | 1307 |
| 377 | Ga0207693_10001239 | 3300025915 | Bacteria | 22700 |
| 378 | Ga0207693_10006137 | 3300025915 | Bacteria | 9961 |
| 379 | Ga0207693_10013383 | 3300025915 | Bacteria | 6614 |
| 380 | Ga0207693_10064686 | 3300025915 | Bacteria | 2865 |
| 381 | Ga0207693_10335098 | 3300025915 | Bacteria | 1184 |
| 382 | Ga0207663_10019511 | 3300025916 | Bacteria | 3822 |
| 383 | Ga0207663_10022853 | 3300025916 | Bacteria | 3580 |
| 384 | Ga0207663_10071352 | 3300025916 | Bacteria | 2241 |
| 385 | Ga0207663_11144628 | 3300025916 | Bacteria | 626 |
| 386 | Ga0207660_10004154 | 3300025917 | Bacteria | 9422 |
| 387 | Ga0207660_10015766 | 3300025917 | Bacteria | 4994 |
| 388 | Ga0207660_10028341 | 3300025917 | Bacteria | 3830 |
| 389 | Ga0207660_10140445 | 3300025917 | Bacteria | 1846 |
| 390 | Ga0207660_11010526 | 3300025917 | Bacteria | 678 |
| 391 | Ga0207662_10032660 | 3300025918 | Bacteria | 3031 |
| 392 | Ga0207662_10328773 | 3300025918 | Bacteria | 1022 |
| 393 | Ga0207662_10381012 | 3300025918 | Bacteria | 953 |
| 394 | Ga0207657_10052397 | 3300025919 | Bacteria | 3541 |
| 395 | Ga0207657_10054228 | 3300025919 | Bacteria | 3468 |
| 396 | Ga0207657_10077345 | 3300025919 | Bacteria | 2804 |
| 397 | Ga0207657_10643333 | 3300025919 | Bacteria | 826 |
| 398 | Ga0207649_10000090 | 3300025920 | Bacteria | 75387 |
| 399 | Ga0207652_10001397 | 3300025921 | Bacteria | 21434 |
| 400 | Ga0207652_10004018 | 3300025921 | Bacteria | 12012 |
| 401 | Ga0207652_10068573 | 3300025921 | Bacteria | 3078 |
| 402 | Ga0207652_10250845 | 3300025921 | Bacteria | 1596 |
| 403 | Ga0207652_10424313 | 3300025921 | Bacteria | 1199 |
| 404 | Ga0207652_10613162 | 3300025921 | Bacteria | 975 |
| 405 | Ga0207681_10001592 | 3300025923 | Bacteria | 14608 |
| 406 | Ga0207694_11216550 | 3300025924 | Bacteria | 637 |
| 407 | Ga0207650_10007098 | 3300025925 | Bacteria | 7630 |
| 408 | Ga0207659_10000038 | 3300025926 | Bacteria | 93848 |
| 409 | Ga0207687_10000445 | 3300025927 | Bacteria | 28075 |
| 410 | Ga0207687_10017603 | 3300025927 | Bacteria | 4707 |
| 411 | Ga0207700_10003402 | 3300025928 | Bacteria | 9241 |
| 412 | Ga0207700_10085958 | 3300025928 | Bacteria | 2470 |
| 413 | Ga0207700_10099918 | 3300025928 | Bacteria | 2311 |
| 414 | Ga0207664_10608410 | 3300025929 | Bacteria | 981 |
| 415 | Ga0207644_10000816 | 3300025931 | Bacteria | 19791 |
| 416 | Ga0207644_10514398 | 3300025931 | Bacteria | 988 |
| 417 | Ga0207690_10000440 | 3300025932 | Bacteria | 26959 |
| 418 | Ga0207690_10082283 | 3300025932 | Bacteria | 2251 |
| 419 | Ga0207690_10144572 | 3300025932 | Bacteria | 1757 |
| 420 | Ga0207690_10244781 | 3300025932 | Bacteria | 1383 |
| 421 | Ga0207690_10440704 | 3300025932 | Bacteria | 1045 |
| 422 | Ga0207706_10008938 | 3300025933 | Bacteria | 9223 |
| 423 | Ga0207706_10055499 | 3300025933 | Bacteria | 3493 |
| 424 | Ga0207706_10059966 | 3300025933 | Bacteria | 3351 |
| 425 | Ga0207686_10000433 | 3300025934 | Bacteria | 28288 |
| 426 | Ga0207686_10369100 | 3300025934 | Bacteria | 1085 |
| 427 | Ga0207709_10000494 | 3300025935 | Bacteria | 35647 |
| 428 | Ga0207709_10021426 | 3300025935 | Bacteria | 3659 |
| 429 | Ga0207709_10184343 | 3300025935 | Bacteria | 1477 |
| 430 | Ga0207670_10001363 | 3300025936 | Bacteria | 12858 |
| 431 | Ga0207670_10139679 | 3300025936 | Bacteria | 1785 |
| 432 | Ga0207670_10512922 | 3300025936 | Bacteria | 975 |
| 433 | Ga0207670_11006992 | 3300025936 | Bacteria | 701 |
| 434 | Ga0207669_10000063 | 3300025937 | Bacteria | 53494 |
| 435 | Ga0207669_10109699 | 3300025937 | Bacteria | 1846 |
| 436 | Ga0207669_10455866 | 3300025937 | Bacteria | 1014 |
| 437 | Ga0207704_10001268 | 3300025938 | Bacteria | 11299 |
| 438 | Ga0207665_10003373 | 3300025939 | Bacteria | 10695 |
| 439 | Ga0207665_10028918 | 3300025939 | Bacteria | 3664 |
| 440 | Ga0207665_10030904 | 3300025939 | Bacteria | 3541 |
| 441 | Ga0207665_10108301 | 3300025939 | Bacteria | 1949 |
| 442 | Ga0207691_10000981 | 3300025940 | Bacteria | 28361 |
| 443 | Ga0207691_10517083 | 3300025940 | Bacteria | 1013 |
| 444 | Ga0207711_10000792 | 3300025941 | Bacteria | 31089 |
| 445 | Ga0207711_10012513 | 3300025941 | Bacteria | 7052 |
| 446 | Ga0207711_10075463 | 3300025941 | Bacteria | 2934 |
| 447 | Ga0207689_10002635 | 3300025942 | Bacteria | 16609 |
| 448 | Ga0207689_10247590 | 3300025942 | Bacteria | 1474 |
| 449 | Ga0207689_10419153 | 3300025942 | Bacteria | 1117 |
| 450 | Ga0207661_10000531 | 3300025944 | Bacteria | 24434 |
| 451 | Ga0207661_10284230 | 3300025944 | Bacteria | 1479 |
| 452 | Ga0207661_10473035 | 3300025944 | Bacteria | 1143 |
| 453 | Ga0207679_10001109 | 3300025945 | Bacteria | 17141 |
| 454 | Ga0207679_10054930 | 3300025945 | Bacteria | 2934 |
| 455 | Ga0207679_10231357 | 3300025945 | Bacteria | 1561 |
| 456 | Ga0207679_10526080 | 3300025945 | Bacteria | 1058 |
| 457 | Ga0207667_10022580 | 3300025949 | Bacteria | 6945 |
| 458 | Ga0207667_10554214 | 3300025949 | Bacteria | 1162 |
| 459 | Ga0207651_10000379 | 3300025960 | Bacteria | 18945 |
| 460 | Ga0207651_10565668 | 3300025960 | Bacteria | 990 |
| 461 | Ga0207712_10000717 | 3300025961 | Bacteria | 25585 |
| 462 | Ga0207712_10339234 | 3300025961 | Bacteria | 1246 |
| 463 | Ga0207712_10659694 | 3300025961 | Bacteria | 910 |
| 464 | Ga0207668_10000429 | 3300025972 | Bacteria | 26510 |
| 465 | Ga0207668_10016879 | 3300025972 | Bacteria | 4567 |
| 466 | Ga0207640_10000516 | 3300025981 | Bacteria | 23270 |
| 467 | Ga0207658_10020967 | 3300025986 | Bacteria | 4530 |
| 468 | Ga0207658_10079727 | 3300025986 | Bacteria | 2506 |
| 469 | Ga0207658_10436337 | 3300025986 | Bacteria | 1157 |
| 470 | Ga0207677_10001164 | 3300026023 | Bacteria | 14343 |
| 471 | Ga0207677_10217318 | 3300026023 | Bacteria | 1530 |
| 472 | Ga0207703_10007685 | 3300026035 | Bacteria | 8544 |
| 473 | Ga0207703_10074671 | 3300026035 | Bacteria | 2808 |
| 474 | Ga0207703_10140580 | 3300026035 | Bacteria | 2095 |
| 475 | Ga0207703_10456481 | 3300026035 | Bacteria | 1194 |
| 476 | Ga0207639_10003596 | 3300026041 | Bacteria | 10414 |
| 477 | Ga0207639_10292101 | 3300026041 | Bacteria | 1438 |
| 478 | Ga0207639_10346725 | 3300026041 | Bacteria | 1325 |
| 479 | Ga0207678_10002770 | 3300026067 | Bacteria | 15870 |
| 480 | Ga0207678_10026091 | 3300026067 | Bacteria | 5097 |
| 481 | Ga0207678_10140321 | 3300026067 | Bacteria | 2062 |
| 482 | Ga0207708_10055110 | 3300026075 | Bacteria | 3031 |
| 483 | Ga0207708_10055122 | 3300026075 | Bacteria | 3031 |
| 484 | Ga0207702_10003627 | 3300026078 | Bacteria | 14009 |
| 485 | Ga0207702_10230482 | 3300026078 | Bacteria | 1731 |
| 486 | Ga0207702_10430426 | 3300026078 | Bacteria | 1277 |
| 487 | Ga0207702_11190156 | 3300026078 | Unclassified | 756 |
| 488 | Ga0207641_10003728 | 3300026088 | Bacteria | 13402 |
| 489 | Ga0207641_10046965 | 3300026088 | Bacteria | 3640 |
| 490 | Ga0207641_10535008 | 3300026088 | Bacteria | 1141 |
| 491 | Ga0207648_10013027 | 3300026089 | Bacteria | 7756 |
| 492 | Ga0207648_10412631 | 3300026089 | Bacteria | 1225 |
| 493 | Ga0207648_10648804 | 3300026089 | Bacteria | 975 |
| 494 | Ga0207676_10000583 | 3300026095 | Bacteria | 30033 |
| 495 | Ga0207676_10078337 | 3300026095 | Bacteria | 2677 |
| 496 | Ga0207676_10295329 | 3300026095 | Bacteria | 1477 |
| 497 | Ga0207674_10028860 | 3300026116 | Bacteria | 5849 |
| 498 | Ga0207674_10409594 | 3300026116 | Bacteria | 1310 |
| 499 | Ga0207675_100036186 | 3300026118 | Bacteria | 4605 |
| 500 | Ga0207675_100429521 | 3300026118 | Bacteria | 1306 |
| 501 | Ga0207683_10000138 | 3300026121 | Bacteria | 60113 |
| 502 | Ga0207683_10025410 | 3300026121 | Bacteria | 5109 |
| 503 | Ga0207683_10228463 | 3300026121 | Bacteria | 1697 |
| 504 | Ga0207698_10005821 | 3300026142 | Bacteria | 7655 |
| 505 | Ga0207698_10649640 | 3300026142 | Bacteria | 1045 |
| 506 | Ga0209973_1012711 | 3300027252 | Bacteria | 1027 |
| 507 | Ga0209967_1001718 | 3300027364 | Bacteria | 2816 |
| 508 | Ga0209995_1003384 | 3300027471 | Bacteria | 2540 |
| 509 | Ga0209968_1009407 | 3300027526 | Bacteria | 1496 |
| 510 | Ga0210002_1000870 | 3300027617 | Bacteria | 4142 |
| 511 | Ga0210002_1023208 | 3300027617 | Bacteria | 1008 |
| 512 | Ga0209983_1005120 | 3300027665 | Bacteria | 2729 |
| 513 | Ga0209971_1014116 | 3300027682 | Bacteria | 1892 |
| 514 | Ga0209971_1057654 | 3300027682 | Bacteria | 939 |
| 515 | Ga0209966_1003383 | 3300027695 | Bacteria | 2682 |
| 516 | Ga0209966_1013394 | 3300027695 | Bacteria | 1518 |
| 517 | Ga0209998_10007335 | 3300027717 | Bacteria | 2288 |
| 518 | Ga0209998_10008256 | 3300027717 | Bacteria | 2159 |
| 519 | Ga0209974_10006454 | 3300027876 | Bacteria | 4094 |
| 520 | Ga0209974_10063771 | 3300027876 | Bacteria | 1250 |
| 521 | Ga0207428_10001759 | 3300027907 | Bacteria | 22205 |
| 522 | Ga0207428_10023515 | 3300027907 | Bacteria | 5182 |
| 523 | Ga0207428_10194065 | 3300027907 | Bacteria | 1530 |
| 524 | Ga0268266_10062397 | 3300028379 | Bacteria | 3216 |
| 525 | Ga0268265_10002569 | 3300028380 | Bacteria | 13569 |
| 526 | Ga0268265_10551182 | 3300028380 | Bacteria | 1094 |
| 527 | Ga0268264_10002097 | 3300028381 | Bacteria | 17812 |
| 528 | Ga0268264_10271581 | 3300028381 | Bacteria | 1584 |
| 529 | Ga0268264_10529914 | 3300028381 | Bacteria | 1153 |
| 530 | Ga0268264_10715518 | 3300028381 | Bacteria | 995 |
| 531 | Ga0268264_11680334 | 3300028381 | Bacteria | 645 |
| 532 | Ga0268264_12150210 | 3300028381 | Unclassified | 566 |
| 533 | Ga0265337_1001017 | 3300028556 | Bacteria | 14559 |
| 534 | Ga0265338_10184604 | 3300028800 | Bacteria | 1586 |
| 535 | Ga0265338_10328354 | 3300028800 | Bacteria | 1105 |
| 536 | Ga0265338_10444083 | 3300028800 | Bacteria | 919 |
| 537 | Ga0265330_10009166 | 3300031235 | Bacteria | 4716 |
| 538 | Ga0265332_10168956 | 3300031238 | Bacteria | 913 |
| 539 | Ga0265332_10170392 | 3300031238 | Bacteria | 909 |
| 540 | Ga0265325_10000019 | 3300031241 | Bacteria | 125265 |
| 541 | Ga0265325_10004257 | 3300031241 | Bacteria | 9079 |
| 542 | Ga0265325_10043241 | 3300031241 | Bacteria | 2351 |
| 543 | Ga0265340_10055326 | 3300031247 | Bacteria | 1911 |
| 544 | Ga0265340_10122121 | 3300031247 | Bacteria | 1198 |
| 545 | Ga0265339_10001671 | 3300031249 | Bacteria | 16385 |
| 546 | Ga0265339_10019397 | 3300031249 | Bacteria | 3992 |
| 547 | Ga0265316_10016529 | 3300031344 | Bacteria | 6395 |
| 548 | Ga0307408_100939644 | 3300031548 | Bacteria | 794 |
| 549 | Ga0265313_10001789 | 3300031595 | Bacteria | 19628 |
| 550 | Ga0265313_10004986 | 3300031595 | Bacteria | 9932 |
| 551 | Ga0265313_10023160 | 3300031595 | Bacteria | 3351 |
| 552 | Ga0265313_10024803 | 3300031595 | Bacteria | 3193 |
| 553 | Ga0316575_10096374 | 3300031665 | Bacteria | 1201 |
| 554 | Ga0316579_10030720 | 3300031691 | Bacteria | 2456 |
| 555 | Ga0265314_10000577 | 3300031711 | Bacteria | 46408 |
| 556 | Ga0265314_10028869 | 3300031711 | Bacteria | 4129 |
| 557 | Ga0265342_10000211 | 3300031712 | Bacteria | 65440 |
| 558 | Ga0307406_10525537 | 3300031901 | Bacteria | 964 |
| 559 | Ga0307414_11928885 | 3300032004 | Bacteria | 551 |
| 560 | Ga0307411_10340846 | 3300032005 | Bacteria | 1218 |
| 561 | Ga0307415_100792740 | 3300032126 | Bacteria | 864 |
| 562 | Ga0316583_10002625 | 3300032133 | Bacteria | 6274 |
| 563 | Ga0373930_0000568 | 3300034816 | Bacteria | 5085 |
| 564 | Ga0373930_0180071 | 3300034816 | Bacteria | 542 |
| 565 | Ga0373948_0000092 | 3300034817 | Bacteria | 9192 |
| 566 | Ga0373950_0008904 | 3300034818 | Bacteria | 1590 |
| 567 | Ga0373958_0000576 | 3300034819 | Bacteria | 4549 |
| 568 | Ga0373958_0018463 | 3300034819 | Bacteria | 1264 |
| 569 | Ga0373959_0000576 | 3300034820 | Bacteria | 6439 |
| 570 | Ga0373959_0018902 | 3300034820 | Bacteria | 1300 |
| 571 | Ga0373938_0008030 | 3300034957 | Bacteria | 1876 |
| 572 | Ga0373926_0010362 | 3300035083 | Bacteria | 3123 |
| 573 | Ga0373928_0000100 | 3300035084 | Bacteria | 15370 |
| 574 | Ga0373928_0010483 | 3300035084 | Bacteria | 1821 |
| 575 | Ga0373934_0015086 | 3300035086 | Bacteria | 2930 |
| 576 | Ga0373940_0000073 | 3300035088 | Bacteria | 11686 |
| 577 | Ga0373940_0039370 | 3300035088 | Bacteria | 1293 |
| 578 | Ga0373944_0008786 | 3300035089 | Bacteria | 2730 |
| 579 | Ga0373949_0007976 | 3300035090 | Bacteria | 2318 |
| 580 | Ga0373951_0000189 | 3300035091 | Bacteria | 22384 |
| 581 | Ga0373951_0053331 | 3300035091 | Bacteria | 999 |
| 582 | Ga0373952_0002023 | 3300035092 | Bacteria | 3660 |
| 583 | Ga0373952_0003463 | 3300035092 | Bacteria | 2848 |
| 584 | Ga0373932_0001729 | 3300035112 | Bacteria | 5928 |
| 585 | Ga0373932_0041963 | 3300035112 | Bacteria | 1325 |
| 586 | Ga0373939_0002882 | 3300035114 | Bacteria | 4043 |
| 587 | Ga0373939_0023616 | 3300035114 | Bacteria | 1705 |
| 588 | Ga0373939_0025973 | 3300035114 | Bacteria | 1646 |
| 589 | Ga0373939_0128354 | 3300035114 | Bacteria | 902 |
| 590 | Ga0373941_0000363 | 3300035115 | Bacteria | 8980 |
| 591 | Ga0373941_0068324 | 3300035115 | Bacteria | 1173 |
| 592 | Ga0373945_0023425 | 3300035116 | Bacteria | 2132 |
| 593 | Ga0373953_0014530 | 3300035117 | Bacteria | 2834 |
| 594 | Ga0373953_0025742 | 3300035117 | Bacteria | 2250 |
| 595 | Ga0373953_0034276 | 3300035117 | Bacteria | 1989 |
| 596 | Ga0373954_0009564 | 3300035118 | Bacteria | 4266 |
| 597 | Ga0373954_0036308 | 3300035118 | Bacteria | 2287 |
| 598 | Ga0373954_0057838 | 3300035118 | Bacteria | 1826 |
| 599 | Ga0373956_0016343 | 3300035119 | Bacteria | 3116 |
| 600 | Ga0373956_0026913 | 3300035119 | Bacteria | 2493 |
| 601 | Ga0373956_0034039 | 3300035119 | Bacteria | 2243 |
| 602 | Ga0373956_0340127 | 3300035119 | Bacteria | 715 |
| 603 | Ga0373957_0013580 | 3300035120 | Bacteria | 2766 |
| 604 | Ga0373957_0049474 | 3300035120 | Bacteria | 1604 |
| 605 | Ga0373960_0005418 | 3300035121 | Bacteria | 2955 |
| 606 | Ga0373960_0037620 | 3300035121 | Bacteria | 1383 |
| 607 | Ga0373943_0011131 | 3300035170 | Bacteria | 4044 |
| 608 | Ga0373946_0051342 | 3300035171 | Bacteria | 1725 |
| 609 | Ga0373955_0000249 | 3300035172 | Bacteria | 22417 |
| 610 | Ga0373955_0002898 | 3300035172 | Bacteria | 7524 |
| 611 | Ga0373955_0022122 | 3300035172 | Bacteria | 3221 |
| 612 | Ga0373955_0026958 | 3300035172 | Bacteria | 2965 |
| 613 | Ga0373955_0106574 | 3300035172 | Bacteria | 1616 |
| 614 | Ga0373942_0001810 | 3300035207 | Bacteria | 5406 |
| 615 | Ga0373942_0049618 | 3300035207 | Bacteria | 1172 |
| 616 | Ga0373961_0000633 | 3300035241 | Bacteria | 12709 |
| 617 | Ga0373961_0078130 | 3300035241 | Bacteria | 1036 |
| 618 | Ga0373961_0130379 | 3300035241 | Bacteria | 841 |
| 619 | Ga0373962_0000689 | 3300035242 | Bacteria | 7635 |
| 620 | Ga0373962_0004675 | 3300035242 | Bacteria | 3305 |
| 621 | Ga0373924_0009601 | 3300035410 | Bacteria | 3551 |
| 622 | Ga0373924_0053480 | 3300035410 | Bacteria | 1677 |
| 623 | Ga0373931_0002415 | 3300035691 | Bacteria | 8264 |
| 624 | Ga0373931_0023900 | 3300035691 | Bacteria | 3089 |
| 625 | Ga0373931_0193365 | 3300035691 | Bacteria | 1212 |
| 626 | Ga0373935_0141903 | 3300035692 | Bacteria | 1623 |
| 627 | Ga0373935_0261213 | 3300035692 | Bacteria | 1214 |
| 628 | Ga0373935_0430927 | 3300035692 | Bacteria | 950 |
| 629 | Ga0373927_0871100 | 3300035695 | Unclassified | 594 |
| 630 | Ga0373933_0002548 | 3300035724 | Bacteria | 10223 |
| 631 | Ga0373933_0015532 | 3300035724 | Bacteria | 4246 |
| 632 | Ga0373933_0029959 | 3300035724 | Bacteria | 3149 |
| 633 | Ga0373937_0003343 | 3300036401 | Bacteria | 13462 |
| 634 | Ga0373937_0005946 | 3300036401 | Bacteria | 10502 |
| 635 | Ga0373937_0006652 | 3300036401 | Bacteria | 9974 |
| 636 | Ga0373937_0032148 | 3300036401 | Bacteria | 4758 |
| 637 | Ga0373937_0375534 | 3300036401 | Bacteria | 1348 |
| 638 | Ga0316582_0522086 | 3300036647 | Bacteria | 818 |
| 639 | Ga0373925_0010323 | 3300037068 | Bacteria | 6776 |
| 640 | Ga0373925_0291256 | 3300037068 | Bacteria | 1316 |
| 641 | Ga0395899_0023868 | 3300037312 | Bacteria | 4627 |
| 642 | Ga0395899_0548684 | 3300037312 | Unclassified | 743 |
| 643 | Ga0395900_0025072 | 3300037418 | Bacteria | 6104 |
| 644 | Ga0395900_0030088 | 3300037418 | Bacteria | 5573 |
| 645 | Ga0395900_0032733 | 3300037418 | Bacteria | 5347 |
| 646 | Ga0395900_0067088 | 3300037418 | Bacteria | 3686 |
| 647 | Ga0395900_0557877 | 3300037418 | Bacteria | 1089 |
| 648 | Ga0395898_0012791 | 3300037466 | Bacteria | 8664 |
| 649 | Ga0395898_0044840 | 3300037466 | Bacteria | 4349 |
| 650 | Ga0395898_0064147 | 3300037466 | Bacteria | 3563 |
| 651 | Ga0395898_0096286 | 3300037466 | Bacteria | 2843 |
| 652 | Ga0395901_0052189 | 3300038443 | Bacteria | 4250 |
| 653 | Ga0395901_0062934 | 3300038443 | Bacteria | 3861 |
| 654 | Ga0395901_0079781 | 3300038443 | Bacteria | 3417 |
| 655 | Ga0242419_001940 | 3300038698 | Bacteria | 1319 |
| 656 | Ga0242420_017826 | 3300038996 | Bacteria | 1245 |
| 657 | Ga0436365_0121354 | 3300039437 | Bacteria | 2188 |
| 658 | Ga0436365_0240412 | 3300039437 | Bacteria | 11459 |
| 659 | Ga0436362_1251783 | 3300039453 | Bacteria | 1180 |
| 660 | Ga0439441_008331 | 3300042001 | Bacteria | 1691 |
| 661 | Ga0439448_0015191 | 3300042005 | Bacteria | 2330 |
| 662 | Ga0439455_0010382 | 3300042012 | Bacteria | 2047 |
| 663 | Ga0439463_008538 | 3300042016 | Bacteria | 2525 |
| 664 | Ga0439458_0181699 | 3300042157 | Bacteria | 571 |
| 665 | Ga0439460_0007591 | 3300042461 | Bacteria | 2718 |
| 666 | Ga0450916_069745 | 3300042530 | Bacteria | 585 |
| 667 | Ga0466966_0196236 | 3300044684 | Bacteria | 1222 |
| 668 | Ga0466961_0193538 | 3300044693 | Bacteria | 1260 |
| 669 | Ga0466961_0283374 | 3300044693 | Bacteria | 1014 |
| 670 | Ga0466963_0815007 | 3300044694 | Bacteria | 658 |
| 671 | Ga0466963_0935382 | 3300044694 | Bacteria | 611 |
| 672 | Ga0453684_0081063 | 3300044712 | Bacteria | 4049 |
| 673 | Ga0466971_0098808 | 3300044719 | Bacteria | 1340 |
| 674 | Ga0466959_0051788 | 3300045049 | Bacteria | 3009 |
| 675 | Ga0451576_0023984 | 3300045051 | Bacteria | 6594 |
| 676 | Ga0451576_0843923 | 3300045051 | Bacteria | 962 |
| 677 | Ga0466958_0145501 | 3300045836 | Bacteria | 1493 |
| 678 | Ga0466958_0802816 | 3300045836 | Bacteria | 614 |
| 679 | Ga0466967_0040855 | 3300045976 | Bacteria | 3995 |
| 680 | Ga0466967_0348804 | 3300045976 | Bacteria | 1432 |
| 681 | Ga0495592_0000604 | 3300046454 | Bacteria | 25327 |
| 682 | Ga0495629_0167300 | 3300046459 | Bacteria | 1526 |
| 683 | Ga0495629_0435814 | 3300046459 | Bacteria | 888 |
| 684 | Ga0495641_0040433 | 3300046461 | Bacteria | 2168 |
| 685 | Ga0495651_0006587 | 3300046462 | Bacteria | 8867 |
| 686 | Ga0495651_0557123 | 3300046462 | Bacteria | 727 |
| 687 | Ga0495653_0004982 | 3300046463 | Bacteria | 10779 |
| 688 | Ga0495653_0198794 | 3300046463 | Bacteria | 1362 |
| 689 | Ga0495653_0776423 | 3300046463 | Bacteria | 577 |
| 690 | Ga0495580_0271808 | 3300046472 | Bacteria | 1157 |
| 691 | Ga0495582_0052609 | 3300046473 | Bacteria | 2245 |
| 692 | Ga0495639_0106598 | 3300046475 | Bacteria | 1327 |
| 693 | Ga0495664_0009456 | 3300046477 | Bacteria | 5455 |
| 694 | Ga0495664_0058441 | 3300046477 | Bacteria | 2294 |
| 695 | Ga0495664_0302996 | 3300046477 | Bacteria | 964 |
| 696 | Ga0495608_0011300 | 3300046511 | Bacteria | 6215 |
| 697 | Ga0495618_0008660 | 3300046514 | Bacteria | 6149 |
| 698 | Ga0495618_0056738 | 3300046514 | Bacteria | 2479 |
| 699 | Ga0495618_0079083 | 3300046514 | Bacteria | 2097 |
| 700 | Ga0495618_0144176 | 3300046514 | Bacteria | 1523 |
| 701 | Ga0495628_0076911 | 3300046516 | Bacteria | 2597 |
| 702 | Ga0495628_0295278 | 3300046516 | Bacteria | 1200 |
| 703 | Ga0495630_0165508 | 3300046517 | Bacteria | 1684 |
| 704 | Ga0495630_0532319 | 3300046517 | Bacteria | 901 |
| 705 | Ga0495666_0167768 | 3300046526 | Bacteria | 1016 |
| 706 | Ga0495652_0011134 | 3300046529 | Bacteria | 8150 |
| 707 | Ga0495652_0081886 | 3300046529 | Bacteria | 2661 |
| 708 | Ga0495652_0408858 | 3300046529 | Bacteria | 959 |
| 709 | Ga0495652_0463006 | 3300046529 | Bacteria | 885 |
| 710 | Ga0495665_0047369 | 3300046531 | Bacteria | 2280 |
| 711 | Ga0495640_0063961 | 3300046533 | Bacteria | 2489 |
| 712 | Ga0495640_0395095 | 3300046533 | Bacteria | 849 |
| 713 | Ga0495640_0424261 | 3300046533 | Bacteria | 814 |
| 714 | Ga0495640_0756063 | 3300046533 | Bacteria | 581 |
| 715 | Ga0495586_0007329 | 3300046535 | Bacteria | 5888 |
| 716 | Ga0495586_0698286 | 3300046535 | Bacteria | 586 |
| 717 | Ga0495587_0003722 | 3300046536 | Bacteria | 10121 |
| 718 | Ga0495587_0031441 | 3300046536 | Bacteria | 3214 |
| 719 | Ga0495587_0351648 | 3300046536 | Bacteria | 821 |
| 720 | Ga0495645_0002643 | 3300046543 | Bacteria | 12188 |
| 721 | Ga0495645_0005135 | 3300046543 | Bacteria | 8967 |
| 722 | Ga0495645_0686841 | 3300046543 | Bacteria | 622 |
| 723 | Ga0495667_0014666 | 3300046559 | Bacteria | 5295 |
| 724 | Ga0495667_0015973 | 3300046559 | Bacteria | 5073 |
| 725 | Ga0495667_0646138 | 3300046559 | Bacteria | 657 |
| 726 | Ga0495634_0081330 | 3300046642 | Bacteria | 2118 |
| 727 | Ga0495634_0330982 | 3300046642 | Bacteria | 915 |
| 728 | Ga0495635_0014791 | 3300046663 | Bacteria | 5459 |
| 729 | Ga0495635_0148863 | 3300046663 | Bacteria | 1593 |
| 730 | Ga0495635_0238116 | 3300046663 | Bacteria | 1228 |
| 731 | Ga0495657_0266273 | 3300046675 | Bacteria | 1028 |
| 732 | Ga0495657_0325479 | 3300046675 | Bacteria | 913 |
| 733 | Ga0495599_0006067 | 3300046678 | Bacteria | 7271 |
| 734 | Ga0495623_0005084 | 3300046679 | Bacteria | 8628 |
| 735 | Ga0495646_0001510 | 3300046680 | Bacteria | 13865 |
| 736 | Ga0495646_0181357 | 3300046680 | Bacteria | 1155 |
| 737 | Ga0495669_0108929 | 3300046684 | Bacteria | 1292 |
| 738 | Ga0495613_0175258 | 3300046689 | Bacteria | 1520 |
| 739 | Ga0495613_0380363 | 3300046689 | Bacteria | 965 |
| 740 | Ga0495624_0150794 | 3300046690 | Bacteria | 1422 |
| 741 | Ga0495624_0487288 | 3300046690 | Bacteria | 738 |
| 742 | Ga0495600_0002242 | 3300046809 | Bacteria | 11012 |
| 743 | Ga0495600_0007130 | 3300046809 | Bacteria | 6830 |
| 744 | Ga0495600_0407634 | 3300046809 | Bacteria | 845 |
| 745 | Ga0495600_0516478 | 3300046809 | Bacteria | 733 |
| 746 | Ga0495581_0379853 | 3300047315 | Bacteria | 824 |
| 747 | Ga0495581_0411699 | 3300047315 | Bacteria | 788 |
| 748 | Ga0495604_0000807 | 3300047317 | Bacteria | 26338 |
| 749 | Ga0495604_0018346 | 3300047317 | Bacteria | 5603 |
| 750 | Ga0495604_0032681 | 3300047317 | Bacteria | 4123 |
| 751 | Ga0495674_0060527 | 3300047319 | Bacteria | 3303 |
| 752 | Ga0495674_0109001 | 3300047319 | Bacteria | 2349 |
| 753 | Ga0495674_0531030 | 3300047319 | Bacteria | 938 |
| 754 | Ga0495676_0283497 | 3300047321 | Bacteria | 1121 |
| 755 | Ga0495676_0547610 | 3300047321 | Bacteria | 756 |
| 756 | Ga0495680_0026918 | 3300047322 | Bacteria | 4733 |
| 757 | Ga0495680_0038199 | 3300047322 | Bacteria | 3839 |
| 758 | Ga0495680_0100807 | 3300047322 | Bacteria | 2151 |
| 759 | Ga0495680_0106631 | 3300047322 | Bacteria | 2082 |
| 760 | Ga0495680_0330292 | 3300047322 | Bacteria | 1065 |
| 761 | Ga0495675_0000700 | 3300047444 | Bacteria | 20964 |
| 762 | Ga0495675_0010767 | 3300047444 | Bacteria | 5729 |
| 763 | Ga0495675_0433279 | 3300047444 | Bacteria | 763 |
| 764 | Ga0495684_0255811 | 3300047471 | Bacteria | 1272 |
| 765 | Ga0495593_0056182 | 3300047673 | Bacteria | 2070 |
| 766 | Ga0495593_0200878 | 3300047673 | Bacteria | 1002 |
| 767 | Ga0495602_0001773 | 3300048088 | Bacteria | 21601 |
| 768 | Ga0495602_0012708 | 3300048088 | Bacteria | 8637 |
| 769 | Ga0495602_0054174 | 3300048088 | Bacteria | 3544 |
| 770 | Ga0495614_0430706 | 3300048089 | Bacteria | 622 |
| 771 | Ga0496100_0000839 | 3300048903 | Bacteria | 14752 |
| 772 | Ga0496100_0161943 | 3300048903 | Bacteria | 1604 |
| 773 | Ga0496100_0170130 | 3300048903 | Bacteria | 1568 |
| 774 | Ga0496100_0971509 | 3300048903 | Bacteria | 668 |
| 775 | Ga0496101_0000633 | 3300048904 | Bacteria | 21327 |
| 776 | Ga0496101_0004102 | 3300048904 | Bacteria | 9113 |
| 777 | Ga0496101_0192773 | 3300048904 | Bacteria | 1573 |
| 778 | Ga0496101_0279530 | 3300048904 | Bacteria | 1304 |
| 779 | Ga0496101_0949479 | 3300048904 | Bacteria | 676 |
| 780 | Ga0496102_0002481 | 3300048905 | Bacteria | 15749 |
| 781 | Ga0496102_0128171 | 3300048905 | Bacteria | 2373 |
| 782 | Ga0496102_0149712 | 3300048905 | Bacteria | 2192 |
| 783 | Ga0496102_0488791 | 3300048905 | Bacteria | 1152 |
| 784 | Ga0496102_1178696 | 3300048905 | Bacteria | 685 |
| 785 | Ga0496103_0000717 | 3300048906 | Bacteria | 24507 |
| 786 | Ga0496103_0009959 | 3300048906 | Bacteria | 5621 |
| 787 | Ga0496103_0632701 | 3300048906 | Bacteria | 680 |
| 788 | Ga0496104_0013489 | 3300048907 | Bacteria | 7362 |
| 789 | Ga0496104_0081209 | 3300048907 | Bacteria | 3091 |
| 790 | Ga0496104_0330060 | 3300048907 | Bacteria | 1438 |
| 791 | Ga0496104_0425177 | 3300048907 | Bacteria | 1240 |
| 792 | Ga0496105_0000950 | 3300048908 | Bacteria | 19841 |
| 793 | Ga0496105_0080899 | 3300048908 | Bacteria | 2683 |
| 794 | Ga0496105_0140839 | 3300048908 | Bacteria | 1985 |
| 795 | Ga0496106_0002354 | 3300048909 | Bacteria | 14076 |
| 796 | Ga0496106_0103947 | 3300048909 | Bacteria | 2205 |
| 797 | Ga0496106_0140922 | 3300048909 | Bacteria | 1896 |
| 798 | Ga0496106_0243951 | 3300048909 | Bacteria | 1435 |
| 799 | Ga0496107_0001263 | 3300048910 | Bacteria | 15487 |
| 800 | Ga0496107_0010575 | 3300048910 | Bacteria | 6416 |
| 801 | Ga0496107_0076401 | 3300048910 | Bacteria | 2439 |
| 802 | Ga0496107_0081726 | 3300048910 | Bacteria | 2356 |
| 803 | Ga0496107_0133211 | 3300048910 | Bacteria | 1835 |
| 804 | Ga0496108_0005842 | 3300048911 | Bacteria | 9975 |
| 805 | Ga0496108_0014469 | 3300048911 | Bacteria | 6442 |
| 806 | Ga0496108_0045694 | 3300048911 | Bacteria | 3658 |
| 807 | Ga0496108_0072423 | 3300048911 | Bacteria | 2908 |
| 808 | Ga0496108_0615737 | 3300048911 | Bacteria | 945 |
| 809 | Ga0496108_0844072 | 3300048911 | Bacteria | 788 |
| 810 | Ga0496109_0002017 | 3300048912 | Bacteria | 16843 |
| 811 | Ga0496109_0064505 | 3300048912 | Bacteria | 3352 |
| 812 | Ga0496109_0264743 | 3300048912 | Bacteria | 1619 |
| 813 | Ga0496109_0420494 | 3300048912 | Bacteria | 1262 |
| 814 | Ga0496109_0797386 | 3300048912 | Bacteria | 882 |
| 815 | Ga0496110_0062959 | 3300048913 | Bacteria | 3277 |
| 816 | Ga0496110_0824306 | 3300048913 | Bacteria | 832 |
| 817 | Ga0496111_0047606 | 3300048914 | Bacteria | 3088 |
| 818 | Ga0496111_0126152 | 3300048914 | Bacteria | 1892 |
| 819 | Ga0496112_0011955 | 3300048915 | Bacteria | 7955 |
| 820 | Ga0496112_0063884 | 3300048915 | Bacteria | 3631 |
| 821 | Ga0496112_0182295 | 3300048915 | Bacteria | 2063 |
| 822 | Ga0496112_0381482 | 3300048915 | Bacteria | 1350 |
| 823 | Ga0496113_0002233 | 3300048916 | Bacteria | 11186 |
| 824 | Ga0496113_0029827 | 3300048916 | Bacteria | 3943 |
| 825 | Ga0496113_0182856 | 3300048916 | Bacteria | 1662 |
| 826 | Ga0496114_0068146 | 3300048917 | Bacteria | 2987 |
| 827 | Ga0496114_0316138 | 3300048917 | Bacteria | 1379 |
| 828 | Ga0496115_0013377 | 3300048918 | Bacteria | 6207 |
| 829 | Ga0496115_0173982 | 3300048918 | Bacteria | 1780 |
| 830 | Ga0496115_0259085 | 3300048918 | Bacteria | 1430 |
| 831 | Ga0501031_0001817 | 3300049568 | Bacteria | 13417 |
| 832 | Ga0501032_0014494 | 3300049569 | Bacteria | 5582 |
| 833 | Ga0501032_0138065 | 3300049569 | Bacteria | 1606 |
| 834 | Ga0501033_0014506 | 3300049570 | Bacteria | 5982 |
| 835 | Ga0501033_0069790 | 3300049570 | Bacteria | 2582 |
| 836 | Ga0501033_0491419 | 3300049570 | Bacteria | 850 |
| 837 | Ga0501034_0021775 | 3300049571 | Bacteria | 6531 |
| 838 | Ga0501034_0068635 | 3300049571 | Bacteria | 3555 |
| 839 | Ga0501034_0311509 | 3300049571 | Bacteria | 1508 |
| 840 | Ga0501034_0357091 | 3300049571 | Bacteria | 1389 |
| 841 | Ga0501034_1010191 | 3300049571 | Bacteria | 715 |
| 842 | Ga0501036_0019391 | 3300049572 | Bacteria | 5709 |
| 843 | Ga0501036_0202693 | 3300049572 | Bacteria | 1668 |
| 844 | Ga0501036_0386489 | 3300049572 | Bacteria | 1168 |
| 845 | Ga0501037_0665499 | 3300049573 | Bacteria | 695 |
| 846 | Ga0501038_0101807 | 3300049574 | Bacteria | 2391 |
| 847 | Ga0501038_0105053 | 3300049574 | Bacteria | 2346 |
| 848 | Ga0501039_0363704 | 3300049575 | Bacteria | 1137 |
| 849 | Ga0501043_0218212 | 3300049579 | Bacteria | 1476 |
| 850 | Ga0501043_0498564 | 3300049579 | Bacteria | 910 |
| 851 | Ga0501043_0588455 | 3300049579 | Bacteria | 823 |
| 852 | Ga0501046_0173852 | 3300049580 | Bacteria | 1615 |
| 853 | Ga0501047_0043849 | 3300049581 | Bacteria | 4320 |
| 854 | Ga0501047_0534888 | 3300049581 | Bacteria | 997 |
| 855 | Ga0501047_0736179 | 3300049581 | Bacteria | 802 |
| 856 | Ga0501047_1307430 | 3300049581 | Archaea | 539 |
| 857 | Ga0501048_0049894 | 3300049582 | Bacteria | 2982 |
| 858 | Ga0501048_1339513 | 3300049582 | Bacteria | 515 |
| 859 | Ga0501069_0522343 | 3300049585 | Bacteria | 709 |
| 860 | Ga0501069_0870878 | 3300049585 | Bacteria | 547 |
| 861 | Ga0501070_0106381 | 3300049586 | Bacteria | 2319 |
| 862 | Ga0501070_0124351 | 3300049586 | Bacteria | 2132 |
| 863 | Ga0501070_0478792 | 3300049586 | Bacteria | 1001 |
| 864 | Ga0501070_0582403 | 3300049586 | Bacteria | 893 |
| 865 | Ga0501071_0109523 | 3300049587 | Bacteria | 2040 |
| 866 | Ga0501071_0576804 | 3300049587 | Bacteria | 864 |
| 867 | Ga0501071_0757097 | 3300049587 | Bacteria | 748 |
| 868 | Ga0501071_0975056 | 3300049587 | Bacteria | 655 |
| 869 | Ga0501072_0114497 | 3300049588 | Bacteria | 2147 |
| 870 | Ga0501072_0367395 | 3300049588 | Bacteria | 1142 |
| 871 | Ga0501073_0028170 | 3300049589 | Bacteria | 4014 |
| 872 | Ga0501074_0264212 | 3300049590 | Bacteria | 1223 |
| 873 | Ga0501076_0022574 | 3300049592 | Bacteria | 4838 |
| 874 | Ga0501077_0461930 | 3300049593 | Bacteria | 813 |
| 875 | Ga0501077_0669517 | 3300049593 | Bacteria | 667 |
| 876 | Ga0501079_1245584 | 3300049741 | Bacteria | 586 |
| 877 | Ga0501083_0015623 | 3300049744 | Bacteria | 5315 |
| 878 | Ga0501083_0185831 | 3300049744 | Bacteria | 1357 |
| 879 | Ga0501083_0642080 | 3300049744 | Bacteria | 690 |
| 880 | Ga0501035_0021027 | 3300049822 | Bacteria | 5998 |
| 881 | Ga0501035_0078558 | 3300049822 | Bacteria | 2915 |
| 882 | Ga0501044_0023194 | 3300049823 | Bacteria | 6604 |
| 883 | Ga0501044_0058854 | 3300049823 | Bacteria | 3939 |
| 884 | Ga0501044_0131262 | 3300049823 | Bacteria | 2499 |
| 885 | Ga0501044_0151201 | 3300049823 | Bacteria | 2303 |
| 886 | Ga0501044_0220640 | 3300049823 | Bacteria | 1846 |
| 887 | Ga0501044_0927325 | 3300049823 | Unclassified | 745 |
| 888 | Ga0501044_1363734 | 3300049823 | Bacteria | 575 |
| 889 | nmdc:mga06z11_2876_c1 | 3300050494 | Bacteria | 6617 |
| 890 | nmdc:mga06z11_307728_c1 | 3300050494 | Bacteria | 943 |
| 891 | nmdc:mga06z11_928495_c1 | 3300050494 | Unclassified | 530 |
| 892 | nmdc:mga07m45_166240_c1 | 3300050496 | Bacteria | 1281 |
| 893 | nmdc:mga07m45_16715_c1 | 3300050496 | Bacteria | 3929 |
| 894 | nmdc:mga07m45_71480_c1 | 3300050496 | Bacteria | 1974 |
| 895 | nmdc:mga09592_489504_c1 | 3300050508 | Bacteria | 1059 |
| 896 | nmdc:mga08y16_22355_c1 | 3300050511 | Bacteria | 6675 |
| 897 | nmdc:mga08y16_22831_c1 | 3300050511 | Bacteria | 6603 |
| 898 | nmdc:mga0n895_5206_c1 | 3300050512 | Bacteria | 10827 |
| 899 | nmdc:mga0n895_754317_c1 | 3300050512 | Bacteria | 966 |
| 900 | nmdc:mga0n895_999538_c1 | 3300050512 | Bacteria | 818 |
| 901 | nmdc:mga0rr50_158506_c1 | 3300050513 | Bacteria | 1835 |
| 902 | nmdc:mga0rr50_223325_c1 | 3300050513 | Bacteria | 983 |
| 903 | nmdc:mga0rr50_312938_c1 | 3300050513 | Bacteria | 1315 |
| 904 | nmdc:mga08x19_54072_c1 | 3300050514 | Bacteria | 2584 |
| 905 | nmdc:mga0a205_13129_c1 | 3300050515 | Bacteria | 7693 |
| 906 | nmdc:mga0a205_98453_c1 | 3300050515 | Bacteria | 2823 |
| 907 | Ga0495601_0000233 | 3300053077 | Bacteria | 29812 |
| 908 | Ga0495601_0006401 | 3300053077 | Bacteria | 6886 |
| 909 | Ga0495601_0034773 | 3300053077 | Bacteria | 3144 |
| 910 | Ga0495601_0037667 | 3300053077 | Bacteria | 3023 |
| 911 | Ga0495601_0238201 | 3300053077 | Bacteria | 1188 |
| 912 | Ga0495601_0255778 | 3300053077 | Bacteria | 1143 |
| 913 | Ga0495612_0000533 | 3300053078 | Bacteria | 15307 |
| 914 | Ga0495612_0016648 | 3300053078 | Bacteria | 2946 |
| 915 | Ga0495612_0035482 | 3300053078 | Bacteria | 2021 |
| 916 | Ga0495595_0000360 | 3300053084 | Bacteria | 17303 |
| 917 | Ga0495595_0008907 | 3300053084 | Bacteria | 4135 |
| 918 | Ga0495595_0011483 | 3300053084 | Bacteria | 3703 |
| 919 | Ga0495595_0066145 | 3300053084 | Bacteria | 1701 |
| 920 | Ga0495619_0001179 | 3300053085 | Bacteria | 17221 |
| 921 | Ga0495619_0002698 | 3300053085 | Bacteria | 11606 |
| 922 | Ga0495619_0007775 | 3300053085 | Bacteria | 6786 |
| 923 | Ga0495619_0033967 | 3300053085 | Bacteria | 3314 |
| 924 | Ga0495619_0119157 | 3300053085 | Bacteria | 1809 |
| 925 | Ga0495619_0291014 | 3300053085 | Bacteria | 1131 |
| 926 | Ga0500643_005032 | 3300053087 | Bacteria | 5790 |
| 927 | Ga0500643_125844 | 3300053087 | Unclassified | 690 |
| 928 | Ga0500644_0001907 | 3300053088 | Bacteria | 5349 |
| 929 | Ga0500651_0416824 | 3300053093 | Bacteria | 752 |
| 930 | Ga0500641_0001278 | 3300053096 | Bacteria | 8932 |
| 931 | Ga0500595_000003 | 3300053119 | Bacteria | 419332 |
| 932 | Ga0500652_065133 | 3300053131 | Bacteria | 1505 |
| 933 | Ga0500577_0228948 | 3300053142 | Bacteria | 806 |
| 934 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 935 | Ga0500645_001358 | 3300053730 | Bacteria | 12602 |
| 936 | Ga0501084_0554597 | 3300054114 | Bacteria | 971 |
| 937 | Ga0501082_0044600 | 3300060353 | Bacteria | 3824 |
| 938 | Ga0501082_0185934 | 3300060353 | Bacteria | 1808 |
| 939 | Ga0530510_0753301 | 3300061734 | Bacteria | 743 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046809 | Ga0495600_0407634 | Ga0495600_0407634_406_822 | 138 |
| 2 | 3300049593 | Ga0501077_0461930 | Ga0501077_0461930_365_781 | 138 |
| 3 | 3300050496 | nmdc:mga07m45_166240_c1 | nmdc:mga07m45_166240_c1_796_1236 | 146 |
| 4 | 3300049573 | Ga0501037_0665499 | Ga0501037_0665499_26_484 | 149 |
| 5 | 3300049575 | Ga0501039_0363704 | Ga0501039_0363704_215_673 | 149 |
| 6 | 3300049593 | Ga0501077_0669517 | Ga0501077_0669517_148_606 | 149 |
| 7 | 3300049744 | Ga0501083_0185831 | Ga0501083_0185831_528_986 | 149 |
| 8 | 3300005327 | Ga0070658_10011335 | Ga0070658_100113354 | 150 |
| 9 | 3300005336 | Ga0070680_100005059 | Ga0070680_1000050597 | 150 |
| 10 | 3300005339 | Ga0070660_100068323 | Ga0070660_1000683232 | 150 |
| 11 | 3300005458 | Ga0070681_10035093 | Ga0070681_100350932 | 150 |
| 12 | 3300005530 | Ga0070679_100016998 | Ga0070679_1000169983 | 150 |
| 13 | 3300005563 | Ga0068855_100147058 | Ga0068855_1001470582 | 150 |
| 14 | 3300005616 | Ga0068852_100022111 | Ga0068852_1000221113 | 150 |
| 15 | 3300013102 | Ga0157371_10160695 | Ga0157371_101606952 | 150 |
| 16 | 3300013307 | Ga0157372_11798275 | Ga0157372_117982751 | 150 |
| 17 | 3300025917 | Ga0207660_10015766 | Ga0207660_100157665 | 150 |
| 18 | 3300025919 | Ga0207657_10077345 | Ga0207657_100773452 | 150 |
| 19 | 3300025921 | Ga0207652_10004018 | Ga0207652_100040183 | 150 |
| 20 | 3300031595 | Ga0265313_10004986 | Ga0265313_1000498610 | 150 |
| 21 | 3300031711 | Ga0265314_10028869 | Ga0265314_100288692 | 150 |
| 22 | 3300031712 | Ga0265342_10000211 | Ga0265342_1000021163 | 150 |
| 23 | 3300044684 | Ga0466966_0196236 | Ga0466966_0196236_493_945 | 150 |
| 24 | 3300044693 | Ga0466961_0193538 | Ga0466961_0193538_766_1218 | 150 |
| 25 | 3300044693 | Ga0466961_0283374 | Ga0466961_0283374_351_803 | 150 |
| 26 | 3300044694 | Ga0466963_0815007 | Ga0466963_0815007_40_492 | 150 |
| 27 | 3300044719 | Ga0466971_0098808 | Ga0466971_0098808_219_671 | 150 |
| 28 | 3300045049 | Ga0466959_0051788 | Ga0466959_0051788_745_1197 | 150 |
| 29 | 3300045836 | Ga0466958_0145501 | Ga0466958_0145501_549_1001 | 150 |
| 30 | 3300045836 | Ga0466958_0802816 | Ga0466958_0802816_107_559 | 150 |
| 31 | 3300045976 | Ga0466967_0348804 | Ga0466967_0348804_352_804 | 150 |
| 32 | 3300049571 | Ga0501034_0068635 | Ga0501034_0068635_1301_1753 | 150 |
| 33 | 3300049580 | Ga0501046_0173852 | Ga0501046_0173852_706_1158 | 150 |
| 34 | 3300049581 | Ga0501047_0736179 | Ga0501047_0736179_91_543 | 150 |
| 35 | 3300049585 | Ga0501069_0870878 | Ga0501069_0870878_60_512 | 150 |
| 36 | 3300049586 | Ga0501070_0124351 | Ga0501070_0124351_1063_1515 | 150 |
| 37 | 3300049587 | Ga0501071_0109523 | Ga0501071_0109523_1416_1868 | 150 |
| 38 | 3300049590 | Ga0501074_0264212 | Ga0501074_0264212_613_1065 | 150 |
| 39 | 3300049741 | Ga0501079_1245584 | Ga0501079_1245584_76_528 | 150 |
| 40 | 3300049822 | Ga0501035_0078558 | Ga0501035_0078558_918_1370 | 150 |
| 41 | 3300049823 | Ga0501044_0023194 | Ga0501044_0023194_5151_5603 | 150 |
| 42 | 3300049823 | Ga0501044_0058854 | Ga0501044_0058854_2042_2494 | 150 |
| 43 | 3300053085 | Ga0495619_0119157 | Ga0495619_0119157_1285_1737 | 150 |
| 44 | 3300060353 | Ga0501082_0185934 | Ga0501082_0185934_342_794 | 150 |
| 45 | 3300005340 | Ga0070689_100297273 | Ga0070689_1002972733 | 151 |
| 46 | 3300005617 | Ga0068859_100268285 | Ga0068859_1002682853 | 151 |
| 47 | 3300005843 | Ga0068860_100976067 | Ga0068860_1009760671 | 151 |
| 48 | 3300006175 | Ga0070712_100440913 | Ga0070712_1004409132 | 151 |
| 49 | 3300006931 | Ga0097620_100268300 | Ga0097620_1002683003 | 151 |
| 50 | 3300009553 | Ga0105249_10540713 | Ga0105249_105407132 | 151 |
| 51 | 3300013104 | Ga0157370_10125769 | Ga0157370_101257693 | 151 |
| 52 | 3300020070 | Ga0206356_10272352 | Ga0206356_102723522 | 151 |
| 53 | 3300025915 | Ga0207693_10335098 | Ga0207693_103350982 | 151 |
| 54 | 3300028381 | Ga0268264_10529914 | Ga0268264_105299143 | 151 |
| 55 | 3300028381 | Ga0268264_12150210 | Ga0268264_121502101 | 151 |
| 56 | 3300049581 | Ga0501047_0534888 | Ga0501047_0534888_71_526 | 151 |
| 57 | 3300005434 | Ga0070709_10829887 | Ga0070709_108298871 | 152 |
| 58 | 3300013307 | Ga0157372_10721470 | Ga0157372_107214702 | 152 |
| 59 | 3300025918 | Ga0207662_10381012 | Ga0207662_103810122 | 152 |
| 60 | 3300025932 | Ga0207690_10440704 | Ga0207690_104407042 | 152 |
| 61 | 3300031665 | Ga0316575_10096374 | Ga0316575_100963742 | 152 |
| 62 | 3300032133 | Ga0316583_10002625 | Ga0316583_100026252 | 152 |
| 63 | 3300036647 | Ga0316582_0522086 | Ga0316582_0522086_341_799 | 152 |
| 64 | 3300037312 | Ga0395899_0023868 | Ga0395899_0023868_1718_2176 | 152 |
| 65 | 3300037312 | Ga0395899_0548684 | Ga0395899_0548684_10_468 | 152 |
| 66 | 3300037418 | Ga0395900_0025072 | Ga0395900_0025072_2835_3293 | 152 |
| 67 | 3300037418 | Ga0395900_0030088 | Ga0395900_0030088_1679_2137 | 152 |
| 68 | 3300037418 | Ga0395900_0032733 | Ga0395900_0032733_2919_3377 | 152 |
| 69 | 3300037418 | Ga0395900_0067088 | Ga0395900_0067088_1300_1758 | 152 |
| 70 | 3300037418 | Ga0395900_0557877 | Ga0395900_0557877_256_714 | 152 |
| 71 | 3300037466 | Ga0395898_0012791 | Ga0395898_0012791_5391_5849 | 152 |
| 72 | 3300037466 | Ga0395898_0044840 | Ga0395898_0044840_2644_3102 | 152 |
| 73 | 3300037466 | Ga0395898_0064147 | Ga0395898_0064147_1894_2352 | 152 |
| 74 | 3300037466 | Ga0395898_0096286 | Ga0395898_0096286_234_692 | 152 |
| 75 | 3300038443 | Ga0395901_0052189 | Ga0395901_0052189_2635_3093 | 152 |
| 76 | 3300038443 | Ga0395901_0062934 | Ga0395901_0062934_890_1348 | 152 |
| 77 | 3300038443 | Ga0395901_0079781 | Ga0395901_0079781_1940_2398 | 152 |
| 78 | 3300039437 | Ga0436365_0121354 | Ga0436365_0121354_1016_1474 | 152 |
| 79 | 3300044694 | Ga0466963_0935382 | Ga0466963_0935382_11_469 | 152 |
| 80 | 3300045976 | Ga0466967_0040855 | Ga0466967_0040855_111_569 | 152 |
| 81 | 3300049570 | Ga0501033_0491419 | Ga0501033_0491419_52_510 | 152 |
| 82 | 3300049571 | Ga0501034_0357091 | Ga0501034_0357091_912_1370 | 152 |
| 83 | 3300049581 | Ga0501047_1307430 | Ga0501047_1307430_62_520 | 152 |
| 84 | 3300049823 | Ga0501044_0927325 | Ga0501044_0927325_142_600 | 152 |
| 85 | 2209111006 | 2214544922 | 2213593458 | 153 |
| 86 | 3300000041 | ARcpr5oldR_c000056 | ARcpr5oldR_00005626 | 153 |
| 87 | 3300000042 | ARSoilYngRDRAFT_c00038 | ARSoilYngRDRAFT_000388 | 153 |
| 88 | 3300000043 | ARcpr5yngRDRAFT_c000037 | ARcpr5yngRDRAFT_0000376 | 153 |
| 89 | 3300000044 | ARSoilOldRDRAFT_c000060 | ARSoilOldRDRAFT_00006024 | 153 |
| 90 | 3300000045 | ARCol0oldRDRAFT_c00584 | ARCol0oldRDRAFT_005842 | 153 |
| 91 | 3300000652 | ARCol0yngRDRAFT_1000282 | ARCol0yngRDRAFT_10002824 | 153 |
| 92 | 3300001989 | JGI24739J22299_10005110 | JGI24739J22299_100051103 | 153 |
| 93 | 3300001990 | JGI24737J22298_10010531 | JGI24737J22298_100105312 | 153 |
| 94 | 3300001990 | JGI24737J22298_10018489 | JGI24737J22298_100184892 | 153 |
| 95 | 3300002070 | JGI24750J21931_1000905 | JGI24750J21931_10009052 | 153 |
| 96 | 3300002074 | JGI24748J21848_1000368 | JGI24748J21848_10003684 | 153 |
| 97 | 3300002075 | JGI24738J21930_10000907 | JGI24738J21930_100009078 | 153 |
| 98 | 3300002077 | JGI24744J21845_10000074 | JGI24744J21845_100000747 | 153 |
| 99 | 3300002126 | JGI24035J26624_1000024 | JGI24035J26624_100002413 | 153 |
| 100 | 3300002126 | JGI24035J26624_1000069 | JGI24035J26624_10000695 | 153 |
| 101 | 3300002244 | JGI24742J22300_10001012 | JGI24742J22300_100010123 | 153 |
| 102 | 3300002459 | JGI24751J29686_10005292 | JGI24751J29686_100052923 | 153 |
| 103 | 3300003911 | JGI25405J52794_10146540 | JGI25405J52794_101465401 | 153 |
| 104 | 3300005276 | Ga0065717_1001986 | Ga0065717_10019862 | 153 |
| 105 | 3300005289 | Ga0065704_10075779 | Ga0065704_100757792 | 153 |
| 106 | 3300005290 | Ga0065712_10009656 | Ga0065712_100096562 | 153 |
| 107 | 3300005290 | Ga0065712_10078326 | Ga0065712_100783262 | 153 |
| 108 | 3300005290 | Ga0065712_10080698 | Ga0065712_100806982 | 153 |
| 109 | 3300005293 | Ga0065715_10020644 | Ga0065715_100206443 | 153 |
| 110 | 3300005327 | Ga0070658_10445637 | Ga0070658_104456371 | 153 |
| 111 | 3300005328 | Ga0070676_10000085 | Ga0070676_1000008528 | 153 |
| 112 | 3300005328 | Ga0070676_10164820 | Ga0070676_101648201 | 153 |
| 113 | 3300005329 | Ga0070683_100003426 | Ga0070683_1000034268 | 153 |
| 114 | 3300005329 | Ga0070683_100010425 | Ga0070683_1000104256 | 153 |
| 115 | 3300005329 | Ga0070683_100179463 | Ga0070683_1001794632 | 153 |
| 116 | 3300005330 | Ga0070690_100023770 | Ga0070690_1000237702 | 153 |
| 117 | 3300005330 | Ga0070690_100217662 | Ga0070690_1002176623 | 153 |
| 118 | 3300005331 | Ga0070670_100045650 | Ga0070670_1000456504 | 153 |
| 119 | 3300005333 | Ga0070677_10000381 | Ga0070677_100003812 | 153 |
| 120 | 3300005334 | Ga0068869_100000832 | Ga0068869_10000083212 | 153 |
| 121 | 3300005335 | Ga0070666_10050801 | Ga0070666_100508014 | 153 |
| 122 | 3300005335 | Ga0070666_10154150 | Ga0070666_101541502 | 153 |
| 123 | 3300005336 | Ga0070680_100008571 | Ga0070680_1000085712 | 153 |
| 124 | 3300005336 | Ga0070680_100270099 | Ga0070680_1002700992 | 153 |
| 125 | 3300005336 | Ga0070680_100865053 | Ga0070680_1008650531 | 153 |
| 126 | 3300005337 | Ga0070682_100028237 | Ga0070682_1000282374 | 153 |
| 127 | 3300005337 | Ga0070682_100031073 | Ga0070682_1000310733 | 153 |
| 128 | 3300005337 | Ga0070682_100114322 | Ga0070682_1001143222 | 153 |
| 129 | 3300005338 | Ga0068868_100000495 | Ga0068868_1000004954 | 153 |
| 130 | 3300005338 | Ga0068868_100210301 | Ga0068868_1002103012 | 153 |
| 131 | 3300005339 | Ga0070660_100007071 | Ga0070660_1000070717 | 153 |
| 132 | 3300005339 | Ga0070660_100068984 | Ga0070660_1000689843 | 153 |
| 133 | 3300005339 | Ga0070660_100484773 | Ga0070660_1004847731 | 153 |
| 134 | 3300005339 | Ga0070660_100939211 | Ga0070660_1009392112 | 153 |
| 135 | 3300005340 | Ga0070689_100064034 | Ga0070689_1000640344 | 153 |
| 136 | 3300005341 | Ga0070691_10002861 | Ga0070691_100028612 | 153 |
| 137 | 3300005341 | Ga0070691_10101797 | Ga0070691_101017972 | 153 |
| 138 | 3300005343 | Ga0070687_100001770 | Ga0070687_1000017707 | 153 |
| 139 | 3300005344 | Ga0070661_100000983 | Ga0070661_10000098313 | 153 |
| 140 | 3300005345 | Ga0070692_10002229 | Ga0070692_100022297 | 153 |
| 141 | 3300005347 | Ga0070668_100005583 | Ga0070668_1000055837 | 153 |
| 142 | 3300005347 | Ga0070668_100099878 | Ga0070668_1000998782 | 153 |
| 143 | 3300005353 | Ga0070669_100002421 | Ga0070669_1000024217 | 153 |
| 144 | 3300005354 | Ga0070675_100001045 | Ga0070675_1000010458 | 153 |
| 145 | 3300005355 | Ga0070671_100000386 | Ga0070671_1000003868 | 153 |
| 146 | 3300005355 | Ga0070671_100028690 | Ga0070671_1000286903 | 153 |
| 147 | 3300005355 | Ga0070671_100167936 | Ga0070671_1001679362 | 153 |
| 148 | 3300005355 | Ga0070671_100737816 | Ga0070671_1007378162 | 153 |
| 149 | 3300005356 | Ga0070674_100006162 | Ga0070674_1000061626 | 153 |
| 150 | 3300005356 | Ga0070674_100957957 | Ga0070674_1009579572 | 153 |
| 151 | 3300005364 | Ga0070673_100009652 | Ga0070673_1000096522 | 153 |
| 152 | 3300005365 | Ga0070688_100033469 | Ga0070688_1000334694 | 153 |
| 153 | 3300005365 | Ga0070688_100125808 | Ga0070688_1001258082 | 153 |
| 154 | 3300005365 | Ga0070688_100126315 | Ga0070688_1001263153 | 153 |
| 155 | 3300005366 | Ga0070659_100007775 | Ga0070659_1000077757 | 153 |
| 156 | 3300005366 | Ga0070659_100222970 | Ga0070659_1002229702 | 153 |
| 157 | 3300005367 | Ga0070667_100296318 | Ga0070667_1002963182 | 153 |
| 158 | 3300005367 | Ga0070667_100657925 | Ga0070667_1006579251 | 153 |
| 159 | 3300005406 | Ga0070703_10005487 | Ga0070703_100054874 | 153 |
| 160 | 3300005434 | Ga0070709_10016725 | Ga0070709_100167256 | 153 |
| 161 | 3300005434 | Ga0070709_10023290 | Ga0070709_100232902 | 153 |
| 162 | 3300005434 | Ga0070709_10143939 | Ga0070709_101439391 | 153 |
| 163 | 3300005434 | Ga0070709_11070810 | Ga0070709_110708101 | 153 |
| 164 | 3300005435 | Ga0070714_100028926 | Ga0070714_1000289265 | 153 |
| 165 | 3300005435 | Ga0070714_100031838 | Ga0070714_1000318384 | 153 |
| 166 | 3300005435 | Ga0070714_100076629 | Ga0070714_1000766294 | 153 |
| 167 | 3300005435 | Ga0070714_100736146 | Ga0070714_1007361462 | 153 |
| 168 | 3300005436 | Ga0070713_100028382 | Ga0070713_1000283825 | 153 |
| 169 | 3300005436 | Ga0070713_100242511 | Ga0070713_1002425113 | 153 |
| 170 | 3300005436 | Ga0070713_100833977 | Ga0070713_1008339772 | 153 |
| 171 | 3300005436 | Ga0070713_100895097 | Ga0070713_1008950972 | 153 |
| 172 | 3300005437 | Ga0070710_10034212 | Ga0070710_100342123 | 153 |
| 173 | 3300005437 | Ga0070710_10050952 | Ga0070710_100509522 | 153 |
| 174 | 3300005438 | Ga0070701_10000908 | Ga0070701_100009084 | 153 |
| 175 | 3300005439 | Ga0070711_100011651 | Ga0070711_1000116512 | 153 |
| 176 | 3300005439 | Ga0070711_100054215 | Ga0070711_1000542152 | 153 |
| 177 | 3300005439 | Ga0070711_100125077 | Ga0070711_1001250772 | 153 |
| 178 | 3300005439 | Ga0070711_100214232 | Ga0070711_1002142322 | 153 |
| 179 | 3300005439 | Ga0070711_100245600 | Ga0070711_1002456001 | 153 |
| 180 | 3300005439 | Ga0070711_101677175 | Ga0070711_1016771751 | 153 |
| 181 | 3300005440 | Ga0070705_100003404 | Ga0070705_1000034042 | 153 |
| 182 | 3300005440 | Ga0070705_100365850 | Ga0070705_1003658501 | 153 |
| 183 | 3300005440 | Ga0070705_100408374 | Ga0070705_1004083742 | 153 |
| 184 | 3300005441 | Ga0070700_100003334 | Ga0070700_1000033342 | 153 |
| 185 | 3300005441 | Ga0070700_101561241 | Ga0070700_1015612411 | 153 |
| 186 | 3300005444 | Ga0070694_100005587 | Ga0070694_1000055872 | 153 |
| 187 | 3300005445 | Ga0070708_100064337 | Ga0070708_1000643373 | 153 |
| 188 | 3300005455 | Ga0070663_100012099 | Ga0070663_1000120992 | 153 |
| 189 | 3300005455 | Ga0070663_100150828 | Ga0070663_1001508282 | 153 |
| 190 | 3300005455 | Ga0070663_100240197 | Ga0070663_1002401973 | 153 |
| 191 | 3300005455 | Ga0070663_100733134 | Ga0070663_1007331342 | 153 |
| 192 | 3300005456 | Ga0070678_100000260 | Ga0070678_10000026018 | 153 |
| 193 | 3300005456 | Ga0070678_100154027 | Ga0070678_1001540272 | 153 |
| 194 | 3300005456 | Ga0070678_100594102 | Ga0070678_1005941022 | 153 |
| 195 | 3300005457 | Ga0070662_100084360 | Ga0070662_1000843602 | 153 |
| 196 | 3300005457 | Ga0070662_100414481 | Ga0070662_1004144812 | 153 |
| 197 | 3300005457 | Ga0070662_100497392 | Ga0070662_1004973922 | 153 |
| 198 | 3300005458 | Ga0070681_10003989 | Ga0070681_100039897 | 153 |
| 199 | 3300005458 | Ga0070681_10071454 | Ga0070681_100714542 | 153 |
| 200 | 3300005458 | Ga0070681_10405100 | Ga0070681_104051002 | 153 |
| 201 | 3300005459 | Ga0068867_100002696 | Ga0068867_1000026967 | 153 |
| 202 | 3300005459 | Ga0068867_100107284 | Ga0068867_1001072842 | 153 |
| 203 | 3300005466 | Ga0070685_10007108 | Ga0070685_100071082 | 153 |
| 204 | 3300005466 | Ga0070685_10023063 | Ga0070685_100230632 | 153 |
| 205 | 3300005466 | Ga0070685_10149156 | Ga0070685_101491562 | 153 |
| 206 | 3300005468 | Ga0070707_100222997 | Ga0070707_1002229972 | 153 |
| 207 | 3300005471 | Ga0070698_100733499 | Ga0070698_1007334991 | 153 |
| 208 | 3300005518 | Ga0070699_100506441 | Ga0070699_1005064412 | 153 |
| 209 | 3300005530 | Ga0070679_100043302 | Ga0070679_1000433024 | 153 |
| 210 | 3300005530 | Ga0070679_100062508 | Ga0070679_1000625083 | 153 |
| 211 | 3300005530 | Ga0070679_100460335 | Ga0070679_1004603352 | 153 |
| 212 | 3300005530 | Ga0070679_100527303 | Ga0070679_1005273032 | 153 |
| 213 | 3300005530 | Ga0070679_100864914 | Ga0070679_1008649142 | 153 |
| 214 | 3300005535 | Ga0070684_100002858 | Ga0070684_1000028588 | 153 |
| 215 | 3300005535 | Ga0070684_100029407 | Ga0070684_1000294072 | 153 |
| 216 | 3300005535 | Ga0070684_101135567 | Ga0070684_1011355671 | 153 |
| 217 | 3300005535 | Ga0070684_101321803 | Ga0070684_1013218031 | 153 |
| 218 | 3300005535 | Ga0070684_101622635 | Ga0070684_1016226351 | 153 |
| 219 | 3300005536 | Ga0070697_100443608 | Ga0070697_1004436082 | 153 |
| 220 | 3300005539 | Ga0068853_100073074 | Ga0068853_1000730744 | 153 |
| 221 | 3300005539 | Ga0068853_100173730 | Ga0068853_1001737303 | 153 |
| 222 | 3300005543 | Ga0070672_100006644 | Ga0070672_1000066447 | 153 |
| 223 | 3300005544 | Ga0070686_100030263 | Ga0070686_1000302632 | 153 |
| 224 | 3300005544 | Ga0070686_100197802 | Ga0070686_1001978023 | 153 |
| 225 | 3300005545 | Ga0070695_100020350 | Ga0070695_1000203503 | 153 |
| 226 | 3300005545 | Ga0070695_100022315 | Ga0070695_1000223154 | 153 |
| 227 | 3300005546 | Ga0070696_100034090 | Ga0070696_1000340902 | 153 |
| 228 | 3300005546 | Ga0070696_100328134 | Ga0070696_1003281341 | 153 |
| 229 | 3300005546 | Ga0070696_101826230 | Ga0070696_1018262301 | 153 |
| 230 | 3300005547 | Ga0070693_100000947 | Ga0070693_1000009477 | 153 |
| 231 | 3300005547 | Ga0070693_100024354 | Ga0070693_1000243544 | 153 |
| 232 | 3300005547 | Ga0070693_100027275 | Ga0070693_1000272753 | 153 |
| 233 | 3300005548 | Ga0070665_100355973 | Ga0070665_1003559732 | 153 |
| 234 | 3300005548 | Ga0070665_100718134 | Ga0070665_1007181342 | 153 |
| 235 | 3300005549 | Ga0070704_100239051 | Ga0070704_1002390512 | 153 |
| 236 | 3300005563 | Ga0068855_100216080 | Ga0068855_1002160802 | 153 |
| 237 | 3300005563 | Ga0068855_100261759 | Ga0068855_1002617592 | 153 |
| 238 | 3300005563 | Ga0068855_100417287 | Ga0068855_1004172872 | 153 |
| 239 | 3300005564 | Ga0070664_100002866 | Ga0070664_1000028664 | 153 |
| 240 | 3300005564 | Ga0070664_100701938 | Ga0070664_1007019382 | 153 |
| 241 | 3300005577 | Ga0068857_100002854 | Ga0068857_1000028544 | 153 |
| 242 | 3300005577 | Ga0068857_100185441 | Ga0068857_1001854412 | 153 |
| 243 | 3300005578 | Ga0068854_100014002 | Ga0068854_1000140022 | 153 |
| 244 | 3300005578 | Ga0068854_100213516 | Ga0068854_1002135162 | 153 |
| 245 | 3300005578 | Ga0068854_100489761 | Ga0068854_1004897612 | 153 |
| 246 | 3300005614 | Ga0068856_100002432 | Ga0068856_10000243217 | 153 |
| 247 | 3300005614 | Ga0068856_100064883 | Ga0068856_1000648834 | 153 |
| 248 | 3300005614 | Ga0068856_100192582 | Ga0068856_1001925823 | 153 |
| 249 | 3300005614 | Ga0068856_100460879 | Ga0068856_1004608792 | 153 |
| 250 | 3300005614 | Ga0068856_100957560 | Ga0068856_1009575602 | 153 |
| 251 | 3300005615 | Ga0070702_100001455 | Ga0070702_1000014554 | 153 |
| 252 | 3300005616 | Ga0068852_100426174 | Ga0068852_1004261742 | 153 |
| 253 | 3300005616 | Ga0068852_100580087 | Ga0068852_1005800872 | 153 |
| 254 | 3300005617 | Ga0068859_100402635 | Ga0068859_1004026353 | 153 |
| 255 | 3300005618 | Ga0068864_100003611 | Ga0068864_1000036118 | 153 |
| 256 | 3300005718 | Ga0068866_10000364 | Ga0068866_1000036419 | 153 |
| 257 | 3300005718 | Ga0068866_11110913 | Ga0068866_111109131 | 153 |
| 258 | 3300005719 | Ga0068861_100006781 | Ga0068861_1000067812 | 153 |
| 259 | 3300005719 | Ga0068861_100310779 | Ga0068861_1003107792 | 153 |
| 260 | 3300005834 | Ga0068851_10026178 | Ga0068851_100261782 | 153 |
| 261 | 3300005834 | Ga0068851_10305352 | Ga0068851_103053522 | 153 |
| 262 | 3300005840 | Ga0068870_10000015 | Ga0068870_1000001522 | 153 |
| 263 | 3300005841 | Ga0068863_100000278 | Ga0068863_1000002782 | 153 |
| 264 | 3300005841 | Ga0068863_100043782 | Ga0068863_1000437823 | 153 |
| 265 | 3300005842 | Ga0068858_100042094 | Ga0068858_1000420942 | 153 |
| 266 | 3300005842 | Ga0068858_100357013 | Ga0068858_1003570133 | 153 |
| 267 | 3300005843 | Ga0068860_100005473 | Ga0068860_1000054737 | 153 |
| 268 | 3300005843 | Ga0068860_100196722 | Ga0068860_1001967223 | 153 |
| 269 | 3300005843 | Ga0068860_100374697 | Ga0068860_1003746972 | 153 |
| 270 | 3300005843 | Ga0068860_100422597 | Ga0068860_1004225972 | 153 |
| 271 | 3300005844 | Ga0068862_100003784 | Ga0068862_1000037847 | 153 |
| 272 | 3300005844 | Ga0068862_100435980 | Ga0068862_1004359802 | 153 |
| 273 | 3300005844 | Ga0068862_101571878 | Ga0068862_1015718782 | 153 |
| 274 | 3300005937 | Ga0081455_10001601 | Ga0081455_100016019 | 153 |
| 275 | 3300005937 | Ga0081455_10082066 | Ga0081455_100820663 | 153 |
| 276 | 3300006028 | Ga0070717_10144648 | Ga0070717_101446482 | 153 |
| 277 | 3300006058 | Ga0075432_10240718 | Ga0075432_102407182 | 153 |
| 278 | 3300006163 | Ga0070715_10016578 | Ga0070715_100165783 | 153 |
| 279 | 3300006173 | Ga0070716_100018193 | Ga0070716_1000181931 | 153 |
| 280 | 3300006173 | Ga0070716_100114391 | Ga0070716_1001143913 | 153 |
| 281 | 3300006173 | Ga0070716_100153419 | Ga0070716_1001534192 | 153 |
| 282 | 3300006175 | Ga0070712_100012900 | Ga0070712_1000129005 | 153 |
| 283 | 3300006175 | Ga0070712_100078211 | Ga0070712_1000782112 | 153 |
| 284 | 3300006175 | Ga0070712_100309321 | Ga0070712_1003093212 | 153 |
| 285 | 3300006175 | Ga0070712_100371284 | Ga0070712_1003712842 | 153 |
| 286 | 3300006175 | Ga0070712_100773489 | Ga0070712_1007734892 | 153 |
| 287 | 3300006178 | Ga0075367_10035568 | Ga0075367_100355682 | 153 |
| 288 | 3300006237 | Ga0097621_100009409 | Ga0097621_1000094096 | 153 |
| 289 | 3300006237 | Ga0097621_100019613 | Ga0097621_1000196134 | 153 |
| 290 | 3300006237 | Ga0097621_100252555 | Ga0097621_1002525552 | 153 |
| 291 | 3300006353 | Ga0075370_10041043 | Ga0075370_100410433 | 153 |
| 292 | 3300006353 | Ga0075370_10116379 | Ga0075370_101163792 | 153 |
| 293 | 3300006358 | Ga0068871_100005915 | Ga0068871_1000059152 | 153 |
| 294 | 3300006358 | Ga0068871_100088803 | Ga0068871_1000888034 | 153 |
| 295 | 3300006358 | Ga0068871_100153104 | Ga0068871_1001531042 | 153 |
| 296 | 3300006852 | Ga0075433_10088886 | Ga0075433_100888862 | 153 |
| 297 | 3300006871 | Ga0075434_100011707 | Ga0075434_1000117072 | 153 |
| 298 | 3300006880 | Ga0075429_100543689 | Ga0075429_1005436892 | 153 |
| 299 | 3300006881 | Ga0068865_100046627 | Ga0068865_1000466272 | 153 |
| 300 | 3300006914 | Ga0075436_100144184 | Ga0075436_1001441842 | 153 |
| 301 | 3300006931 | Ga0097620_100402642 | Ga0097620_1004026423 | 153 |
| 302 | 3300007076 | Ga0075435_100307280 | Ga0075435_1003072802 | 153 |
| 303 | 3300007076 | Ga0075435_100434709 | Ga0075435_1004347092 | 153 |
| 304 | 3300007076 | Ga0075435_100491581 | Ga0075435_1004915812 | 153 |
| 305 | 3300009011 | Ga0105251_10079855 | Ga0105251_100798553 | 153 |
| 306 | 3300009011 | Ga0105251_10284245 | Ga0105251_102842452 | 153 |
| 307 | 3300009036 | Ga0105244_10092970 | Ga0105244_100929702 | 153 |
| 308 | 3300009092 | Ga0105250_10041851 | Ga0105250_100418512 | 153 |
| 309 | 3300009092 | Ga0105250_10166071 | Ga0105250_101660712 | 153 |
| 310 | 3300009094 | Ga0111539_10022188 | Ga0111539_100221882 | 153 |
| 311 | 3300009094 | Ga0111539_10080457 | Ga0111539_100804575 | 153 |
| 312 | 3300009094 | Ga0111539_10121090 | Ga0111539_101210902 | 153 |
| 313 | 3300009098 | Ga0105245_10003800 | Ga0105245_100038007 | 153 |
| 314 | 3300009098 | Ga0105245_10158044 | Ga0105245_101580442 | 153 |
| 315 | 3300009098 | Ga0105245_11102628 | Ga0105245_111026282 | 153 |
| 316 | 3300009098 | Ga0105245_11284263 | Ga0105245_112842632 | 153 |
| 317 | 3300009098 | Ga0105245_12090982 | Ga0105245_120909822 | 153 |
| 318 | 3300009101 | Ga0105247_10012563 | Ga0105247_100125635 | 153 |
| 319 | 3300009101 | Ga0105247_10029045 | Ga0105247_100290452 | 153 |
| 320 | 3300009101 | Ga0105247_10427843 | Ga0105247_104278431 | 153 |
| 321 | 3300009101 | Ga0105247_10978299 | Ga0105247_109782991 | 153 |
| 322 | 3300009148 | Ga0105243_10007557 | Ga0105243_100075572 | 153 |
| 323 | 3300009148 | Ga0105243_10023375 | Ga0105243_100233753 | 153 |
| 324 | 3300009148 | Ga0105243_10185610 | Ga0105243_101856102 | 153 |
| 325 | 3300009174 | Ga0105241_10000982 | Ga0105241_1000098217 | 153 |
| 326 | 3300009174 | Ga0105241_10023898 | Ga0105241_100238984 | 153 |
| 327 | 3300009174 | Ga0105241_10280611 | Ga0105241_102806112 | 153 |
| 328 | 3300009174 | Ga0105241_10291363 | Ga0105241_102913632 | 153 |
| 329 | 3300009176 | Ga0105242_10001299 | Ga0105242_100012996 | 153 |
| 330 | 3300009176 | Ga0105242_10008924 | Ga0105242_100089247 | 153 |
| 331 | 3300009176 | Ga0105242_10133517 | Ga0105242_101335172 | 153 |
| 332 | 3300009177 | Ga0105248_10002736 | Ga0105248_100027367 | 153 |
| 333 | 3300009177 | Ga0105248_10011811 | Ga0105248_100118113 | 153 |
| 334 | 3300009177 | Ga0105248_10157656 | Ga0105248_101576562 | 153 |
| 335 | 3300009177 | Ga0105248_10358083 | Ga0105248_103580832 | 153 |
| 336 | 3300009545 | Ga0105237_10019497 | Ga0105237_100194977 | 153 |
| 337 | 3300009545 | Ga0105237_10295171 | Ga0105237_102951712 | 153 |
| 338 | 3300009545 | Ga0105237_10365882 | Ga0105237_103658823 | 153 |
| 339 | 3300009545 | Ga0105237_10372078 | Ga0105237_103720782 | 153 |
| 340 | 3300009545 | Ga0105237_11521316 | Ga0105237_115213161 | 153 |
| 341 | 3300009551 | Ga0105238_10040330 | Ga0105238_100403303 | 153 |
| 342 | 3300009551 | Ga0105238_10278821 | Ga0105238_102788213 | 153 |
| 343 | 3300009551 | Ga0105238_10545414 | Ga0105238_105454141 | 153 |
| 344 | 3300009553 | Ga0105249_10003014 | Ga0105249_100030147 | 153 |
| 345 | 3300009553 | Ga0105249_10087070 | Ga0105249_100870702 | 153 |
| 346 | 3300009553 | Ga0105249_10114678 | Ga0105249_101146782 | 153 |
| 347 | 3300009553 | Ga0105249_10420896 | Ga0105249_104208962 | 153 |
| 348 | 3300010375 | Ga0105239_10015884 | Ga0105239_100158842 | 153 |
| 349 | 3300010375 | Ga0105239_10101705 | Ga0105239_101017052 | 153 |
| 350 | 3300010375 | Ga0105239_10350876 | Ga0105239_103508763 | 153 |
| 351 | 3300010375 | Ga0105239_10634999 | Ga0105239_106349992 | 153 |
| 352 | 3300011119 | Ga0105246_10004947 | Ga0105246_100049472 | 153 |
| 353 | 3300011119 | Ga0105246_10158676 | Ga0105246_101586762 | 153 |
| 354 | 3300012478 | Ga0157328_1001908 | Ga0157328_10019082 | 153 |
| 355 | 3300012480 | Ga0157346_1001147 | Ga0157346_10011471 | 153 |
| 356 | 3300012488 | Ga0157343_1004982 | Ga0157343_10049822 | 153 |
| 357 | 3300012490 | Ga0157322_1001471 | Ga0157322_10014711 | 153 |
| 358 | 3300012502 | Ga0157347_1011258 | Ga0157347_10112582 | 153 |
| 359 | 3300012507 | Ga0157342_1004570 | Ga0157342_10045702 | 153 |
| 360 | 3300012508 | Ga0157315_1007302 | Ga0157315_10073022 | 153 |
| 361 | 3300013100 | Ga0157373_10017859 | Ga0157373_100178596 | 153 |
| 362 | 3300013100 | Ga0157373_10065620 | Ga0157373_100656202 | 153 |
| 363 | 3300013100 | Ga0157373_10178233 | Ga0157373_101782333 | 153 |
| 364 | 3300013100 | Ga0157373_10481740 | Ga0157373_104817401 | 153 |
| 365 | 3300013102 | Ga0157371_10226602 | Ga0157371_102266022 | 153 |
| 366 | 3300013104 | Ga0157370_10196656 | Ga0157370_101966562 | 153 |
| 367 | 3300013105 | Ga0157369_10045190 | Ga0157369_100451902 | 153 |
| 368 | 3300013105 | Ga0157369_10373571 | Ga0157369_103735713 | 153 |
| 369 | 3300013105 | Ga0157369_11556141 | Ga0157369_115561411 | 153 |
| 370 | 3300013296 | Ga0157374_10009129 | Ga0157374_100091295 | 153 |
| 371 | 3300013296 | Ga0157374_10091222 | Ga0157374_100912222 | 153 |
| 372 | 3300013296 | Ga0157374_10487326 | Ga0157374_104873262 | 153 |
| 373 | 3300013297 | Ga0157378_10004364 | Ga0157378_1000436415 | 153 |
| 374 | 3300013297 | Ga0157378_10042070 | Ga0157378_100420705 | 153 |
| 375 | 3300013297 | Ga0157378_10474274 | Ga0157378_104742742 | 153 |
| 376 | 3300013306 | Ga0163162_10011614 | Ga0163162_100116143 | 153 |
| 377 | 3300013306 | Ga0163162_10087519 | Ga0163162_100875192 | 153 |
| 378 | 3300013306 | Ga0163162_10341842 | Ga0163162_103418422 | 153 |
| 379 | 3300013307 | Ga0157372_10195872 | Ga0157372_101958721 | 153 |
| 380 | 3300013307 | Ga0157372_10249843 | Ga0157372_102498432 | 153 |
| 381 | 3300013307 | Ga0157372_10611866 | Ga0157372_106118662 | 153 |
| 382 | 3300013307 | Ga0157372_10618363 | Ga0157372_106183632 | 153 |
| 383 | 3300013308 | Ga0157375_10008586 | Ga0157375_100085861 | 153 |
| 384 | 3300013308 | Ga0157375_10330690 | Ga0157375_103306902 | 153 |
| 385 | 3300013308 | Ga0157375_10657776 | Ga0157375_106577762 | 153 |
| 386 | 3300014325 | Ga0163163_10063140 | Ga0163163_100631403 | 153 |
| 387 | 3300014325 | Ga0163163_10260337 | Ga0163163_102603372 | 153 |
| 388 | 3300014325 | Ga0163163_10842531 | Ga0163163_108425311 | 153 |
| 389 | 3300014325 | Ga0163163_12583151 | Ga0163163_125831511 | 153 |
| 390 | 3300014326 | Ga0157380_10003889 | Ga0157380_100038894 | 153 |
| 391 | 3300014326 | Ga0157380_10113220 | Ga0157380_101132202 | 153 |
| 392 | 3300014326 | Ga0157380_11219269 | Ga0157380_112192692 | 153 |
| 393 | 3300014745 | Ga0157377_10000317 | Ga0157377_1000031717 | 153 |
| 394 | 3300014968 | Ga0157379_10000067 | Ga0157379_1000006771 | 153 |
| 395 | 3300014968 | Ga0157379_10018396 | Ga0157379_100183962 | 153 |
| 396 | 3300014968 | Ga0157379_10516277 | Ga0157379_105162772 | 153 |
| 397 | 3300014969 | Ga0157376_10005894 | Ga0157376_100058948 | 153 |
| 398 | 3300014969 | Ga0157376_11634894 | Ga0157376_116348941 | 153 |
| 399 | 3300017792 | Ga0163161_10000693 | Ga0163161_1000069315 | 153 |
| 400 | 3300017792 | Ga0163161_10126818 | Ga0163161_101268182 | 153 |
| 401 | 3300017792 | Ga0163161_11175856 | Ga0163161_111758561 | 153 |
| 402 | 3300020070 | Ga0206356_11494623 | Ga0206356_114946232 | 153 |
| 403 | 3300021384 | Ga0213876_10013750 | Ga0213876_100137502 | 153 |
| 404 | 3300025271 | Ga0207666_1000681 | Ga0207666_10006812 | 153 |
| 405 | 3300025271 | Ga0207666_1001215 | Ga0207666_10012152 | 153 |
| 406 | 3300025290 | Ga0207673_1001404 | Ga0207673_10014043 | 153 |
| 407 | 3300025315 | Ga0207697_10016607 | Ga0207697_100166072 | 153 |
| 408 | 3300025315 | Ga0207697_10119883 | Ga0207697_101198832 | 153 |
| 409 | 3300025885 | Ga0207653_10003762 | Ga0207653_100037622 | 153 |
| 410 | 3300025885 | Ga0207653_10074057 | Ga0207653_100740572 | 153 |
| 411 | 3300025893 | Ga0207682_10000264 | Ga0207682_100002643 | 153 |
| 412 | 3300025898 | Ga0207692_10002735 | Ga0207692_100027353 | 153 |
| 413 | 3300025899 | Ga0207642_10000834 | Ga0207642_100008348 | 153 |
| 414 | 3300025899 | Ga0207642_10300214 | Ga0207642_103002142 | 153 |
| 415 | 3300025900 | Ga0207710_10005159 | Ga0207710_100051592 | 153 |
| 416 | 3300025900 | Ga0207710_10025358 | Ga0207710_100253582 | 153 |
| 417 | 3300025900 | Ga0207710_10087483 | Ga0207710_100874832 | 153 |
| 418 | 3300025900 | Ga0207710_10379584 | Ga0207710_103795842 | 153 |
| 419 | 3300025901 | Ga0207688_10015833 | Ga0207688_100158332 | 153 |
| 420 | 3300025901 | Ga0207688_10062252 | Ga0207688_100622522 | 153 |
| 421 | 3300025903 | Ga0207680_10013218 | Ga0207680_100132184 | 153 |
| 422 | 3300025904 | Ga0207647_10041608 | Ga0207647_100416083 | 153 |
| 423 | 3300025905 | Ga0207685_10004366 | Ga0207685_100043664 | 153 |
| 424 | 3300025905 | Ga0207685_10043609 | Ga0207685_100436092 | 153 |
| 425 | 3300025906 | Ga0207699_10040119 | Ga0207699_100401193 | 153 |
| 426 | 3300025906 | Ga0207699_10128144 | Ga0207699_101281441 | 153 |
| 427 | 3300025906 | Ga0207699_10173029 | Ga0207699_101730293 | 153 |
| 428 | 3300025906 | Ga0207699_10513252 | Ga0207699_105132522 | 153 |
| 429 | 3300025907 | Ga0207645_10000926 | Ga0207645_1000092624 | 153 |
| 430 | 3300025907 | Ga0207645_10222865 | Ga0207645_102228652 | 153 |
| 431 | 3300025907 | Ga0207645_10451235 | Ga0207645_104512352 | 153 |
| 432 | 3300025908 | Ga0207643_10000004 | Ga0207643_10000004140 | 153 |
| 433 | 3300025909 | Ga0207705_11374108 | Ga0207705_113741081 | 153 |
| 434 | 3300025910 | Ga0207684_10096691 | Ga0207684_100966912 | 153 |
| 435 | 3300025911 | Ga0207654_10000437 | Ga0207654_100004377 | 153 |
| 436 | 3300025911 | Ga0207654_10872418 | Ga0207654_108724181 | 153 |
| 437 | 3300025912 | Ga0207707_10004519 | Ga0207707_100045198 | 153 |
| 438 | 3300025912 | Ga0207707_10060140 | Ga0207707_100601404 | 153 |
| 439 | 3300025912 | Ga0207707_11118437 | Ga0207707_111184371 | 153 |
| 440 | 3300025914 | Ga0207671_10010091 | Ga0207671_100100918 | 153 |
| 441 | 3300025914 | Ga0207671_10283607 | Ga0207671_102836072 | 153 |
| 442 | 3300025915 | Ga0207693_10001239 | Ga0207693_1000123926 | 153 |
| 443 | 3300025915 | Ga0207693_10006137 | Ga0207693_100061378 | 153 |
| 444 | 3300025915 | Ga0207693_10013383 | Ga0207693_100133833 | 153 |
| 445 | 3300025915 | Ga0207693_10064686 | Ga0207693_100646862 | 153 |
| 446 | 3300025916 | Ga0207663_10019511 | Ga0207663_100195112 | 153 |
| 447 | 3300025916 | Ga0207663_10022853 | Ga0207663_100228535 | 153 |
| 448 | 3300025916 | Ga0207663_10071352 | Ga0207663_100713522 | 153 |
| 449 | 3300025916 | Ga0207663_11144628 | Ga0207663_111446281 | 153 |
| 450 | 3300025917 | Ga0207660_10004154 | Ga0207660_100041547 | 153 |
| 451 | 3300025917 | Ga0207660_10028341 | Ga0207660_100283414 | 153 |
| 452 | 3300025917 | Ga0207660_10140445 | Ga0207660_101404452 | 153 |
| 453 | 3300025917 | Ga0207660_11010526 | Ga0207660_110105262 | 153 |
| 454 | 3300025918 | Ga0207662_10032660 | Ga0207662_100326602 | 153 |
| 455 | 3300025918 | Ga0207662_10328773 | Ga0207662_103287732 | 153 |
| 456 | 3300025919 | Ga0207657_10052397 | Ga0207657_100523973 | 153 |
| 457 | 3300025919 | Ga0207657_10054228 | Ga0207657_100542283 | 153 |
| 458 | 3300025919 | Ga0207657_10643333 | Ga0207657_106433332 | 153 |
| 459 | 3300025920 | Ga0207649_10000090 | Ga0207649_1000009017 | 153 |
| 460 | 3300025921 | Ga0207652_10001397 | Ga0207652_1000139711 | 153 |
| 461 | 3300025921 | Ga0207652_10068573 | Ga0207652_100685733 | 153 |
| 462 | 3300025921 | Ga0207652_10250845 | Ga0207652_102508452 | 153 |
| 463 | 3300025921 | Ga0207652_10424313 | Ga0207652_104243132 | 153 |
| 464 | 3300025921 | Ga0207652_10613162 | Ga0207652_106131622 | 153 |
| 465 | 3300025923 | Ga0207681_10001592 | Ga0207681_100015927 | 153 |
| 466 | 3300025924 | Ga0207694_11216550 | Ga0207694_112165501 | 153 |
| 467 | 3300025925 | Ga0207650_10007098 | Ga0207650_100070987 | 153 |
| 468 | 3300025926 | Ga0207659_10000038 | Ga0207659_1000003855 | 153 |
| 469 | 3300025927 | Ga0207687_10000445 | Ga0207687_1000044528 | 153 |
| 470 | 3300025927 | Ga0207687_10017603 | Ga0207687_100176034 | 153 |
| 471 | 3300025928 | Ga0207700_10003402 | Ga0207700_100034022 | 153 |
| 472 | 3300025928 | Ga0207700_10085958 | Ga0207700_100859582 | 153 |
| 473 | 3300025928 | Ga0207700_10099918 | Ga0207700_100999183 | 153 |
| 474 | 3300025929 | Ga0207664_10608410 | Ga0207664_106084102 | 153 |
| 475 | 3300025931 | Ga0207644_10000816 | Ga0207644_1000081618 | 153 |
| 476 | 3300025931 | Ga0207644_10514398 | Ga0207644_105143982 | 153 |
| 477 | 3300025932 | Ga0207690_10000440 | Ga0207690_100004408 | 153 |
| 478 | 3300025932 | Ga0207690_10082283 | Ga0207690_100822833 | 153 |
| 479 | 3300025932 | Ga0207690_10144572 | Ga0207690_101445722 | 153 |
| 480 | 3300025932 | Ga0207690_10244781 | Ga0207690_102447812 | 153 |
| 481 | 3300025933 | Ga0207706_10008938 | Ga0207706_100089388 | 153 |
| 482 | 3300025933 | Ga0207706_10055499 | Ga0207706_100554992 | 153 |
| 483 | 3300025933 | Ga0207706_10059966 | Ga0207706_100599662 | 153 |
| 484 | 3300025934 | Ga0207686_10000433 | Ga0207686_1000043319 | 153 |
| 485 | 3300025934 | Ga0207686_10369100 | Ga0207686_103691002 | 153 |
| 486 | 3300025935 | Ga0207709_10000494 | Ga0207709_1000049420 | 153 |
| 487 | 3300025935 | Ga0207709_10021426 | Ga0207709_100214262 | 153 |
| 488 | 3300025935 | Ga0207709_10184343 | Ga0207709_101843432 | 153 |
| 489 | 3300025936 | Ga0207670_10001363 | Ga0207670_1000136315 | 153 |
| 490 | 3300025936 | Ga0207670_10139679 | Ga0207670_101396792 | 153 |
| 491 | 3300025936 | Ga0207670_10512922 | Ga0207670_105129222 | 153 |
| 492 | 3300025936 | Ga0207670_11006992 | Ga0207670_110069921 | 153 |
| 493 | 3300025937 | Ga0207669_10000063 | Ga0207669_1000006350 | 153 |
| 494 | 3300025937 | Ga0207669_10109699 | Ga0207669_101096992 | 153 |
| 495 | 3300025937 | Ga0207669_10455866 | Ga0207669_104558662 | 153 |
| 496 | 3300025938 | Ga0207704_10001268 | Ga0207704_100012684 | 153 |
| 497 | 3300025939 | Ga0207665_10003373 | Ga0207665_1000337311 | 153 |
| 498 | 3300025939 | Ga0207665_10028918 | Ga0207665_100289183 | 153 |
| 499 | 3300025939 | Ga0207665_10030904 | Ga0207665_100309041 | 153 |
| 500 | 3300025939 | Ga0207665_10108301 | Ga0207665_101083012 | 153 |
| 501 | 3300025940 | Ga0207691_10000981 | Ga0207691_1000098118 | 153 |
| 502 | 3300025940 | Ga0207691_10517083 | Ga0207691_105170831 | 153 |
| 503 | 3300025941 | Ga0207711_10000792 | Ga0207711_100007924 | 153 |
| 504 | 3300025941 | Ga0207711_10012513 | Ga0207711_100125135 | 153 |
| 505 | 3300025941 | Ga0207711_10075463 | Ga0207711_100754634 | 153 |
| 506 | 3300025942 | Ga0207689_10002635 | Ga0207689_1000263519 | 153 |
| 507 | 3300025942 | Ga0207689_10247590 | Ga0207689_102475902 | 153 |
| 508 | 3300025942 | Ga0207689_10419153 | Ga0207689_104191532 | 153 |
| 509 | 3300025944 | Ga0207661_10000531 | Ga0207661_1000053114 | 153 |
| 510 | 3300025944 | Ga0207661_10284230 | Ga0207661_102842302 | 153 |
| 511 | 3300025944 | Ga0207661_10473035 | Ga0207661_104730353 | 153 |
| 512 | 3300025945 | Ga0207679_10001109 | Ga0207679_1000110915 | 153 |
| 513 | 3300025945 | Ga0207679_10054930 | Ga0207679_100549302 | 153 |
| 514 | 3300025945 | Ga0207679_10231357 | Ga0207679_102313572 | 153 |
| 515 | 3300025945 | Ga0207679_10526080 | Ga0207679_105260802 | 153 |
| 516 | 3300025949 | Ga0207667_10022580 | Ga0207667_100225803 | 153 |
| 517 | 3300025949 | Ga0207667_10554214 | Ga0207667_105542142 | 153 |
| 518 | 3300025960 | Ga0207651_10000379 | Ga0207651_100003798 | 153 |
| 519 | 3300025960 | Ga0207651_10565668 | Ga0207651_105656682 | 153 |
| 520 | 3300025961 | Ga0207712_10000717 | Ga0207712_1000071716 | 153 |
| 521 | 3300025961 | Ga0207712_10339234 | Ga0207712_103392342 | 153 |
| 522 | 3300025961 | Ga0207712_10659694 | Ga0207712_106596942 | 153 |
| 523 | 3300025972 | Ga0207668_10000429 | Ga0207668_100004298 | 153 |
| 524 | 3300025972 | Ga0207668_10016879 | Ga0207668_100168792 | 153 |
| 525 | 3300025981 | Ga0207640_10000516 | Ga0207640_100005162 | 153 |
| 526 | 3300025986 | Ga0207658_10020967 | Ga0207658_100209672 | 153 |
| 527 | 3300025986 | Ga0207658_10079727 | Ga0207658_100797272 | 153 |
| 528 | 3300025986 | Ga0207658_10436337 | Ga0207658_104363372 | 153 |
| 529 | 3300026023 | Ga0207677_10001164 | Ga0207677_1000116410 | 153 |
| 530 | 3300026023 | Ga0207677_10217318 | Ga0207677_102173182 | 153 |
| 531 | 3300026035 | Ga0207703_10007685 | Ga0207703_100076857 | 153 |
| 532 | 3300026035 | Ga0207703_10074671 | Ga0207703_100746713 | 153 |
| 533 | 3300026035 | Ga0207703_10140580 | Ga0207703_101405803 | 153 |
| 534 | 3300026035 | Ga0207703_10456481 | Ga0207703_104564812 | 153 |
| 535 | 3300026041 | Ga0207639_10003596 | Ga0207639_100035967 | 153 |
| 536 | 3300026041 | Ga0207639_10292101 | Ga0207639_102921012 | 153 |
| 537 | 3300026041 | Ga0207639_10346725 | Ga0207639_103467252 | 153 |
| 538 | 3300026067 | Ga0207678_10002770 | Ga0207678_100027703 | 153 |
| 539 | 3300026067 | Ga0207678_10026091 | Ga0207678_100260913 | 153 |
| 540 | 3300026067 | Ga0207678_10140321 | Ga0207678_101403213 | 153 |
| 541 | 3300026075 | Ga0207708_10055110 | Ga0207708_100551102 | 153 |
| 542 | 3300026075 | Ga0207708_10055122 | Ga0207708_100551222 | 153 |
| 543 | 3300026078 | Ga0207702_10003627 | Ga0207702_100036278 | 153 |
| 544 | 3300026078 | Ga0207702_10230482 | Ga0207702_102304823 | 153 |
| 545 | 3300026078 | Ga0207702_10430426 | Ga0207702_104304263 | 153 |
| 546 | 3300026078 | Ga0207702_11190156 | Ga0207702_111901562 | 153 |
| 547 | 3300026088 | Ga0207641_10003728 | Ga0207641_100037287 | 153 |
| 548 | 3300026088 | Ga0207641_10046965 | Ga0207641_100469653 | 153 |
| 549 | 3300026088 | Ga0207641_10535008 | Ga0207641_105350082 | 153 |
| 550 | 3300026089 | Ga0207648_10013027 | Ga0207648_100130277 | 153 |
| 551 | 3300026089 | Ga0207648_10412631 | Ga0207648_104126312 | 153 |
| 552 | 3300026089 | Ga0207648_10648804 | Ga0207648_106488042 | 153 |
| 553 | 3300026095 | Ga0207676_10000583 | Ga0207676_1000058310 | 153 |
| 554 | 3300026095 | Ga0207676_10078337 | Ga0207676_100783372 | 153 |
| 555 | 3300026095 | Ga0207676_10295329 | Ga0207676_102953292 | 153 |
| 556 | 3300026116 | Ga0207674_10028860 | Ga0207674_100288605 | 153 |
| 557 | 3300026116 | Ga0207674_10409594 | Ga0207674_104095942 | 153 |
| 558 | 3300026118 | Ga0207675_100036186 | Ga0207675_1000361863 | 153 |
| 559 | 3300026118 | Ga0207675_100429521 | Ga0207675_1004295212 | 153 |
| 560 | 3300026121 | Ga0207683_10000138 | Ga0207683_1000013810 | 153 |
| 561 | 3300026121 | Ga0207683_10025410 | Ga0207683_100254106 | 153 |
| 562 | 3300026121 | Ga0207683_10228463 | Ga0207683_102284632 | 153 |
| 563 | 3300026142 | Ga0207698_10005821 | Ga0207698_100058212 | 153 |
| 564 | 3300026142 | Ga0207698_10649640 | Ga0207698_106496402 | 153 |
| 565 | 3300027252 | Ga0209973_1012711 | Ga0209973_10127112 | 153 |
| 566 | 3300027364 | Ga0209967_1001718 | Ga0209967_10017183 | 153 |
| 567 | 3300027471 | Ga0209995_1003384 | Ga0209995_10033842 | 153 |
| 568 | 3300027526 | Ga0209968_1009407 | Ga0209968_10094071 | 153 |
| 569 | 3300027617 | Ga0210002_1000870 | Ga0210002_10008702 | 153 |
| 570 | 3300027617 | Ga0210002_1023208 | Ga0210002_10232082 | 153 |
| 571 | 3300027665 | Ga0209983_1005120 | Ga0209983_10051203 | 153 |
| 572 | 3300027682 | Ga0209971_1014116 | Ga0209971_10141162 | 153 |
| 573 | 3300027682 | Ga0209971_1057654 | Ga0209971_10576542 | 153 |
| 574 | 3300027695 | Ga0209966_1003383 | Ga0209966_10033832 | 153 |
| 575 | 3300027695 | Ga0209966_1013394 | Ga0209966_10133942 | 153 |
| 576 | 3300027717 | Ga0209998_10007335 | Ga0209998_100073352 | 153 |
| 577 | 3300027717 | Ga0209998_10008256 | Ga0209998_100082562 | 153 |
| 578 | 3300027876 | Ga0209974_10006454 | Ga0209974_100064543 | 153 |
| 579 | 3300027876 | Ga0209974_10063771 | Ga0209974_100637712 | 153 |
| 580 | 3300027907 | Ga0207428_10001759 | Ga0207428_1000175916 | 153 |
| 581 | 3300027907 | Ga0207428_10023515 | Ga0207428_100235155 | 153 |
| 582 | 3300027907 | Ga0207428_10194065 | Ga0207428_101940653 | 153 |
| 583 | 3300028379 | Ga0268266_10062397 | Ga0268266_100623973 | 153 |
| 584 | 3300028380 | Ga0268265_10002569 | Ga0268265_100025697 | 153 |
| 585 | 3300028380 | Ga0268265_10551182 | Ga0268265_105511822 | 153 |
| 586 | 3300028381 | Ga0268264_10002097 | Ga0268264_1000209716 | 153 |
| 587 | 3300028381 | Ga0268264_10271581 | Ga0268264_102715812 | 153 |
| 588 | 3300028381 | Ga0268264_10715518 | Ga0268264_107155181 | 153 |
| 589 | 3300028381 | Ga0268264_11680334 | Ga0268264_116803341 | 153 |
| 590 | 3300028556 | Ga0265337_1001017 | Ga0265337_100101717 | 153 |
| 591 | 3300028800 | Ga0265338_10184604 | Ga0265338_101846043 | 153 |
| 592 | 3300028800 | Ga0265338_10328354 | Ga0265338_103283542 | 153 |
| 593 | 3300028800 | Ga0265338_10444083 | Ga0265338_104440832 | 153 |
| 594 | 3300031235 | Ga0265330_10009166 | Ga0265330_100091665 | 153 |
| 595 | 3300031238 | Ga0265332_10168956 | Ga0265332_101689561 | 153 |
| 596 | 3300031238 | Ga0265332_10170392 | Ga0265332_101703922 | 153 |
| 597 | 3300031241 | Ga0265325_10000019 | Ga0265325_10000019100 | 153 |
| 598 | 3300031241 | Ga0265325_10004257 | Ga0265325_100042575 | 153 |
| 599 | 3300031241 | Ga0265325_10043241 | Ga0265325_100432413 | 153 |
| 600 | 3300031247 | Ga0265340_10055326 | Ga0265340_100553263 | 153 |
| 601 | 3300031247 | Ga0265340_10122121 | Ga0265340_101221212 | 153 |
| 602 | 3300031249 | Ga0265339_10001671 | Ga0265339_100016716 | 153 |
| 603 | 3300031249 | Ga0265339_10019397 | Ga0265339_100193972 | 153 |
| 604 | 3300031344 | Ga0265316_10016529 | Ga0265316_100165292 | 153 |
| 605 | 3300031548 | Ga0307408_100939644 | Ga0307408_1009396442 | 153 |
| 606 | 3300031595 | Ga0265313_10001789 | Ga0265313_100017899 | 153 |
| 607 | 3300031595 | Ga0265313_10023160 | Ga0265313_100231602 | 153 |
| 608 | 3300031595 | Ga0265313_10024803 | Ga0265313_100248033 | 153 |
| 609 | 3300031691 | Ga0316579_10030720 | Ga0316579_100307202 | 153 |
| 610 | 3300031711 | Ga0265314_10000577 | Ga0265314_1000057725 | 153 |
| 611 | 3300031901 | Ga0307406_10525537 | Ga0307406_105255372 | 153 |
| 612 | 3300032004 | Ga0307414_11928885 | Ga0307414_119288851 | 153 |
| 613 | 3300032005 | Ga0307411_10340846 | Ga0307411_103408462 | 153 |
| 614 | 3300032126 | Ga0307415_100792740 | Ga0307415_1007927401 | 153 |
| 615 | 3300034816 | Ga0373930_0000568 | Ga0373930_0000568_1186_1647 | 153 |
| 616 | 3300034816 | Ga0373930_0180071 | Ga0373930_0180071_34_495 | 153 |
| 617 | 3300034817 | Ga0373948_0000092 | Ga0373948_0000092_6142_6603 | 153 |
| 618 | 3300034818 | Ga0373950_0008904 | Ga0373950_0008904_1076_1537 | 153 |
| 619 | 3300034819 | Ga0373958_0000576 | Ga0373958_0000576_700_1161 | 153 |
| 620 | 3300034819 | Ga0373958_0018463 | Ga0373958_0018463_628_1089 | 153 |
| 621 | 3300034820 | Ga0373959_0000576 | Ga0373959_0000576_2513_2974 | 153 |
| 622 | 3300034820 | Ga0373959_0018902 | Ga0373959_0018902_177_638 | 153 |
| 623 | 3300034957 | Ga0373938_0008030 | Ga0373938_0008030_169_630 | 153 |
| 624 | 3300035083 | Ga0373926_0010362 | Ga0373926_0010362_43_504 | 153 |
| 625 | 3300035084 | Ga0373928_0000100 | Ga0373928_0000100_12467_12928 | 153 |
| 626 | 3300035084 | Ga0373928_0010483 | Ga0373928_0010483_1129_1590 | 153 |
| 627 | 3300035086 | Ga0373934_0015086 | Ga0373934_0015086_1564_2025 | 153 |
| 628 | 3300035088 | Ga0373940_0000073 | Ga0373940_0000073_8393_8854 | 153 |
| 629 | 3300035088 | Ga0373940_0039370 | Ga0373940_0039370_709_1170 | 153 |
| 630 | 3300035089 | Ga0373944_0008786 | Ga0373944_0008786_1401_1862 | 153 |
| 631 | 3300035090 | Ga0373949_0007976 | Ga0373949_0007976_1699_2160 | 153 |
| 632 | 3300035091 | Ga0373951_0000189 | Ga0373951_0000189_971_1432 | 153 |
| 633 | 3300035091 | Ga0373951_0053331 | Ga0373951_0053331_468_929 | 153 |
| 634 | 3300035092 | Ga0373952_0002023 | Ga0373952_0002023_2063_2524 | 153 |
| 635 | 3300035092 | Ga0373952_0003463 | Ga0373952_0003463_1439_1900 | 153 |
| 636 | 3300035112 | Ga0373932_0001729 | Ga0373932_0001729_5187_5648 | 153 |
| 637 | 3300035112 | Ga0373932_0041963 | Ga0373932_0041963_533_994 | 153 |
| 638 | 3300035114 | Ga0373939_0002882 | Ga0373939_0002882_447_911 | 153 |
| 639 | 3300035114 | Ga0373939_0023616 | Ga0373939_0023616_425_886 | 153 |
| 640 | 3300035114 | Ga0373939_0025973 | Ga0373939_0025973_436_897 | 153 |
| 641 | 3300035114 | Ga0373939_0128354 | Ga0373939_0128354_42_503 | 153 |
| 642 | 3300035115 | Ga0373941_0000363 | Ga0373941_0000363_1184_1645 | 153 |
| 643 | 3300035115 | Ga0373941_0068324 | Ga0373941_0068324_542_1003 | 153 |
| 644 | 3300035116 | Ga0373945_0023425 | Ga0373945_0023425_381_842 | 153 |
| 645 | 3300035117 | Ga0373953_0014530 | Ga0373953_0014530_1773_2234 | 153 |
| 646 | 3300035117 | Ga0373953_0025742 | Ga0373953_0025742_1385_1846 | 153 |
| 647 | 3300035117 | Ga0373953_0034276 | Ga0373953_0034276_813_1274 | 153 |
| 648 | 3300035118 | Ga0373954_0009564 | Ga0373954_0009564_2141_2602 | 153 |
| 649 | 3300035118 | Ga0373954_0036308 | Ga0373954_0036308_891_1352 | 153 |
| 650 | 3300035118 | Ga0373954_0057838 | Ga0373954_0057838_874_1335 | 153 |
| 651 | 3300035119 | Ga0373956_0016343 | Ga0373956_0016343_1857_2318 | 153 |
| 652 | 3300035119 | Ga0373956_0026913 | Ga0373956_0026913_1463_1924 | 153 |
| 653 | 3300035119 | Ga0373956_0034039 | Ga0373956_0034039_302_766 | 153 |
| 654 | 3300035119 | Ga0373956_0340127 | Ga0373956_0340127_126_587 | 153 |
| 655 | 3300035120 | Ga0373957_0013580 | Ga0373957_0013580_2048_2509 | 153 |
| 656 | 3300035120 | Ga0373957_0049474 | Ga0373957_0049474_12_473 | 153 |
| 657 | 3300035121 | Ga0373960_0005418 | Ga0373960_0005418_1278_1739 | 153 |
| 658 | 3300035121 | Ga0373960_0037620 | Ga0373960_0037620_480_941 | 153 |
| 659 | 3300035170 | Ga0373943_0011131 | Ga0373943_0011131_2793_3254 | 153 |
| 660 | 3300035171 | Ga0373946_0051342 | Ga0373946_0051342_401_862 | 153 |
| 661 | 3300035172 | Ga0373955_0000249 | Ga0373955_0000249_16608_17069 | 153 |
| 662 | 3300035172 | Ga0373955_0002898 | Ga0373955_0002898_5117_5578 | 153 |
| 663 | 3300035172 | Ga0373955_0022122 | Ga0373955_0022122_1122_1583 | 153 |
| 664 | 3300035172 | Ga0373955_0026958 | Ga0373955_0026958_664_1125 | 153 |
| 665 | 3300035172 | Ga0373955_0106574 | Ga0373955_0106574_315_779 | 153 |
| 666 | 3300035207 | Ga0373942_0001810 | Ga0373942_0001810_1228_1689 | 153 |
| 667 | 3300035207 | Ga0373942_0049618 | Ga0373942_0049618_389_850 | 153 |
| 668 | 3300035241 | Ga0373961_0000633 | Ga0373961_0000633_745_1206 | 153 |
| 669 | 3300035241 | Ga0373961_0078130 | Ga0373961_0078130_350_811 | 153 |
| 670 | 3300035241 | Ga0373961_0130379 | Ga0373961_0130379_283_744 | 153 |
| 671 | 3300035242 | Ga0373962_0000689 | Ga0373962_0000689_1383_1844 | 153 |
| 672 | 3300035242 | Ga0373962_0004675 | Ga0373962_0004675_389_850 | 153 |
| 673 | 3300035410 | Ga0373924_0009601 | Ga0373924_0009601_2638_3099 | 153 |
| 674 | 3300035410 | Ga0373924_0053480 | Ga0373924_0053480_781_1242 | 153 |
| 675 | 3300035691 | Ga0373931_0002415 | Ga0373931_0002415_5376_5837 | 153 |
| 676 | 3300035691 | Ga0373931_0023900 | Ga0373931_0023900_153_614 | 153 |
| 677 | 3300035691 | Ga0373931_0193365 | Ga0373931_0193365_370_831 | 153 |
| 678 | 3300035692 | Ga0373935_0141903 | Ga0373935_0141903_393_854 | 153 |
| 679 | 3300035692 | Ga0373935_0261213 | Ga0373935_0261213_33_494 | 153 |
| 680 | 3300035692 | Ga0373935_0430927 | Ga0373935_0430927_67_528 | 153 |
| 681 | 3300035695 | Ga0373927_0871100 | Ga0373927_0871100_96_557 | 153 |
| 682 | 3300035724 | Ga0373933_0002548 | Ga0373933_0002548_3116_3577 | 153 |
| 683 | 3300035724 | Ga0373933_0015532 | Ga0373933_0015532_826_1287 | 153 |
| 684 | 3300035724 | Ga0373933_0029959 | Ga0373933_0029959_2566_3027 | 153 |
| 685 | 3300036401 | Ga0373937_0003343 | Ga0373937_0003343_1702_2163 | 153 |
| 686 | 3300036401 | Ga0373937_0005946 | Ga0373937_0005946_5966_6430 | 153 |
| 687 | 3300036401 | Ga0373937_0006652 | Ga0373937_0006652_9087_9548 | 153 |
| 688 | 3300036401 | Ga0373937_0032148 | Ga0373937_0032148_279_740 | 153 |
| 689 | 3300036401 | Ga0373937_0375534 | Ga0373937_0375534_468_929 | 153 |
| 690 | 3300037068 | Ga0373925_0010323 | Ga0373925_0010323_5426_5887 | 153 |
| 691 | 3300037068 | Ga0373925_0291256 | Ga0373925_0291256_634_1095 | 153 |
| 692 | 3300038698 | Ga0242419_001940 | Ga0242419_001940_245_706 | 153 |
| 693 | 3300038996 | Ga0242420_017826 | Ga0242420_017826_698_1159 | 153 |
| 694 | 3300039437 | Ga0436365_0240412 | Ga0436365_0240412_3616_4080 | 153 |
| 695 | 3300039453 | Ga0436362_1251783 | Ga0436362_1251783_203_667 | 153 |
| 696 | 3300042001 | Ga0439441_008331 | Ga0439441_008331_77_538 | 153 |
| 697 | 3300042005 | Ga0439448_0015191 | Ga0439448_0015191_1559_2020 | 153 |
| 698 | 3300042012 | Ga0439455_0010382 | Ga0439455_0010382_1301_1762 | 153 |
| 699 | 3300042016 | Ga0439463_008538 | Ga0439463_008538_331_792 | 153 |
| 700 | 3300042157 | Ga0439458_0181699 | Ga0439458_0181699_61_522 | 153 |
| 701 | 3300042461 | Ga0439460_0007591 | Ga0439460_0007591_291_752 | 153 |
| 702 | 3300042530 | Ga0450916_069745 | Ga0450916_069745_76_537 | 153 |
| 703 | 3300044712 | Ga0453684_0081063 | Ga0453684_0081063_1181_1642 | 153 |
| 704 | 3300045051 | Ga0451576_0023984 | Ga0451576_0023984_3009_3470 | 153 |
| 705 | 3300045051 | Ga0451576_0843923 | Ga0451576_0843923_350_811 | 153 |
| 706 | 3300046454 | Ga0495592_0000604 | Ga0495592_0000604_10482_10943 | 153 |
| 707 | 3300046459 | Ga0495629_0167300 | Ga0495629_0167300_1034_1495 | 153 |
| 708 | 3300046459 | Ga0495629_0435814 | Ga0495629_0435814_253_714 | 153 |
| 709 | 3300046461 | Ga0495641_0040433 | Ga0495641_0040433_512_973 | 153 |
| 710 | 3300046462 | Ga0495651_0006587 | Ga0495651_0006587_7930_8391 | 153 |
| 711 | 3300046462 | Ga0495651_0557123 | Ga0495651_0557123_122_583 | 153 |
| 712 | 3300046463 | Ga0495653_0004982 | Ga0495653_0004982_658_1119 | 153 |
| 713 | 3300046463 | Ga0495653_0198794 | Ga0495653_0198794_288_749 | 153 |
| 714 | 3300046463 | Ga0495653_0776423 | Ga0495653_0776423_58_519 | 153 |
| 715 | 3300046472 | Ga0495580_0271808 | Ga0495580_0271808_191_652 | 153 |
| 716 | 3300046473 | Ga0495582_0052609 | Ga0495582_0052609_336_797 | 153 |
| 717 | 3300046475 | Ga0495639_0106598 | Ga0495639_0106598_100_561 | 153 |
| 718 | 3300046477 | Ga0495664_0009456 | Ga0495664_0009456_120_581 | 153 |
| 719 | 3300046477 | Ga0495664_0058441 | Ga0495664_0058441_1621_2082 | 153 |
| 720 | 3300046477 | Ga0495664_0302996 | Ga0495664_0302996_276_737 | 153 |
| 721 | 3300046511 | Ga0495608_0011300 | Ga0495608_0011300_2076_2537 | 153 |
| 722 | 3300046514 | Ga0495618_0008660 | Ga0495618_0008660_5428_5889 | 153 |
| 723 | 3300046514 | Ga0495618_0056738 | Ga0495618_0056738_354_815 | 153 |
| 724 | 3300046514 | Ga0495618_0079083 | Ga0495618_0079083_507_968 | 153 |
| 725 | 3300046514 | Ga0495618_0144176 | Ga0495618_0144176_919_1380 | 153 |
| 726 | 3300046516 | Ga0495628_0076911 | Ga0495628_0076911_1964_2425 | 153 |
| 727 | 3300046516 | Ga0495628_0295278 | Ga0495628_0295278_469_930 | 153 |
| 728 | 3300046517 | Ga0495630_0165508 | Ga0495630_0165508_608_1069 | 153 |
| 729 | 3300046517 | Ga0495630_0532319 | Ga0495630_0532319_92_553 | 153 |
| 730 | 3300046526 | Ga0495666_0167768 | Ga0495666_0167768_47_508 | 153 |
| 731 | 3300046529 | Ga0495652_0011134 | Ga0495652_0011134_1125_1586 | 153 |
| 732 | 3300046529 | Ga0495652_0081886 | Ga0495652_0081886_975_1436 | 153 |
| 733 | 3300046529 | Ga0495652_0408858 | Ga0495652_0408858_233_694 | 153 |
| 734 | 3300046529 | Ga0495652_0463006 | Ga0495652_0463006_103_564 | 153 |
| 735 | 3300046531 | Ga0495665_0047369 | Ga0495665_0047369_1163_1624 | 153 |
| 736 | 3300046533 | Ga0495640_0063961 | Ga0495640_0063961_840_1301 | 153 |
| 737 | 3300046533 | Ga0495640_0395095 | Ga0495640_0395095_224_685 | 153 |
| 738 | 3300046533 | Ga0495640_0424261 | Ga0495640_0424261_32_493 | 153 |
| 739 | 3300046533 | Ga0495640_0756063 | Ga0495640_0756063_80_541 | 153 |
| 740 | 3300046535 | Ga0495586_0007329 | Ga0495586_0007329_156_617 | 153 |
| 741 | 3300046535 | Ga0495586_0698286 | Ga0495586_0698286_75_536 | 153 |
| 742 | 3300046536 | Ga0495587_0003722 | Ga0495587_0003722_6397_6858 | 153 |
| 743 | 3300046536 | Ga0495587_0031441 | Ga0495587_0031441_1608_2069 | 153 |
| 744 | 3300046536 | Ga0495587_0351648 | Ga0495587_0351648_251_712 | 153 |
| 745 | 3300046543 | Ga0495645_0002643 | Ga0495645_0002643_8076_8537 | 153 |
| 746 | 3300046543 | Ga0495645_0005135 | Ga0495645_0005135_1245_1706 | 153 |
| 747 | 3300046543 | Ga0495645_0686841 | Ga0495645_0686841_23_484 | 153 |
| 748 | 3300046559 | Ga0495667_0014666 | Ga0495667_0014666_1551_2012 | 153 |
| 749 | 3300046559 | Ga0495667_0015973 | Ga0495667_0015973_3130_3591 | 153 |
| 750 | 3300046559 | Ga0495667_0646138 | Ga0495667_0646138_139_603 | 153 |
| 751 | 3300046642 | Ga0495634_0081330 | Ga0495634_0081330_967_1428 | 153 |
| 752 | 3300046642 | Ga0495634_0330982 | Ga0495634_0330982_55_516 | 153 |
| 753 | 3300046663 | Ga0495635_0014791 | Ga0495635_0014791_2140_2601 | 153 |
| 754 | 3300046663 | Ga0495635_0148863 | Ga0495635_0148863_616_1077 | 153 |
| 755 | 3300046663 | Ga0495635_0238116 | Ga0495635_0238116_161_622 | 153 |
| 756 | 3300046675 | Ga0495657_0266273 | Ga0495657_0266273_493_954 | 153 |
| 757 | 3300046675 | Ga0495657_0325479 | Ga0495657_0325479_213_674 | 153 |
| 758 | 3300046678 | Ga0495599_0006067 | Ga0495599_0006067_4467_4928 | 153 |
| 759 | 3300046679 | Ga0495623_0005084 | Ga0495623_0005084_676_1137 | 153 |
| 760 | 3300046680 | Ga0495646_0001510 | Ga0495646_0001510_12558_13019 | 153 |
| 761 | 3300046680 | Ga0495646_0181357 | Ga0495646_0181357_164_625 | 153 |
| 762 | 3300046684 | Ga0495669_0108929 | Ga0495669_0108929_337_798 | 153 |
| 763 | 3300046689 | Ga0495613_0175258 | Ga0495613_0175258_606_1067 | 153 |
| 764 | 3300046689 | Ga0495613_0380363 | Ga0495613_0380363_339_800 | 153 |
| 765 | 3300046690 | Ga0495624_0150794 | Ga0495624_0150794_749_1210 | 153 |
| 766 | 3300046690 | Ga0495624_0487288 | Ga0495624_0487288_22_483 | 153 |
| 767 | 3300046809 | Ga0495600_0002242 | Ga0495600_0002242_7384_7845 | 153 |
| 768 | 3300046809 | Ga0495600_0007130 | Ga0495600_0007130_6291_6752 | 153 |
| 769 | 3300046809 | Ga0495600_0516478 | Ga0495600_0516478_234_695 | 153 |
| 770 | 3300047315 | Ga0495581_0379853 | Ga0495581_0379853_252_713 | 153 |
| 771 | 3300047315 | Ga0495581_0411699 | Ga0495581_0411699_62_523 | 153 |
| 772 | 3300047317 | Ga0495604_0000807 | Ga0495604_0000807_25004_25465 | 153 |
| 773 | 3300047317 | Ga0495604_0018346 | Ga0495604_0018346_4361_4822 | 153 |
| 774 | 3300047317 | Ga0495604_0032681 | Ga0495604_0032681_148_609 | 153 |
| 775 | 3300047319 | Ga0495674_0060527 | Ga0495674_0060527_241_702 | 153 |
| 776 | 3300047319 | Ga0495674_0109001 | Ga0495674_0109001_1636_2097 | 153 |
| 777 | 3300047319 | Ga0495674_0531030 | Ga0495674_0531030_124_585 | 153 |
| 778 | 3300047321 | Ga0495676_0283497 | Ga0495676_0283497_305_766 | 153 |
| 779 | 3300047321 | Ga0495676_0547610 | Ga0495676_0547610_209_670 | 153 |
| 780 | 3300047322 | Ga0495680_0026918 | Ga0495680_0026918_2607_3068 | 153 |
| 781 | 3300047322 | Ga0495680_0038199 | Ga0495680_0038199_1859_2320 | 153 |
| 782 | 3300047322 | Ga0495680_0100807 | Ga0495680_0100807_1120_1581 | 153 |
| 783 | 3300047322 | Ga0495680_0106631 | Ga0495680_0106631_202_663 | 153 |
| 784 | 3300047322 | Ga0495680_0330292 | Ga0495680_0330292_159_620 | 153 |
| 785 | 3300047444 | Ga0495675_0000700 | Ga0495675_0000700_499_960 | 153 |
| 786 | 3300047444 | Ga0495675_0010767 | Ga0495675_0010767_3813_4274 | 153 |
| 787 | 3300047444 | Ga0495675_0433279 | Ga0495675_0433279_211_672 | 153 |
| 788 | 3300047471 | Ga0495684_0255811 | Ga0495684_0255811_708_1169 | 153 |
| 789 | 3300047673 | Ga0495593_0056182 | Ga0495593_0056182_1506_1967 | 153 |
| 790 | 3300047673 | Ga0495593_0200878 | Ga0495593_0200878_122_583 | 153 |
| 791 | 3300048088 | Ga0495602_0001773 | Ga0495602_0001773_8456_8917 | 153 |
| 792 | 3300048088 | Ga0495602_0012708 | Ga0495602_0012708_175_636 | 153 |
| 793 | 3300048088 | Ga0495602_0054174 | Ga0495602_0054174_640_1101 | 153 |
| 794 | 3300048089 | Ga0495614_0430706 | Ga0495614_0430706_27_488 | 153 |
| 795 | 3300048903 | Ga0496100_0000839 | Ga0496100_0000839_8689_9150 | 153 |
| 796 | 3300048903 | Ga0496100_0161943 | Ga0496100_0161943_283_744 | 153 |
| 797 | 3300048903 | Ga0496100_0170130 | Ga0496100_0170130_753_1214 | 153 |
| 798 | 3300048903 | Ga0496100_0971509 | Ga0496100_0971509_15_476 | 153 |
| 799 | 3300048904 | Ga0496101_0000633 | Ga0496101_0000633_6059_6520 | 153 |
| 800 | 3300048904 | Ga0496101_0004102 | Ga0496101_0004102_2689_3150 | 153 |
| 801 | 3300048904 | Ga0496101_0192773 | Ga0496101_0192773_432_893 | 153 |
| 802 | 3300048904 | Ga0496101_0279530 | Ga0496101_0279530_785_1246 | 153 |
| 803 | 3300048904 | Ga0496101_0949479 | Ga0496101_0949479_50_511 | 153 |
| 804 | 3300048905 | Ga0496102_0002481 | Ga0496102_0002481_11543_12004 | 153 |
| 805 | 3300048905 | Ga0496102_0128171 | Ga0496102_0128171_40_501 | 153 |
| 806 | 3300048905 | Ga0496102_0149712 | Ga0496102_0149712_635_1096 | 153 |
| 807 | 3300048905 | Ga0496102_0488791 | Ga0496102_0488791_526_987 | 153 |
| 808 | 3300048905 | Ga0496102_1178696 | Ga0496102_1178696_78_539 | 153 |
| 809 | 3300048906 | Ga0496103_0000717 | Ga0496103_0000717_11884_12345 | 153 |
| 810 | 3300048906 | Ga0496103_0009959 | Ga0496103_0009959_4775_5236 | 153 |
| 811 | 3300048906 | Ga0496103_0632701 | Ga0496103_0632701_50_511 | 153 |
| 812 | 3300048907 | Ga0496104_0013489 | Ga0496104_0013489_2989_3450 | 153 |
| 813 | 3300048907 | Ga0496104_0081209 | Ga0496104_0081209_260_721 | 153 |
| 814 | 3300048907 | Ga0496104_0330060 | Ga0496104_0330060_454_915 | 153 |
| 815 | 3300048907 | Ga0496104_0425177 | Ga0496104_0425177_385_846 | 153 |
| 816 | 3300048908 | Ga0496105_0000950 | Ga0496105_0000950_6390_6851 | 153 |
| 817 | 3300048908 | Ga0496105_0080899 | Ga0496105_0080899_2181_2642 | 153 |
| 818 | 3300048908 | Ga0496105_0140839 | Ga0496105_0140839_1439_1900 | 153 |
| 819 | 3300048909 | Ga0496106_0002354 | Ga0496106_0002354_8720_9181 | 153 |
| 820 | 3300048909 | Ga0496106_0103947 | Ga0496106_0103947_134_595 | 153 |
| 821 | 3300048909 | Ga0496106_0140922 | Ga0496106_0140922_105_566 | 153 |
| 822 | 3300048909 | Ga0496106_0243951 | Ga0496106_0243951_420_881 | 153 |
| 823 | 3300048910 | Ga0496107_0001263 | Ga0496107_0001263_2992_3453 | 153 |
| 824 | 3300048910 | Ga0496107_0010575 | Ga0496107_0010575_71_532 | 153 |
| 825 | 3300048910 | Ga0496107_0076401 | Ga0496107_0076401_1167_1628 | 153 |
| 826 | 3300048910 | Ga0496107_0081726 | Ga0496107_0081726_1856_2317 | 153 |
| 827 | 3300048910 | Ga0496107_0133211 | Ga0496107_0133211_1028_1489 | 153 |
| 828 | 3300048911 | Ga0496108_0005842 | Ga0496108_0005842_4890_5351 | 153 |
| 829 | 3300048911 | Ga0496108_0014469 | Ga0496108_0014469_1121_1582 | 153 |
| 830 | 3300048911 | Ga0496108_0045694 | Ga0496108_0045694_2598_3059 | 153 |
| 831 | 3300048911 | Ga0496108_0072423 | Ga0496108_0072423_2349_2810 | 153 |
| 832 | 3300048911 | Ga0496108_0615737 | Ga0496108_0615737_42_503 | 153 |
| 833 | 3300048911 | Ga0496108_0844072 | Ga0496108_0844072_260_721 | 153 |
| 834 | 3300048912 | Ga0496109_0002017 | Ga0496109_0002017_11028_11489 | 153 |
| 835 | 3300048912 | Ga0496109_0064505 | Ga0496109_0064505_2770_3231 | 153 |
| 836 | 3300048912 | Ga0496109_0264743 | Ga0496109_0264743_331_792 | 153 |
| 837 | 3300048912 | Ga0496109_0420494 | Ga0496109_0420494_686_1147 | 153 |
| 838 | 3300048912 | Ga0496109_0797386 | Ga0496109_0797386_40_501 | 153 |
| 839 | 3300048913 | Ga0496110_0062959 | Ga0496110_0062959_14_475 | 153 |
| 840 | 3300048913 | Ga0496110_0824306 | Ga0496110_0824306_21_482 | 153 |
| 841 | 3300048914 | Ga0496111_0047606 | Ga0496111_0047606_2535_2996 | 153 |
| 842 | 3300048914 | Ga0496111_0126152 | Ga0496111_0126152_620_1081 | 153 |
| 843 | 3300048915 | Ga0496112_0011955 | Ga0496112_0011955_4229_4690 | 153 |
| 844 | 3300048915 | Ga0496112_0063884 | Ga0496112_0063884_569_1030 | 153 |
| 845 | 3300048915 | Ga0496112_0182295 | Ga0496112_0182295_53_514 | 153 |
| 846 | 3300048915 | Ga0496112_0381482 | Ga0496112_0381482_837_1298 | 153 |
| 847 | 3300048916 | Ga0496113_0002233 | Ga0496113_0002233_5663_6124 | 153 |
| 848 | 3300048916 | Ga0496113_0029827 | Ga0496113_0029827_619_1080 | 153 |
| 849 | 3300048916 | Ga0496113_0182856 | Ga0496113_0182856_589_1050 | 153 |
| 850 | 3300048917 | Ga0496114_0068146 | Ga0496114_0068146_686_1147 | 153 |
| 851 | 3300048917 | Ga0496114_0316138 | Ga0496114_0316138_647_1108 | 153 |
| 852 | 3300048918 | Ga0496115_0013377 | Ga0496115_0013377_1243_1704 | 153 |
| 853 | 3300048918 | Ga0496115_0173982 | Ga0496115_0173982_217_678 | 153 |
| 854 | 3300048918 | Ga0496115_0259085 | Ga0496115_0259085_123_584 | 153 |
| 855 | 3300049568 | Ga0501031_0001817 | Ga0501031_0001817_4196_4660 | 153 |
| 856 | 3300049569 | Ga0501032_0014494 | Ga0501032_0014494_5055_5519 | 153 |
| 857 | 3300049569 | Ga0501032_0138065 | Ga0501032_0138065_430_894 | 153 |
| 858 | 3300049570 | Ga0501033_0014506 | Ga0501033_0014506_366_830 | 153 |
| 859 | 3300049570 | Ga0501033_0069790 | Ga0501033_0069790_296_760 | 153 |
| 860 | 3300049571 | Ga0501034_0021775 | Ga0501034_0021775_4960_5427 | 153 |
| 861 | 3300049571 | Ga0501034_0311509 | Ga0501034_0311509_694_1158 | 153 |
| 862 | 3300049571 | Ga0501034_1010191 | Ga0501034_1010191_218_682 | 153 |
| 863 | 3300049572 | Ga0501036_0019391 | Ga0501036_0019391_5135_5599 | 153 |
| 864 | 3300049572 | Ga0501036_0202693 | Ga0501036_0202693_987_1451 | 153 |
| 865 | 3300049572 | Ga0501036_0386489 | Ga0501036_0386489_101_568 | 153 |
| 866 | 3300049574 | Ga0501038_0101807 | Ga0501038_0101807_1156_1620 | 153 |
| 867 | 3300049574 | Ga0501038_0105053 | Ga0501038_0105053_298_762 | 153 |
| 868 | 3300049579 | Ga0501043_0218212 | Ga0501043_0218212_690_1154 | 153 |
| 869 | 3300049579 | Ga0501043_0498564 | Ga0501043_0498564_116_580 | 153 |
| 870 | 3300049579 | Ga0501043_0588455 | Ga0501043_0588455_293_760 | 153 |
| 871 | 3300049581 | Ga0501047_0043849 | Ga0501047_0043849_1469_1936 | 153 |
| 872 | 3300049582 | Ga0501048_0049894 | Ga0501048_0049894_621_1091 | 153 |
| 873 | 3300049582 | Ga0501048_1339513 | Ga0501048_1339513_25_495 | 153 |
| 874 | 3300049585 | Ga0501069_0522343 | Ga0501069_0522343_212_679 | 153 |
| 875 | 3300049586 | Ga0501070_0106381 | Ga0501070_0106381_465_947 | 153 |
| 876 | 3300049586 | Ga0501070_0478792 | Ga0501070_0478792_237_701 | 153 |
| 877 | 3300049586 | Ga0501070_0582403 | Ga0501070_0582403_40_504 | 153 |
| 878 | 3300049587 | Ga0501071_0576804 | Ga0501071_0576804_367_828 | 153 |
| 879 | 3300049587 | Ga0501071_0757097 | Ga0501071_0757097_167_631 | 153 |
| 880 | 3300049587 | Ga0501071_0975056 | Ga0501071_0975056_144_608 | 153 |
| 881 | 3300049588 | Ga0501072_0114497 | Ga0501072_0114497_802_1269 | 153 |
| 882 | 3300049588 | Ga0501072_0367395 | Ga0501072_0367395_221_682 | 153 |
| 883 | 3300049589 | Ga0501073_0028170 | Ga0501073_0028170_2107_2574 | 153 |
| 884 | 3300049592 | Ga0501076_0022574 | Ga0501076_0022574_2072_2533 | 153 |
| 885 | 3300049744 | Ga0501083_0015623 | Ga0501083_0015623_2060_2527 | 153 |
| 886 | 3300049744 | Ga0501083_0642080 | Ga0501083_0642080_99_560 | 153 |
| 887 | 3300049822 | Ga0501035_0021027 | Ga0501035_0021027_5015_5479 | 153 |
| 888 | 3300049823 | Ga0501044_0131262 | Ga0501044_0131262_481_948 | 153 |
| 889 | 3300049823 | Ga0501044_0151201 | Ga0501044_0151201_218_682 | 153 |
| 890 | 3300049823 | Ga0501044_0220640 | Ga0501044_0220640_475_939 | 153 |
| 891 | 3300049823 | Ga0501044_1363734 | Ga0501044_1363734_49_510 | 153 |
| 892 | 3300050494 | nmdc:mga06z11_2876_c1 | nmdc:mga06z11_2876_c1_1885_2346 | 153 |
| 893 | 3300050494 | nmdc:mga06z11_307728_c1 | nmdc:mga06z11_307728_c1_23_484 | 153 |
| 894 | 3300050494 | nmdc:mga06z11_928495_c1 | nmdc:mga06z11_928495_c1_17_478 | 153 |
| 895 | 3300050496 | nmdc:mga07m45_16715_c1 | nmdc:mga07m45_16715_c1_1185_1646 | 153 |
| 896 | 3300050496 | nmdc:mga07m45_71480_c1 | nmdc:mga07m45_71480_c1_171_632 | 153 |
| 897 | 3300050508 | nmdc:mga09592_489504_c1 | nmdc:mga09592_489504_c1_104_565 | 153 |
| 898 | 3300050511 | nmdc:mga08y16_22355_c1 | nmdc:mga08y16_22355_c1_1319_1780 | 153 |
| 899 | 3300050511 | nmdc:mga08y16_22831_c1 | nmdc:mga08y16_22831_c1_4895_5356 | 153 |
| 900 | 3300050512 | nmdc:mga0n895_5206_c1 | nmdc:mga0n895_5206_c1_5846_6307 | 153 |
| 901 | 3300050512 | nmdc:mga0n895_754317_c1 | nmdc:mga0n895_754317_c1_97_558 | 153 |
| 902 | 3300050512 | nmdc:mga0n895_999538_c1 | nmdc:mga0n895_999538_c1_100_561 | 153 |
| 903 | 3300050513 | nmdc:mga0rr50_158506_c1 | nmdc:mga0rr50_158506_c1_1070_1531 | 153 |
| 904 | 3300050513 | nmdc:mga0rr50_223325_c1 | nmdc:mga0rr50_223325_c1_254_715 | 153 |
| 905 | 3300050513 | nmdc:mga0rr50_312938_c1 | nmdc:mga0rr50_312938_c1_85_546 | 153 |
| 906 | 3300050514 | nmdc:mga08x19_54072_c1 | nmdc:mga08x19_54072_c1_907_1368 | 153 |
| 907 | 3300050515 | nmdc:mga0a205_13129_c1 | nmdc:mga0a205_13129_c1_2412_2873 | 153 |
| 908 | 3300050515 | nmdc:mga0a205_98453_c1 | nmdc:mga0a205_98453_c1_147_608 | 153 |
| 909 | 3300053077 | Ga0495601_0000233 | Ga0495601_0000233_5282_5743 | 153 |
| 910 | 3300053077 | Ga0495601_0006401 | Ga0495601_0006401_4303_4764 | 153 |
| 911 | 3300053077 | Ga0495601_0034773 | Ga0495601_0034773_1555_2016 | 153 |
| 912 | 3300053077 | Ga0495601_0037667 | Ga0495601_0037667_2107_2568 | 153 |
| 913 | 3300053077 | Ga0495601_0238201 | Ga0495601_0238201_147_608 | 153 |
| 914 | 3300053077 | Ga0495601_0255778 | Ga0495601_0255778_227_688 | 153 |
| 915 | 3300053078 | Ga0495612_0000533 | Ga0495612_0000533_7617_8078 | 153 |
| 916 | 3300053078 | Ga0495612_0016648 | Ga0495612_0016648_1992_2453 | 153 |
| 917 | 3300053078 | Ga0495612_0035482 | Ga0495612_0035482_100_561 | 153 |
| 918 | 3300053084 | Ga0495595_0000360 | Ga0495595_0000360_9567_10028 | 153 |
| 919 | 3300053084 | Ga0495595_0008907 | Ga0495595_0008907_3110_3571 | 153 |
| 920 | 3300053084 | Ga0495595_0011483 | Ga0495595_0011483_132_593 | 153 |
| 921 | 3300053084 | Ga0495595_0066145 | Ga0495595_0066145_332_796 | 153 |
| 922 | 3300053085 | Ga0495619_0001179 | Ga0495619_0001179_538_999 | 153 |
| 923 | 3300053085 | Ga0495619_0002698 | Ga0495619_0002698_3502_3963 | 153 |
| 924 | 3300053085 | Ga0495619_0007775 | Ga0495619_0007775_2402_2863 | 153 |
| 925 | 3300053085 | Ga0495619_0033967 | Ga0495619_0033967_1636_2097 | 153 |
| 926 | 3300053085 | Ga0495619_0291014 | Ga0495619_0291014_244_705 | 153 |
| 927 | 3300053087 | Ga0500643_005032 | Ga0500643_005032_5284_5748 | 153 |
| 928 | 3300053087 | Ga0500643_125844 | Ga0500643_125844_159_626 | 153 |
| 929 | 3300053088 | Ga0500644_0001907 | Ga0500644_0001907_1682_2146 | 153 |
| 930 | 3300053093 | Ga0500651_0416824 | Ga0500651_0416824_67_531 | 153 |
| 931 | 3300053096 | Ga0500641_0001278 | Ga0500641_0001278_3872_4336 | 153 |
| 932 | 3300053119 | Ga0500595_000003 | Ga0500595_000003_4874_5338 | 153 |
| 933 | 3300053131 | Ga0500652_065133 | Ga0500652_065133_778_1242 | 153 |
| 934 | 3300053142 | Ga0500577_0228948 | Ga0500577_0228948_227_691 | 153 |
| 935 | 3300053153 | Ga0500616_0000002 | Ga0500616_0000002_1202607_1203071 | 153 |
| 936 | 3300053730 | Ga0500645_001358 | Ga0500645_001358_8402_8866 | 153 |
| 937 | 3300054114 | Ga0501084_0554597 | Ga0501084_0554597_157_618 | 153 |
| 938 | 3300060353 | Ga0501082_0044600 | Ga0501082_0044600_1437_1904 | 153 |
| 939 | 3300061734 | Ga0530510_0753301 | Ga0530510_0753301_22_483 | 153 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4jpb-assembly1.cif.gz_W | the structure of a ternary complex between chea domains p4 and p5 with chew and with an unzipped fragment of tm14, a chemoreceptor analog from thermotoga maritima. | 0.9147 | 8 | 143 |
| 3ja6-assembly1.cif.gz_F | cryo-electron tomography and all-atom molecular dynamics simulations reveal a novel kinase conformational switch in bacterial chemotaxis signaling | 0.9002 | 8 | 143 |
| 2qdl-assembly2.cif.gz_B | crystal structure of scaffolding protein ttchew from thermoanaerobacter tengcongensis | 0.8989 | 10 | 147 |
| 2qdl-assembly1.cif.gz_A | crystal structure of scaffolding protein ttchew from thermoanaerobacter tengcongensis | 0.8936 | 10 | 140 |
| 8c5v-assembly1.cif.gz_H | chemotaxis core signalling unit from e protein lysed e. coli cells | 0.8819 | 10 | 144 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2ch4W02 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 | 0.8898 | 29 | 96 | 2.40.50.180 |
| 2qdlB02 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 | 0.8818 | 30 | 96 | 2.40.50.180 |
| af_P0A964_36_100_2.40.50.180 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 | 0.8682 | 29 | 92 | 2.40.50.180 |
| af_P0A964_36_100_2.40.50.180 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 | 0.8445 | 29 | 92 | 2.40.50.180 |
| 1b3qA04 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 | 0.8157 | 30 | 95 | 2.40.50.180 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A327JSZ2-F1-model_v4 | Chemotaxis protein CheW | 0.9838 | 3 | 144 |
GO:0005829
GO:0006935 GO:0007165 |
| AF-A0A212IYY1-F1-model_v4 | CheW protein | 0.9799 | 2 | 144 |
GO:0005829
GO:0006935 GO:0007165 |
| AF-A0A522A6C7-F1-model_v4 | Chemotaxis protein CheW | 0.9785 | 13 | 145 |
GO:0005829
GO:0006935 GO:0007165 |
| AF-A0A317FC28-F1-model_v4 | Chemotaxis protein CheW | 0.9783 | 1 | 145 |
GO:0005829
GO:0006935 GO:0007165 |
| AF-A0A0P7VGF4-F1-model_v4 | Chemotaxis signal relay system purine-binding protiein CheW | 0.9766 | 5 | 144 |
GO:0005829
GO:0006935 GO:0007165 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar