F486264
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 938 | 511 | 867 | 245 |
Family's Representative Sequence
| Representative Sequence | 3300049570|Ga0501033_0081015|Ga0501033_0081015_1032_1895 |
| Length | 287 |
| Sequence | MAVRLRCRREIRLGHLRRLIEGALRRVRVARYGEAMATVDLNCDLGEGFGAWTIGDDDALLELVTSANVACGFHAGDPQIMLETCRLAAERGVAIGAHVAYRDLHGFGRRPMPVTPGELFADVVYQLGALRAAASAAGARVSYVKPHGALYNVAVRDAAQADAVARACAAVDPGLALLALPGSELLRAASAHGLAPIAETFADRAFRPDGTLVPRSQPGSVLHDPDEIAARVVRLVIEGRVAAIDGSEIAVDARSVCVHGDTPDAVAIAARVRAELTAAGVELRAFV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 3 | 2511231221 | Azospirillum lipoferum 4B | Isolate | Rhizosphere |
| 4 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 5 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 6 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 7 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 8 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 9 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 10 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 11 | 2643221670 | Streptomyces sp. Root431 | Isolate | Unclassified |
| 12 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 13 | 2643221690 | Cellulomonas sp. Root485 | Isolate | Unclassified |
| 14 | 2643221694 | Cellulomonas sp. Root137 | Isolate | Unclassified |
| 15 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 16 | 2643221722 | Cellulomonas sp. Root930 | Isolate | Unclassified |
| 17 | 2767802112 | Streptomyces avicenniae NRRL B-24776 | Isolate | Rhizosphere |
| 18 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 19 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 20 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 21 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 22 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 23 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 24 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 25 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 26 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 27 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 28 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 29 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 30 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 31 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 32 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 33 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 34 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 35 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 36 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 37 | 2884994152 | Cellulomonas sp. H30R-01 | Isolate | Rhizosphere |
| 38 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 39 | 2897803580 | Azospirillum doebereinerae GSF71 | Isolate | Unclassified |
| 40 | 2899275550 | Paracoccus hibiscisoli CCTCC AB2016182 | Isolate | Rhizosphere |
| 41 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 42 | 2904504865 | Serratia marcescens 1822 | Isolate | Unclassified |
| 43 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 44 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 45 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 46 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 47 | 2917736166 | Amycolatopsis dendrobii DR6-1 | Isolate | Unclassified |
| 48 | 2919506607 | Acinetobacter sp. 3657 | Isolate | Unclassified |
| 49 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 50 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 51 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 52 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 53 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 54 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 55 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 56 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 57 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 58 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 59 | 2984568884 | Acinetobacter baylyi SORGH_AS893 | Isolate | Aerial Root |
| 60 | 3001889506 | Janibacter sp. YIM B02568 | Isolate | Unclassified |
| 61 | 3006425503 | Streptomyces zingiberis PLAI1-29 | Isolate | Unclassified |
| 62 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 63 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 64 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 65 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 66 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 67 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 68 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 69 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 70 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 71 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 72 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 76 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 78 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 79 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 80 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 81 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 82 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 91 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 92 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 98 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 99 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 100 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 101 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 102 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 103 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 106 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 107 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 108 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 109 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 110 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 111 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 112 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 113 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 114 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 115 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 116 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 117 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 118 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 120 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 121 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 122 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 123 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 124 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 125 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 126 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 127 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 128 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 129 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 130 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 131 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 132 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 133 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 134 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 135 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 136 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 137 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 138 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 139 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 140 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 151 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 154 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 163 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 165 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 167 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 224 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 225 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 229 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 230 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 231 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 232 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 233 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 234 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 235 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 236 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 237 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 238 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 239 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 240 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 241 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 242 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 243 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 244 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 245 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 246 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 247 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 248 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 249 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 250 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 251 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 252 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 253 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 254 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 255 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 256 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 257 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 258 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 259 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 260 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 261 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 262 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 263 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 264 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 265 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 266 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 267 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 268 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 269 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 270 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 271 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 272 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 273 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 274 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 275 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 276 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 277 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 278 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 279 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 280 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 281 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 282 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 283 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 284 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 285 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 286 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 287 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 288 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 289 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 290 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 291 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 292 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 293 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 294 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 295 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 296 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 297 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 298 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 299 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 300 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 301 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 302 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 303 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 304 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 305 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 306 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 307 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 308 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 309 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 310 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 311 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 312 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 313 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 314 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 315 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 316 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 317 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 403 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 404 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 405 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 406 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 407 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 408 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 409 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 410 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 411 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 412 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 413 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 414 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 415 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 416 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 417 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 418 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 419 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 420 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 421 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 422 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 423 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 424 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 426 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 427 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 428 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 429 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 430 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 431 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 432 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 433 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 434 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 437 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 439 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 440 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 441 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 442 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 443 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 444 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 445 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 446 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 447 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 448 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 449 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 450 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 451 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 452 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 453 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 454 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 455 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 456 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 457 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 458 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 459 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 460 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 461 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 462 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 466 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 467 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 468 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 469 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 470 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 471 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 472 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 473 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 474 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 475 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 476 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 477 | 3300053113 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere | Metagenome | Endosphere |
| 478 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 479 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 480 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 481 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 482 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 483 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 484 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 485 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 486 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 487 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 488 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 489 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 490 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 491 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 492 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 493 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 494 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 495 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 496 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 497 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 498 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 499 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 500 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 501 | 640427133 | Stutzerimonas stutzeri A1501 | Isolate | Rhizosphere |
| 502 | 651053060 | Stutzerimonas stutzeri CMT.A.9 | Isolate | Rhizosphere |
| 503 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 504 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 505 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 506 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 507 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 508 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 509 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
| 510 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 511 | 8057160832 | Larsenimonas rhizosphaerae GH2-1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.11 |
| Metatranscriptomes | 0.32 |
| Isolates | 7.57 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.11 |
| Bulb | 0 |
| Endosphere | 8.96 |
| Nodule | 1.6 |
| Rhizoplane | 3.41 |
| Rhizosphere | 75.91 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.02 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_5111757 | 2162886012 | Bacteria | 1045 |
| 2 | JGI25151J46595_10000290 | 3300003187 | Bacteria | 56749 |
| 3 | JGI25151J46595_10000452 | 3300003187 | Bacteria | 39759 |
| 4 | JGI25406J46586_10000004 | 3300003203 | Bacteria | 149772 |
| 5 | JGI25406J46586_10020592 | 3300003203 | Bacteria | 2664 |
| 6 | JGI25153J46596_10005638 | 3300003215 | Bacteria | 6539 |
| 7 | rootH1_10018128 | 3300003316 | Bacteria | 14780 |
| 8 | rootL2_10033936 | 3300003322 | Bacteria | 7201 |
| 9 | JGI25160J50197_1010453 | 3300003354 | Bacteria | 3357 |
| 10 | Ga0006562J51391_1084840 | 3300003578 | Bacteria | 3460 |
| 11 | Ga0055538_1000078 | 3300003751 | Bacteria | 86114 |
| 12 | Ga0055532_1007244 | 3300003758 | Bacteria | 1438 |
| 13 | Ga0065714_10003968 | 3300005288 | Bacteria | 7942 |
| 14 | Ga0070658_10000776 | 3300005327 | Bacteria | 27421 |
| 15 | Ga0070658_10216466 | 3300005327 | Bacteria | 1619 |
| 16 | Ga0070676_10029865 | 3300005328 | Unclassified | 3103 |
| 17 | Ga0070683_100010912 | 3300005329 | Bacteria | 7823 |
| 18 | Ga0070683_100735749 | 3300005329 | Bacteria | 945 |
| 19 | Ga0070690_100178577 | 3300005330 | Bacteria | 1466 |
| 20 | Ga0070690_100361843 | 3300005330 | Bacteria | 1056 |
| 21 | Ga0070670_100143050 | 3300005331 | Bacteria | 2068 |
| 22 | Ga0070670_100304917 | 3300005331 | Bacteria | 1393 |
| 23 | Ga0070670_100462072 | 3300005331 | Bacteria | 1126 |
| 24 | Ga0068869_100250063 | 3300005334 | Bacteria | 1415 |
| 25 | Ga0070680_100011979 | 3300005336 | Bacteria | 6730 |
| 26 | Ga0070680_100036774 | 3300005336 | Bacteria | 3955 |
| 27 | Ga0070682_100063807 | 3300005337 | Bacteria | 2337 |
| 28 | Ga0068868_100061827 | 3300005338 | Unclassified | 2967 |
| 29 | Ga0070687_100039063 | 3300005343 | Bacteria | 2383 |
| 30 | Ga0070661_100105058 | 3300005344 | Bacteria | 2105 |
| 31 | Ga0070661_100198869 | 3300005344 | Bacteria | 1531 |
| 32 | Ga0070668_100123061 | 3300005347 | Bacteria | 2075 |
| 33 | Ga0070668_100219142 | 3300005347 | Bacteria | 1568 |
| 34 | Ga0070669_100086582 | 3300005353 | Bacteria | 2341 |
| 35 | Ga0070669_100254844 | 3300005353 | Bacteria | 1398 |
| 36 | Ga0070671_100064633 | 3300005355 | Bacteria | 3047 |
| 37 | Ga0070674_100013133 | 3300005356 | Bacteria | 5109 |
| 38 | Ga0070674_100160811 | 3300005356 | Unclassified | 1704 |
| 39 | Ga0070674_100164204 | 3300005356 | Bacteria | 1687 |
| 40 | Ga0070659_100087500 | 3300005366 | Bacteria | 2494 |
| 41 | Ga0070667_100724239 | 3300005367 | Bacteria | 921 |
| 42 | Ga0070714_100059899 | 3300005435 | Bacteria | 3266 |
| 43 | Ga0070714_100060184 | 3300005435 | Bacteria | 3259 |
| 44 | Ga0070713_100007399 | 3300005436 | Bacteria | 7704 |
| 45 | Ga0070713_100335831 | 3300005436 | Bacteria | 1399 |
| 46 | Ga0070710_10000700 | 3300005437 | Bacteria | 15951 |
| 47 | Ga0070701_10063609 | 3300005438 | Bacteria | 1953 |
| 48 | Ga0070701_10191800 | 3300005438 | Bacteria | 1203 |
| 49 | Ga0070700_100053995 | 3300005441 | Unclassified | 2509 |
| 50 | Ga0070663_100001689 | 3300005455 | Bacteria | 12257 |
| 51 | Ga0070663_100100056 | 3300005455 | Bacteria | 2162 |
| 52 | Ga0070678_100089913 | 3300005456 | Bacteria | 2351 |
| 53 | Ga0070662_100066983 | 3300005457 | Bacteria | 2636 |
| 54 | Ga0070662_100138823 | 3300005457 | Bacteria | 1881 |
| 55 | Ga0070662_100189766 | 3300005457 | Bacteria | 1624 |
| 56 | Ga0070662_100269236 | 3300005457 | Bacteria | 1375 |
| 57 | Ga0070662_100372651 | 3300005457 | Bacteria | 1174 |
| 58 | Ga0070681_10085409 | 3300005458 | Bacteria | 3108 |
| 59 | Ga0070681_10206222 | 3300005458 | Bacteria | 1883 |
| 60 | Ga0068867_100013927 | 3300005459 | Bacteria | 5692 |
| 61 | Ga0070679_100018059 | 3300005530 | Bacteria | 6836 |
| 62 | Ga0070684_100015276 | 3300005535 | Bacteria | 6248 |
| 63 | Ga0070684_100333307 | 3300005535 | Bacteria | 1394 |
| 64 | Ga0068853_100126244 | 3300005539 | Bacteria | 2285 |
| 65 | Ga0068853_100275185 | 3300005539 | Bacteria | 1551 |
| 66 | Ga0070686_100011330 | 3300005544 | Bacteria | 5056 |
| 67 | Ga0070696_100094253 | 3300005546 | Bacteria | 2136 |
| 68 | Ga0070696_100274669 | 3300005546 | Bacteria | 1283 |
| 69 | Ga0070665_100041123 | 3300005548 | Bacteria | 4646 |
| 70 | Ga0070665_100169556 | 3300005548 | Bacteria | 2184 |
| 71 | Ga0070665_100394545 | 3300005548 | Bacteria | 1391 |
| 72 | Ga0068855_100079887 | 3300005563 | Bacteria | 3792 |
| 73 | Ga0068855_100361771 | 3300005563 | Bacteria | 1596 |
| 74 | Ga0068854_100139147 | 3300005578 | Bacteria | 1861 |
| 75 | Ga0068854_100170182 | 3300005578 | Bacteria | 1695 |
| 76 | Ga0068854_100733481 | 3300005578 | Bacteria | 856 |
| 77 | Ga0068856_100001981 | 3300005614 | Bacteria | 21353 |
| 78 | Ga0068856_100746448 | 3300005614 | Bacteria | 999 |
| 79 | Ga0068852_100299550 | 3300005616 | Bacteria | 1556 |
| 80 | Ga0068866_10004618 | 3300005718 | Bacteria | 5647 |
| 81 | Ga0068866_10033488 | 3300005718 | Unclassified | 2494 |
| 82 | Ga0068861_100021041 | 3300005719 | Bacteria | 4685 |
| 83 | Ga0068861_100091331 | 3300005719 | Bacteria | 2404 |
| 84 | Ga0068861_100226373 | 3300005719 | Bacteria | 1583 |
| 85 | Ga0068861_100296045 | 3300005719 | Bacteria | 1399 |
| 86 | Ga0068863_100114888 | 3300005841 | Bacteria | 2564 |
| 87 | Ga0068858_100237967 | 3300005842 | Bacteria | 1727 |
| 88 | Ga0068858_100288269 | 3300005842 | Bacteria | 1564 |
| 89 | Ga0068860_100129848 | 3300005843 | Bacteria | 2417 |
| 90 | Ga0068860_100325553 | 3300005843 | Bacteria | 1509 |
| 91 | Ga0068860_100365588 | 3300005843 | Bacteria | 1422 |
| 92 | Ga0068862_100086716 | 3300005844 | Bacteria | 2722 |
| 93 | Ga0068862_100259672 | 3300005844 | Bacteria | 1585 |
| 94 | Ga0068862_100382985 | 3300005844 | Unclassified | 1312 |
| 95 | Ga0081455_10024373 | 3300005937 | Bacteria | 5604 |
| 96 | Ga0081455_10049743 | 3300005937 | Bacteria | 3611 |
| 97 | Ga0081455_10067919 | 3300005937 | Bacteria | 2969 |
| 98 | Ga0081540_1001654 | 3300005983 | Bacteria | 18964 |
| 99 | Ga0081540_1002242 | 3300005983 | Bacteria | 15915 |
| 100 | Ga0081540_1002357 | 3300005983 | Bacteria | 15438 |
| 101 | Ga0081540_1004805 | 3300005983 | Bacteria | 10181 |
| 102 | Ga0081540_1035212 | 3300005983 | Bacteria | 2688 |
| 103 | Ga0081540_1062046 | 3300005983 | Bacteria | 1778 |
| 104 | Ga0081539_10000080 | 3300005985 | Bacteria | 222745 |
| 105 | Ga0081539_10000366 | 3300005985 | Bacteria | 98762 |
| 106 | Ga0070717_10000850 | 3300006028 | Bacteria | 20235 |
| 107 | Ga0070717_10361128 | 3300006028 | Bacteria | 1300 |
| 108 | Ga0075365_10029915 | 3300006038 | Bacteria | 3484 |
| 109 | Ga0075365_10045983 | 3300006038 | Bacteria | 2866 |
| 110 | Ga0075365_10057240 | 3300006038 | Bacteria | 2593 |
| 111 | Ga0075365_10063980 | 3300006038 | Bacteria | 2463 |
| 112 | Ga0075365_10319331 | 3300006038 | Bacteria | 1094 |
| 113 | Ga0075368_10079589 | 3300006042 | Bacteria | 1332 |
| 114 | Ga0075364_10003253 | 3300006051 | Bacteria | 9197 |
| 115 | Ga0075364_10039785 | 3300006051 | Bacteria | 3048 |
| 116 | Ga0075364_10078219 | 3300006051 | Bacteria | 2184 |
| 117 | Ga0075364_10321114 | 3300006051 | Bacteria | 1054 |
| 118 | Ga0075432_10000367 | 3300006058 | Bacteria | 13018 |
| 119 | Ga0075432_10001438 | 3300006058 | Bacteria | 7767 |
| 120 | Ga0070712_100008065 | 3300006175 | Bacteria | 6608 |
| 121 | Ga0075362_10019548 | 3300006177 | Bacteria | 2818 |
| 122 | Ga0075362_10066772 | 3300006177 | Bacteria | 1635 |
| 123 | Ga0075367_10003283 | 3300006178 | Bacteria | 7666 |
| 124 | Ga0075367_10140894 | 3300006178 | Bacteria | 1493 |
| 125 | Ga0075369_10016597 | 3300006186 | Bacteria | 2974 |
| 126 | Ga0075370_10038370 | 3300006353 | Bacteria | 2695 |
| 127 | Ga0068871_100192267 | 3300006358 | Bacteria | 1758 |
| 128 | Ga0075428_100009319 | 3300006844 | Bacteria | 10887 |
| 129 | Ga0075430_100133963 | 3300006846 | Bacteria | 2065 |
| 130 | Ga0075430_100442087 | 3300006846 | Bacteria | 1073 |
| 131 | Ga0075431_100844292 | 3300006847 | Unclassified | 887 |
| 132 | Ga0075433_10004818 | 3300006852 | Bacteria | 10539 |
| 133 | Ga0075434_100007683 | 3300006871 | Bacteria | 9980 |
| 134 | Ga0075429_100014062 | 3300006880 | Bacteria | 6937 |
| 135 | Ga0068865_100009881 | 3300006881 | Bacteria | 5928 |
| 136 | Ga0068865_100036225 | 3300006881 | Unclassified | 3325 |
| 137 | Ga0068865_100101680 | 3300006881 | Bacteria | 2105 |
| 138 | Ga0068865_100148720 | 3300006881 | Bacteria | 1774 |
| 139 | Ga0075436_100029385 | 3300006914 | Bacteria | 3780 |
| 140 | Ga0099826_10143414 | 3300006948 | Bacteria | 1376 |
| 141 | Ga0075435_100002860 | 3300007076 | Bacteria | 11562 |
| 142 | Ga0075435_100247358 | 3300007076 | Bacteria | 1517 |
| 143 | Ga0099795_10082104 | 3300007788 | Bacteria | 1235 |
| 144 | Ga0105244_10000125 | 3300009036 | Bacteria | 78586 |
| 145 | Ga0105244_10021312 | 3300009036 | Bacteria | 3587 |
| 146 | Ga0105250_10000007 | 3300009092 | Bacteria | 355249 |
| 147 | Ga0105250_10000082 | 3300009092 | Bacteria | 82954 |
| 148 | Ga0105250_10175416 | 3300009092 | Bacteria | 898 |
| 149 | Ga0111539_10010908 | 3300009094 | Bacteria | 11437 |
| 150 | Ga0111539_10110632 | 3300009094 | Bacteria | 3223 |
| 151 | Ga0105245_10024804 | 3300009098 | Bacteria | 5268 |
| 152 | Ga0105245_10116651 | 3300009098 | Bacteria | 2489 |
| 153 | Ga0105245_10690417 | 3300009098 | Bacteria | 1053 |
| 154 | Ga0114129_10015367 | 3300009147 | Bacteria | 10893 |
| 155 | Ga0114129_10144631 | 3300009147 | Unclassified | 3258 |
| 156 | Ga0114129_10524983 | 3300009147 | Unclassified | 1543 |
| 157 | Ga0105243_10074411 | 3300009148 | Bacteria | 2755 |
| 158 | Ga0105243_10077812 | 3300009148 | Bacteria | 2699 |
| 159 | Ga0105243_10108545 | 3300009148 | Bacteria | 2316 |
| 160 | Ga0105243_10374442 | 3300009148 | Bacteria | 1315 |
| 161 | Ga0105241_10011484 | 3300009174 | Bacteria | 6492 |
| 162 | Ga0105241_10292487 | 3300009174 | Bacteria | 1395 |
| 163 | Ga0105237_10022833 | 3300009545 | Bacteria | 6417 |
| 164 | Ga0105237_10317216 | 3300009545 | Bacteria | 1562 |
| 165 | Ga0105238_10092613 | 3300009551 | Bacteria | 3010 |
| 166 | Ga0105238_10192548 | 3300009551 | Bacteria | 2015 |
| 167 | Ga0105238_10254646 | 3300009551 | Bacteria | 1734 |
| 168 | Ga0105238_10595616 | 3300009551 | Bacteria | 1113 |
| 169 | Ga0105249_10054067 | 3300009553 | Bacteria | 3671 |
| 170 | Ga0105249_10188211 | 3300009553 | Bacteria | 2013 |
| 171 | Ga0105249_10617704 | 3300009553 | Bacteria | 1140 |
| 172 | Ga0099796_10016663 | 3300010159 | Bacteria | 2174 |
| 173 | Ga0105239_10015107 | 3300010375 | Bacteria | 8561 |
| 174 | Ga0105239_10152156 | 3300010375 | Bacteria | 2582 |
| 175 | Ga0105239_10193695 | 3300010375 | Bacteria | 2276 |
| 176 | Ga0105239_10584221 | 3300010375 | Bacteria | 1274 |
| 177 | Ga0105246_10039933 | 3300011119 | Bacteria | 3164 |
| 178 | Ga0105246_10141199 | 3300011119 | Bacteria | 1811 |
| 179 | Ga0157314_1002520 | 3300012500 | Bacteria | 1267 |
| 180 | Ga0157370_10038272 | 3300013104 | Bacteria | 4640 |
| 181 | Ga0157370_10405659 | 3300013104 | Bacteria | 1254 |
| 182 | Ga0157369_10002377 | 3300013105 | Bacteria | 22613 |
| 183 | Ga0157369_10010836 | 3300013105 | Bacteria | 10384 |
| 184 | Ga0157369_10012075 | 3300013105 | Bacteria | 9809 |
| 185 | Ga0157369_10045795 | 3300013105 | Bacteria | 4756 |
| 186 | Ga0157369_10119955 | 3300013105 | Bacteria | 2791 |
| 187 | Ga0157378_10007645 | 3300013297 | Bacteria | 9434 |
| 188 | Ga0157378_10172604 | 3300013297 | Bacteria | 2029 |
| 189 | Ga0157378_10265492 | 3300013297 | Bacteria | 1648 |
| 190 | Ga0157378_10333987 | 3300013297 | Bacteria | 1476 |
| 191 | Ga0163162_10195665 | 3300013306 | Bacteria | 2150 |
| 192 | Ga0163162_10380193 | 3300013306 | Bacteria | 1545 |
| 193 | Ga0163162_10815544 | 3300013306 | Bacteria | 1050 |
| 194 | Ga0157372_10000598 | 3300013307 | Bacteria | 39369 |
| 195 | Ga0157372_10082081 | 3300013307 | Bacteria | 3649 |
| 196 | Ga0157372_10348336 | 3300013307 | Bacteria | 1726 |
| 197 | Ga0157372_10366859 | 3300013307 | Bacteria | 1678 |
| 198 | Ga0157372_10541015 | 3300013307 | Bacteria | 1358 |
| 199 | Ga0157375_10807322 | 3300013308 | Bacteria | 1087 |
| 200 | Ga0163163_10862600 | 3300014325 | Bacteria | 969 |
| 201 | Ga0157380_10153017 | 3300014326 | Bacteria | 1996 |
| 202 | Ga0182008_10000543 | 3300014497 | Bacteria | 28040 |
| 203 | Ga0157377_10033791 | 3300014745 | Bacteria | 2794 |
| 204 | Ga0182007_10023586 | 3300015262 | Bacteria | 2163 |
| 205 | Ga0163161_10195097 | 3300017792 | Bacteria | 1558 |
| 206 | Ga0163161_10221675 | 3300017792 | Bacteria | 1465 |
| 207 | Ga0163161_10245798 | 3300017792 | Bacteria | 1393 |
| 208 | Ga0206353_10369860 | 3300020082 | Bacteria | 959 |
| 209 | Ga0206353_10722848 | 3300020082 | Bacteria | 3394 |
| 210 | Ga0209147_101597 | 3300025229 | Bacteria | 7647 |
| 211 | Ga0209130_1000723 | 3300025284 | Bacteria | 29231 |
| 212 | Ga0209025_1000212 | 3300025294 | Bacteria | 139086 |
| 213 | Ga0209758_1002140 | 3300025297 | Bacteria | 20814 |
| 214 | Ga0209758_1007630 | 3300025297 | Bacteria | 7297 |
| 215 | Ga0209758_1028198 | 3300025297 | Bacteria | 2381 |
| 216 | Ga0207426_1000102 | 3300025302 | Bacteria | 255303 |
| 217 | Ga0207426_1023168 | 3300025302 | Bacteria | 2121 |
| 218 | Ga0207696_1000029 | 3300025711 | Bacteria | 398074 |
| 219 | Ga0207696_1000219 | 3300025711 | Bacteria | 83088 |
| 220 | Ga0207713_1000036 | 3300025735 | Bacteria | 259717 |
| 221 | Ga0207713_1007766 | 3300025735 | Bacteria | 6264 |
| 222 | Ga0207692_10006007 | 3300025898 | Bacteria | 4908 |
| 223 | Ga0207642_10060145 | 3300025899 | Unclassified | 1761 |
| 224 | Ga0207688_10070069 | 3300025901 | Bacteria | 1988 |
| 225 | Ga0207688_10083853 | 3300025901 | Bacteria | 1823 |
| 226 | Ga0207688_10201075 | 3300025901 | Bacteria | 1194 |
| 227 | Ga0207647_10018809 | 3300025904 | Bacteria | 4660 |
| 228 | Ga0207647_10065042 | 3300025904 | Bacteria | 2214 |
| 229 | Ga0207647_10154094 | 3300025904 | Bacteria | 1342 |
| 230 | Ga0207699_10049700 | 3300025906 | Bacteria | 2469 |
| 231 | Ga0207699_10145127 | 3300025906 | Bacteria | 1564 |
| 232 | Ga0207645_10033287 | 3300025907 | Unclassified | 3313 |
| 233 | Ga0207705_10000676 | 3300025909 | Bacteria | 28263 |
| 234 | Ga0207705_10133712 | 3300025909 | Bacteria | 1847 |
| 235 | Ga0207654_10014624 | 3300025911 | Bacteria | 4057 |
| 236 | Ga0207707_10001525 | 3300025912 | Bacteria | 21374 |
| 237 | Ga0207707_10309072 | 3300025912 | Bacteria | 1366 |
| 238 | Ga0207695_10185086 | 3300025913 | Bacteria | 2002 |
| 239 | Ga0207671_10037138 | 3300025914 | Bacteria | 3613 |
| 240 | Ga0207671_10062270 | 3300025914 | Bacteria | 2770 |
| 241 | Ga0207671_10196832 | 3300025914 | Bacteria | 1573 |
| 242 | Ga0207693_10012101 | 3300025915 | Bacteria | 6976 |
| 243 | Ga0207693_10156026 | 3300025915 | Bacteria | 1795 |
| 244 | Ga0207660_10008817 | 3300025917 | Bacteria | 6519 |
| 245 | Ga0207660_10009614 | 3300025917 | Bacteria | 6259 |
| 246 | Ga0207662_10034565 | 3300025918 | Unclassified | 2950 |
| 247 | Ga0207649_10096185 | 3300025920 | Bacteria | 1950 |
| 248 | Ga0207652_10042144 | 3300025921 | Bacteria | 3883 |
| 249 | Ga0207652_10051372 | 3300025921 | Bacteria | 3534 |
| 250 | Ga0207681_10084424 | 3300025923 | Bacteria | 2251 |
| 251 | Ga0207694_10159429 | 3300025924 | Bacteria | 1822 |
| 252 | Ga0207694_10273153 | 3300025924 | Bacteria | 1387 |
| 253 | Ga0207650_10004248 | 3300025925 | Bacteria | 9778 |
| 254 | Ga0207700_10004989 | 3300025928 | Bacteria | 7890 |
| 255 | Ga0207700_10055356 | 3300025928 | Bacteria | 2982 |
| 256 | Ga0207700_10348696 | 3300025928 | Bacteria | 1289 |
| 257 | Ga0207664_10013023 | 3300025929 | Bacteria | 5960 |
| 258 | Ga0207664_10492209 | 3300025929 | Bacteria | 1097 |
| 259 | Ga0207664_10938293 | 3300025929 | Bacteria | 776 |
| 260 | Ga0207706_10020869 | 3300025933 | Bacteria | 5882 |
| 261 | Ga0207706_10036247 | 3300025933 | Bacteria | 4382 |
| 262 | Ga0207706_10126572 | 3300025933 | Bacteria | 2247 |
| 263 | Ga0207706_10148626 | 3300025933 | Unclassified | 2061 |
| 264 | Ga0207686_10280776 | 3300025934 | Bacteria | 1229 |
| 265 | Ga0207709_10113826 | 3300025935 | Bacteria | 1814 |
| 266 | Ga0207669_10034512 | 3300025937 | Bacteria | 2867 |
| 267 | Ga0207669_10056437 | 3300025937 | Unclassified | 2385 |
| 268 | Ga0207704_10092144 | 3300025938 | Unclassified | 1994 |
| 269 | Ga0207704_10108668 | 3300025938 | Bacteria | 1869 |
| 270 | Ga0207691_10025136 | 3300025940 | Bacteria | 5595 |
| 271 | Ga0207691_10237065 | 3300025940 | Bacteria | 1578 |
| 272 | Ga0207689_10109560 | 3300025942 | Bacteria | 2269 |
| 273 | Ga0207689_10252184 | 3300025942 | Bacteria | 1459 |
| 274 | Ga0207689_10293197 | 3300025942 | Bacteria | 1348 |
| 275 | Ga0207661_10147736 | 3300025944 | Bacteria | 2029 |
| 276 | Ga0207661_10852886 | 3300025944 | Unclassified | 839 |
| 277 | Ga0207667_10130634 | 3300025949 | Bacteria | 2587 |
| 278 | Ga0207667_10291644 | 3300025949 | Bacteria | 1667 |
| 279 | Ga0207667_10335745 | 3300025949 | Bacteria | 1543 |
| 280 | Ga0207667_10508063 | 3300025949 | Bacteria | 1222 |
| 281 | Ga0207712_10010325 | 3300025961 | Bacteria | 5929 |
| 282 | Ga0207712_10274965 | 3300025961 | Bacteria | 1372 |
| 283 | Ga0207668_10020551 | 3300025972 | Bacteria | 4197 |
| 284 | Ga0207668_10073433 | 3300025972 | Bacteria | 2451 |
| 285 | Ga0207668_10164736 | 3300025972 | Bacteria | 1731 |
| 286 | Ga0207640_10163924 | 3300025981 | Bacteria | 1648 |
| 287 | Ga0207640_10787981 | 3300025981 | Unclassified | 822 |
| 288 | Ga0207658_10752442 | 3300025986 | Bacteria | 883 |
| 289 | Ga0207677_10110172 | 3300026023 | Bacteria | 2049 |
| 290 | Ga0207677_10118785 | 3300026023 | Bacteria | 1984 |
| 291 | Ga0207639_10037054 | 3300026041 | Bacteria | 3620 |
| 292 | Ga0207639_10138747 | 3300026041 | Bacteria | 2023 |
| 293 | Ga0207639_10198861 | 3300026041 | Bacteria | 1717 |
| 294 | Ga0207678_10000232 | 3300026067 | Bacteria | 49851 |
| 295 | Ga0207678_10030951 | 3300026067 | Bacteria | 4671 |
| 296 | Ga0207678_10036762 | 3300026067 | Bacteria | 4263 |
| 297 | Ga0207678_10099875 | 3300026067 | Bacteria | 2479 |
| 298 | Ga0207708_10016735 | 3300026075 | Bacteria | 5518 |
| 299 | Ga0207708_10053249 | 3300026075 | Unclassified | 3083 |
| 300 | Ga0207708_10142716 | 3300026075 | Bacteria | 1880 |
| 301 | Ga0207708_10255577 | 3300026075 | Bacteria | 1413 |
| 302 | Ga0207702_10000640 | 3300026078 | Bacteria | 38336 |
| 303 | Ga0207641_10585853 | 3300026088 | Bacteria | 1091 |
| 304 | Ga0207648_10050344 | 3300026089 | Bacteria | 3642 |
| 305 | Ga0207648_10153106 | 3300026089 | Bacteria | 2035 |
| 306 | Ga0207676_10051154 | 3300026095 | Bacteria | 3224 |
| 307 | Ga0207674_10020811 | 3300026116 | Bacteria | 7080 |
| 308 | Ga0207674_10116606 | 3300026116 | Bacteria | 2641 |
| 309 | Ga0207674_10317332 | 3300026116 | Bacteria | 1508 |
| 310 | Ga0207675_100024426 | 3300026118 | Bacteria | 5619 |
| 311 | Ga0207675_100038277 | 3300026118 | Bacteria | 4476 |
| 312 | Ga0207675_100052667 | 3300026118 | Bacteria | 3798 |
| 313 | Ga0207675_100142806 | 3300026118 | Unclassified | 2275 |
| 314 | Ga0207675_100157313 | 3300026118 | Bacteria | 2166 |
| 315 | Ga0207675_100311593 | 3300026118 | Bacteria | 1535 |
| 316 | Ga0207683_10119042 | 3300026121 | Bacteria | 2369 |
| 317 | Ga0207683_10146839 | 3300026121 | Bacteria | 2127 |
| 318 | Ga0209981_1007580 | 3300027378 | Bacteria | 1465 |
| 319 | Ga0209982_1001892 | 3300027552 | Bacteria | 2895 |
| 320 | Ga0209983_1005466 | 3300027665 | Bacteria | 2631 |
| 321 | Ga0209971_1000529 | 3300027682 | Bacteria | 10064 |
| 322 | Ga0209813_10084967 | 3300027866 | Bacteria | 1053 |
| 323 | Ga0207428_10000706 | 3300027907 | Bacteria | 38683 |
| 324 | Ga0268266_10053275 | 3300028379 | Bacteria | 3475 |
| 325 | Ga0268265_10111826 | 3300028380 | Bacteria | 2231 |
| 326 | Ga0268265_10283467 | 3300028380 | Bacteria | 1483 |
| 327 | Ga0268264_10252543 | 3300028381 | Bacteria | 1639 |
| 328 | Ga0268264_10340706 | 3300028381 | Bacteria | 1424 |
| 329 | Ga0307517_10005855 | 3300028786 | Bacteria | 18372 |
| 330 | Ga0307515_10068642 | 3300028794 | Bacteria | 4865 |
| 331 | Ga0307515_10078627 | 3300028794 | Bacteria | 4334 |
| 332 | Ga0307515_10217621 | 3300028794 | Bacteria | 1737 |
| 333 | Ga0307511_10215903 | 3300030521 | Bacteria | 971 |
| 334 | Ga0307512_10054085 | 3300030522 | Bacteria | 3183 |
| 335 | Ga0316177_1032584 | 3300030731 | Bacteria | 4094 |
| 336 | Ga0316176_1148195 | 3300030732 | Bacteria | 1018 |
| 337 | Ga0314311_1152931 | 3300030733 | Bacteria | 8709 |
| 338 | Ga0316180_1055335 | 3300030736 | Bacteria | 1400 |
| 339 | Ga0265332_10074137 | 3300031238 | Bacteria | 1447 |
| 340 | Ga0307513_10197139 | 3300031456 | Bacteria | 1859 |
| 341 | Ga0307513_10425208 | 3300031456 | Bacteria | 1057 |
| 342 | Ga0307509_10035904 | 3300031507 | Bacteria | 5434 |
| 343 | Ga0307509_10116051 | 3300031507 | Bacteria | 2667 |
| 344 | Ga0307508_10008307 | 3300031616 | Bacteria | 9606 |
| 345 | Ga0307508_10261036 | 3300031616 | Bacteria | 1327 |
| 346 | Ga0307508_10299813 | 3300031616 | Bacteria | 1200 |
| 347 | Ga0307514_10006568 | 3300031649 | Bacteria | 10103 |
| 348 | Ga0307514_10033166 | 3300031649 | Bacteria | 4122 |
| 349 | Ga0265314_10021126 | 3300031711 | Bacteria | 5014 |
| 350 | Ga0265342_10116338 | 3300031712 | Bacteria | 1509 |
| 351 | Ga0307516_10002742 | 3300031730 | Bacteria | 23227 |
| 352 | Ga0307516_10004092 | 3300031730 | Bacteria | 18235 |
| 353 | Ga0307413_10029742 | 3300031824 | Bacteria | 3061 |
| 354 | Ga0307413_10067686 | 3300031824 | Bacteria | 2234 |
| 355 | Ga0307518_10025604 | 3300031838 | Bacteria | 4255 |
| 356 | Ga0307406_10113393 | 3300031901 | Bacteria | 1871 |
| 357 | Ga0307406_10453554 | 3300031901 | Bacteria | 1029 |
| 358 | Ga0307407_10547107 | 3300031903 | Bacteria | 855 |
| 359 | Ga0307416_100428202 | 3300032002 | Bacteria | 1370 |
| 360 | Ga0307414_10000905 | 3300032004 | Bacteria | 15205 |
| 361 | Ga0307414_10053229 | 3300032004 | Bacteria | 2822 |
| 362 | Ga0307414_10340183 | 3300032004 | Bacteria | 1284 |
| 363 | Ga0307507_10024788 | 3300033179 | Bacteria | 6527 |
| 364 | Ga0307510_10010654 | 3300033180 | Bacteria | 10926 |
| 365 | Ga0307510_10015733 | 3300033180 | Bacteria | 8946 |
| 366 | Ga0307510_10203101 | 3300033180 | Bacteria | 1514 |
| 367 | Ga0307510_10212540 | 3300033180 | Bacteria | 1455 |
| 368 | Ga0373930_0003508 | 3300034816 | Bacteria | 2491 |
| 369 | Ga0373948_0017766 | 3300034817 | Bacteria | 1329 |
| 370 | Ga0373928_0000800 | 3300035084 | Bacteria | 6127 |
| 371 | Ga0373928_0025680 | 3300035084 | Bacteria | 1272 |
| 372 | Ga0373934_0136200 | 3300035086 | Bacteria | 1003 |
| 373 | Ga0373923_0194604 | 3300035111 | Bacteria | 935 |
| 374 | Ga0373932_0021501 | 3300035112 | Bacteria | 1704 |
| 375 | Ga0373936_0007027 | 3300035113 | Bacteria | 4236 |
| 376 | Ga0373936_0007241 | 3300035113 | Bacteria | 4175 |
| 377 | Ga0373945_0040951 | 3300035116 | Bacteria | 1674 |
| 378 | Ga0373946_0041580 | 3300035171 | Bacteria | 1886 |
| 379 | Ga0373946_0291885 | 3300035171 | Bacteria | 804 |
| 380 | Ga0373931_0000001 | 3300035691 | Bacteria | 634029 |
| 381 | Ga0373931_0000038 | 3300035691 | Bacteria | 74311 |
| 382 | Ga0373935_0001717 | 3300035692 | Bacteria | 12270 |
| 383 | Ga0373935_0477141 | 3300035692 | Bacteria | 903 |
| 384 | Ga0373927_0001560 | 3300035695 | Bacteria | 17188 |
| 385 | Ga0373927_0041650 | 3300035695 | Bacteria | 2978 |
| 386 | Ga0373927_0148845 | 3300035695 | Bacteria | 1533 |
| 387 | Ga0373947_0052206 | 3300035725 | Bacteria | 2462 |
| 388 | Ga0373947_0154875 | 3300035725 | Bacteria | 1478 |
| 389 | Ga0373937_0017600 | 3300036401 | Bacteria | 6371 |
| 390 | Ga0373937_0164480 | 3300036401 | Bacteria | 2080 |
| 391 | Ga0316584_0317867 | 3300036712 | Bacteria | 1124 |
| 392 | Ga0373925_0002416 | 3300037068 | Bacteria | 14983 |
| 393 | Ga0373925_0171043 | 3300037068 | Bacteria | 1715 |
| 394 | Ga0395900_0081695 | 3300037418 | Bacteria | 3320 |
| 395 | Ga0395898_0008785 | 3300037466 | Bacteria | 10647 |
| 396 | Ga0395898_0131206 | 3300037466 | Bacteria | 2400 |
| 397 | Ga0395905_0001110 | 3300037471 | Bacteria | 33818 |
| 398 | Ga0436364_0136448 | 3300037853 | Bacteria | 2487 |
| 399 | Ga0395901_0425572 | 3300038443 | Bacteria | 1361 |
| 400 | Ga0400488_14442 | 3300038741 | Bacteria | 1409 |
| 401 | Ga0436365_0175813 | 3300039437 | Bacteria | 2750 |
| 402 | Ga0436365_0944416 | 3300039437 | Bacteria | 4480 |
| 403 | Ga0436365_1444934 | 3300039437 | Bacteria | 1882 |
| 404 | Ga0436360_1343606 | 3300039438 | Bacteria | 3256 |
| 405 | Ga0436363_1332597 | 3300039450 | Bacteria | 1010 |
| 406 | Ga0439436_0003644 | 3300041404 | Bacteria | 4694 |
| 407 | Ga0439438_000453 | 3300041405 | Bacteria | 18539 |
| 408 | Ga0439438_000829 | 3300041405 | Bacteria | 13843 |
| 409 | Ga0439439_0001165 | 3300041406 | Bacteria | 5061 |
| 410 | Ga0439447_001186 | 3300041407 | Bacteria | 9504 |
| 411 | Ga0439466_0011204 | 3300041411 | Bacteria | 3319 |
| 412 | Ga0439465_0024664 | 3300041413 | Bacteria | 1896 |
| 413 | Ga0451795_0444049 | 3300041456 | Bacteria | 1563 |
| 414 | Ga0451835_0889745 | 3300041492 | Bacteria | 1121 |
| 415 | Ga0451837_0485700 | 3300041494 | Bacteria | 4304 |
| 416 | Ga0451853_1195562 | 3300041512 | Bacteria | 5498 |
| 417 | Ga0439431_0036423 | 3300041997 | Bacteria | 1239 |
| 418 | Ga0439433_0002581 | 3300041999 | Bacteria | 3848 |
| 419 | Ga0439442_008450 | 3300042002 | Bacteria | 2079 |
| 420 | Ga0439448_0079991 | 3300042005 | Bacteria | 1097 |
| 421 | Ga0439432_002880 | 3300042006 | Bacteria | 6410 |
| 422 | Ga0439449_0001695 | 3300042007 | Bacteria | 8674 |
| 423 | Ga0439452_001698 | 3300042010 | Bacteria | 8654 |
| 424 | Ga0439457_001044 | 3300042014 | Bacteria | 8376 |
| 425 | Ga0439462_0020429 | 3300042015 | Bacteria | 1727 |
| 426 | Ga0450923_001643 | 3300042125 | Bacteria | 3021 |
| 427 | Ga0450907_010208 | 3300042146 | Bacteria | 1559 |
| 428 | Ga0439446_0010479 | 3300042156 | Bacteria | 2496 |
| 429 | Ga0439458_0009563 | 3300042157 | Bacteria | 2160 |
| 430 | Ga0439458_0010452 | 3300042157 | Bacteria | 2070 |
| 431 | Ga0439434_0031543 | 3300042435 | Bacteria | 1611 |
| 432 | Ga0466969_0012942 | 3300044656 | Bacteria | 4395 |
| 433 | Ga0466969_0039102 | 3300044656 | Bacteria | 2384 |
| 434 | Ga0466972_0001762 | 3300044658 | Bacteria | 10612 |
| 435 | Ga0466972_0002122 | 3300044658 | Bacteria | 9732 |
| 436 | Ga0466972_0003178 | 3300044658 | Bacteria | 8161 |
| 437 | Ga0466972_0015460 | 3300044658 | Bacteria | 3814 |
| 438 | Ga0466972_0026339 | 3300044658 | Bacteria | 2882 |
| 439 | Ga0466965_0000492 | 3300044683 | Bacteria | 14023 |
| 440 | Ga0466965_0021514 | 3300044683 | Bacteria | 3105 |
| 441 | Ga0466965_0048074 | 3300044683 | Bacteria | 2113 |
| 442 | Ga0466965_0083212 | 3300044683 | Bacteria | 1620 |
| 443 | Ga0466965_0109366 | 3300044683 | Bacteria | 1419 |
| 444 | Ga0466966_0018718 | 3300044684 | Bacteria | 4562 |
| 445 | Ga0466966_0041891 | 3300044684 | Bacteria | 2941 |
| 446 | Ga0466966_0048196 | 3300044684 | Bacteria | 2714 |
| 447 | Ga0466961_0005326 | 3300044693 | Bacteria | 8094 |
| 448 | Ga0466961_0011622 | 3300044693 | Bacteria | 5626 |
| 449 | Ga0466961_0025475 | 3300044693 | Bacteria | 3803 |
| 450 | Ga0466961_0384301 | 3300044693 | Bacteria | 853 |
| 451 | Ga0466963_0000319 | 3300044694 | Bacteria | 21690 |
| 452 | Ga0466963_0000336 | 3300044694 | Bacteria | 21334 |
| 453 | Ga0466963_0040999 | 3300044694 | Bacteria | 3035 |
| 454 | Ga0466963_0045770 | 3300044694 | Bacteria | 2883 |
| 455 | Ga0466964_0000999 | 3300044706 | Bacteria | 9395 |
| 456 | Ga0453684_0626590 | 3300044712 | Bacteria | 1176 |
| 457 | Ga0466971_0000247 | 3300044719 | Bacteria | 20764 |
| 458 | Ga0466971_0035672 | 3300044719 | Bacteria | 2230 |
| 459 | Ga0466968_0006777 | 3300044735 | Bacteria | 4333 |
| 460 | Ga0466968_0032354 | 3300044735 | Bacteria | 2175 |
| 461 | Ga0466968_0086510 | 3300044735 | Bacteria | 1384 |
| 462 | Ga0466970_0000625 | 3300044765 | Bacteria | 17367 |
| 463 | Ga0466970_0270686 | 3300044765 | Bacteria | 954 |
| 464 | Ga0466957_0000837 | 3300044842 | Bacteria | 15736 |
| 465 | Ga0466957_0052166 | 3300044842 | Bacteria | 2490 |
| 466 | Ga0466957_0363938 | 3300044842 | Bacteria | 983 |
| 467 | Ga0466960_0075425 | 3300044901 | Bacteria | 1687 |
| 468 | Ga0466960_0141952 | 3300044901 | Bacteria | 1276 |
| 469 | Ga0466959_0048132 | 3300045049 | Bacteria | 3134 |
| 470 | Ga0466959_0104912 | 3300045049 | Bacteria | 2021 |
| 471 | Ga0466959_0105730 | 3300045049 | Bacteria | 2012 |
| 472 | Ga0466959_0106306 | 3300045049 | Bacteria | 2006 |
| 473 | Ga0466959_0234125 | 3300045049 | Bacteria | 1270 |
| 474 | Ga0466958_0001544 | 3300045836 | Bacteria | 11027 |
| 475 | Ga0466967_0001364 | 3300045976 | Bacteria | 14054 |
| 476 | Ga0466967_0030588 | 3300045976 | Bacteria | 4520 |
| 477 | Ga0466967_0076913 | 3300045976 | Bacteria | 3003 |
| 478 | Ga0466967_0097359 | 3300045976 | Bacteria | 2685 |
| 479 | Ga0466967_0099857 | 3300045976 | Bacteria | 2651 |
| 480 | Ga0466967_0114799 | 3300045976 | Bacteria | 2479 |
| 481 | Ga0466967_0146604 | 3300045976 | Bacteria | 2202 |
| 482 | Ga0466967_0336521 | 3300045976 | Bacteria | 1459 |
| 483 | Ga0466967_0485282 | 3300045976 | Bacteria | 1211 |
| 484 | Ga0495617_028853 | 3300046452 | Bacteria | 1866 |
| 485 | Ga0495627_000054 | 3300046453 | Bacteria | 151899 |
| 486 | Ga0495627_000164 | 3300046453 | Bacteria | 75744 |
| 487 | Ga0495592_0360769 | 3300046454 | Bacteria | 929 |
| 488 | Ga0495603_0000356 | 3300046455 | Bacteria | 24663 |
| 489 | Ga0495603_0001798 | 3300046455 | Bacteria | 12664 |
| 490 | Ga0495603_0007578 | 3300046455 | Bacteria | 6531 |
| 491 | Ga0495603_0029388 | 3300046455 | Bacteria | 3314 |
| 492 | Ga0495591_000002 | 3300046458 | Bacteria | 455013 |
| 493 | Ga0495629_0000087 | 3300046459 | Bacteria | 81337 |
| 494 | Ga0495629_0047708 | 3300046459 | Bacteria | 3004 |
| 495 | Ga0495629_0122012 | 3300046459 | Bacteria | 1815 |
| 496 | Ga0495629_0191217 | 3300046459 | Bacteria | 1417 |
| 497 | Ga0495638_0019670 | 3300046460 | Bacteria | 4465 |
| 498 | Ga0495638_0212043 | 3300046460 | Bacteria | 1087 |
| 499 | Ga0495638_0215507 | 3300046460 | Bacteria | 1076 |
| 500 | Ga0495641_0003485 | 3300046461 | Bacteria | 11729 |
| 501 | Ga0495651_0002844 | 3300046462 | Bacteria | 13401 |
| 502 | Ga0495651_0005413 | 3300046462 | Bacteria | 9739 |
| 503 | Ga0495653_0000291 | 3300046463 | Bacteria | 40584 |
| 504 | Ga0495653_0028857 | 3300046463 | Bacteria | 4436 |
| 505 | Ga0495650_0004704 | 3300046471 | Bacteria | 9206 |
| 506 | Ga0495580_0187728 | 3300046472 | Bacteria | 1426 |
| 507 | Ga0495580_0463899 | 3300046472 | Bacteria | 849 |
| 508 | Ga0495582_0004609 | 3300046473 | Bacteria | 7744 |
| 509 | Ga0495582_0116310 | 3300046473 | Bacteria | 1504 |
| 510 | Ga0495605_0000052 | 3300046474 | Bacteria | 162723 |
| 511 | Ga0495605_0000550 | 3300046474 | Bacteria | 30682 |
| 512 | Ga0495639_0000022 | 3300046475 | Bacteria | 72037 |
| 513 | Ga0495662_0001463 | 3300046476 | Bacteria | 11692 |
| 514 | Ga0495662_0002185 | 3300046476 | Bacteria | 9837 |
| 515 | Ga0495662_0007605 | 3300046476 | Bacteria | 5347 |
| 516 | Ga0495662_0014932 | 3300046476 | Bacteria | 3772 |
| 517 | Ga0495664_0003293 | 3300046477 | Bacteria | 8786 |
| 518 | Ga0495664_0073467 | 3300046477 | Bacteria | 2045 |
| 519 | Ga0495664_0082815 | 3300046477 | Bacteria | 1925 |
| 520 | Ga0495664_0102750 | 3300046477 | Bacteria | 1722 |
| 521 | Ga0495664_0380693 | 3300046477 | Bacteria | 848 |
| 522 | Ga0495585_0001175 | 3300046492 | Bacteria | 21290 |
| 523 | Ga0495585_0017276 | 3300046492 | Bacteria | 4171 |
| 524 | Ga0495585_0155881 | 3300046492 | Bacteria | 1188 |
| 525 | Ga0495585_0169304 | 3300046492 | Bacteria | 1129 |
| 526 | Ga0495594_0000169 | 3300046499 | Bacteria | 31347 |
| 527 | Ga0495594_0018658 | 3300046499 | Bacteria | 3677 |
| 528 | Ga0495607_0000045 | 3300046501 | Bacteria | 125217 |
| 529 | Ga0495607_0000052 | 3300046501 | Bacteria | 118863 |
| 530 | Ga0495607_0001929 | 3300046501 | Bacteria | 17511 |
| 531 | Ga0495607_0008284 | 3300046501 | Bacteria | 7111 |
| 532 | Ga0495607_0036302 | 3300046501 | Bacteria | 2970 |
| 533 | Ga0495607_0072851 | 3300046501 | Bacteria | 1911 |
| 534 | Ga0495607_0125200 | 3300046501 | Bacteria | 1344 |
| 535 | Ga0495607_0282064 | 3300046501 | Bacteria | 788 |
| 536 | Ga0495583_0000089 | 3300046506 | Bacteria | 163349 |
| 537 | Ga0495583_0000747 | 3300046506 | Bacteria | 41311 |
| 538 | Ga0495583_0008269 | 3300046506 | Bacteria | 6379 |
| 539 | Ga0495606_0000155 | 3300046507 | Bacteria | 119163 |
| 540 | Ga0495610_0036021 | 3300046512 | Bacteria | 2533 |
| 541 | Ga0495610_0100317 | 3300046512 | Bacteria | 1298 |
| 542 | Ga0495618_0053015 | 3300046514 | Bacteria | 2565 |
| 543 | Ga0495618_0154568 | 3300046514 | Bacteria | 1465 |
| 544 | Ga0495620_0007303 | 3300046515 | Bacteria | 6017 |
| 545 | Ga0495620_0021420 | 3300046515 | Bacteria | 3139 |
| 546 | Ga0495620_0032288 | 3300046515 | Bacteria | 2387 |
| 547 | Ga0495628_0019565 | 3300046516 | Bacteria | 5595 |
| 548 | Ga0495628_0032670 | 3300046516 | Bacteria | 4199 |
| 549 | Ga0495630_0002076 | 3300046517 | Bacteria | 13929 |
| 550 | Ga0495630_0003347 | 3300046517 | Bacteria | 11165 |
| 551 | Ga0495631_0047180 | 3300046518 | Bacteria | 1892 |
| 552 | Ga0495631_0051596 | 3300046518 | Bacteria | 1797 |
| 553 | Ga0495631_0190039 | 3300046518 | Bacteria | 879 |
| 554 | Ga0495632_0000158 | 3300046519 | Bacteria | 70148 |
| 555 | Ga0495632_0003072 | 3300046519 | Bacteria | 12130 |
| 556 | Ga0495632_0021156 | 3300046519 | Bacteria | 3508 |
| 557 | Ga0495632_0034192 | 3300046519 | Bacteria | 2603 |
| 558 | Ga0495637_0000143 | 3300046520 | Bacteria | 53795 |
| 559 | Ga0495637_0001518 | 3300046520 | Bacteria | 13576 |
| 560 | Ga0495637_0001574 | 3300046520 | Bacteria | 13274 |
| 561 | Ga0495637_0005149 | 3300046520 | Bacteria | 6700 |
| 562 | Ga0495637_0018209 | 3300046520 | Bacteria | 3260 |
| 563 | Ga0495637_0127525 | 3300046520 | Bacteria | 974 |
| 564 | Ga0495643_0004652 | 3300046522 | Bacteria | 9535 |
| 565 | Ga0495643_0014862 | 3300046522 | Bacteria | 4620 |
| 566 | Ga0495652_0001618 | 3300046529 | Bacteria | 24581 |
| 567 | Ga0495652_0055099 | 3300046529 | Bacteria | 3383 |
| 568 | Ga0495654_0000664 | 3300046530 | Bacteria | 27101 |
| 569 | Ga0495654_0038900 | 3300046530 | Bacteria | 2376 |
| 570 | Ga0495654_0108210 | 3300046530 | Bacteria | 1271 |
| 571 | Ga0495665_0004349 | 3300046531 | Bacteria | 7646 |
| 572 | Ga0495640_0018265 | 3300046533 | Bacteria | 5207 |
| 573 | Ga0495640_0050427 | 3300046533 | Bacteria | 2867 |
| 574 | Ga0495640_0230048 | 3300046533 | Bacteria | 1166 |
| 575 | Ga0495587_0018037 | 3300046536 | Bacteria | 4375 |
| 576 | Ga0495609_0000033 | 3300046538 | Bacteria | 208889 |
| 577 | Ga0495609_0119109 | 3300046538 | Bacteria | 1136 |
| 578 | Ga0495621_0079636 | 3300046539 | Bacteria | 1220 |
| 579 | Ga0495597_0000023 | 3300046542 | Bacteria | 149302 |
| 580 | Ga0495597_0109430 | 3300046542 | Bacteria | 1160 |
| 581 | Ga0495645_0205443 | 3300046543 | Bacteria | 1333 |
| 582 | Ga0495645_0357339 | 3300046543 | Bacteria | 940 |
| 583 | Ga0495622_0027208 | 3300046557 | Bacteria | 2669 |
| 584 | Ga0495622_0089411 | 3300046557 | Bacteria | 1415 |
| 585 | Ga0495633_0035203 | 3300046558 | Bacteria | 2405 |
| 586 | Ga0495633_0116036 | 3300046558 | Bacteria | 1241 |
| 587 | Ga0495667_0003542 | 3300046559 | Bacteria | 10484 |
| 588 | Ga0495667_0258210 | 3300046559 | Bacteria | 1108 |
| 589 | Ga0495656_0028697 | 3300046615 | Bacteria | 2234 |
| 590 | Ga0495668_0007355 | 3300046616 | Bacteria | 7055 |
| 591 | Ga0495668_0053528 | 3300046616 | Bacteria | 2231 |
| 592 | Ga0495668_0071254 | 3300046616 | Bacteria | 1910 |
| 593 | Ga0495634_0006461 | 3300046642 | Bacteria | 8908 |
| 594 | Ga0495634_0008868 | 3300046642 | Bacteria | 7455 |
| 595 | Ga0495634_0106683 | 3300046642 | Bacteria | 1805 |
| 596 | Ga0495611_0112960 | 3300046648 | Bacteria | 1265 |
| 597 | Ga0495635_0006054 | 3300046663 | Bacteria | 8437 |
| 598 | Ga0495635_0008558 | 3300046663 | Bacteria | 7145 |
| 599 | Ga0495635_0016099 | 3300046663 | Bacteria | 5222 |
| 600 | Ga0495635_0192104 | 3300046663 | Bacteria | 1386 |
| 601 | Ga0495635_0355194 | 3300046663 | Bacteria | 977 |
| 602 | Ga0495659_0139015 | 3300046664 | Bacteria | 968 |
| 603 | Ga0495661_0000039 | 3300046665 | Bacteria | 153539 |
| 604 | Ga0495661_0001793 | 3300046665 | Bacteria | 17257 |
| 605 | Ga0495661_0050072 | 3300046665 | Bacteria | 2531 |
| 606 | Ga0495588_0003260 | 3300046674 | Bacteria | 7044 |
| 607 | Ga0495588_0003708 | 3300046674 | Bacteria | 6689 |
| 608 | Ga0495588_0021738 | 3300046674 | Bacteria | 3165 |
| 609 | Ga0495657_0001338 | 3300046675 | Bacteria | 21439 |
| 610 | Ga0495657_0016592 | 3300046675 | Bacteria | 5365 |
| 611 | Ga0495657_0236014 | 3300046675 | Bacteria | 1105 |
| 612 | Ga0495599_0111128 | 3300046678 | Bacteria | 1707 |
| 613 | Ga0495599_0120783 | 3300046678 | Bacteria | 1629 |
| 614 | Ga0495623_0058278 | 3300046679 | Bacteria | 2428 |
| 615 | Ga0495623_0191924 | 3300046679 | Bacteria | 1180 |
| 616 | Ga0495646_0017985 | 3300046680 | Bacteria | 4478 |
| 617 | Ga0495646_0047000 | 3300046680 | Bacteria | 2629 |
| 618 | Ga0495647_0000258 | 3300046681 | Bacteria | 14555 |
| 619 | Ga0495647_0128098 | 3300046681 | Bacteria | 1073 |
| 620 | Ga0495658_0001900 | 3300046683 | Bacteria | 10665 |
| 621 | Ga0495658_0037206 | 3300046683 | Bacteria | 2689 |
| 622 | Ga0495669_0068292 | 3300046684 | Bacteria | 1617 |
| 623 | Ga0495613_0001802 | 3300046689 | Bacteria | 16281 |
| 624 | Ga0495613_0006831 | 3300046689 | Bacteria | 8522 |
| 625 | Ga0495613_0016830 | 3300046689 | Bacteria | 5444 |
| 626 | Ga0495613_0051657 | 3300046689 | Bacteria | 3029 |
| 627 | Ga0495613_0197246 | 3300046689 | Bacteria | 1421 |
| 628 | Ga0495624_0010406 | 3300046690 | Bacteria | 6411 |
| 629 | Ga0495624_0363465 | 3300046690 | Bacteria | 870 |
| 630 | Ga0495670_0106107 | 3300046691 | Bacteria | 1451 |
| 631 | Ga0495671_0057638 | 3300046692 | Bacteria | 1922 |
| 632 | Ga0495671_0085585 | 3300046692 | Bacteria | 1544 |
| 633 | Ga0495649_0000027 | 3300046694 | Bacteria | 164157 |
| 634 | Ga0495589_0050869 | 3300046794 | Bacteria | 2049 |
| 635 | Ga0495589_0087516 | 3300046794 | Bacteria | 1513 |
| 636 | Ga0495600_0000502 | 3300046809 | Bacteria | 20307 |
| 637 | Ga0495600_0008141 | 3300046809 | Bacteria | 6433 |
| 638 | Ga0495660_0000088 | 3300046810 | Bacteria | 98970 |
| 639 | Ga0495660_0002686 | 3300046810 | Bacteria | 11244 |
| 640 | Ga0495660_0040126 | 3300046810 | Bacteria | 2596 |
| 641 | Ga0495660_0068488 | 3300046810 | Bacteria | 1888 |
| 642 | Ga0495660_0191960 | 3300046810 | Bacteria | 981 |
| 643 | Ga0495581_0000161 | 3300047315 | Bacteria | 29999 |
| 644 | Ga0495581_0148365 | 3300047315 | Bacteria | 1369 |
| 645 | Ga0495581_0185012 | 3300047315 | Bacteria | 1218 |
| 646 | Ga0495581_0307746 | 3300047315 | Bacteria | 926 |
| 647 | Ga0495604_0001218 | 3300047317 | Bacteria | 21129 |
| 648 | Ga0495604_0323100 | 3300047317 | Bacteria | 1031 |
| 649 | Ga0495636_0036299 | 3300047318 | Bacteria | 2032 |
| 650 | Ga0495636_0054455 | 3300047318 | Bacteria | 1681 |
| 651 | Ga0495636_0060436 | 3300047318 | Bacteria | 1601 |
| 652 | Ga0495636_0065561 | 3300047318 | Bacteria | 1543 |
| 653 | Ga0495674_0000805 | 3300047319 | Bacteria | 29851 |
| 654 | Ga0495674_0316402 | 3300047319 | Bacteria | 1272 |
| 655 | Ga0495672_0001914 | 3300047320 | Bacteria | 19737 |
| 656 | Ga0495672_0156755 | 3300047320 | Bacteria | 1175 |
| 657 | Ga0495672_0210877 | 3300047320 | Bacteria | 965 |
| 658 | Ga0495676_0001308 | 3300047321 | Bacteria | 21346 |
| 659 | Ga0495676_0008498 | 3300047321 | Bacteria | 9408 |
| 660 | Ga0495676_0008726 | 3300047321 | Bacteria | 9277 |
| 661 | Ga0495676_0108391 | 3300047321 | Bacteria | 2043 |
| 662 | Ga0495683_0000477 | 3300047323 | Bacteria | 31110 |
| 663 | Ga0495683_0030623 | 3300047323 | Bacteria | 2745 |
| 664 | Ga0495687_016952 | 3300047443 | Bacteria | 3648 |
| 665 | Ga0495675_0276163 | 3300047444 | Bacteria | 1003 |
| 666 | Ga0495677_0072921 | 3300047445 | Bacteria | 1281 |
| 667 | Ga0495685_000326 | 3300047447 | Bacteria | 15300 |
| 668 | Ga0495685_023846 | 3300047447 | Bacteria | 2106 |
| 669 | Ga0495673_0000538 | 3300047469 | Bacteria | 39158 |
| 670 | Ga0495673_0002632 | 3300047469 | Bacteria | 12431 |
| 671 | Ga0495673_0027949 | 3300047469 | Bacteria | 2677 |
| 672 | Ga0495673_0085478 | 3300047469 | Bacteria | 1298 |
| 673 | Ga0495681_0005390 | 3300047470 | Bacteria | 8574 |
| 674 | Ga0495681_0009660 | 3300047470 | Bacteria | 5923 |
| 675 | Ga0495684_0009071 | 3300047471 | Bacteria | 7682 |
| 676 | Ga0495684_0091838 | 3300047471 | Bacteria | 2300 |
| 677 | Ga0495686_0058816 | 3300047472 | Bacteria | 2395 |
| 678 | Ga0495686_0060909 | 3300047472 | Bacteria | 2345 |
| 679 | Ga0495593_0000042 | 3300047673 | Bacteria | 51536 |
| 680 | Ga0495593_0009905 | 3300047673 | Bacteria | 5526 |
| 681 | Ga0495602_0018583 | 3300048088 | Bacteria | 6934 |
| 682 | Ga0495602_0052900 | 3300048088 | Bacteria | 3602 |
| 683 | Ga0495614_0013088 | 3300048089 | Bacteria | 3639 |
| 684 | Ga0495614_0037092 | 3300048089 | Bacteria | 2091 |
| 685 | Ga0495626_0048357 | 3300048091 | Bacteria | 1974 |
| 686 | Ga0496100_0201352 | 3300048903 | Bacteria | 1451 |
| 687 | Ga0496100_0292603 | 3300048903 | Bacteria | 1217 |
| 688 | Ga0496101_0244026 | 3300048904 | Bacteria | 1398 |
| 689 | Ga0496102_0131622 | 3300048905 | Bacteria | 2342 |
| 690 | Ga0496102_0395634 | 3300048905 | Bacteria | 1299 |
| 691 | Ga0496102_0505074 | 3300048905 | Bacteria | 1131 |
| 692 | Ga0496102_0533068 | 3300048905 | Bacteria | 1097 |
| 693 | Ga0496104_0208079 | 3300048907 | Bacteria | 1868 |
| 694 | Ga0496104_0246582 | 3300048907 | Bacteria | 1699 |
| 695 | Ga0496104_0277265 | 3300048907 | Bacteria | 1590 |
| 696 | Ga0496105_0031202 | 3300048908 | Bacteria | 4369 |
| 697 | Ga0496105_0194522 | 3300048908 | Bacteria | 1657 |
| 698 | Ga0496105_0524199 | 3300048908 | Bacteria | 928 |
| 699 | Ga0496106_0114914 | 3300048909 | Bacteria | 2099 |
| 700 | Ga0496108_0119045 | 3300048911 | Bacteria | 2264 |
| 701 | Ga0496108_0184516 | 3300048911 | Bacteria | 1807 |
| 702 | Ga0496108_0195000 | 3300048911 | Bacteria | 1756 |
| 703 | Ga0496109_0000315 | 3300048912 | Bacteria | 45480 |
| 704 | Ga0496109_0050177 | 3300048912 | Bacteria | 3801 |
| 705 | Ga0496109_0129545 | 3300048912 | Bacteria | 2354 |
| 706 | Ga0496110_0025423 | 3300048913 | Bacteria | 5060 |
| 707 | Ga0496110_0183440 | 3300048913 | Bacteria | 1900 |
| 708 | Ga0496110_0343228 | 3300048913 | Bacteria | 1360 |
| 709 | Ga0496111_0203039 | 3300048914 | Bacteria | 1473 |
| 710 | Ga0496112_0120106 | 3300048915 | Bacteria | 2598 |
| 711 | Ga0496114_0080195 | 3300048917 | Bacteria | 2756 |
| 712 | Ga0496114_0084285 | 3300048917 | Bacteria | 2691 |
| 713 | Ga0496114_0177389 | 3300048917 | Bacteria | 1859 |
| 714 | Ga0496115_0075571 | 3300048918 | Bacteria | 2737 |
| 715 | Ga0496115_0234876 | 3300048918 | Bacteria | 1511 |
| 716 | Ga0496118_0007726 | 3300048921 | Bacteria | 11300 |
| 717 | Ga0496119_0023262 | 3300048922 | Bacteria | 4404 |
| 718 | Ga0496120_0024167 | 3300048923 | Bacteria | 3792 |
| 719 | Ga0496121_0000216 | 3300048924 | Bacteria | 127028 |
| 720 | Ga0496121_0000732 | 3300048924 | Bacteria | 60492 |
| 721 | Ga0496121_0086391 | 3300048924 | Bacteria | 2465 |
| 722 | Ga0496121_0178503 | 3300048924 | Bacteria | 1535 |
| 723 | Ga0496122_0014961 | 3300048925 | Bacteria | 7460 |
| 724 | Ga0496122_0114215 | 3300048925 | Bacteria | 1762 |
| 725 | Ga0496123_0002036 | 3300048926 | Bacteria | 26111 |
| 726 | Ga0496124_0017924 | 3300048927 | Bacteria | 6654 |
| 727 | Ga0496124_0019937 | 3300048927 | Bacteria | 6218 |
| 728 | Ga0496124_0054129 | 3300048927 | Bacteria | 3398 |
| 729 | Ga0496124_0067580 | 3300048927 | Bacteria | 2974 |
| 730 | Ga0496124_0220886 | 3300048927 | Bacteria | 1425 |
| 731 | Ga0496125_0000073 | 3300048928 | Bacteria | 236928 |
| 732 | Ga0496125_0056005 | 3300048928 | Bacteria | 3206 |
| 733 | Ga0496125_0069774 | 3300048928 | Bacteria | 2755 |
| 734 | Ga0496125_0196449 | 3300048928 | Bacteria | 1326 |
| 735 | Ga0496126_0000265 | 3300048929 | Bacteria | 111370 |
| 736 | Ga0496126_0031666 | 3300048929 | Bacteria | 4991 |
| 737 | Ga0496126_0031676 | 3300048929 | Bacteria | 4991 |
| 738 | Ga0496126_0044892 | 3300048929 | Bacteria | 4066 |
| 739 | Ga0496126_0073769 | 3300048929 | Bacteria | 3032 |
| 740 | Ga0496126_0147925 | 3300048929 | Bacteria | 2015 |
| 741 | Ga0496126_0523434 | 3300048929 | Bacteria | 944 |
| 742 | Ga0495678_000382 | 3300049459 | Bacteria | 44896 |
| 743 | Ga0501031_0008935 | 3300049568 | Bacteria | 6514 |
| 744 | Ga0501031_0116370 | 3300049568 | Bacteria | 1746 |
| 745 | Ga0501032_0006631 | 3300049569 | Bacteria | 8500 |
| 746 | Ga0501032_0008335 | 3300049569 | Bacteria | 7554 |
| 747 | Ga0501032_0046226 | 3300049569 | Bacteria | 2942 |
| 748 | Ga0501033_0009751 | 3300049570 | Bacteria | 7377 |
| 749 | Ga0501033_0041468 | 3300049570 | Bacteria | 3434 |
| 750 | Ga0501033_0046666 | 3300049570 | Bacteria | 3221 |
| 751 | Ga0501033_0081015 | 3300049570 | Bacteria | 2381 |
| 752 | Ga0501034_0025083 | 3300049571 | Bacteria | 6067 |
| 753 | Ga0501034_0055215 | 3300049571 | Bacteria | 3997 |
| 754 | Ga0501034_0175932 | 3300049571 | Bacteria | 2106 |
| 755 | Ga0501034_0187441 | 3300049571 | Bacteria | 2031 |
| 756 | Ga0501036_0055364 | 3300049572 | Bacteria | 3360 |
| 757 | Ga0501037_0007818 | 3300049573 | Bacteria | 7829 |
| 758 | Ga0501037_0038719 | 3300049573 | Bacteria | 3512 |
| 759 | Ga0501037_0113684 | 3300049573 | Bacteria | 1949 |
| 760 | Ga0501038_0023174 | 3300049574 | Bacteria | 5554 |
| 761 | Ga0501042_0005265 | 3300049578 | Bacteria | 8312 |
| 762 | Ga0501043_0069366 | 3300049579 | Bacteria | 2768 |
| 763 | Ga0501043_0142027 | 3300049579 | Bacteria | 1880 |
| 764 | Ga0501043_0240918 | 3300049579 | Bacteria | 1395 |
| 765 | Ga0501043_0513239 | 3300049579 | Bacteria | 894 |
| 766 | Ga0501046_0193743 | 3300049580 | Bacteria | 1515 |
| 767 | Ga0501047_0004338 | 3300049581 | Bacteria | 13356 |
| 768 | Ga0501047_0006647 | 3300049581 | Bacteria | 10870 |
| 769 | Ga0501047_0067509 | 3300049581 | Bacteria | 3446 |
| 770 | Ga0501047_0077803 | 3300049581 | Bacteria | 3190 |
| 771 | Ga0501047_0084763 | 3300049581 | Bacteria | 3045 |
| 772 | Ga0501047_0339601 | 3300049581 | Bacteria | 1340 |
| 773 | Ga0501048_0062620 | 3300049582 | Bacteria | 2632 |
| 774 | Ga0501070_0019514 | 3300049586 | Bacteria | 5686 |
| 775 | Ga0501071_0744721 | 3300049587 | Bacteria | 755 |
| 776 | Ga0501073_0072545 | 3300049589 | Bacteria | 2398 |
| 777 | Ga0501074_0057245 | 3300049590 | Bacteria | 2808 |
| 778 | Ga0501080_0146418 | 3300049742 | Bacteria | 2183 |
| 779 | Ga0501080_0357704 | 3300049742 | Bacteria | 1317 |
| 780 | Ga0501083_0000204 | 3300049744 | Bacteria | 38263 |
| 781 | Ga0501083_0009486 | 3300049744 | Bacteria | 6874 |
| 782 | Ga0501035_0159771 | 3300049822 | Bacteria | 1951 |
| 783 | Ga0501035_0268908 | 3300049822 | Bacteria | 1443 |
| 784 | Ga0501035_0370189 | 3300049822 | Bacteria | 1196 |
| 785 | Ga0501044_0015713 | 3300049823 | Bacteria | 8153 |
| 786 | Ga0501044_0032452 | 3300049823 | Bacteria | 5490 |
| 787 | Ga0501044_0043867 | 3300049823 | Bacteria | 4644 |
| 788 | Ga0501044_0050091 | 3300049823 | Bacteria | 4310 |
| 789 | Ga0501044_0196854 | 3300049823 | Bacteria | 1975 |
| 790 | nmdc:mga03683_175289_c1 | 3300050489 | Bacteria | 976 |
| 791 | nmdc:mga03683_90668_c1 | 3300050489 | Bacteria | 1332 |
| 792 | nmdc:mga03n38_234582_c1 | 3300050490 | Bacteria | 963 |
| 793 | nmdc:mga03n38_24003_c1 | 3300050490 | Bacteria | 2489 |
| 794 | nmdc:mga03n38_9938_c1 | 3300050490 | Bacteria | 3481 |
| 795 | nmdc:mga00v17_206932_c1 | 3300050491 | Bacteria | 1269 |
| 796 | nmdc:mga0yw44_112_c1 | 3300050492 | Bacteria | 28571 |
| 797 | nmdc:mga0yw44_30078_c1 | 3300050492 | Bacteria | 3143 |
| 798 | nmdc:mga0yw44_40667_c1 | 3300050492 | Bacteria | 2764 |
| 799 | nmdc:mga0yw44_69281_c1 | 3300050492 | Bacteria | 2184 |
| 800 | nmdc:mga06z11_2010_c1 | 3300050494 | Bacteria | 7704 |
| 801 | nmdc:mga04h51_14870_c1 | 3300050495 | Bacteria | 2233 |
| 802 | nmdc:mga07m45_167354_c1 | 3300050496 | Bacteria | 1277 |
| 803 | nmdc:mga07m45_24588_c1 | 3300050496 | Bacteria | 3302 |
| 804 | nmdc:mga05p37_113515_c1 | 3300050507 | Bacteria | 3331 |
| 805 | nmdc:mga05p37_455255_c1 | 3300050507 | Bacteria | 1480 |
| 806 | nmdc:mga05p37_886540_c1 | 3300050507 | Unclassified | 964 |
| 807 | nmdc:mga09592_5411_c1 | 3300050508 | Bacteria | 10373 |
| 808 | nmdc:mga0qj67_22672_c1 | 3300050509 | Plasmid | 4824 |
| 809 | nmdc:mga06r32_228056_c1 | 3300050510 | Unclassified | 1851 |
| 810 | nmdc:mga06r32_8006_c1 | 3300050510 | Bacteria | 9503 |
| 811 | nmdc:mga08y16_14940_c1 | 3300050511 | Bacteria | 8166 |
| 812 | nmdc:mga08y16_319880_c1 | 3300050511 | Bacteria | 1597 |
| 813 | nmdc:mga08y16_339477_c1 | 3300050511 | Bacteria | 1544 |
| 814 | nmdc:mga08y16_48705_c1 | 3300050511 | Bacteria | 4434 |
| 815 | nmdc:mga0n895_41425_c1 | 3300050512 | Bacteria | 4478 |
| 816 | nmdc:mga0rr50_24210_c1 | 3300050513 | Bacteria | 4202 |
| 817 | nmdc:mga0rr50_361965_c1 | 3300050513 | Bacteria | 1221 |
| 818 | nmdc:mga08x19_36329_c1 | 3300050514 | Bacteria | 3120 |
| 819 | nmdc:mga0a205_168538_c1 | 3300050515 | Bacteria | 2085 |
| 820 | nmdc:mga0a205_4768_c1 | 3300050515 | Bacteria | 12185 |
| 821 | nmdc:mga0sz30_69541_c1 | 3300050516 | Bacteria | 1514 |
| 822 | Ga0495601_0001643 | 3300053077 | Bacteria | 12333 |
| 823 | Ga0495601_0067361 | 3300053077 | Bacteria | 2281 |
| 824 | Ga0495612_0154630 | 3300053078 | Bacteria | 999 |
| 825 | Ga0495612_0345945 | 3300053078 | Bacteria | 671 |
| 826 | Ga0495619_0107364 | 3300053085 | Bacteria | 1904 |
| 827 | Ga0500578_0155740 | 3300053086 | Bacteria | 1421 |
| 828 | Ga0500643_061713 | 3300053087 | Bacteria | 1051 |
| 829 | Ga0500583_0133758 | 3300053092 | Bacteria | 1230 |
| 830 | Ga0500566_0037300 | 3300053094 | Bacteria | 2817 |
| 831 | Ga0500640_031019 | 3300053095 | Bacteria | 2342 |
| 832 | Ga0500641_0029541 | 3300053096 | Bacteria | 2148 |
| 833 | Ga0500650_0158098 | 3300053098 | Bacteria | 1046 |
| 834 | Ga0500553_142778 | 3300053101 | Bacteria | 940 |
| 835 | Ga0500554_000216 | 3300053102 | Bacteria | 12313 |
| 836 | Ga0500554_003422 | 3300053102 | Bacteria | 3247 |
| 837 | Ga0500555_071087 | 3300053103 | Bacteria | 919 |
| 838 | Ga0500569_117555 | 3300053109 | Bacteria | 883 |
| 839 | Ga0500572_003499 | 3300053111 | Bacteria | 3582 |
| 840 | Ga0500580_042563 | 3300053113 | Bacteria | 1922 |
| 841 | Ga0500595_003430 | 3300053119 | Bacteria | 7403 |
| 842 | Ga0500595_007000 | 3300053119 | Bacteria | 4727 |
| 843 | Ga0500595_117009 | 3300053119 | Bacteria | 755 |
| 844 | Ga0500614_054757 | 3300053123 | Bacteria | 1057 |
| 845 | Ga0500618_000389 | 3300053125 | Bacteria | 30138 |
| 846 | Ga0500618_009090 | 3300053125 | Bacteria | 2731 |
| 847 | Ga0500628_038040 | 3300053129 | Bacteria | 1084 |
| 848 | Ga0500642_0220743 | 3300053130 | Bacteria | 878 |
| 849 | Ga0500652_010498 | 3300053131 | Bacteria | 3175 |
| 850 | Ga0500658_0023991 | 3300053134 | Bacteria | 2334 |
| 851 | Ga0500568_0074637 | 3300053139 | Bacteria | 1294 |
| 852 | Ga0500573_0135194 | 3300053140 | Bacteria | 1362 |
| 853 | Ga0500577_0081400 | 3300053142 | Bacteria | 1292 |
| 854 | Ga0500589_155951 | 3300053147 | Bacteria | 923 |
| 855 | Ga0500600_0003279 | 3300053149 | Bacteria | 9310 |
| 856 | Ga0500603_000213 | 3300053150 | Bacteria | 15359 |
| 857 | Ga0500616_0170829 | 3300053153 | Bacteria | 987 |
| 858 | Ga0500624_002759 | 3300053157 | Bacteria | 2336 |
| 859 | Ga0500634_0003973 | 3300053161 | Bacteria | 6724 |
| 860 | Ga0500638_000053 | 3300053162 | Bacteria | 23611 |
| 861 | Ga0500636_0000830 | 3300053177 | Bacteria | 16649 |
| 862 | Ga0500637_0000149 | 3300053178 | Bacteria | 25364 |
| 863 | Ga0500656_007270 | 3300053732 | Bacteria | 1146 |
| 864 | Ga0500661_000226 | 3300055283 | Bacteria | 10060 |
| 865 | Ga0501082_0298908 | 3300060353 | Bacteria | 1402 |
| 866 | Ga0466962_0001430 | 3300061719 | Bacteria | 11124 |
| 867 | Ga0466962_0062845 | 3300061719 | Bacteria | 1773 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003322 | rootL2_10033936 | rootL2_100339365 | 192 |
| 2 | 3300026088 | Ga0207641_10585853 | Ga0207641_105858532 | 193 |
| 3 | 3300053092 | Ga0500583_0133758 | Ga0500583_0133758_584_1219 | 197 |
| 4 | 3300050513 | nmdc:mga0rr50_361965_c1 | nmdc:mga0rr50_361965_c1_14_652 | 198 |
| 5 | iso_pu_bacteria | 640427133 | 640488705 | 206 |
| 6 | 3300035086 | Ga0373934_0136200 | Ga0373934_0136200_10_645 | 207 |
| 7 | 3300053078 | Ga0495612_0345945 | Ga0495612_0345945_19_654 | 207 |
| 8 | 3300045976 | Ga0466967_0030588 | Ga0466967_0030588_2614_3384 | 212 |
| 9 | 3300048915 | Ga0496112_0120106 | Ga0496112_0120106_1906_2586 | 212 |
| 10 | 3300053109 | Ga0500569_117555 | Ga0500569_117555_156_863 | 213 |
| 11 | 3300048928 | Ga0496125_0196449 | Ga0496125_0196449_163_924 | 214 |
| 12 | 3300039437 | Ga0436365_0175813 | Ga0436365_0175813_2024_2740 | 216 |
| 13 | 3300047318 | Ga0495636_0060436 | Ga0495636_0060436_11_721 | 216 |
| 14 | 3300046501 | Ga0495607_0282064 | Ga0495607_0282064_69_764 | 217 |
| 15 | 3300048924 | Ga0496121_0178503 | Ga0496121_0178503_812_1522 | 217 |
| 16 | 3300049571 | Ga0501034_0025083 | Ga0501034_0025083_4122_4871 | 217 |
| 17 | 3300049823 | Ga0501044_0196854 | Ga0501044_0196854_375_1124 | 217 |
| 18 | 3300053096 | Ga0500641_0029541 | Ga0500641_0029541_969_1730 | 217 |
| 19 | 3300053119 | Ga0500595_117009 | Ga0500595_117009_19_738 | 217 |
| 20 | 3300053130 | Ga0500642_0220743 | Ga0500642_0220743_70_831 | 217 |
| 21 | 3300005331 | Ga0070670_100143050 | Ga0070670_1001430502 | 218 |
| 22 | 3300009551 | Ga0105238_10092613 | Ga0105238_100926132 | 218 |
| 23 | 3300017792 | Ga0163161_10221675 | Ga0163161_102216752 | 218 |
| 24 | 3300031901 | Ga0307406_10113393 | Ga0307406_101133932 | 218 |
| 25 | 3300046460 | Ga0495638_0212043 | Ga0495638_0212043_196_957 | 218 |
| 26 | 3300046616 | Ga0495668_0053528 | Ga0495668_0053528_1092_1853 | 218 |
| 27 | 3300049587 | Ga0501071_0744721 | Ga0501071_0744721_25_741 | 218 |
| 28 | 3300050511 | nmdc:mga08y16_319880_c1 | nmdc:mga08y16_319880_c1_491_1252 | 218 |
| 29 | 3300053086 | Ga0500578_0155740 | Ga0500578_0155740_403_1164 | 218 |
| 30 | 3300053103 | Ga0500555_071087 | Ga0500555_071087_71_832 | 218 |
| 31 | 3300005719 | Ga0068861_100296045 | Ga0068861_1002960452 | 219 |
| 32 | 3300006042 | Ga0075368_10079589 | Ga0075368_100795892 | 219 |
| 33 | 3300006177 | Ga0075362_10019548 | Ga0075362_100195482 | 219 |
| 34 | 3300027866 | Ga0209813_10084967 | Ga0209813_100849671 | 219 |
| 35 | 3300031901 | Ga0307406_10453554 | Ga0307406_104535542 | 219 |
| 36 | 3300032004 | Ga0307414_10053229 | Ga0307414_100532293 | 219 |
| 37 | 3300046542 | Ga0495597_0109430 | Ga0495597_0109430_416_1144 | 219 |
| 38 | 3300046690 | Ga0495624_0363465 | Ga0495624_0363465_36_764 | 219 |
| 39 | 3300046810 | Ga0495660_0068488 | Ga0495660_0068488_143_883 | 219 |
| 40 | 3300047315 | Ga0495581_0307746 | Ga0495581_0307746_185_901 | 219 |
| 41 | 3300047472 | Ga0495686_0058816 | Ga0495686_0058816_1054_1821 | 219 |
| 42 | 3300050490 | nmdc:mga03n38_24003_c1 | nmdc:mga03n38_24003_c1_410_1117 | 219 |
| 43 | 3300050495 | nmdc:mga04h51_14870_c1 | nmdc:mga04h51_14870_c1_15_722 | 219 |
| 44 | 3300006038 | Ga0075365_10063980 | Ga0075365_100639803 | 220 |
| 45 | 3300006051 | Ga0075364_10039785 | Ga0075364_100397851 | 220 |
| 46 | 3300006177 | Ga0075362_10066772 | Ga0075362_100667723 | 220 |
| 47 | 3300006186 | Ga0075369_10016597 | Ga0075369_100165973 | 220 |
| 48 | 3300009098 | Ga0105245_10690417 | Ga0105245_106904172 | 220 |
| 49 | 3300026041 | Ga0207639_10138747 | Ga0207639_101387473 | 220 |
| 50 | 3300031730 | Ga0307516_10004092 | Ga0307516_100040924 | 220 |
| 51 | 3300046452 | Ga0495617_028853 | Ga0495617_028853_864_1634 | 220 |
| 52 | 3300048927 | Ga0496124_0220886 | Ga0496124_0220886_562_1332 | 220 |
| 53 | 3300050489 | nmdc:mga03683_175289_c1 | nmdc:mga03683_175289_c1_38_760 | 220 |
| 54 | 3300050489 | nmdc:mga03683_90668_c1 | nmdc:mga03683_90668_c1_515_1285 | 220 |
| 55 | 3300050491 | nmdc:mga00v17_206932_c1 | nmdc:mga00v17_206932_c1_54_776 | 220 |
| 56 | 3300050492 | nmdc:mga0yw44_40667_c1 | nmdc:mga0yw44_40667_c1_599_1369 | 220 |
| 57 | 3300050507 | nmdc:mga05p37_113515_c1 | nmdc:mga05p37_113515_c1_191_961 | 220 |
| 58 | 3300050515 | nmdc:mga0a205_168538_c1 | nmdc:mga0a205_168538_c1_1207_1974 | 220 |
| 59 | 3300050516 | nmdc:mga0sz30_69541_c1 | nmdc:mga0sz30_69541_c1_161_931 | 220 |
| 60 | 3300053087 | Ga0500643_061713 | Ga0500643_061713_271_1041 | 220 |
| 61 | 3300053142 | Ga0500577_0081400 | Ga0500577_0081400_23_793 | 220 |
| 62 | 3300053147 | Ga0500589_155951 | Ga0500589_155951_135_905 | 220 |
| 63 | iso_pu_bacteria | 2808606379 | 2808942693 | 220 |
| 64 | 3300005327 | Ga0070658_10216466 | Ga0070658_102164662 | 221 |
| 65 | 3300005334 | Ga0068869_100250063 | Ga0068869_1002500632 | 221 |
| 66 | 3300005353 | Ga0070669_100086582 | Ga0070669_1000865822 | 221 |
| 67 | 3300005457 | Ga0070662_100372651 | Ga0070662_1003726512 | 221 |
| 68 | 3300005843 | Ga0068860_100129848 | Ga0068860_1001298482 | 221 |
| 69 | 3300005844 | Ga0068862_100086716 | Ga0068862_1000867162 | 221 |
| 70 | 3300009092 | Ga0105250_10175416 | Ga0105250_101754161 | 221 |
| 71 | 3300009174 | Ga0105241_10292487 | Ga0105241_102924873 | 221 |
| 72 | 3300025923 | Ga0207681_10084424 | Ga0207681_100844242 | 221 |
| 73 | 3300025929 | Ga0207664_10938293 | Ga0207664_109382931 | 221 |
| 74 | 3300025933 | Ga0207706_10126572 | Ga0207706_101265722 | 221 |
| 75 | 3300025942 | Ga0207689_10293197 | Ga0207689_102931972 | 221 |
| 76 | 3300025972 | Ga0207668_10164736 | Ga0207668_101647362 | 221 |
| 77 | 3300026089 | Ga0207648_10153106 | Ga0207648_101531063 | 221 |
| 78 | 3300026118 | Ga0207675_100157313 | Ga0207675_1001573132 | 221 |
| 79 | 3300028380 | Ga0268265_10111826 | Ga0268265_101118262 | 221 |
| 80 | 3300044693 | Ga0466961_0384301 | Ga0466961_0384301_22_729 | 221 |
| 81 | 3300044735 | Ga0466968_0086510 | Ga0466968_0086510_22_729 | 221 |
| 82 | 3300048905 | Ga0496102_0505074 | Ga0496102_0505074_65_838 | 221 |
| 83 | 3300048917 | Ga0496114_0084285 | Ga0496114_0084285_640_1410 | 221 |
| 84 | 3300048924 | Ga0496121_0086391 | Ga0496121_0086391_1361_2134 | 221 |
| 85 | 3300005330 | Ga0070690_100361843 | Ga0070690_1003618432 | 222 |
| 86 | 3300005344 | Ga0070661_100198869 | Ga0070661_1001988691 | 222 |
| 87 | 3300005347 | Ga0070668_100123061 | Ga0070668_1001230612 | 222 |
| 88 | 3300005356 | Ga0070674_100164204 | Ga0070674_1001642041 | 222 |
| 89 | 3300005539 | Ga0068853_100126244 | Ga0068853_1001262442 | 222 |
| 90 | 3300005548 | Ga0070665_100169556 | Ga0070665_1001695562 | 222 |
| 91 | 3300005614 | Ga0068856_100746448 | Ga0068856_1007464481 | 222 |
| 92 | 3300005719 | Ga0068861_100226373 | Ga0068861_1002263732 | 222 |
| 93 | 3300005841 | Ga0068863_100114888 | Ga0068863_1001148882 | 222 |
| 94 | 3300005842 | Ga0068858_100288269 | Ga0068858_1002882692 | 222 |
| 95 | 3300006038 | Ga0075365_10029915 | Ga0075365_100299153 | 222 |
| 96 | 3300006051 | Ga0075364_10078219 | Ga0075364_100782192 | 222 |
| 97 | 3300006358 | Ga0068871_100192267 | Ga0068871_1001922672 | 222 |
| 98 | 3300007076 | Ga0075435_100247358 | Ga0075435_1002473582 | 222 |
| 99 | 3300009098 | Ga0105245_10116651 | Ga0105245_101166512 | 222 |
| 100 | 3300009148 | Ga0105243_10108545 | Ga0105243_101085452 | 222 |
| 101 | 3300009174 | Ga0105241_10011484 | Ga0105241_100114846 | 222 |
| 102 | 3300009545 | Ga0105237_10317216 | Ga0105237_103172162 | 222 |
| 103 | 3300010159 | Ga0099796_10016663 | Ga0099796_100166632 | 222 |
| 104 | 3300013308 | Ga0157375_10807322 | Ga0157375_108073222 | 222 |
| 105 | 3300014745 | Ga0157377_10033791 | Ga0157377_100337912 | 222 |
| 106 | 3300025911 | Ga0207654_10014624 | Ga0207654_100146242 | 222 |
| 107 | 3300026095 | Ga0207676_10051154 | Ga0207676_100511543 | 222 |
| 108 | 3300026116 | Ga0207674_10317332 | Ga0207674_103173322 | 222 |
| 109 | 3300026118 | Ga0207675_100038277 | Ga0207675_1000382773 | 222 |
| 110 | 3300028379 | Ga0268266_10053275 | Ga0268266_100532752 | 222 |
| 111 | 3300033180 | Ga0307510_10203101 | Ga0307510_102031011 | 222 |
| 112 | 3300038741 | Ga0400488_14442 | Ga0400488_14442_620_1330 | 222 |
| 113 | 3300041413 | Ga0439465_0024664 | Ga0439465_0024664_370_1191 | 222 |
| 114 | 3300046648 | Ga0495611_0112960 | Ga0495611_0112960_499_1227 | 222 |
| 115 | 3300048905 | Ga0496102_0131622 | Ga0496102_0131622_1247_2020 | 222 |
| 116 | 3300048907 | Ga0496104_0246582 | Ga0496104_0246582_914_1687 | 222 |
| 117 | 3300048909 | Ga0496106_0114914 | Ga0496106_0114914_1041_1814 | 222 |
| 118 | 3300048911 | Ga0496108_0184516 | Ga0496108_0184516_215_988 | 222 |
| 119 | 3300031824 | Ga0307413_10029742 | Ga0307413_100297423 | 223 |
| 120 | 3300042157 | Ga0439458_0010452 | Ga0439458_0010452_875_1651 | 223 |
| 121 | 3300046674 | Ga0495588_0021738 | Ga0495588_0021738_1541_2323 | 223 |
| 122 | 3300046810 | Ga0495660_0191960 | Ga0495660_0191960_38_820 | 223 |
| 123 | 3300047321 | Ga0495676_0108391 | Ga0495676_0108391_419_1201 | 223 |
| 124 | 3300047445 | Ga0495677_0072921 | Ga0495677_0072921_173_955 | 223 |
| 125 | 3300005457 | Ga0070662_100138823 | Ga0070662_1001388232 | 224 |
| 126 | 3300005535 | Ga0070684_100333307 | Ga0070684_1003333072 | 224 |
| 127 | 3300005983 | Ga0081540_1002357 | Ga0081540_10023577 | 224 |
| 128 | 3300009094 | Ga0111539_10110632 | Ga0111539_101106323 | 224 |
| 129 | 3300009551 | Ga0105238_10192548 | Ga0105238_101925482 | 224 |
| 130 | 3300010375 | Ga0105239_10584221 | Ga0105239_105842212 | 224 |
| 131 | 3300013105 | Ga0157369_10010836 | Ga0157369_100108363 | 224 |
| 132 | 3300014325 | Ga0163163_10862600 | Ga0163163_108626001 | 224 |
| 133 | 3300025904 | Ga0207647_10154094 | Ga0207647_101540942 | 224 |
| 134 | 3300025933 | Ga0207706_10036247 | Ga0207706_100362474 | 224 |
| 135 | 3300026067 | Ga0207678_10036762 | Ga0207678_100367624 | 224 |
| 136 | 3300026075 | Ga0207708_10142716 | Ga0207708_101427162 | 224 |
| 137 | 3300026118 | Ga0207675_100052667 | Ga0207675_1000526674 | 224 |
| 138 | 3300044683 | Ga0466965_0048074 | Ga0466965_0048074_1114_1890 | 224 |
| 139 | 3300046473 | Ga0495582_0116310 | Ga0495582_0116310_198_980 | 224 |
| 140 | 3300046518 | Ga0495631_0190039 | Ga0495631_0190039_45_827 | 224 |
| 141 | 3300046539 | Ga0495621_0079636 | Ga0495621_0079636_180_962 | 224 |
| 142 | 3300046557 | Ga0495622_0089411 | Ga0495622_0089411_190_972 | 224 |
| 143 | 3300046558 | Ga0495633_0116036 | Ga0495633_0116036_241_1023 | 224 |
| 144 | 3300046615 | Ga0495656_0028697 | Ga0495656_0028697_554_1336 | 224 |
| 145 | 3300046664 | Ga0495659_0139015 | Ga0495659_0139015_150_932 | 224 |
| 146 | 3300046684 | Ga0495669_0068292 | Ga0495669_0068292_793_1575 | 224 |
| 147 | 3300048905 | Ga0496102_0395634 | Ga0496102_0395634_146_928 | 224 |
| 148 | 3300048907 | Ga0496104_0208079 | Ga0496104_0208079_976_1749 | 224 |
| 149 | 3300048908 | Ga0496105_0194522 | Ga0496105_0194522_528_1301 | 224 |
| 150 | 3300048911 | Ga0496108_0195000 | Ga0496108_0195000_819_1592 | 224 |
| 151 | 3300048912 | Ga0496109_0129545 | Ga0496109_0129545_316_1089 | 224 |
| 152 | 3300048914 | Ga0496111_0203039 | Ga0496111_0203039_78_851 | 224 |
| 153 | 3300049569 | Ga0501032_0006631 | Ga0501032_0006631_4708_5424 | 224 |
| 154 | 3300049573 | Ga0501037_0038719 | Ga0501037_0038719_2167_2883 | 224 |
| 155 | 3300050511 | nmdc:mga08y16_48705_c1 | nmdc:mga08y16_48705_c1_920_1702 | 224 |
| 156 | 3300013306 | Ga0163162_10815544 | Ga0163162_108155442 | 225 |
| 157 | 3300041404 | Ga0439436_0003644 | Ga0439436_0003644_2345_3103 | 225 |
| 158 | 3300041406 | Ga0439439_0001165 | Ga0439439_0001165_1245_2003 | 225 |
| 159 | 3300041999 | Ga0439433_0002581 | Ga0439433_0002581_873_1631 | 225 |
| 160 | 3300042002 | Ga0439442_008450 | Ga0439442_008450_1293_2051 | 225 |
| 161 | 3300042014 | Ga0439457_001044 | Ga0439457_001044_2217_2975 | 225 |
| 162 | 3300042015 | Ga0439462_0020429 | Ga0439462_0020429_53_811 | 225 |
| 163 | 3300046518 | Ga0495631_0051596 | Ga0495631_0051596_24_746 | 225 |
| 164 | 3300048907 | Ga0496104_0277265 | Ga0496104_0277265_18_746 | 225 |
| 165 | 3300048925 | Ga0496122_0114215 | Ga0496122_0114215_602_1342 | 225 |
| 166 | 3300046520 | Ga0495637_0127525 | Ga0495637_0127525_231_953 | 226 |
| 167 | 3300005457 | Ga0070662_100269236 | Ga0070662_1002692362 | 227 |
| 168 | 3300005719 | Ga0068861_100021041 | Ga0068861_1000210412 | 227 |
| 169 | 3300006058 | Ga0075432_10000367 | Ga0075432_100003678 | 227 |
| 170 | 3300006844 | Ga0075428_100009319 | Ga0075428_1000093197 | 227 |
| 171 | 3300006846 | Ga0075430_100133963 | Ga0075430_1001339632 | 227 |
| 172 | 3300006852 | Ga0075433_10004818 | Ga0075433_1000481811 | 227 |
| 173 | 3300006871 | Ga0075434_100007683 | Ga0075434_1000076834 | 227 |
| 174 | 3300006880 | Ga0075429_100014062 | Ga0075429_1000140624 | 227 |
| 175 | 3300006881 | Ga0068865_100148720 | Ga0068865_1001487202 | 227 |
| 176 | 3300006914 | Ga0075436_100029385 | Ga0075436_1000293853 | 227 |
| 177 | 3300007076 | Ga0075435_100002860 | Ga0075435_1000028602 | 227 |
| 178 | 3300009094 | Ga0111539_10010908 | Ga0111539_100109086 | 227 |
| 179 | 3300009098 | Ga0105245_10024804 | Ga0105245_100248044 | 227 |
| 180 | 3300009147 | Ga0114129_10015367 | Ga0114129_100153675 | 227 |
| 181 | 3300009553 | Ga0105249_10188211 | Ga0105249_101882113 | 227 |
| 182 | 3300013306 | Ga0163162_10380193 | Ga0163162_103801932 | 227 |
| 183 | 3300013307 | Ga0157372_10366859 | Ga0157372_103668592 | 227 |
| 184 | 3300013307 | Ga0157372_10541015 | Ga0157372_105410152 | 227 |
| 185 | 3300025901 | Ga0207688_10201075 | Ga0207688_102010752 | 227 |
| 186 | 3300025924 | Ga0207694_10159429 | Ga0207694_101594292 | 227 |
| 187 | 3300025938 | Ga0207704_10108668 | Ga0207704_101086682 | 227 |
| 188 | 3300025961 | Ga0207712_10274965 | Ga0207712_102749652 | 227 |
| 189 | 3300026118 | Ga0207675_100024426 | Ga0207675_1000244264 | 227 |
| 190 | 3300027907 | Ga0207428_10000706 | Ga0207428_1000070627 | 227 |
| 191 | 3300033179 | Ga0307507_10024788 | Ga0307507_100247886 | 227 |
| 192 | 3300041405 | Ga0439438_000453 | Ga0439438_000453_13932_14657 | 227 |
| 193 | 3300050508 | nmdc:mga09592_5411_c1 | nmdc:mga09592_5411_c1_3131_3913 | 227 |
| 194 | 3300050510 | nmdc:mga06r32_8006_c1 | nmdc:mga06r32_8006_c1_5692_6474 | 227 |
| 195 | 3300050511 | nmdc:mga08y16_14940_c1 | nmdc:mga08y16_14940_c1_6748_7530 | 227 |
| 196 | 3300050512 | nmdc:mga0n895_41425_c1 | nmdc:mga0n895_41425_c1_860_1642 | 227 |
| 197 | 3300050513 | nmdc:mga0rr50_24210_c1 | nmdc:mga0rr50_24210_c1_1413_2195 | 227 |
| 198 | 3300050514 | nmdc:mga08x19_36329_c1 | nmdc:mga08x19_36329_c1_1084_1866 | 227 |
| 199 | 3300050515 | nmdc:mga0a205_4768_c1 | nmdc:mga0a205_4768_c1_2658_3440 | 227 |
| 200 | 3300006038 | Ga0075365_10319331 | Ga0075365_103193312 | 228 |
| 201 | 3300033180 | Ga0307510_10212540 | Ga0307510_102125402 | 228 |
| 202 | 3300044683 | Ga0466965_0021514 | Ga0466965_0021514_2281_3054 | 228 |
| 203 | 3300045976 | Ga0466967_0485282 | Ga0466967_0485282_18_761 | 228 |
| 204 | 3300005438 | Ga0070701_10191800 | Ga0070701_101918002 | 229 |
| 205 | 3300006038 | Ga0075365_10057240 | Ga0075365_100572402 | 229 |
| 206 | 3300025901 | Ga0207688_10083853 | Ga0207688_100838532 | 229 |
| 207 | 3300031456 | Ga0307513_10197139 | Ga0307513_101971392 | 229 |
| 208 | 3300045976 | Ga0466967_0097359 | Ga0466967_0097359_1408_2193 | 229 |
| 209 | 3300046515 | Ga0495620_0032288 | Ga0495620_0032288_1114_1875 | 229 |
| 210 | 3300046692 | Ga0495671_0057638 | Ga0495671_0057638_657_1418 | 229 |
| 211 | 3300048929 | Ga0496126_0044892 | Ga0496126_0044892_357_1118 | 229 |
| 212 | 3300050492 | nmdc:mga0yw44_30078_c1 | nmdc:mga0yw44_30078_c1_2237_2998 | 229 |
| 213 | 3300050496 | nmdc:mga07m45_167354_c1 | nmdc:mga07m45_167354_c1_500_1261 | 229 |
| 214 | 3300003758 | Ga0055532_1007244 | Ga0055532_10072441 | 230 |
| 215 | 3300025229 | Ga0209147_101597 | Ga0209147_1015975 | 230 |
| 216 | 3300035171 | Ga0373946_0041580 | Ga0373946_0041580_785_1555 | 230 |
| 217 | 3300005937 | Ga0081455_10049743 | Ga0081455_100497434 | 231 |
| 218 | 3300013297 | Ga0157378_10007645 | Ga0157378_100076452 | 231 |
| 219 | 3300028794 | Ga0307515_10217621 | Ga0307515_102176212 | 231 |
| 220 | 3300033180 | Ga0307510_10015733 | Ga0307510_1001573310 | 231 |
| 221 | 3300035692 | Ga0373935_0477141 | Ga0373935_0477141_50_811 | 231 |
| 222 | 3300039450 | Ga0436363_1332597 | Ga0436363_1332597_129_899 | 231 |
| 223 | 3300041456 | Ga0451795_0444049 | Ga0451795_0444049_724_1494 | 231 |
| 224 | 3300046455 | Ga0495603_0001798 | Ga0495603_0001798_2744_3514 | 231 |
| 225 | 3300046477 | Ga0495664_0073467 | Ga0495664_0073467_67_834 | 231 |
| 226 | 3300046477 | Ga0495664_0380693 | Ga0495664_0380693_62_823 | 231 |
| 227 | 3300046543 | Ga0495645_0357339 | Ga0495645_0357339_87_848 | 231 |
| 228 | 3300053102 | Ga0500554_000216 | Ga0500554_000216_7517_8287 | 231 |
| 229 | 3300053150 | Ga0500603_000213 | Ga0500603_000213_5975_6745 | 231 |
| 230 | 3300053178 | Ga0500637_0000149 | Ga0500637_0000149_20503_21273 | 231 |
| 231 | 3300060353 | Ga0501082_0298908 | Ga0501082_0298908_505_1275 | 231 |
| 232 | iso_pu_bacteria | 2917736166 | 2917739595 | 231 |
| 233 | iso_pu_bacteria | 651053060 | 651176754 | 231 |
| 234 | iso_pu_bacteria | 8057160832 | 8057161307 | 231 |
| 235 | 3300003751 | Ga0055538_1000078 | Ga0055538_100007852 | 232 |
| 236 | 3300005288 | Ga0065714_10003968 | Ga0065714_100039684 | 232 |
| 237 | 3300005844 | Ga0068862_100259672 | Ga0068862_1002596722 | 232 |
| 238 | 3300007788 | Ga0099795_10082104 | Ga0099795_100821042 | 232 |
| 239 | 3300009148 | Ga0105243_10374442 | Ga0105243_103744422 | 232 |
| 240 | 3300009551 | Ga0105238_10254646 | Ga0105238_102546462 | 232 |
| 241 | 3300026121 | Ga0207683_10119042 | Ga0207683_101190423 | 232 |
| 242 | 3300028380 | Ga0268265_10283467 | Ga0268265_102834672 | 232 |
| 243 | 3300035113 | Ga0373936_0007027 | Ga0373936_0007027_260_1030 | 232 |
| 244 | 3300035116 | Ga0373945_0040951 | Ga0373945_0040951_649_1419 | 232 |
| 245 | 3300035692 | Ga0373935_0001717 | Ga0373935_0001717_10660_11430 | 232 |
| 246 | 3300035695 | Ga0373927_0001560 | Ga0373927_0001560_7041_7811 | 232 |
| 247 | 3300035725 | Ga0373947_0154875 | Ga0373947_0154875_477_1247 | 232 |
| 248 | 3300036401 | Ga0373937_0017600 | Ga0373937_0017600_453_1223 | 232 |
| 249 | 3300037068 | Ga0373925_0002416 | Ga0373925_0002416_2142_2912 | 232 |
| 250 | 3300041494 | Ga0451837_0485700 | Ga0451837_0485700_1346_2140 | 232 |
| 251 | 3300046454 | Ga0495592_0360769 | Ga0495592_0360769_20_790 | 232 |
| 252 | 3300046455 | Ga0495603_0000356 | Ga0495603_0000356_22989_23759 | 232 |
| 253 | 3300046459 | Ga0495629_0000087 | Ga0495629_0000087_43734_44504 | 232 |
| 254 | 3300046461 | Ga0495641_0003485 | Ga0495641_0003485_7757_8527 | 232 |
| 255 | 3300046463 | Ga0495653_0028857 | Ga0495653_0028857_118_888 | 232 |
| 256 | 3300046473 | Ga0495582_0004609 | Ga0495582_0004609_1919_2689 | 232 |
| 257 | 3300046475 | Ga0495639_0000022 | Ga0495639_0000022_22171_22941 | 232 |
| 258 | 3300046476 | Ga0495662_0001463 | Ga0495662_0001463_827_1597 | 232 |
| 259 | 3300046477 | Ga0495664_0082815 | Ga0495664_0082815_118_888 | 232 |
| 260 | 3300046499 | Ga0495594_0000169 | Ga0495594_0000169_15052_15822 | 232 |
| 261 | 3300046506 | Ga0495583_0008269 | Ga0495583_0008269_3901_4641 | 232 |
| 262 | 3300046516 | Ga0495628_0019565 | Ga0495628_0019565_1999_2769 | 232 |
| 263 | 3300046517 | Ga0495630_0002076 | Ga0495630_0002076_9917_10687 | 232 |
| 264 | 3300046531 | Ga0495665_0004349 | Ga0495665_0004349_6472_7242 | 232 |
| 265 | 3300046533 | Ga0495640_0018265 | Ga0495640_0018265_2155_2925 | 232 |
| 266 | 3300046559 | Ga0495667_0003542 | Ga0495667_0003542_2805_3575 | 232 |
| 267 | 3300046642 | Ga0495634_0006461 | Ga0495634_0006461_1025_1795 | 232 |
| 268 | 3300046663 | Ga0495635_0008558 | Ga0495635_0008558_4092_4862 | 232 |
| 269 | 3300046674 | Ga0495588_0003260 | Ga0495588_0003260_2585_3355 | 232 |
| 270 | 3300046678 | Ga0495599_0120783 | Ga0495599_0120783_724_1494 | 232 |
| 271 | 3300046681 | Ga0495647_0000258 | Ga0495647_0000258_13226_13996 | 232 |
| 272 | 3300046683 | Ga0495658_0001900 | Ga0495658_0001900_3854_4624 | 232 |
| 273 | 3300046689 | Ga0495613_0006831 | Ga0495613_0006831_3883_4653 | 232 |
| 274 | 3300046690 | Ga0495624_0010406 | Ga0495624_0010406_2046_2816 | 232 |
| 275 | 3300047315 | Ga0495581_0000161 | Ga0495581_0000161_9909_10679 | 232 |
| 276 | 3300047319 | Ga0495674_0000805 | Ga0495674_0000805_25873_26643 | 232 |
| 277 | 3300047444 | Ga0495675_0276163 | Ga0495675_0276163_72_839 | 232 |
| 278 | 3300047471 | Ga0495684_0091838 | Ga0495684_0091838_1314_2084 | 232 |
| 279 | 3300047673 | Ga0495593_0000042 | Ga0495593_0000042_28759_29529 | 232 |
| 280 | 3300048089 | Ga0495614_0013088 | Ga0495614_0013088_1143_1913 | 232 |
| 281 | 3300048924 | Ga0496121_0000732 | Ga0496121_0000732_15429_16196 | 232 |
| 282 | 3300053077 | Ga0495601_0067361 | Ga0495601_0067361_146_916 | 232 |
| 283 | 3300053119 | Ga0500595_007000 | Ga0500595_007000_3203_3970 | 232 |
| 284 | iso_pu_bacteria | 2582581314 | 2585316902 | 232 |
| 285 | iso_pu_bacteria | 2643221690 | 2644502667 | 232 |
| 286 | iso_pu_bacteria | 2643221694 | 2644525041 | 232 |
| 287 | iso_pu_bacteria | 2643221722 | 2644669128 | 232 |
| 288 | iso_pu_bacteria | 8003314358 | 8003319539 | 232 |
| 289 | 3300003203 | JGI25406J46586_10020592 | JGI25406J46586_100205923 | 233 |
| 290 | 3300005329 | Ga0070683_100010912 | Ga0070683_1000109124 | 233 |
| 291 | 3300005331 | Ga0070670_100304917 | Ga0070670_1003049172 | 233 |
| 292 | 3300005331 | Ga0070670_100462072 | Ga0070670_1004620721 | 233 |
| 293 | 3300005337 | Ga0070682_100063807 | Ga0070682_1000638073 | 233 |
| 294 | 3300005344 | Ga0070661_100105058 | Ga0070661_1001050582 | 233 |
| 295 | 3300005458 | Ga0070681_10085409 | Ga0070681_100854094 | 233 |
| 296 | 3300005530 | Ga0070679_100018059 | Ga0070679_1000180593 | 233 |
| 297 | 3300005535 | Ga0070684_100015276 | Ga0070684_1000152765 | 233 |
| 298 | 3300005563 | Ga0068855_100361771 | Ga0068855_1003617712 | 233 |
| 299 | 3300005578 | Ga0068854_100733481 | Ga0068854_1007334811 | 233 |
| 300 | 3300005985 | Ga0081539_10000366 | Ga0081539_1000036658 | 233 |
| 301 | 3300013105 | Ga0157369_10045795 | Ga0157369_100457954 | 233 |
| 302 | 3300025297 | Ga0209758_1028198 | Ga0209758_10281982 | 233 |
| 303 | 3300025906 | Ga0207699_10145127 | Ga0207699_101451272 | 233 |
| 304 | 3300025912 | Ga0207707_10001525 | Ga0207707_1000152520 | 233 |
| 305 | 3300025913 | Ga0207695_10185086 | Ga0207695_101850862 | 233 |
| 306 | 3300025914 | Ga0207671_10196832 | Ga0207671_101968322 | 233 |
| 307 | 3300025917 | Ga0207660_10009614 | Ga0207660_100096144 | 233 |
| 308 | 3300025920 | Ga0207649_10096185 | Ga0207649_100961851 | 233 |
| 309 | 3300025921 | Ga0207652_10042144 | Ga0207652_100421442 | 233 |
| 310 | 3300025921 | Ga0207652_10051372 | Ga0207652_100513722 | 233 |
| 311 | 3300025942 | Ga0207689_10109560 | Ga0207689_101095602 | 233 |
| 312 | 3300025944 | Ga0207661_10147736 | Ga0207661_101477362 | 233 |
| 313 | 3300025944 | Ga0207661_10852886 | Ga0207661_108528861 | 233 |
| 314 | 3300025949 | Ga0207667_10335745 | Ga0207667_103357452 | 233 |
| 315 | 3300026041 | Ga0207639_10198861 | Ga0207639_101988612 | 233 |
| 316 | 3300026067 | Ga0207678_10030951 | Ga0207678_100309516 | 233 |
| 317 | 3300026116 | Ga0207674_10020811 | Ga0207674_100208117 | 233 |
| 318 | 3300031903 | Ga0307407_10547107 | Ga0307407_105471071 | 233 |
| 319 | 3300035111 | Ga0373923_0194604 | Ga0373923_0194604_11_781 | 233 |
| 320 | 3300035113 | Ga0373936_0007241 | Ga0373936_0007241_2082_2852 | 233 |
| 321 | 3300035171 | Ga0373946_0291885 | Ga0373946_0291885_11_781 | 233 |
| 322 | 3300035695 | Ga0373927_0041650 | Ga0373927_0041650_1918_2688 | 233 |
| 323 | 3300035725 | Ga0373947_0052206 | Ga0373947_0052206_571_1341 | 233 |
| 324 | 3300036401 | Ga0373937_0164480 | Ga0373937_0164480_446_1216 | 233 |
| 325 | 3300037068 | Ga0373925_0171043 | Ga0373925_0171043_320_1090 | 233 |
| 326 | 3300041405 | Ga0439438_000829 | Ga0439438_000829_2035_2781 | 233 |
| 327 | 3300041407 | Ga0439447_001186 | Ga0439447_001186_1752_2498 | 233 |
| 328 | 3300041411 | Ga0439466_0011204 | Ga0439466_0011204_1926_2672 | 233 |
| 329 | 3300042006 | Ga0439432_002880 | Ga0439432_002880_2012_2758 | 233 |
| 330 | 3300042010 | Ga0439452_001698 | Ga0439452_001698_6091_6837 | 233 |
| 331 | 3300042125 | Ga0450923_001643 | Ga0450923_001643_720_1466 | 233 |
| 332 | 3300042156 | Ga0439446_0010479 | Ga0439446_0010479_1666_2412 | 233 |
| 333 | 3300042435 | Ga0439434_0031543 | Ga0439434_0031543_828_1574 | 233 |
| 334 | 3300046459 | Ga0495629_0191217 | Ga0495629_0191217_548_1318 | 233 |
| 335 | 3300046472 | Ga0495580_0187728 | Ga0495580_0187728_474_1244 | 233 |
| 336 | 3300046477 | Ga0495664_0102750 | Ga0495664_0102750_797_1567 | 233 |
| 337 | 3300046533 | Ga0495640_0230048 | Ga0495640_0230048_327_1097 | 233 |
| 338 | 3300046543 | Ga0495645_0205443 | Ga0495645_0205443_89_859 | 233 |
| 339 | 3300046559 | Ga0495667_0258210 | Ga0495667_0258210_70_840 | 233 |
| 340 | 3300046642 | Ga0495634_0106683 | Ga0495634_0106683_62_832 | 233 |
| 341 | 3300046663 | Ga0495635_0355194 | Ga0495635_0355194_11_781 | 233 |
| 342 | 3300046675 | Ga0495657_0236014 | Ga0495657_0236014_272_1039 | 233 |
| 343 | 3300046681 | Ga0495647_0128098 | Ga0495647_0128098_238_1008 | 233 |
| 344 | 3300046683 | Ga0495658_0037206 | Ga0495658_0037206_509_1279 | 233 |
| 345 | 3300046689 | Ga0495613_0197246 | Ga0495613_0197246_156_926 | 233 |
| 346 | 3300047315 | Ga0495581_0148365 | Ga0495581_0148365_335_1105 | 233 |
| 347 | 3300047317 | Ga0495604_0323100 | Ga0495604_0323100_11_781 | 233 |
| 348 | 3300047319 | Ga0495674_0316402 | Ga0495674_0316402_491_1261 | 233 |
| 349 | 3300047471 | Ga0495684_0009071 | Ga0495684_0009071_6521_7291 | 233 |
| 350 | 3300048912 | Ga0496109_0000315 | Ga0496109_0000315_1074_1847 | 233 |
| 351 | 3300048929 | Ga0496126_0073769 | Ga0496126_0073769_915_1682 | 233 |
| 352 | 3300050490 | nmdc:mga03n38_9938_c1 | nmdc:mga03n38_9938_c1_2699_3466 | 233 |
| 353 | 3300053098 | Ga0500650_0158098 | Ga0500650_0158098_38_808 | 233 |
| 354 | 3300003215 | JGI25153J46596_10005638 | JGI25153J46596_100056388 | 234 |
| 355 | 3300005330 | Ga0070690_100178577 | Ga0070690_1001785772 | 234 |
| 356 | 3300005336 | Ga0070680_100036774 | Ga0070680_1000367745 | 234 |
| 357 | 3300005356 | Ga0070674_100013133 | Ga0070674_1000131332 | 234 |
| 358 | 3300005366 | Ga0070659_100087500 | Ga0070659_1000875003 | 234 |
| 359 | 3300005435 | Ga0070714_100060184 | Ga0070714_1000601844 | 234 |
| 360 | 3300005438 | Ga0070701_10063609 | Ga0070701_100636092 | 234 |
| 361 | 3300005455 | Ga0070663_100100056 | Ga0070663_1001000562 | 234 |
| 362 | 3300005456 | Ga0070678_100089913 | Ga0070678_1000899132 | 234 |
| 363 | 3300005458 | Ga0070681_10206222 | Ga0070681_102062223 | 234 |
| 364 | 3300005459 | Ga0068867_100013927 | Ga0068867_1000139272 | 234 |
| 365 | 3300005539 | Ga0068853_100275185 | Ga0068853_1002751852 | 234 |
| 366 | 3300005548 | Ga0070665_100394545 | Ga0070665_1003945452 | 234 |
| 367 | 3300005563 | Ga0068855_100079887 | Ga0068855_1000798875 | 234 |
| 368 | 3300005614 | Ga0068856_100001981 | Ga0068856_1000019815 | 234 |
| 369 | 3300005842 | Ga0068858_100237967 | Ga0068858_1002379672 | 234 |
| 370 | 3300005937 | Ga0081455_10024373 | Ga0081455_100243735 | 234 |
| 371 | 3300006028 | Ga0070717_10361128 | Ga0070717_103611281 | 234 |
| 372 | 3300006178 | Ga0075367_10140894 | Ga0075367_101408942 | 234 |
| 373 | 3300006881 | Ga0068865_100101680 | Ga0068865_1001016802 | 234 |
| 374 | 3300009148 | Ga0105243_10077812 | Ga0105243_100778122 | 234 |
| 375 | 3300009551 | Ga0105238_10595616 | Ga0105238_105956162 | 234 |
| 376 | 3300009553 | Ga0105249_10617704 | Ga0105249_106177041 | 234 |
| 377 | 3300013104 | Ga0157370_10038272 | Ga0157370_100382725 | 234 |
| 378 | 3300013297 | Ga0157378_10172604 | Ga0157378_101726042 | 234 |
| 379 | 3300013307 | Ga0157372_10348336 | Ga0157372_103483362 | 234 |
| 380 | 3300017792 | Ga0163161_10245798 | Ga0163161_102457982 | 234 |
| 381 | 3300025297 | Ga0209758_1002140 | Ga0209758_100214022 | 234 |
| 382 | 3300025909 | Ga0207705_10133712 | Ga0207705_101337122 | 234 |
| 383 | 3300025912 | Ga0207707_10309072 | Ga0207707_103090721 | 234 |
| 384 | 3300025915 | Ga0207693_10156026 | Ga0207693_101560262 | 234 |
| 385 | 3300025929 | Ga0207664_10013023 | Ga0207664_100130235 | 234 |
| 386 | 3300025934 | Ga0207686_10280776 | Ga0207686_102807762 | 234 |
| 387 | 3300025935 | Ga0207709_10113826 | Ga0207709_101138262 | 234 |
| 388 | 3300025937 | Ga0207669_10034512 | Ga0207669_100345122 | 234 |
| 389 | 3300025940 | Ga0207691_10025136 | Ga0207691_100251364 | 234 |
| 390 | 3300025949 | Ga0207667_10130634 | Ga0207667_101306341 | 234 |
| 391 | 3300025949 | Ga0207667_10291644 | Ga0207667_102916442 | 234 |
| 392 | 3300025972 | Ga0207668_10073433 | Ga0207668_100734332 | 234 |
| 393 | 3300026067 | Ga0207678_10099875 | Ga0207678_100998752 | 234 |
| 394 | 3300026078 | Ga0207702_10000640 | Ga0207702_1000064020 | 234 |
| 395 | 3300026089 | Ga0207648_10050344 | Ga0207648_100503442 | 234 |
| 396 | 3300026121 | Ga0207683_10146839 | Ga0207683_101468392 | 234 |
| 397 | 3300031616 | Ga0307508_10299813 | Ga0307508_102998131 | 234 |
| 398 | 3300031711 | Ga0265314_10021126 | Ga0265314_100211264 | 234 |
| 399 | 3300037418 | Ga0395900_0081695 | Ga0395900_0081695_2215_2985 | 234 |
| 400 | 3300037466 | Ga0395898_0131206 | Ga0395898_0131206_315_1085 | 234 |
| 401 | 3300037853 | Ga0436364_0136448 | Ga0436364_0136448_943_1713 | 234 |
| 402 | 3300039437 | Ga0436365_1444934 | Ga0436365_1444934_294_1064 | 234 |
| 403 | 3300046472 | Ga0495580_0463899 | Ga0495580_0463899_61_828 | 234 |
| 404 | 3300046794 | Ga0495589_0087516 | Ga0495589_0087516_578_1360 | 234 |
| 405 | 3300048904 | Ga0496101_0244026 | Ga0496101_0244026_59_841 | 234 |
| 406 | 3300048928 | Ga0496125_0069774 | Ga0496125_0069774_1980_2726 | 234 |
| 407 | 3300053102 | Ga0500554_003422 | Ga0500554_003422_1841_2611 | 234 |
| 408 | 3300053119 | Ga0500595_003430 | Ga0500595_003430_5069_5839 | 234 |
| 409 | 3300053162 | Ga0500638_000053 | Ga0500638_000053_12910_13680 | 234 |
| 410 | 3300055283 | Ga0500661_000226 | Ga0500661_000226_1482_2252 | 234 |
| 411 | iso_pu_bacteria | 2582581313 | 2585303428 | 234 |
| 412 | iso_pu_bacteria | 2784746763 | 2785345832 | 234 |
| 413 | iso_pu_bacteria | 2784746768 | 2785367055 | 234 |
| 414 | iso_pu_bacteria | 2786546132 | 2786668094 | 234 |
| 415 | iso_pu_bacteria | 2811994879 | 2812360407 | 234 |
| 416 | iso_pu_bacteria | 2811994917 | 2812482507 | 234 |
| 417 | iso_pu_bacteria | 2852635781 | 2852637622 | 234 |
| 418 | iso_pu_bacteria | 2862281513 | 2862289758 | 234 |
| 419 | iso_pu_bacteria | 2862382967 | 2862391686 | 234 |
| 420 | iso_pu_bacteria | 2863404153 | 2863407065 | 234 |
| 421 | iso_pu_bacteria | 2867428634 | 2867428656 | 234 |
| 422 | iso_pu_bacteria | 2912723979 | 2912726284 | 234 |
| 423 | iso_pu_bacteria | 2919506607 | 2919506850 | 234 |
| 424 | iso_pu_bacteria | 2946064051 | 2946065482 | 234 |
| 425 | iso_pu_bacteria | 2947224130 | 2947231928 | 234 |
| 426 | iso_pu_bacteria | 2954380949 | 2954388742 | 234 |
| 427 | iso_pu_bacteria | 2954673503 | 2954674382 | 234 |
| 428 | iso_pu_bacteria | 2954682443 | 2954689749 | 234 |
| 429 | iso_pu_bacteria | 2954691527 | 2954699532 | 234 |
| 430 | iso_pu_bacteria | 2954701450 | 2954702686 | 234 |
| 431 | iso_pu_bacteria | 8008558824 | 8008561216 | 234 |
| 432 | iso_pu_bacteria | 8048406513 | 8048408074 | 234 |
| 433 | 3300003316 | rootH1_10018128 | rootH1_1001812812 | 235 |
| 434 | 3300005436 | Ga0070713_100007399 | Ga0070713_1000073994 | 235 |
| 435 | 3300005455 | Ga0070663_100001689 | Ga0070663_10000168916 | 235 |
| 436 | 3300005546 | Ga0070696_100274669 | Ga0070696_1002746691 | 235 |
| 437 | 3300005843 | Ga0068860_100365588 | Ga0068860_1003655882 | 235 |
| 438 | 3300005983 | Ga0081540_1001654 | Ga0081540_100165414 | 235 |
| 439 | 3300006028 | Ga0070717_10000850 | Ga0070717_1000085014 | 235 |
| 440 | 3300006353 | Ga0075370_10038370 | Ga0075370_100383703 | 235 |
| 441 | 3300025711 | Ga0207696_1000219 | Ga0207696_100021951 | 235 |
| 442 | 3300025735 | Ga0207713_1000036 | Ga0207713_1000036197 | 235 |
| 443 | 3300025928 | Ga0207700_10004989 | Ga0207700_100049895 | 235 |
| 444 | 3300026023 | Ga0207677_10110172 | Ga0207677_101101722 | 235 |
| 445 | 3300026067 | Ga0207678_10000232 | Ga0207678_1000023211 | 235 |
| 446 | 3300028381 | Ga0268264_10340706 | Ga0268264_103407062 | 235 |
| 447 | 3300031824 | Ga0307413_10067686 | Ga0307413_100676862 | 235 |
| 448 | 3300032004 | Ga0307414_10340183 | Ga0307414_103401831 | 235 |
| 449 | 3300035695 | Ga0373927_0148845 | Ga0373927_0148845_207_977 | 235 |
| 450 | 3300039438 | Ga0436360_1343606 | Ga0436360_1343606_67_837 | 235 |
| 451 | 3300044694 | Ga0466963_0045770 | Ga0466963_0045770_157_927 | 235 |
| 452 | 3300045976 | Ga0466967_0076913 | Ga0466967_0076913_80_850 | 235 |
| 453 | 3300046460 | Ga0495638_0019670 | Ga0495638_0019670_1372_2154 | 235 |
| 454 | 3300046463 | Ga0495653_0000291 | Ga0495653_0000291_14182_14931 | 235 |
| 455 | 3300046492 | Ga0495585_0001175 | Ga0495585_0001175_9569_10318 | 235 |
| 456 | 3300046501 | Ga0495607_0001929 | Ga0495607_0001929_15071_15820 | 235 |
| 457 | 3300046507 | Ga0495606_0000155 | Ga0495606_0000155_46761_47510 | 235 |
| 458 | 3300046519 | Ga0495632_0003072 | Ga0495632_0003072_6176_6925 | 235 |
| 459 | 3300046520 | Ga0495637_0001518 | Ga0495637_0001518_6126_6875 | 235 |
| 460 | 3300046530 | Ga0495654_0108210 | Ga0495654_0108210_392_1141 | 235 |
| 461 | 3300046616 | Ga0495668_0071254 | Ga0495668_0071254_73_855 | 235 |
| 462 | 3300046665 | Ga0495661_0000039 | Ga0495661_0000039_70858_71607 | 235 |
| 463 | 3300046665 | Ga0495661_0050072 | Ga0495661_0050072_1311_2060 | 235 |
| 464 | 3300047321 | Ga0495676_0008498 | Ga0495676_0008498_1986_2735 | 235 |
| 465 | 3300047323 | Ga0495683_0000477 | Ga0495683_0000477_7883_8632 | 235 |
| 466 | 3300047469 | Ga0495673_0085478 | Ga0495673_0085478_189_971 | 235 |
| 467 | 3300048903 | Ga0496100_0292603 | Ga0496100_0292603_317_1081 | 235 |
| 468 | 3300048905 | Ga0496102_0533068 | Ga0496102_0533068_238_1002 | 235 |
| 469 | 3300048908 | Ga0496105_0031202 | Ga0496105_0031202_2810_3574 | 235 |
| 470 | 3300048913 | Ga0496110_0183440 | Ga0496110_0183440_355_1137 | 235 |
| 471 | 3300048917 | Ga0496114_0177389 | Ga0496114_0177389_288_1052 | 235 |
| 472 | 3300049580 | Ga0501046_0193743 | Ga0501046_0193743_488_1258 | 235 |
| 473 | 3300049581 | Ga0501047_0006647 | Ga0501047_0006647_8811_9581 | 235 |
| 474 | 3300049586 | Ga0501070_0019514 | Ga0501070_0019514_1447_2217 | 235 |
| 475 | 3300049589 | Ga0501073_0072545 | Ga0501073_0072545_505_1275 | 235 |
| 476 | 3300049590 | Ga0501074_0057245 | Ga0501074_0057245_1585_2355 | 235 |
| 477 | 3300049742 | Ga0501080_0357704 | Ga0501080_0357704_80_850 | 235 |
| 478 | 3300049823 | Ga0501044_0043867 | Ga0501044_0043867_3235_4005 | 235 |
| 479 | 3300050492 | nmdc:mga0yw44_112_c1 | nmdc:mga0yw44_112_c1_1413_2204 | 235 |
| 480 | 3300050496 | nmdc:mga07m45_24588_c1 | nmdc:mga07m45_24588_c1_1752_2534 | 235 |
| 481 | 3300053125 | Ga0500618_009090 | Ga0500618_009090_1792_2541 | 235 |
| 482 | 3300053139 | Ga0500568_0074637 | Ga0500568_0074637_14_796 | 235 |
| 483 | iso_pu_bacteria | 2867369537 | 2867370130 | 235 |
| 484 | 3300005355 | Ga0070671_100064633 | Ga0070671_1000646332 | 236 |
| 485 | 3300005843 | Ga0068860_100325553 | Ga0068860_1003255532 | 236 |
| 486 | 3300005937 | Ga0081455_10067919 | Ga0081455_100679192 | 236 |
| 487 | 3300005983 | Ga0081540_1002242 | Ga0081540_100224216 | 236 |
| 488 | 3300005983 | Ga0081540_1004805 | Ga0081540_10048057 | 236 |
| 489 | 3300010375 | Ga0105239_10152156 | Ga0105239_101521562 | 236 |
| 490 | 3300010375 | Ga0105239_10193695 | Ga0105239_101936953 | 236 |
| 491 | 3300013297 | Ga0157378_10265492 | Ga0157378_102654923 | 236 |
| 492 | 3300013307 | Ga0157372_10000598 | Ga0157372_1000059830 | 236 |
| 493 | 3300020082 | Ga0206353_10369860 | Ga0206353_103698601 | 236 |
| 494 | 3300025302 | Ga0207426_1023168 | Ga0207426_10231683 | 236 |
| 495 | 3300025735 | Ga0207713_1007766 | Ga0207713_10077666 | 236 |
| 496 | 3300025914 | Ga0207671_10037138 | Ga0207671_100371384 | 236 |
| 497 | 3300025924 | Ga0207694_10273153 | Ga0207694_102731532 | 236 |
| 498 | 3300025972 | Ga0207668_10020551 | Ga0207668_100205513 | 236 |
| 499 | 3300026041 | Ga0207639_10037054 | Ga0207639_100370543 | 236 |
| 500 | 3300027378 | Ga0209981_1007580 | Ga0209981_10075801 | 236 |
| 501 | 3300027552 | Ga0209982_1001892 | Ga0209982_10018923 | 236 |
| 502 | 3300027665 | Ga0209983_1005466 | Ga0209983_10054661 | 236 |
| 503 | 3300027682 | Ga0209971_1000529 | Ga0209971_10005299 | 236 |
| 504 | 3300028381 | Ga0268264_10252543 | Ga0268264_102525432 | 236 |
| 505 | 3300028794 | Ga0307515_10078627 | Ga0307515_100786273 | 236 |
| 506 | 3300030521 | Ga0307511_10215903 | Ga0307511_102159032 | 236 |
| 507 | 3300031238 | Ga0265332_10074137 | Ga0265332_100741372 | 236 |
| 508 | 3300031507 | Ga0307509_10035904 | Ga0307509_100359045 | 236 |
| 509 | 3300031616 | Ga0307508_10261036 | Ga0307508_102610362 | 236 |
| 510 | 3300031712 | Ga0265342_10116338 | Ga0265342_101163383 | 236 |
| 511 | 3300032004 | Ga0307414_10000905 | Ga0307414_100009055 | 236 |
| 512 | 3300044656 | Ga0466969_0012942 | Ga0466969_0012942_3204_3956 | 236 |
| 513 | 3300044658 | Ga0466972_0001762 | Ga0466972_0001762_7728_8480 | 236 |
| 514 | 3300044658 | Ga0466972_0015460 | Ga0466972_0015460_886_1638 | 236 |
| 515 | 3300044684 | Ga0466966_0041891 | Ga0466966_0041891_116_868 | 236 |
| 516 | 3300044693 | Ga0466961_0005326 | Ga0466961_0005326_22_774 | 236 |
| 517 | 3300044694 | Ga0466963_0000336 | Ga0466963_0000336_6125_6877 | 236 |
| 518 | 3300044735 | Ga0466968_0006777 | Ga0466968_0006777_32_784 | 236 |
| 519 | 3300044765 | Ga0466970_0270686 | Ga0466970_0270686_71_823 | 236 |
| 520 | 3300044842 | Ga0466957_0052166 | Ga0466957_0052166_1595_2347 | 236 |
| 521 | 3300045049 | Ga0466959_0234125 | Ga0466959_0234125_425_1177 | 236 |
| 522 | 3300048913 | Ga0496110_0025423 | Ga0496110_0025423_2486_3265 | 236 |
| 523 | 3300048918 | Ga0496115_0075571 | Ga0496115_0075571_559_1329 | 236 |
| 524 | 3300048927 | Ga0496124_0017924 | Ga0496124_0017924_2540_3319 | 236 |
| 525 | 3300048927 | Ga0496124_0067580 | Ga0496124_0067580_1995_2777 | 236 |
| 526 | 3300048928 | Ga0496125_0056005 | Ga0496125_0056005_2016_2795 | 236 |
| 527 | 3300048929 | Ga0496126_0031666 | Ga0496126_0031666_3334_4113 | 236 |
| 528 | 3300049568 | Ga0501031_0008935 | Ga0501031_0008935_5472_6224 | 236 |
| 529 | 3300049569 | Ga0501032_0046226 | Ga0501032_0046226_2002_2754 | 236 |
| 530 | 3300049570 | Ga0501033_0009751 | Ga0501033_0009751_1409_2161 | 236 |
| 531 | 3300049571 | Ga0501034_0175932 | Ga0501034_0175932_1081_1845 | 236 |
| 532 | 3300049571 | Ga0501034_0187441 | Ga0501034_0187441_613_1365 | 236 |
| 533 | 3300049572 | Ga0501036_0055364 | Ga0501036_0055364_1551_2303 | 236 |
| 534 | 3300049573 | Ga0501037_0007818 | Ga0501037_0007818_5368_6120 | 236 |
| 535 | 3300049574 | Ga0501038_0023174 | Ga0501038_0023174_3972_4724 | 236 |
| 536 | 3300049579 | Ga0501043_0069366 | Ga0501043_0069366_1478_2230 | 236 |
| 537 | 3300049581 | Ga0501047_0077803 | Ga0501047_0077803_1968_2732 | 236 |
| 538 | 3300049582 | Ga0501048_0062620 | Ga0501048_0062620_1527_2279 | 236 |
| 539 | 3300049823 | Ga0501044_0032452 | Ga0501044_0032452_332_1096 | 236 |
| 540 | 3300049823 | Ga0501044_0050091 | Ga0501044_0050091_3020_3772 | 236 |
| 541 | 3300061719 | Ga0466962_0062845 | Ga0466962_0062845_479_1231 | 236 |
| 542 | iso_pu_bacteria | 2599185155 | 2599327358 | 236 |
| 543 | iso_pu_bacteria | 2643221670 | 2644388987 | 236 |
| 544 | iso_pu_bacteria | 2984568884 | 2984570298 | 236 |
| 545 | 3300005435 | Ga0070714_100059899 | Ga0070714_1000598992 | 237 |
| 546 | 3300005436 | Ga0070713_100335831 | Ga0070713_1003358312 | 237 |
| 547 | 3300005548 | Ga0070665_100041123 | Ga0070665_1000411233 | 237 |
| 548 | 3300005983 | Ga0081540_1035212 | Ga0081540_10352123 | 237 |
| 549 | 3300025928 | Ga0207700_10055356 | Ga0207700_100553562 | 237 |
| 550 | 3300025929 | Ga0207664_10492209 | Ga0207664_104922092 | 237 |
| 551 | 3300030736 | Ga0316180_1055335 | Ga0316180_10553352 | 237 |
| 552 | 3300036712 | Ga0316584_0317867 | Ga0316584_0317867_285_1052 | 237 |
| 553 | 3300045976 | Ga0466967_0146604 | Ga0466967_0146604_820_1638 | 237 |
| 554 | 3300045976 | Ga0466967_0336521 | Ga0466967_0336521_119_928 | 237 |
| 555 | 3300046459 | Ga0495629_0122012 | Ga0495629_0122012_282_1037 | 237 |
| 556 | 3300046462 | Ga0495651_0005413 | Ga0495651_0005413_8047_8802 | 237 |
| 557 | 3300046476 | Ga0495662_0002185 | Ga0495662_0002185_7522_8277 | 237 |
| 558 | 3300046477 | Ga0495664_0003293 | Ga0495664_0003293_4314_5069 | 237 |
| 559 | 3300046514 | Ga0495618_0154568 | Ga0495618_0154568_170_925 | 237 |
| 560 | 3300046517 | Ga0495630_0003347 | Ga0495630_0003347_3078_3833 | 237 |
| 561 | 3300046529 | Ga0495652_0055099 | Ga0495652_0055099_1552_2307 | 237 |
| 562 | 3300046533 | Ga0495640_0050427 | Ga0495640_0050427_145_900 | 237 |
| 563 | 3300046536 | Ga0495587_0018037 | Ga0495587_0018037_1668_2423 | 237 |
| 564 | 3300046557 | Ga0495622_0027208 | Ga0495622_0027208_33_788 | 237 |
| 565 | 3300046642 | Ga0495634_0008868 | Ga0495634_0008868_4732_5487 | 237 |
| 566 | 3300046663 | Ga0495635_0016099 | Ga0495635_0016099_2518_3273 | 237 |
| 567 | 3300046675 | Ga0495657_0001338 | Ga0495657_0001338_1733_2488 | 237 |
| 568 | 3300046678 | Ga0495599_0111128 | Ga0495599_0111128_826_1581 | 237 |
| 569 | 3300046679 | Ga0495623_0191924 | Ga0495623_0191924_182_937 | 237 |
| 570 | 3300046680 | Ga0495646_0017985 | Ga0495646_0017985_1929_2684 | 237 |
| 571 | 3300046689 | Ga0495613_0001802 | Ga0495613_0001802_9309_10064 | 237 |
| 572 | 3300046809 | Ga0495600_0000502 | Ga0495600_0000502_14625_15380 | 237 |
| 573 | 3300047315 | Ga0495581_0185012 | Ga0495581_0185012_416_1171 | 237 |
| 574 | 3300047317 | Ga0495604_0001218 | Ga0495604_0001218_6803_7558 | 237 |
| 575 | 3300047321 | Ga0495676_0008726 | Ga0495676_0008726_3866_4621 | 237 |
| 576 | 3300047673 | Ga0495593_0009905 | Ga0495593_0009905_2802_3557 | 237 |
| 577 | 3300048088 | Ga0495602_0018583 | Ga0495602_0018583_3896_4651 | 237 |
| 578 | 3300048089 | Ga0495614_0037092 | Ga0495614_0037092_430_1185 | 237 |
| 579 | 3300048903 | Ga0496100_0201352 | Ga0496100_0201352_69_839 | 237 |
| 580 | 3300053095 | Ga0500640_031019 | Ga0500640_031019_281_1036 | 237 |
| 581 | 3300053101 | Ga0500553_142778 | Ga0500553_142778_114_869 | 237 |
| 582 | 3300053111 | Ga0500572_003499 | Ga0500572_003499_902_1657 | 237 |
| 583 | 3300053140 | Ga0500573_0135194 | Ga0500573_0135194_88_843 | 237 |
| 584 | iso_pu_bacteria | 2511231221 | 2512035316 | 237 |
| 585 | iso_pu_bacteria | 2512047086 | 2512529451 | 237 |
| 586 | iso_pu_bacteria | 2513237101 | 2513692126 | 237 |
| 587 | iso_pu_bacteria | 2643221634 | 2644196192 | 237 |
| 588 | iso_pu_bacteria | 2643221714 | 2644632471 | 237 |
| 589 | iso_pu_bacteria | 2808606359 | 2808847559 | 237 |
| 590 | iso_pu_bacteria | 2818991461 | 2819683200 | 237 |
| 591 | iso_pu_bacteria | 2899275550 | 2899279533 | 237 |
| 592 | iso_pu_bacteria | 2904504865 | 2904509152 | 237 |
| 593 | iso_pu_bacteria | 2946072368 | 2946073839 | 237 |
| 594 | 3300003578 | Ga0006562J51391_1084840 | Ga0006562J51391_10848403 | 238 |
| 595 | 3300005578 | Ga0068854_100170182 | Ga0068854_1001701822 | 238 |
| 596 | 3300006175 | Ga0070712_100008065 | Ga0070712_1000080652 | 238 |
| 597 | 3300006178 | Ga0075367_10003283 | Ga0075367_100032833 | 238 |
| 598 | 3300006948 | Ga0099826_10143414 | Ga0099826_101434142 | 238 |
| 599 | 3300011119 | Ga0105246_10039933 | Ga0105246_100399332 | 238 |
| 600 | 3300013105 | Ga0157369_10002377 | Ga0157369_1000237724 | 238 |
| 601 | 3300013105 | Ga0157369_10119955 | Ga0157369_101199553 | 238 |
| 602 | 3300014497 | Ga0182008_10000543 | Ga0182008_100005439 | 238 |
| 603 | 3300015262 | Ga0182007_10023586 | Ga0182007_100235863 | 238 |
| 604 | 3300025904 | Ga0207647_10018809 | Ga0207647_100188094 | 238 |
| 605 | 3300025906 | Ga0207699_10049700 | Ga0207699_100497002 | 238 |
| 606 | 3300025915 | Ga0207693_10012101 | Ga0207693_100121012 | 238 |
| 607 | 3300025928 | Ga0207700_10348696 | Ga0207700_103486962 | 238 |
| 608 | 3300028786 | Ga0307517_10005855 | Ga0307517_100058559 | 238 |
| 609 | 3300028794 | Ga0307515_10068642 | Ga0307515_100686424 | 238 |
| 610 | 3300030522 | Ga0307512_10054085 | Ga0307512_100540853 | 238 |
| 611 | 3300031456 | Ga0307513_10425208 | Ga0307513_104252082 | 238 |
| 612 | 3300031616 | Ga0307508_10008307 | Ga0307508_100083073 | 238 |
| 613 | 3300031649 | Ga0307514_10006568 | Ga0307514_100065686 | 238 |
| 614 | 3300031649 | Ga0307514_10033166 | Ga0307514_100331661 | 238 |
| 615 | 3300031730 | Ga0307516_10002742 | Ga0307516_1000274210 | 238 |
| 616 | 3300031838 | Ga0307518_10025604 | Ga0307518_100256045 | 238 |
| 617 | 3300032002 | Ga0307416_100428202 | Ga0307416_1004282022 | 238 |
| 618 | 3300033180 | Ga0307510_10010654 | Ga0307510_100106544 | 238 |
| 619 | 3300034816 | Ga0373930_0003508 | Ga0373930_0003508_430_1230 | 238 |
| 620 | 3300034817 | Ga0373948_0017766 | Ga0373948_0017766_334_1134 | 238 |
| 621 | 3300035084 | Ga0373928_0000800 | Ga0373928_0000800_4320_5120 | 238 |
| 622 | 3300035084 | Ga0373928_0025680 | Ga0373928_0025680_344_1144 | 238 |
| 623 | 3300035112 | Ga0373932_0021501 | Ga0373932_0021501_121_921 | 238 |
| 624 | 3300035691 | Ga0373931_0000001 | Ga0373931_0000001_551106_551906 | 238 |
| 625 | 3300035691 | Ga0373931_0000038 | Ga0373931_0000038_53536_54336 | 238 |
| 626 | 3300037466 | Ga0395898_0008785 | Ga0395898_0008785_3667_4425 | 238 |
| 627 | 3300041492 | Ga0451835_0889745 | Ga0451835_0889745_123_881 | 238 |
| 628 | 3300041512 | Ga0451853_1195562 | Ga0451853_1195562_1552_2319 | 238 |
| 629 | 3300042005 | Ga0439448_0079991 | Ga0439448_0079991_177_935 | 238 |
| 630 | 3300042007 | Ga0439449_0001695 | Ga0439449_0001695_6218_6976 | 238 |
| 631 | 3300042157 | Ga0439458_0009563 | Ga0439458_0009563_816_1574 | 238 |
| 632 | 3300044656 | Ga0466969_0039102 | Ga0466969_0039102_194_952 | 238 |
| 633 | 3300044658 | Ga0466972_0003178 | Ga0466972_0003178_831_1589 | 238 |
| 634 | 3300044683 | Ga0466965_0000492 | Ga0466965_0000492_3196_3954 | 238 |
| 635 | 3300044683 | Ga0466965_0083212 | Ga0466965_0083212_406_1164 | 238 |
| 636 | 3300044684 | Ga0466966_0018718 | Ga0466966_0018718_525_1283 | 238 |
| 637 | 3300044693 | Ga0466961_0011622 | Ga0466961_0011622_2179_2937 | 238 |
| 638 | 3300044694 | Ga0466963_0000319 | Ga0466963_0000319_10854_11612 | 238 |
| 639 | 3300044694 | Ga0466963_0040999 | Ga0466963_0040999_1967_2725 | 238 |
| 640 | 3300044706 | Ga0466964_0000999 | Ga0466964_0000999_7505_8263 | 238 |
| 641 | 3300044719 | Ga0466971_0000247 | Ga0466971_0000247_16530_17288 | 238 |
| 642 | 3300044765 | Ga0466970_0000625 | Ga0466970_0000625_11320_12078 | 238 |
| 643 | 3300044842 | Ga0466957_0000837 | Ga0466957_0000837_1022_1780 | 238 |
| 644 | 3300045049 | Ga0466959_0104912 | Ga0466959_0104912_925_1683 | 238 |
| 645 | 3300045049 | Ga0466959_0105730 | Ga0466959_0105730_397_1155 | 238 |
| 646 | 3300045836 | Ga0466958_0001544 | Ga0466958_0001544_3261_4019 | 238 |
| 647 | 3300045976 | Ga0466967_0001364 | Ga0466967_0001364_8656_9414 | 238 |
| 648 | 3300045976 | Ga0466967_0099857 | Ga0466967_0099857_1270_2028 | 238 |
| 649 | 3300046455 | Ga0495603_0007578 | Ga0495603_0007578_1138_1896 | 238 |
| 650 | 3300046459 | Ga0495629_0047708 | Ga0495629_0047708_179_937 | 238 |
| 651 | 3300046460 | Ga0495638_0215507 | Ga0495638_0215507_256_1047 | 238 |
| 652 | 3300046476 | Ga0495662_0007605 | Ga0495662_0007605_1010_1768 | 238 |
| 653 | 3300046476 | Ga0495662_0014932 | Ga0495662_0014932_381_1139 | 238 |
| 654 | 3300046492 | Ga0495585_0017276 | Ga0495585_0017276_260_1051 | 238 |
| 655 | 3300046499 | Ga0495594_0018658 | Ga0495594_0018658_644_1402 | 238 |
| 656 | 3300046501 | Ga0495607_0072851 | Ga0495607_0072851_85_876 | 238 |
| 657 | 3300046515 | Ga0495620_0007303 | Ga0495620_0007303_3950_4708 | 238 |
| 658 | 3300046522 | Ga0495643_0004652 | Ga0495643_0004652_4088_4846 | 238 |
| 659 | 3300046522 | Ga0495643_0014862 | Ga0495643_0014862_203_973 | 238 |
| 660 | 3300046538 | Ga0495609_0119109 | Ga0495609_0119109_115_906 | 238 |
| 661 | 3300046558 | Ga0495633_0035203 | Ga0495633_0035203_1119_1889 | 238 |
| 662 | 3300046663 | Ga0495635_0192104 | Ga0495635_0192104_20_778 | 238 |
| 663 | 3300046674 | Ga0495588_0003708 | Ga0495588_0003708_5196_5954 | 238 |
| 664 | 3300046675 | Ga0495657_0016592 | Ga0495657_0016592_2498_3256 | 238 |
| 665 | 3300046689 | Ga0495613_0016830 | Ga0495613_0016830_391_1149 | 238 |
| 666 | 3300046689 | Ga0495613_0051657 | Ga0495613_0051657_2023_2781 | 238 |
| 667 | 3300046794 | Ga0495589_0050869 | Ga0495589_0050869_1246_2004 | 238 |
| 668 | 3300046810 | Ga0495660_0040126 | Ga0495660_0040126_1807_2577 | 238 |
| 669 | 3300047318 | Ga0495636_0036299 | Ga0495636_0036299_701_1459 | 238 |
| 670 | 3300047318 | Ga0495636_0054455 | Ga0495636_0054455_886_1644 | 238 |
| 671 | 3300047318 | Ga0495636_0065561 | Ga0495636_0065561_682_1473 | 238 |
| 672 | 3300047320 | Ga0495672_0156755 | Ga0495672_0156755_169_927 | 238 |
| 673 | 3300047323 | Ga0495683_0030623 | Ga0495683_0030623_1623_2414 | 238 |
| 674 | 3300047443 | Ga0495687_016952 | Ga0495687_016952_489_1247 | 238 |
| 675 | 3300047447 | Ga0495685_000326 | Ga0495685_000326_7436_8206 | 238 |
| 676 | 3300047447 | Ga0495685_023846 | Ga0495685_023846_153_911 | 238 |
| 677 | 3300047470 | Ga0495681_0005390 | Ga0495681_0005390_4887_5657 | 238 |
| 678 | 3300047472 | Ga0495686_0060909 | Ga0495686_0060909_480_1238 | 238 |
| 679 | 3300048908 | Ga0496105_0524199 | Ga0496105_0524199_146_904 | 238 |
| 680 | 3300048911 | Ga0496108_0119045 | Ga0496108_0119045_885_1643 | 238 |
| 681 | 3300048912 | Ga0496109_0050177 | Ga0496109_0050177_2927_3685 | 238 |
| 682 | 3300048913 | Ga0496110_0343228 | Ga0496110_0343228_425_1183 | 238 |
| 683 | 3300048922 | Ga0496119_0023262 | Ga0496119_0023262_284_1039 | 238 |
| 684 | 3300048923 | Ga0496120_0024167 | Ga0496120_0024167_2750_3505 | 238 |
| 685 | 3300048925 | Ga0496122_0014961 | Ga0496122_0014961_2765_3520 | 238 |
| 686 | 3300048926 | Ga0496123_0002036 | Ga0496123_0002036_23395_24150 | 238 |
| 687 | 3300048928 | Ga0496125_0000073 | Ga0496125_0000073_23645_24400 | 238 |
| 688 | 3300048929 | Ga0496126_0031676 | Ga0496126_0031676_2248_3018 | 238 |
| 689 | 3300048929 | Ga0496126_0147925 | Ga0496126_0147925_191_946 | 238 |
| 690 | 3300048929 | Ga0496126_0523434 | Ga0496126_0523434_143_898 | 238 |
| 691 | 3300049570 | Ga0501033_0041468 | Ga0501033_0041468_1813_2574 | 238 |
| 692 | 3300049573 | Ga0501037_0113684 | Ga0501037_0113684_770_1531 | 238 |
| 693 | 3300049578 | Ga0501042_0005265 | Ga0501042_0005265_176_934 | 238 |
| 694 | 3300049579 | Ga0501043_0513239 | Ga0501043_0513239_94_855 | 238 |
| 695 | 3300049581 | Ga0501047_0067509 | Ga0501047_0067509_2271_3032 | 238 |
| 696 | 3300049581 | Ga0501047_0084763 | Ga0501047_0084763_1179_1937 | 238 |
| 697 | 3300049742 | Ga0501080_0146418 | Ga0501080_0146418_592_1350 | 238 |
| 698 | 3300049744 | Ga0501083_0000204 | Ga0501083_0000204_8683_9441 | 238 |
| 699 | 3300049744 | Ga0501083_0009486 | Ga0501083_0009486_2025_2888 | 238 |
| 700 | 3300049822 | Ga0501035_0159771 | Ga0501035_0159771_975_1736 | 238 |
| 701 | 3300049822 | Ga0501035_0268908 | Ga0501035_0268908_455_1213 | 238 |
| 702 | 3300049822 | Ga0501035_0370189 | Ga0501035_0370189_135_893 | 238 |
| 703 | 3300049823 | Ga0501044_0015713 | Ga0501044_0015713_5970_6728 | 238 |
| 704 | 3300050490 | nmdc:mga03n38_234582_c1 | nmdc:mga03n38_234582_c1_161_919 | 238 |
| 705 | 3300050494 | nmdc:mga06z11_2010_c1 | nmdc:mga06z11_2010_c1_1271_2029 | 238 |
| 706 | 3300053094 | Ga0500566_0037300 | Ga0500566_0037300_1202_1972 | 238 |
| 707 | 3300053113 | Ga0500580_042563 | Ga0500580_042563_603_1379 | 238 |
| 708 | 3300053123 | Ga0500614_054757 | Ga0500614_054757_143_925 | 238 |
| 709 | 3300053129 | Ga0500628_038040 | Ga0500628_038040_112_882 | 238 |
| 710 | 3300053131 | Ga0500652_010498 | Ga0500652_010498_165_935 | 238 |
| 711 | 3300053134 | Ga0500658_0023991 | Ga0500658_0023991_650_1420 | 238 |
| 712 | 3300053149 | Ga0500600_0003279 | Ga0500600_0003279_1222_1992 | 238 |
| 713 | 3300053153 | Ga0500616_0170829 | Ga0500616_0170829_204_974 | 238 |
| 714 | 3300053732 | Ga0500656_007270 | Ga0500656_007270_245_1015 | 238 |
| 715 | 3300061719 | Ga0466962_0001430 | Ga0466962_0001430_6654_7412 | 238 |
| 716 | iso_pu_bacteria | 2508501128 | 2509151775 | 238 |
| 717 | iso_pu_bacteria | 2643221587 | 2643946670 | 238 |
| 718 | iso_pu_bacteria | 2643221677 | 2644434474 | 238 |
| 719 | iso_pu_bacteria | 2767802112 | 2768644953 | 238 |
| 720 | iso_pu_bacteria | 2841957949 | 2841958283 | 238 |
| 721 | iso_pu_bacteria | 2844315083 | 2844318661 | 238 |
| 722 | iso_pu_bacteria | 2862178590 | 2862186349 | 238 |
| 723 | iso_pu_bacteria | 2876808645 | 2876810387 | 238 |
| 724 | iso_pu_bacteria | 2897803580 | 2897805097 | 238 |
| 725 | iso_pu_bacteria | 2899359706 | 2899361137 | 238 |
| 726 | iso_pu_bacteria | 2906602504 | 2906608520 | 238 |
| 727 | iso_pu_bacteria | 2922361189 | 2922368178 | 238 |
| 728 | iso_pu_bacteria | 2936002035 | 2936006294 | 238 |
| 729 | iso_pu_bacteria | 3006425503 | 3006428266 | 238 |
| 730 | 3300005327 | Ga0070658_10000776 | Ga0070658_1000077615 | 239 |
| 731 | 3300005328 | Ga0070676_10029865 | Ga0070676_100298652 | 239 |
| 732 | 3300005329 | Ga0070683_100735749 | Ga0070683_1007357491 | 239 |
| 733 | 3300005336 | Ga0070680_100011979 | Ga0070680_1000119795 | 239 |
| 734 | 3300005338 | Ga0068868_100061827 | Ga0068868_1000618274 | 239 |
| 735 | 3300005343 | Ga0070687_100039063 | Ga0070687_1000390632 | 239 |
| 736 | 3300005347 | Ga0070668_100219142 | Ga0070668_1002191422 | 239 |
| 737 | 3300005353 | Ga0070669_100254844 | Ga0070669_1002548442 | 239 |
| 738 | 3300005356 | Ga0070674_100160811 | Ga0070674_1001608113 | 239 |
| 739 | 3300005367 | Ga0070667_100724239 | Ga0070667_1007242391 | 239 |
| 740 | 3300005441 | Ga0070700_100053995 | Ga0070700_1000539955 | 239 |
| 741 | 3300005457 | Ga0070662_100066983 | Ga0070662_1000669833 | 239 |
| 742 | 3300005457 | Ga0070662_100189766 | Ga0070662_1001897662 | 239 |
| 743 | 3300005544 | Ga0070686_100011330 | Ga0070686_1000113304 | 239 |
| 744 | 3300005578 | Ga0068854_100139147 | Ga0068854_1001391473 | 239 |
| 745 | 3300005616 | Ga0068852_100299550 | Ga0068852_1002995502 | 239 |
| 746 | 3300005718 | Ga0068866_10004618 | Ga0068866_100046184 | 239 |
| 747 | 3300005718 | Ga0068866_10033488 | Ga0068866_100334883 | 239 |
| 748 | 3300005844 | Ga0068862_100382985 | Ga0068862_1003829852 | 239 |
| 749 | 3300006038 | Ga0075365_10045983 | Ga0075365_100459833 | 239 |
| 750 | 3300006051 | Ga0075364_10321114 | Ga0075364_103211142 | 239 |
| 751 | 3300006847 | Ga0075431_100844292 | Ga0075431_1008442921 | 239 |
| 752 | 3300006881 | Ga0068865_100009881 | Ga0068865_1000098814 | 239 |
| 753 | 3300006881 | Ga0068865_100036225 | Ga0068865_1000362257 | 239 |
| 754 | 3300009036 | Ga0105244_10021312 | Ga0105244_100213123 | 239 |
| 755 | 3300009553 | Ga0105249_10054067 | Ga0105249_100540673 | 239 |
| 756 | 3300012500 | Ga0157314_1002520 | Ga0157314_10025201 | 239 |
| 757 | 3300013297 | Ga0157378_10333987 | Ga0157378_103339872 | 239 |
| 758 | 3300013306 | Ga0163162_10195665 | Ga0163162_101956653 | 239 |
| 759 | 3300013307 | Ga0157372_10082081 | Ga0157372_100820812 | 239 |
| 760 | 3300017792 | Ga0163161_10195097 | Ga0163161_101950972 | 239 |
| 761 | 3300020082 | Ga0206353_10722848 | Ga0206353_107228484 | 239 |
| 762 | 3300025899 | Ga0207642_10060145 | Ga0207642_100601454 | 239 |
| 763 | 3300025901 | Ga0207688_10070069 | Ga0207688_100700692 | 239 |
| 764 | 3300025907 | Ga0207645_10033287 | Ga0207645_100332875 | 239 |
| 765 | 3300025909 | Ga0207705_10000676 | Ga0207705_1000067616 | 239 |
| 766 | 3300025917 | Ga0207660_10008817 | Ga0207660_100088174 | 239 |
| 767 | 3300025918 | Ga0207662_10034565 | Ga0207662_100345653 | 239 |
| 768 | 3300025933 | Ga0207706_10020869 | Ga0207706_100208692 | 239 |
| 769 | 3300025933 | Ga0207706_10148626 | Ga0207706_101486264 | 239 |
| 770 | 3300025937 | Ga0207669_10056437 | Ga0207669_100564373 | 239 |
| 771 | 3300025938 | Ga0207704_10092144 | Ga0207704_100921442 | 239 |
| 772 | 3300025940 | Ga0207691_10237065 | Ga0207691_102370653 | 239 |
| 773 | 3300025942 | Ga0207689_10252184 | Ga0207689_102521842 | 239 |
| 774 | 3300025961 | Ga0207712_10010325 | Ga0207712_100103255 | 239 |
| 775 | 3300025981 | Ga0207640_10163924 | Ga0207640_101639242 | 239 |
| 776 | 3300025981 | Ga0207640_10787981 | Ga0207640_107879811 | 239 |
| 777 | 3300025986 | Ga0207658_10752442 | Ga0207658_107524421 | 239 |
| 778 | 3300026023 | Ga0207677_10118785 | Ga0207677_101187852 | 239 |
| 779 | 3300026075 | Ga0207708_10016735 | Ga0207708_100167353 | 239 |
| 780 | 3300026075 | Ga0207708_10053249 | Ga0207708_100532493 | 239 |
| 781 | 3300026118 | Ga0207675_100142806 | Ga0207675_1001428063 | 239 |
| 782 | 3300044901 | Ga0466960_0075425 | Ga0466960_0075425_14_775 | 239 |
| 783 | 3300048917 | Ga0496114_0080195 | Ga0496114_0080195_330_1103 | 239 |
| 784 | 3300048918 | Ga0496115_0234876 | Ga0496115_0234876_144_917 | 239 |
| 785 | 3300048927 | Ga0496124_0019937 | Ga0496124_0019937_382_1143 | 239 |
| 786 | 3300050492 | nmdc:mga0yw44_69281_c1 | nmdc:mga0yw44_69281_c1_1094_1855 | 239 |
| 787 | 3300053157 | Ga0500624_002759 | Ga0500624_002759_70_846 | 239 |
| 788 | 3300053161 | Ga0500634_0003973 | Ga0500634_0003973_3297_4073 | 239 |
| 789 | iso_pu_bacteria | 2889033259 | 2889040278 | 239 |
| 790 | iso_pu_bacteria | 2904690495 | 2904696064 | 239 |
| 791 | iso_pu_bacteria | 2908756301 | 2908760696 | 239 |
| 792 | iso_pu_bacteria | 8006994254 | 8007000171 | 239 |
| 793 | iso_pu_bacteria | 8054002106 | 8054009181 | 239 |
| 794 | 3300003187 | JGI25151J46595_10000290 | JGI25151J46595_100002902 | 240 |
| 795 | 3300003187 | JGI25151J46595_10000452 | JGI25151J46595_100004528 | 240 |
| 796 | 3300003354 | JGI25160J50197_1010453 | JGI25160J50197_10104533 | 240 |
| 797 | 3300005546 | Ga0070696_100094253 | Ga0070696_1000942532 | 240 |
| 798 | 3300005983 | Ga0081540_1062046 | Ga0081540_10620462 | 240 |
| 799 | 3300009036 | Ga0105244_10000125 | Ga0105244_1000012538 | 240 |
| 800 | 3300009092 | Ga0105250_10000082 | Ga0105250_1000008249 | 240 |
| 801 | 3300009148 | Ga0105243_10074411 | Ga0105243_100744112 | 240 |
| 802 | 3300011119 | Ga0105246_10141199 | Ga0105246_101411992 | 240 |
| 803 | 3300025284 | Ga0209130_1000723 | Ga0209130_10007233 | 240 |
| 804 | 3300025294 | Ga0209025_1000212 | Ga0209025_100021265 | 240 |
| 805 | 3300025297 | Ga0209758_1007630 | Ga0209758_10076304 | 240 |
| 806 | 3300025302 | Ga0207426_1000102 | Ga0207426_100010230 | 240 |
| 807 | 3300042146 | Ga0450907_010208 | Ga0450907_010208_408_1175 | 240 |
| 808 | 3300044712 | Ga0453684_0626590 | Ga0453684_0626590_119_883 | 240 |
| 809 | 3300045049 | Ga0466959_0048132 | Ga0466959_0048132_33_857 | 240 |
| 810 | 3300048927 | Ga0496124_0054129 | Ga0496124_0054129_1410_2174 | 240 |
| 811 | 3300049568 | Ga0501031_0116370 | Ga0501031_0116370_653_1417 | 240 |
| 812 | 3300049569 | Ga0501032_0008335 | Ga0501032_0008335_5286_6110 | 240 |
| 813 | 3300049570 | Ga0501033_0046666 | Ga0501033_0046666_857_1621 | 240 |
| 814 | 3300049571 | Ga0501034_0055215 | Ga0501034_0055215_3196_3960 | 240 |
| 815 | 3300049581 | Ga0501047_0339601 | Ga0501047_0339601_362_1216 | 240 |
| 816 | iso_pu_bacteria | 8006964411 | 8006970770 | 240 |
| 817 | iso_pu_bacteria | 8056673599 | 8056674235 | 240 |
| 818 | 3300003203 | JGI25406J46586_10000004 | JGI25406J46586_1000000495 | 241 |
| 819 | 3300005437 | Ga0070710_10000700 | Ga0070710_100007003 | 241 |
| 820 | 3300005985 | Ga0081539_10000080 | Ga0081539_1000008032 | 241 |
| 821 | 3300006051 | Ga0075364_10003253 | Ga0075364_100032537 | 241 |
| 822 | 3300009092 | Ga0105250_10000007 | Ga0105250_1000000746 | 241 |
| 823 | 3300025711 | Ga0207696_1000029 | Ga0207696_100002982 | 241 |
| 824 | 3300025898 | Ga0207692_10006007 | Ga0207692_100060073 | 241 |
| 825 | 3300025925 | Ga0207650_10004248 | Ga0207650_100042486 | 241 |
| 826 | 3300030731 | Ga0316177_1032584 | Ga0316177_10325844 | 241 |
| 827 | 3300030732 | Ga0316176_1148195 | Ga0316176_11481951 | 241 |
| 828 | 3300030733 | Ga0314311_1152931 | Ga0314311_11529312 | 241 |
| 829 | 3300038443 | Ga0395901_0425572 | Ga0395901_0425572_207_1004 | 241 |
| 830 | 3300044658 | Ga0466972_0002122 | Ga0466972_0002122_394_1173 | 241 |
| 831 | 3300044658 | Ga0466972_0026339 | Ga0466972_0026339_1254_2033 | 241 |
| 832 | 3300044683 | Ga0466965_0109366 | Ga0466965_0109366_336_1115 | 241 |
| 833 | 3300044684 | Ga0466966_0048196 | Ga0466966_0048196_218_1000 | 241 |
| 834 | 3300044693 | Ga0466961_0025475 | Ga0466961_0025475_375_1157 | 241 |
| 835 | 3300044719 | Ga0466971_0035672 | Ga0466971_0035672_345_1127 | 241 |
| 836 | 3300044735 | Ga0466968_0032354 | Ga0466968_0032354_405_1184 | 241 |
| 837 | 3300044842 | Ga0466957_0363938 | Ga0466957_0363938_32_814 | 241 |
| 838 | 3300044901 | Ga0466960_0141952 | Ga0466960_0141952_438_1217 | 241 |
| 839 | 3300045049 | Ga0466959_0106306 | Ga0466959_0106306_184_966 | 241 |
| 840 | 3300046492 | Ga0495585_0169304 | Ga0495585_0169304_97_864 | 241 |
| 841 | 3300046691 | Ga0495670_0106107 | Ga0495670_0106107_350_1135 | 241 |
| 842 | 3300047470 | Ga0495681_0009660 | Ga0495681_0009660_2072_2842 | 241 |
| 843 | 3300048921 | Ga0496118_0007726 | Ga0496118_0007726_10039_10806 | 241 |
| 844 | 3300048924 | Ga0496121_0000216 | Ga0496121_0000216_53684_54451 | 241 |
| 845 | 3300048929 | Ga0496126_0000265 | Ga0496126_0000265_15044_15811 | 241 |
| 846 | 3300053177 | Ga0500636_0000830 | Ga0500636_0000830_1035_1802 | 241 |
| 847 | iso_pu_bacteria | 2874604998 | 2874607606 | 241 |
| 848 | iso_pu_bacteria | 3001889506 | 3001891792 | 241 |
| 849 | iso_pu_bacteria | 8006984368 | 8006985619 | 241 |
| 850 | 3300009545 | Ga0105237_10022833 | Ga0105237_100228339 | 242 |
| 851 | 3300010375 | Ga0105239_10015107 | Ga0105239_100151073 | 242 |
| 852 | 3300013104 | Ga0157370_10405659 | Ga0157370_104056592 | 242 |
| 853 | 3300013105 | Ga0157369_10012075 | Ga0157369_100120753 | 242 |
| 854 | 3300025904 | Ga0207647_10065042 | Ga0207647_100650423 | 242 |
| 855 | 3300025914 | Ga0207671_10062270 | Ga0207671_100622703 | 242 |
| 856 | 3300025949 | Ga0207667_10508063 | Ga0207667_105080631 | 242 |
| 857 | 3300039437 | Ga0436365_0944416 | Ga0436365_0944416_1471_2241 | 242 |
| 858 | 3300041997 | Ga0439431_0036423 | Ga0439431_0036423_80_853 | 242 |
| 859 | 3300045976 | Ga0466967_0114799 | Ga0466967_0114799_188_958 | 242 |
| 860 | 3300046453 | Ga0495627_000054 | Ga0495627_000054_120398_121171 | 242 |
| 861 | 3300046453 | Ga0495627_000164 | Ga0495627_000164_39400_40173 | 242 |
| 862 | 3300046455 | Ga0495603_0029388 | Ga0495603_0029388_1584_2357 | 242 |
| 863 | 3300046492 | Ga0495585_0155881 | Ga0495585_0155881_262_1035 | 242 |
| 864 | 3300046501 | Ga0495607_0000052 | Ga0495607_0000052_103111_103884 | 242 |
| 865 | 3300046512 | Ga0495610_0036021 | Ga0495610_0036021_248_1021 | 242 |
| 866 | 3300046515 | Ga0495620_0021420 | Ga0495620_0021420_672_1445 | 242 |
| 867 | 3300046519 | Ga0495632_0021156 | Ga0495632_0021156_2691_3464 | 242 |
| 868 | 3300046519 | Ga0495632_0034192 | Ga0495632_0034192_45_818 | 242 |
| 869 | 3300046520 | Ga0495637_0000143 | Ga0495637_0000143_31203_31976 | 242 |
| 870 | 3300046520 | Ga0495637_0018209 | Ga0495637_0018209_2432_3205 | 242 |
| 871 | 3300046530 | Ga0495654_0000664 | Ga0495654_0000664_10162_10935 | 242 |
| 872 | 3300046530 | Ga0495654_0038900 | Ga0495654_0038900_171_944 | 242 |
| 873 | 3300046616 | Ga0495668_0007355 | Ga0495668_0007355_5188_5961 | 242 |
| 874 | 3300046692 | Ga0495671_0085585 | Ga0495671_0085585_666_1439 | 242 |
| 875 | 3300046694 | Ga0495649_0000027 | Ga0495649_0000027_62687_63460 | 242 |
| 876 | 3300046810 | Ga0495660_0000088 | Ga0495660_0000088_57129_57902 | 242 |
| 877 | 3300047320 | Ga0495672_0001914 | Ga0495672_0001914_4429_5202 | 242 |
| 878 | 3300047320 | Ga0495672_0210877 | Ga0495672_0210877_17_790 | 242 |
| 879 | 3300047321 | Ga0495676_0001308 | Ga0495676_0001308_4473_5246 | 242 |
| 880 | 3300047469 | Ga0495673_0000538 | Ga0495673_0000538_9453_10226 | 242 |
| 881 | 3300047469 | Ga0495673_0002632 | Ga0495673_0002632_8567_9340 | 242 |
| 882 | 3300048091 | Ga0495626_0048357 | Ga0495626_0048357_815_1585 | 242 |
| 883 | 3300049459 | Ga0495678_000382 | Ga0495678_000382_13048_13821 | 242 |
| 884 | iso_pu_bacteria | 2884994152 | 2884996622 | 242 |
| 885 | 3300005719 | Ga0068861_100091331 | Ga0068861_1000913312 | 243 |
| 886 | 3300006846 | Ga0075430_100442087 | Ga0075430_1004420871 | 243 |
| 887 | 3300009147 | Ga0114129_10144631 | Ga0114129_101446312 | 243 |
| 888 | 3300009147 | Ga0114129_10524983 | Ga0114129_105249832 | 243 |
| 889 | 3300014326 | Ga0157380_10153017 | Ga0157380_101530172 | 243 |
| 890 | 3300026075 | Ga0207708_10255577 | Ga0207708_102555772 | 243 |
| 891 | 3300026116 | Ga0207674_10116606 | Ga0207674_101166063 | 243 |
| 892 | 3300026118 | Ga0207675_100311593 | Ga0207675_1003115932 | 243 |
| 893 | 3300046458 | Ga0495591_000002 | Ga0495591_000002_134074_134892 | 243 |
| 894 | 3300046471 | Ga0495650_0004704 | Ga0495650_0004704_2129_2905 | 243 |
| 895 | 3300046474 | Ga0495605_0000052 | Ga0495605_0000052_73486_74262 | 243 |
| 896 | 3300046474 | Ga0495605_0000550 | Ga0495605_0000550_7266_8084 | 243 |
| 897 | 3300046501 | Ga0495607_0000045 | Ga0495607_0000045_117752_118570 | 243 |
| 898 | 3300046506 | Ga0495583_0000089 | Ga0495583_0000089_6719_7495 | 243 |
| 899 | 3300046512 | Ga0495610_0100317 | Ga0495610_0100317_241_1059 | 243 |
| 900 | 3300046519 | Ga0495632_0000158 | Ga0495632_0000158_62868_63644 | 243 |
| 901 | 3300046520 | Ga0495637_0001574 | Ga0495637_0001574_9977_10795 | 243 |
| 902 | 3300046520 | Ga0495637_0005149 | Ga0495637_0005149_3097_3873 | 243 |
| 903 | 3300046538 | Ga0495609_0000033 | Ga0495609_0000033_147017_147793 | 243 |
| 904 | 3300046542 | Ga0495597_0000023 | Ga0495597_0000023_142269_143087 | 243 |
| 905 | 3300046665 | Ga0495661_0001793 | Ga0495661_0001793_6600_7376 | 243 |
| 906 | 3300046810 | Ga0495660_0002686 | Ga0495660_0002686_3770_4588 | 243 |
| 907 | 3300047469 | Ga0495673_0027949 | Ga0495673_0027949_1751_2527 | 243 |
| 908 | 3300049570 | Ga0501033_0081015 | Ga0501033_0081015_1032_1895 | 243 |
| 909 | 3300049579 | Ga0501043_0142027 | Ga0501043_0142027_214_1077 | 243 |
| 910 | 3300049579 | Ga0501043_0240918 | Ga0501043_0240918_66_896 | 243 |
| 911 | 3300049581 | Ga0501047_0004338 | Ga0501047_0004338_6813_7643 | 243 |
| 912 | 3300050507 | nmdc:mga05p37_455255_c1 | nmdc:mga05p37_455255_c1_651_1427 | 243 |
| 913 | 3300050507 | nmdc:mga05p37_886540_c1 | nmdc:mga05p37_886540_c1_38_814 | 243 |
| 914 | 3300050509 | nmdc:mga0qj67_22672_c1 | nmdc:mga0qj67_22672_c1_951_1727 | 243 |
| 915 | 3300050510 | nmdc:mga06r32_228056_c1 | nmdc:mga06r32_228056_c1_940_1716 | 243 |
| 916 | 3300050511 | nmdc:mga08y16_339477_c1 | nmdc:mga08y16_339477_c1_732_1508 | 243 |
| 917 | 3300053125 | Ga0500618_000389 | Ga0500618_000389_21367_22170 | 243 |
| 918 | 3300031507 | Ga0307509_10116051 | Ga0307509_101160511 | 244 |
| 919 | 3300037471 | Ga0395905_0001110 | Ga0395905_0001110_12412_13197 | 244 |
| 920 | 3300046462 | Ga0495651_0002844 | Ga0495651_0002844_8368_9144 | 244 |
| 921 | 3300046501 | Ga0495607_0036302 | Ga0495607_0036302_647_1426 | 244 |
| 922 | 3300046514 | Ga0495618_0053015 | Ga0495618_0053015_90_866 | 244 |
| 923 | 3300046516 | Ga0495628_0032670 | Ga0495628_0032670_317_1093 | 244 |
| 924 | 3300046529 | Ga0495652_0001618 | Ga0495652_0001618_12190_12966 | 244 |
| 925 | 3300046663 | Ga0495635_0006054 | Ga0495635_0006054_2937_3713 | 244 |
| 926 | 3300046679 | Ga0495623_0058278 | Ga0495623_0058278_618_1394 | 244 |
| 927 | 3300046680 | Ga0495646_0047000 | Ga0495646_0047000_1719_2495 | 244 |
| 928 | 3300046809 | Ga0495600_0008141 | Ga0495600_0008141_2534_3310 | 244 |
| 929 | 3300048088 | Ga0495602_0052900 | Ga0495602_0052900_1762_2538 | 244 |
| 930 | 3300053077 | Ga0495601_0001643 | Ga0495601_0001643_9114_9890 | 244 |
| 931 | 3300053078 | Ga0495612_0154630 | Ga0495612_0154630_34_810 | 244 |
| 932 | 3300053085 | Ga0495619_0107364 | Ga0495619_0107364_133_909 | 244 |
| 933 | 3300006058 | Ga0075432_10001438 | Ga0075432_100014384 | 245 |
| 934 | 3300046501 | Ga0495607_0125200 | Ga0495607_0125200_470_1333 | 249 |
| 935 | 3300046506 | Ga0495583_0000747 | Ga0495583_0000747_23186_24049 | 249 |
| 936 | 3300046501 | Ga0495607_0008284 | Ga0495607_0008284_2177_3055 | 250 |
| 937 | 3300046518 | Ga0495631_0047180 | Ga0495631_0047180_144_1022 | 250 |
| 938 | 2162886012 | MBSR1b_contig_5111757 | MBSR1b_0085.00005260 | 252 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1v6t-assembly1.cif.gz_A | crystal structure of lactam utilization protein from pyrococcus horikoshii ot3 | 0.8717 | 10 | 246 |
| 2xu2-assembly1.cif.gz_A | crystal structure of the hypothetical protein pa4511 from pseudomonas aeruginosa | 0.8626 | 11 | 235 |
| 2dfa-assembly1.cif.gz_A | crystal structure of lactam utilization protein from thermus thermophilus hb8 | 0.8593 | 10 | 247 |
| 1v6t-assembly1.cif.gz_A | crystal structure of lactam utilization protein from pyrococcus horikoshii ot3 | 0.8275 | 10 | 246 |
| 2dfa-assembly1.cif.gz_A | crystal structure of lactam utilization protein from thermus thermophilus hb8 | 0.8261 | 10 | 247 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FXX2_1_250_3.20.20.370 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase | 0.8923 | 10 | 247 | 3.20.20.370 |
| 1v6tA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase | 0.8717 | 10 | 246 | 3.20.20.370 |
| 2x5eA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase | 0.8623 | 11 | 235 | 3.20.20.370 |
| 2dfaA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase | 0.8593 | 10 | 247 | 3.20.20.370 |
| af_Q2FXX2_1_250_3.20.20.370 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase | 0.8472 | 10 | 247 | 3.20.20.370 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A645IXZ5-F1-model_v4 | LamB/YcsF family protein | 0.9913 | 158 | 246 |
GO:0005975
|
| AF-A0A2N8EL15-F1-model_v4 | deleted | 0.987 | 97 | 174 |
|
| AF-W4TG99-F1-model_v4 | deleted | 0.9854 | 160 | 248 |
|
| AF-A0A5P0JK03-F1-model_v4 | LamB/YcsF family protein | 0.9853 | 109 | 218 |
GO:0005975
|
| AF-A0A1V3X7X4-F1-model_v4 | LamB/YcsF family protein | 0.9841 | 141 | 248 |
GO:0005975
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar