F486264

General Info

Members Datasets Scaffolds Average Seq Length
938 511 867 245

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0081015|Ga0501033_0081015_1032_1895
Length 287
Sequence MAVRLRCRREIRLGHLRRLIEGALRRVRVARYGEAMATVDLNCDLGEGFGAWTIGDDDALLELVTSANVACGFHAGDPQIMLETCRLAAERGVAIGAHVAYRDLHGFGRRPMPVTPGELFADVVYQLGALRAAASAAGARVSYVKPHGALYNVAVRDAAQADAVARACAAVDPGLALLALPGSELLRAASAHGLAPIAETFADRAFRPDGTLVPRSQPGSVLHDPDEIAARVVRLVIEGRVAAIDGSEIAVDARSVCVHGDTPDAVAIAARVRAELTAAGVELRAFV

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
3 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
4 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
5 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
6 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
7 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
8 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
9 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
10 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
11 2643221670 Streptomyces sp. Root431 Isolate Unclassified
12 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
13 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
14 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
15 2643221714 Streptomyces sp. Root264 Isolate Unclassified
16 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
17 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
18 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
19 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
20 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
21 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
22 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
23 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
24 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
25 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
26 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
27 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
28 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
29 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
30 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
31 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
32 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
33 2867369537 Streptomyces sp. Z26 Isolate Unclassified
34 2867428634 Streptomyces sp. RP5T Isolate Unclassified
35 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
36 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
37 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
38 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
39 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
40 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
41 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
42 2904504865 Serratia marcescens 1822 Isolate Unclassified
43 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
44 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
45 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
46 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
47 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
48 2919506607 Acinetobacter sp. 3657 Isolate Unclassified
49 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
50 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
51 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
52 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
53 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
54 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
55 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
56 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
57 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
58 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
59 2984568884 Acinetobacter baylyi SORGH_AS893 Isolate Aerial Root
60 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
61 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
62 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
63 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
65 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
66 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
67 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
68 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
69 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
70 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
71 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
72 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
73 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
74 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
75 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
76 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
77 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
78 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
79 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
80 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
81 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
82 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
83 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
84 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
85 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
86 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
87 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
88 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
89 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
90 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
91 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
92 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
93 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
94 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
95 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
96 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
97 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
98 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
99 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
100 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
101 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
102 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
103 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
104 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
105 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
106 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
107 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
108 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
109 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
110 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
111 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
112 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
113 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
114 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
115 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
116 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
117 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
118 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
119 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
120 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
121 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
122 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
123 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
124 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
125 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
126 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
127 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
128 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
129 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
130 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
131 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
132 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
133 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
134 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
135 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
136 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
137 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
138 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
139 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
140 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
141 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
142 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
143 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
144 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
145 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
146 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
147 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
148 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
149 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
150 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
151 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
152 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
153 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
154 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
155 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
156 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
157 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
158 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
159 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
160 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
161 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
162 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
163 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
164 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
165 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
166 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
167 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
169 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
170 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
171 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
172 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
224 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
225 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
229 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
230 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
231 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
232 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
233 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
234 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
235 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
236 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
237 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
238 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
239 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
240 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
241 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
242 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
243 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
244 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
245 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
246 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
247 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
248 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
249 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
250 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
251 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
252 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
253 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
254 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
255 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
256 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
257 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
258 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
259 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
260 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
261 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
262 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
263 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
264 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
265 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
266 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
267 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
268 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
269 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
270 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
271 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
272 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
273 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
274 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
275 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
276 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
277 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
278 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
279 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
280 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
281 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
282 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
283 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
284 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
285 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
286 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
287 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
288 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
289 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
290 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
291 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
292 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
293 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
294 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
295 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
296 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
297 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
298 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
299 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
300 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
301 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
302 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
303 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
304 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
305 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
306 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
307 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
308 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
309 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
310 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
311 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
312 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
313 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
314 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
315 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
316 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
317 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
318 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
319 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
320 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
321 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
322 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
323 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
324 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
325 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
326 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
327 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
328 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
329 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
330 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
331 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
332 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
333 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
334 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
335 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
336 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
337 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
338 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
339 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
340 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
341 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
342 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
343 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
344 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
345 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
346 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
347 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
348 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
349 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
350 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
351 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
352 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
353 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
354 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
355 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
356 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
357 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
358 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
359 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
360 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
361 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
362 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
363 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
364 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
365 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
366 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
367 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
368 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
369 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
370 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
371 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
372 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
373 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
374 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
375 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
376 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
377 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
378 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
379 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
380 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
381 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
382 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
383 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
384 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
385 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
386 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
387 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
388 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
389 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
390 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
391 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
392 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
393 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
394 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
395 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
396 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
397 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
398 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
399 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
400 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
401 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
402 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
403 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
404 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
405 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
406 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
407 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
408 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
409 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
410 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
411 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
412 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
413 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
414 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
415 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
416 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
417 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
418 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
419 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
420 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
421 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
422 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
423 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
424 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
425 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
426 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
427 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
428 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
429 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
430 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
431 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
432 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
433 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
434 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
435 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
436 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
437 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
438 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
439 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
440 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
441 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
442 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
443 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
444 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
445 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
446 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
447 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
448 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
449 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
450 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
451 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
452 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
453 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
454 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
455 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
456 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
457 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
458 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
459 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
460 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
461 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
462 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
463 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
464 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
465 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
466 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
467 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
468 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
469 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
470 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
471 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
472 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
473 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
474 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
475 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
476 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
477 3300053113 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere Metagenome Endosphere
478 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
479 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
480 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
481 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
482 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
483 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
484 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
485 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
486 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
487 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
488 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
489 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
490 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
491 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
492 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
493 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
494 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
495 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
496 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
497 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
498 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
499 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
500 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
501 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
502 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
503 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
504 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
505 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
506 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
507 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
508 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
509 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
510 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
511 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.11
Metatranscriptomes 0.32
Isolates 7.57

Biome Distribution

Category Percentage (%)
Aerial Root 0.11
Bulb 0
Endosphere 8.96
Nodule 1.6
Rhizoplane 3.41
Rhizosphere 75.91
Stem 0
Stem Tuber 0
Unclassified 10.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_5111757 2162886012 Bacteria 1045
2 JGI25151J46595_10000290 3300003187 Bacteria 56749
3 JGI25151J46595_10000452 3300003187 Bacteria 39759
4 JGI25406J46586_10000004 3300003203 Bacteria 149772
5 JGI25406J46586_10020592 3300003203 Bacteria 2664
6 JGI25153J46596_10005638 3300003215 Bacteria 6539
7 rootH1_10018128 3300003316 Bacteria 14780
8 rootL2_10033936 3300003322 Bacteria 7201
9 JGI25160J50197_1010453 3300003354 Bacteria 3357
10 Ga0006562J51391_1084840 3300003578 Bacteria 3460
11 Ga0055538_1000078 3300003751 Bacteria 86114
12 Ga0055532_1007244 3300003758 Bacteria 1438
13 Ga0065714_10003968 3300005288 Bacteria 7942
14 Ga0070658_10000776 3300005327 Bacteria 27421
15 Ga0070658_10216466 3300005327 Bacteria 1619
16 Ga0070676_10029865 3300005328 Unclassified 3103
17 Ga0070683_100010912 3300005329 Bacteria 7823
18 Ga0070683_100735749 3300005329 Bacteria 945
19 Ga0070690_100178577 3300005330 Bacteria 1466
20 Ga0070690_100361843 3300005330 Bacteria 1056
21 Ga0070670_100143050 3300005331 Bacteria 2068
22 Ga0070670_100304917 3300005331 Bacteria 1393
23 Ga0070670_100462072 3300005331 Bacteria 1126
24 Ga0068869_100250063 3300005334 Bacteria 1415
25 Ga0070680_100011979 3300005336 Bacteria 6730
26 Ga0070680_100036774 3300005336 Bacteria 3955
27 Ga0070682_100063807 3300005337 Bacteria 2337
28 Ga0068868_100061827 3300005338 Unclassified 2967
29 Ga0070687_100039063 3300005343 Bacteria 2383
30 Ga0070661_100105058 3300005344 Bacteria 2105
31 Ga0070661_100198869 3300005344 Bacteria 1531
32 Ga0070668_100123061 3300005347 Bacteria 2075
33 Ga0070668_100219142 3300005347 Bacteria 1568
34 Ga0070669_100086582 3300005353 Bacteria 2341
35 Ga0070669_100254844 3300005353 Bacteria 1398
36 Ga0070671_100064633 3300005355 Bacteria 3047
37 Ga0070674_100013133 3300005356 Bacteria 5109
38 Ga0070674_100160811 3300005356 Unclassified 1704
39 Ga0070674_100164204 3300005356 Bacteria 1687
40 Ga0070659_100087500 3300005366 Bacteria 2494
41 Ga0070667_100724239 3300005367 Bacteria 921
42 Ga0070714_100059899 3300005435 Bacteria 3266
43 Ga0070714_100060184 3300005435 Bacteria 3259
44 Ga0070713_100007399 3300005436 Bacteria 7704
45 Ga0070713_100335831 3300005436 Bacteria 1399
46 Ga0070710_10000700 3300005437 Bacteria 15951
47 Ga0070701_10063609 3300005438 Bacteria 1953
48 Ga0070701_10191800 3300005438 Bacteria 1203
49 Ga0070700_100053995 3300005441 Unclassified 2509
50 Ga0070663_100001689 3300005455 Bacteria 12257
51 Ga0070663_100100056 3300005455 Bacteria 2162
52 Ga0070678_100089913 3300005456 Bacteria 2351
53 Ga0070662_100066983 3300005457 Bacteria 2636
54 Ga0070662_100138823 3300005457 Bacteria 1881
55 Ga0070662_100189766 3300005457 Bacteria 1624
56 Ga0070662_100269236 3300005457 Bacteria 1375
57 Ga0070662_100372651 3300005457 Bacteria 1174
58 Ga0070681_10085409 3300005458 Bacteria 3108
59 Ga0070681_10206222 3300005458 Bacteria 1883
60 Ga0068867_100013927 3300005459 Bacteria 5692
61 Ga0070679_100018059 3300005530 Bacteria 6836
62 Ga0070684_100015276 3300005535 Bacteria 6248
63 Ga0070684_100333307 3300005535 Bacteria 1394
64 Ga0068853_100126244 3300005539 Bacteria 2285
65 Ga0068853_100275185 3300005539 Bacteria 1551
66 Ga0070686_100011330 3300005544 Bacteria 5056
67 Ga0070696_100094253 3300005546 Bacteria 2136
68 Ga0070696_100274669 3300005546 Bacteria 1283
69 Ga0070665_100041123 3300005548 Bacteria 4646
70 Ga0070665_100169556 3300005548 Bacteria 2184
71 Ga0070665_100394545 3300005548 Bacteria 1391
72 Ga0068855_100079887 3300005563 Bacteria 3792
73 Ga0068855_100361771 3300005563 Bacteria 1596
74 Ga0068854_100139147 3300005578 Bacteria 1861
75 Ga0068854_100170182 3300005578 Bacteria 1695
76 Ga0068854_100733481 3300005578 Bacteria 856
77 Ga0068856_100001981 3300005614 Bacteria 21353
78 Ga0068856_100746448 3300005614 Bacteria 999
79 Ga0068852_100299550 3300005616 Bacteria 1556
80 Ga0068866_10004618 3300005718 Bacteria 5647
81 Ga0068866_10033488 3300005718 Unclassified 2494
82 Ga0068861_100021041 3300005719 Bacteria 4685
83 Ga0068861_100091331 3300005719 Bacteria 2404
84 Ga0068861_100226373 3300005719 Bacteria 1583
85 Ga0068861_100296045 3300005719 Bacteria 1399
86 Ga0068863_100114888 3300005841 Bacteria 2564
87 Ga0068858_100237967 3300005842 Bacteria 1727
88 Ga0068858_100288269 3300005842 Bacteria 1564
89 Ga0068860_100129848 3300005843 Bacteria 2417
90 Ga0068860_100325553 3300005843 Bacteria 1509
91 Ga0068860_100365588 3300005843 Bacteria 1422
92 Ga0068862_100086716 3300005844 Bacteria 2722
93 Ga0068862_100259672 3300005844 Bacteria 1585
94 Ga0068862_100382985 3300005844 Unclassified 1312
95 Ga0081455_10024373 3300005937 Bacteria 5604
96 Ga0081455_10049743 3300005937 Bacteria 3611
97 Ga0081455_10067919 3300005937 Bacteria 2969
98 Ga0081540_1001654 3300005983 Bacteria 18964
99 Ga0081540_1002242 3300005983 Bacteria 15915
100 Ga0081540_1002357 3300005983 Bacteria 15438
101 Ga0081540_1004805 3300005983 Bacteria 10181
102 Ga0081540_1035212 3300005983 Bacteria 2688
103 Ga0081540_1062046 3300005983 Bacteria 1778
104 Ga0081539_10000080 3300005985 Bacteria 222745
105 Ga0081539_10000366 3300005985 Bacteria 98762
106 Ga0070717_10000850 3300006028 Bacteria 20235
107 Ga0070717_10361128 3300006028 Bacteria 1300
108 Ga0075365_10029915 3300006038 Bacteria 3484
109 Ga0075365_10045983 3300006038 Bacteria 2866
110 Ga0075365_10057240 3300006038 Bacteria 2593
111 Ga0075365_10063980 3300006038 Bacteria 2463
112 Ga0075365_10319331 3300006038 Bacteria 1094
113 Ga0075368_10079589 3300006042 Bacteria 1332
114 Ga0075364_10003253 3300006051 Bacteria 9197
115 Ga0075364_10039785 3300006051 Bacteria 3048
116 Ga0075364_10078219 3300006051 Bacteria 2184
117 Ga0075364_10321114 3300006051 Bacteria 1054
118 Ga0075432_10000367 3300006058 Bacteria 13018
119 Ga0075432_10001438 3300006058 Bacteria 7767
120 Ga0070712_100008065 3300006175 Bacteria 6608
121 Ga0075362_10019548 3300006177 Bacteria 2818
122 Ga0075362_10066772 3300006177 Bacteria 1635
123 Ga0075367_10003283 3300006178 Bacteria 7666
124 Ga0075367_10140894 3300006178 Bacteria 1493
125 Ga0075369_10016597 3300006186 Bacteria 2974
126 Ga0075370_10038370 3300006353 Bacteria 2695
127 Ga0068871_100192267 3300006358 Bacteria 1758
128 Ga0075428_100009319 3300006844 Bacteria 10887
129 Ga0075430_100133963 3300006846 Bacteria 2065
130 Ga0075430_100442087 3300006846 Bacteria 1073
131 Ga0075431_100844292 3300006847 Unclassified 887
132 Ga0075433_10004818 3300006852 Bacteria 10539
133 Ga0075434_100007683 3300006871 Bacteria 9980
134 Ga0075429_100014062 3300006880 Bacteria 6937
135 Ga0068865_100009881 3300006881 Bacteria 5928
136 Ga0068865_100036225 3300006881 Unclassified 3325
137 Ga0068865_100101680 3300006881 Bacteria 2105
138 Ga0068865_100148720 3300006881 Bacteria 1774
139 Ga0075436_100029385 3300006914 Bacteria 3780
140 Ga0099826_10143414 3300006948 Bacteria 1376
141 Ga0075435_100002860 3300007076 Bacteria 11562
142 Ga0075435_100247358 3300007076 Bacteria 1517
143 Ga0099795_10082104 3300007788 Bacteria 1235
144 Ga0105244_10000125 3300009036 Bacteria 78586
145 Ga0105244_10021312 3300009036 Bacteria 3587
146 Ga0105250_10000007 3300009092 Bacteria 355249
147 Ga0105250_10000082 3300009092 Bacteria 82954
148 Ga0105250_10175416 3300009092 Bacteria 898
149 Ga0111539_10010908 3300009094 Bacteria 11437
150 Ga0111539_10110632 3300009094 Bacteria 3223
151 Ga0105245_10024804 3300009098 Bacteria 5268
152 Ga0105245_10116651 3300009098 Bacteria 2489
153 Ga0105245_10690417 3300009098 Bacteria 1053
154 Ga0114129_10015367 3300009147 Bacteria 10893
155 Ga0114129_10144631 3300009147 Unclassified 3258
156 Ga0114129_10524983 3300009147 Unclassified 1543
157 Ga0105243_10074411 3300009148 Bacteria 2755
158 Ga0105243_10077812 3300009148 Bacteria 2699
159 Ga0105243_10108545 3300009148 Bacteria 2316
160 Ga0105243_10374442 3300009148 Bacteria 1315
161 Ga0105241_10011484 3300009174 Bacteria 6492
162 Ga0105241_10292487 3300009174 Bacteria 1395
163 Ga0105237_10022833 3300009545 Bacteria 6417
164 Ga0105237_10317216 3300009545 Bacteria 1562
165 Ga0105238_10092613 3300009551 Bacteria 3010
166 Ga0105238_10192548 3300009551 Bacteria 2015
167 Ga0105238_10254646 3300009551 Bacteria 1734
168 Ga0105238_10595616 3300009551 Bacteria 1113
169 Ga0105249_10054067 3300009553 Bacteria 3671
170 Ga0105249_10188211 3300009553 Bacteria 2013
171 Ga0105249_10617704 3300009553 Bacteria 1140
172 Ga0099796_10016663 3300010159 Bacteria 2174
173 Ga0105239_10015107 3300010375 Bacteria 8561
174 Ga0105239_10152156 3300010375 Bacteria 2582
175 Ga0105239_10193695 3300010375 Bacteria 2276
176 Ga0105239_10584221 3300010375 Bacteria 1274
177 Ga0105246_10039933 3300011119 Bacteria 3164
178 Ga0105246_10141199 3300011119 Bacteria 1811
179 Ga0157314_1002520 3300012500 Bacteria 1267
180 Ga0157370_10038272 3300013104 Bacteria 4640
181 Ga0157370_10405659 3300013104 Bacteria 1254
182 Ga0157369_10002377 3300013105 Bacteria 22613
183 Ga0157369_10010836 3300013105 Bacteria 10384
184 Ga0157369_10012075 3300013105 Bacteria 9809
185 Ga0157369_10045795 3300013105 Bacteria 4756
186 Ga0157369_10119955 3300013105 Bacteria 2791
187 Ga0157378_10007645 3300013297 Bacteria 9434
188 Ga0157378_10172604 3300013297 Bacteria 2029
189 Ga0157378_10265492 3300013297 Bacteria 1648
190 Ga0157378_10333987 3300013297 Bacteria 1476
191 Ga0163162_10195665 3300013306 Bacteria 2150
192 Ga0163162_10380193 3300013306 Bacteria 1545
193 Ga0163162_10815544 3300013306 Bacteria 1050
194 Ga0157372_10000598 3300013307 Bacteria 39369
195 Ga0157372_10082081 3300013307 Bacteria 3649
196 Ga0157372_10348336 3300013307 Bacteria 1726
197 Ga0157372_10366859 3300013307 Bacteria 1678
198 Ga0157372_10541015 3300013307 Bacteria 1358
199 Ga0157375_10807322 3300013308 Bacteria 1087
200 Ga0163163_10862600 3300014325 Bacteria 969
201 Ga0157380_10153017 3300014326 Bacteria 1996
202 Ga0182008_10000543 3300014497 Bacteria 28040
203 Ga0157377_10033791 3300014745 Bacteria 2794
204 Ga0182007_10023586 3300015262 Bacteria 2163
205 Ga0163161_10195097 3300017792 Bacteria 1558
206 Ga0163161_10221675 3300017792 Bacteria 1465
207 Ga0163161_10245798 3300017792 Bacteria 1393
208 Ga0206353_10369860 3300020082 Bacteria 959
209 Ga0206353_10722848 3300020082 Bacteria 3394
210 Ga0209147_101597 3300025229 Bacteria 7647
211 Ga0209130_1000723 3300025284 Bacteria 29231
212 Ga0209025_1000212 3300025294 Bacteria 139086
213 Ga0209758_1002140 3300025297 Bacteria 20814
214 Ga0209758_1007630 3300025297 Bacteria 7297
215 Ga0209758_1028198 3300025297 Bacteria 2381
216 Ga0207426_1000102 3300025302 Bacteria 255303
217 Ga0207426_1023168 3300025302 Bacteria 2121
218 Ga0207696_1000029 3300025711 Bacteria 398074
219 Ga0207696_1000219 3300025711 Bacteria 83088
220 Ga0207713_1000036 3300025735 Bacteria 259717
221 Ga0207713_1007766 3300025735 Bacteria 6264
222 Ga0207692_10006007 3300025898 Bacteria 4908
223 Ga0207642_10060145 3300025899 Unclassified 1761
224 Ga0207688_10070069 3300025901 Bacteria 1988
225 Ga0207688_10083853 3300025901 Bacteria 1823
226 Ga0207688_10201075 3300025901 Bacteria 1194
227 Ga0207647_10018809 3300025904 Bacteria 4660
228 Ga0207647_10065042 3300025904 Bacteria 2214
229 Ga0207647_10154094 3300025904 Bacteria 1342
230 Ga0207699_10049700 3300025906 Bacteria 2469
231 Ga0207699_10145127 3300025906 Bacteria 1564
232 Ga0207645_10033287 3300025907 Unclassified 3313
233 Ga0207705_10000676 3300025909 Bacteria 28263
234 Ga0207705_10133712 3300025909 Bacteria 1847
235 Ga0207654_10014624 3300025911 Bacteria 4057
236 Ga0207707_10001525 3300025912 Bacteria 21374
237 Ga0207707_10309072 3300025912 Bacteria 1366
238 Ga0207695_10185086 3300025913 Bacteria 2002
239 Ga0207671_10037138 3300025914 Bacteria 3613
240 Ga0207671_10062270 3300025914 Bacteria 2770
241 Ga0207671_10196832 3300025914 Bacteria 1573
242 Ga0207693_10012101 3300025915 Bacteria 6976
243 Ga0207693_10156026 3300025915 Bacteria 1795
244 Ga0207660_10008817 3300025917 Bacteria 6519
245 Ga0207660_10009614 3300025917 Bacteria 6259
246 Ga0207662_10034565 3300025918 Unclassified 2950
247 Ga0207649_10096185 3300025920 Bacteria 1950
248 Ga0207652_10042144 3300025921 Bacteria 3883
249 Ga0207652_10051372 3300025921 Bacteria 3534
250 Ga0207681_10084424 3300025923 Bacteria 2251
251 Ga0207694_10159429 3300025924 Bacteria 1822
252 Ga0207694_10273153 3300025924 Bacteria 1387
253 Ga0207650_10004248 3300025925 Bacteria 9778
254 Ga0207700_10004989 3300025928 Bacteria 7890
255 Ga0207700_10055356 3300025928 Bacteria 2982
256 Ga0207700_10348696 3300025928 Bacteria 1289
257 Ga0207664_10013023 3300025929 Bacteria 5960
258 Ga0207664_10492209 3300025929 Bacteria 1097
259 Ga0207664_10938293 3300025929 Bacteria 776
260 Ga0207706_10020869 3300025933 Bacteria 5882
261 Ga0207706_10036247 3300025933 Bacteria 4382
262 Ga0207706_10126572 3300025933 Bacteria 2247
263 Ga0207706_10148626 3300025933 Unclassified 2061
264 Ga0207686_10280776 3300025934 Bacteria 1229
265 Ga0207709_10113826 3300025935 Bacteria 1814
266 Ga0207669_10034512 3300025937 Bacteria 2867
267 Ga0207669_10056437 3300025937 Unclassified 2385
268 Ga0207704_10092144 3300025938 Unclassified 1994
269 Ga0207704_10108668 3300025938 Bacteria 1869
270 Ga0207691_10025136 3300025940 Bacteria 5595
271 Ga0207691_10237065 3300025940 Bacteria 1578
272 Ga0207689_10109560 3300025942 Bacteria 2269
273 Ga0207689_10252184 3300025942 Bacteria 1459
274 Ga0207689_10293197 3300025942 Bacteria 1348
275 Ga0207661_10147736 3300025944 Bacteria 2029
276 Ga0207661_10852886 3300025944 Unclassified 839
277 Ga0207667_10130634 3300025949 Bacteria 2587
278 Ga0207667_10291644 3300025949 Bacteria 1667
279 Ga0207667_10335745 3300025949 Bacteria 1543
280 Ga0207667_10508063 3300025949 Bacteria 1222
281 Ga0207712_10010325 3300025961 Bacteria 5929
282 Ga0207712_10274965 3300025961 Bacteria 1372
283 Ga0207668_10020551 3300025972 Bacteria 4197
284 Ga0207668_10073433 3300025972 Bacteria 2451
285 Ga0207668_10164736 3300025972 Bacteria 1731
286 Ga0207640_10163924 3300025981 Bacteria 1648
287 Ga0207640_10787981 3300025981 Unclassified 822
288 Ga0207658_10752442 3300025986 Bacteria 883
289 Ga0207677_10110172 3300026023 Bacteria 2049
290 Ga0207677_10118785 3300026023 Bacteria 1984
291 Ga0207639_10037054 3300026041 Bacteria 3620
292 Ga0207639_10138747 3300026041 Bacteria 2023
293 Ga0207639_10198861 3300026041 Bacteria 1717
294 Ga0207678_10000232 3300026067 Bacteria 49851
295 Ga0207678_10030951 3300026067 Bacteria 4671
296 Ga0207678_10036762 3300026067 Bacteria 4263
297 Ga0207678_10099875 3300026067 Bacteria 2479
298 Ga0207708_10016735 3300026075 Bacteria 5518
299 Ga0207708_10053249 3300026075 Unclassified 3083
300 Ga0207708_10142716 3300026075 Bacteria 1880
301 Ga0207708_10255577 3300026075 Bacteria 1413
302 Ga0207702_10000640 3300026078 Bacteria 38336
303 Ga0207641_10585853 3300026088 Bacteria 1091
304 Ga0207648_10050344 3300026089 Bacteria 3642
305 Ga0207648_10153106 3300026089 Bacteria 2035
306 Ga0207676_10051154 3300026095 Bacteria 3224
307 Ga0207674_10020811 3300026116 Bacteria 7080
308 Ga0207674_10116606 3300026116 Bacteria 2641
309 Ga0207674_10317332 3300026116 Bacteria 1508
310 Ga0207675_100024426 3300026118 Bacteria 5619
311 Ga0207675_100038277 3300026118 Bacteria 4476
312 Ga0207675_100052667 3300026118 Bacteria 3798
313 Ga0207675_100142806 3300026118 Unclassified 2275
314 Ga0207675_100157313 3300026118 Bacteria 2166
315 Ga0207675_100311593 3300026118 Bacteria 1535
316 Ga0207683_10119042 3300026121 Bacteria 2369
317 Ga0207683_10146839 3300026121 Bacteria 2127
318 Ga0209981_1007580 3300027378 Bacteria 1465
319 Ga0209982_1001892 3300027552 Bacteria 2895
320 Ga0209983_1005466 3300027665 Bacteria 2631
321 Ga0209971_1000529 3300027682 Bacteria 10064
322 Ga0209813_10084967 3300027866 Bacteria 1053
323 Ga0207428_10000706 3300027907 Bacteria 38683
324 Ga0268266_10053275 3300028379 Bacteria 3475
325 Ga0268265_10111826 3300028380 Bacteria 2231
326 Ga0268265_10283467 3300028380 Bacteria 1483
327 Ga0268264_10252543 3300028381 Bacteria 1639
328 Ga0268264_10340706 3300028381 Bacteria 1424
329 Ga0307517_10005855 3300028786 Bacteria 18372
330 Ga0307515_10068642 3300028794 Bacteria 4865
331 Ga0307515_10078627 3300028794 Bacteria 4334
332 Ga0307515_10217621 3300028794 Bacteria 1737
333 Ga0307511_10215903 3300030521 Bacteria 971
334 Ga0307512_10054085 3300030522 Bacteria 3183
335 Ga0316177_1032584 3300030731 Bacteria 4094
336 Ga0316176_1148195 3300030732 Bacteria 1018
337 Ga0314311_1152931 3300030733 Bacteria 8709
338 Ga0316180_1055335 3300030736 Bacteria 1400
339 Ga0265332_10074137 3300031238 Bacteria 1447
340 Ga0307513_10197139 3300031456 Bacteria 1859
341 Ga0307513_10425208 3300031456 Bacteria 1057
342 Ga0307509_10035904 3300031507 Bacteria 5434
343 Ga0307509_10116051 3300031507 Bacteria 2667
344 Ga0307508_10008307 3300031616 Bacteria 9606
345 Ga0307508_10261036 3300031616 Bacteria 1327
346 Ga0307508_10299813 3300031616 Bacteria 1200
347 Ga0307514_10006568 3300031649 Bacteria 10103
348 Ga0307514_10033166 3300031649 Bacteria 4122
349 Ga0265314_10021126 3300031711 Bacteria 5014
350 Ga0265342_10116338 3300031712 Bacteria 1509
351 Ga0307516_10002742 3300031730 Bacteria 23227
352 Ga0307516_10004092 3300031730 Bacteria 18235
353 Ga0307413_10029742 3300031824 Bacteria 3061
354 Ga0307413_10067686 3300031824 Bacteria 2234
355 Ga0307518_10025604 3300031838 Bacteria 4255
356 Ga0307406_10113393 3300031901 Bacteria 1871
357 Ga0307406_10453554 3300031901 Bacteria 1029
358 Ga0307407_10547107 3300031903 Bacteria 855
359 Ga0307416_100428202 3300032002 Bacteria 1370
360 Ga0307414_10000905 3300032004 Bacteria 15205
361 Ga0307414_10053229 3300032004 Bacteria 2822
362 Ga0307414_10340183 3300032004 Bacteria 1284
363 Ga0307507_10024788 3300033179 Bacteria 6527
364 Ga0307510_10010654 3300033180 Bacteria 10926
365 Ga0307510_10015733 3300033180 Bacteria 8946
366 Ga0307510_10203101 3300033180 Bacteria 1514
367 Ga0307510_10212540 3300033180 Bacteria 1455
368 Ga0373930_0003508 3300034816 Bacteria 2491
369 Ga0373948_0017766 3300034817 Bacteria 1329
370 Ga0373928_0000800 3300035084 Bacteria 6127
371 Ga0373928_0025680 3300035084 Bacteria 1272
372 Ga0373934_0136200 3300035086 Bacteria 1003
373 Ga0373923_0194604 3300035111 Bacteria 935
374 Ga0373932_0021501 3300035112 Bacteria 1704
375 Ga0373936_0007027 3300035113 Bacteria 4236
376 Ga0373936_0007241 3300035113 Bacteria 4175
377 Ga0373945_0040951 3300035116 Bacteria 1674
378 Ga0373946_0041580 3300035171 Bacteria 1886
379 Ga0373946_0291885 3300035171 Bacteria 804
380 Ga0373931_0000001 3300035691 Bacteria 634029
381 Ga0373931_0000038 3300035691 Bacteria 74311
382 Ga0373935_0001717 3300035692 Bacteria 12270
383 Ga0373935_0477141 3300035692 Bacteria 903
384 Ga0373927_0001560 3300035695 Bacteria 17188
385 Ga0373927_0041650 3300035695 Bacteria 2978
386 Ga0373927_0148845 3300035695 Bacteria 1533
387 Ga0373947_0052206 3300035725 Bacteria 2462
388 Ga0373947_0154875 3300035725 Bacteria 1478
389 Ga0373937_0017600 3300036401 Bacteria 6371
390 Ga0373937_0164480 3300036401 Bacteria 2080
391 Ga0316584_0317867 3300036712 Bacteria 1124
392 Ga0373925_0002416 3300037068 Bacteria 14983
393 Ga0373925_0171043 3300037068 Bacteria 1715
394 Ga0395900_0081695 3300037418 Bacteria 3320
395 Ga0395898_0008785 3300037466 Bacteria 10647
396 Ga0395898_0131206 3300037466 Bacteria 2400
397 Ga0395905_0001110 3300037471 Bacteria 33818
398 Ga0436364_0136448 3300037853 Bacteria 2487
399 Ga0395901_0425572 3300038443 Bacteria 1361
400 Ga0400488_14442 3300038741 Bacteria 1409
401 Ga0436365_0175813 3300039437 Bacteria 2750
402 Ga0436365_0944416 3300039437 Bacteria 4480
403 Ga0436365_1444934 3300039437 Bacteria 1882
404 Ga0436360_1343606 3300039438 Bacteria 3256
405 Ga0436363_1332597 3300039450 Bacteria 1010
406 Ga0439436_0003644 3300041404 Bacteria 4694
407 Ga0439438_000453 3300041405 Bacteria 18539
408 Ga0439438_000829 3300041405 Bacteria 13843
409 Ga0439439_0001165 3300041406 Bacteria 5061
410 Ga0439447_001186 3300041407 Bacteria 9504
411 Ga0439466_0011204 3300041411 Bacteria 3319
412 Ga0439465_0024664 3300041413 Bacteria 1896
413 Ga0451795_0444049 3300041456 Bacteria 1563
414 Ga0451835_0889745 3300041492 Bacteria 1121
415 Ga0451837_0485700 3300041494 Bacteria 4304
416 Ga0451853_1195562 3300041512 Bacteria 5498
417 Ga0439431_0036423 3300041997 Bacteria 1239
418 Ga0439433_0002581 3300041999 Bacteria 3848
419 Ga0439442_008450 3300042002 Bacteria 2079
420 Ga0439448_0079991 3300042005 Bacteria 1097
421 Ga0439432_002880 3300042006 Bacteria 6410
422 Ga0439449_0001695 3300042007 Bacteria 8674
423 Ga0439452_001698 3300042010 Bacteria 8654
424 Ga0439457_001044 3300042014 Bacteria 8376
425 Ga0439462_0020429 3300042015 Bacteria 1727
426 Ga0450923_001643 3300042125 Bacteria 3021
427 Ga0450907_010208 3300042146 Bacteria 1559
428 Ga0439446_0010479 3300042156 Bacteria 2496
429 Ga0439458_0009563 3300042157 Bacteria 2160
430 Ga0439458_0010452 3300042157 Bacteria 2070
431 Ga0439434_0031543 3300042435 Bacteria 1611
432 Ga0466969_0012942 3300044656 Bacteria 4395
433 Ga0466969_0039102 3300044656 Bacteria 2384
434 Ga0466972_0001762 3300044658 Bacteria 10612
435 Ga0466972_0002122 3300044658 Bacteria 9732
436 Ga0466972_0003178 3300044658 Bacteria 8161
437 Ga0466972_0015460 3300044658 Bacteria 3814
438 Ga0466972_0026339 3300044658 Bacteria 2882
439 Ga0466965_0000492 3300044683 Bacteria 14023
440 Ga0466965_0021514 3300044683 Bacteria 3105
441 Ga0466965_0048074 3300044683 Bacteria 2113
442 Ga0466965_0083212 3300044683 Bacteria 1620
443 Ga0466965_0109366 3300044683 Bacteria 1419
444 Ga0466966_0018718 3300044684 Bacteria 4562
445 Ga0466966_0041891 3300044684 Bacteria 2941
446 Ga0466966_0048196 3300044684 Bacteria 2714
447 Ga0466961_0005326 3300044693 Bacteria 8094
448 Ga0466961_0011622 3300044693 Bacteria 5626
449 Ga0466961_0025475 3300044693 Bacteria 3803
450 Ga0466961_0384301 3300044693 Bacteria 853
451 Ga0466963_0000319 3300044694 Bacteria 21690
452 Ga0466963_0000336 3300044694 Bacteria 21334
453 Ga0466963_0040999 3300044694 Bacteria 3035
454 Ga0466963_0045770 3300044694 Bacteria 2883
455 Ga0466964_0000999 3300044706 Bacteria 9395
456 Ga0453684_0626590 3300044712 Bacteria 1176
457 Ga0466971_0000247 3300044719 Bacteria 20764
458 Ga0466971_0035672 3300044719 Bacteria 2230
459 Ga0466968_0006777 3300044735 Bacteria 4333
460 Ga0466968_0032354 3300044735 Bacteria 2175
461 Ga0466968_0086510 3300044735 Bacteria 1384
462 Ga0466970_0000625 3300044765 Bacteria 17367
463 Ga0466970_0270686 3300044765 Bacteria 954
464 Ga0466957_0000837 3300044842 Bacteria 15736
465 Ga0466957_0052166 3300044842 Bacteria 2490
466 Ga0466957_0363938 3300044842 Bacteria 983
467 Ga0466960_0075425 3300044901 Bacteria 1687
468 Ga0466960_0141952 3300044901 Bacteria 1276
469 Ga0466959_0048132 3300045049 Bacteria 3134
470 Ga0466959_0104912 3300045049 Bacteria 2021
471 Ga0466959_0105730 3300045049 Bacteria 2012
472 Ga0466959_0106306 3300045049 Bacteria 2006
473 Ga0466959_0234125 3300045049 Bacteria 1270
474 Ga0466958_0001544 3300045836 Bacteria 11027
475 Ga0466967_0001364 3300045976 Bacteria 14054
476 Ga0466967_0030588 3300045976 Bacteria 4520
477 Ga0466967_0076913 3300045976 Bacteria 3003
478 Ga0466967_0097359 3300045976 Bacteria 2685
479 Ga0466967_0099857 3300045976 Bacteria 2651
480 Ga0466967_0114799 3300045976 Bacteria 2479
481 Ga0466967_0146604 3300045976 Bacteria 2202
482 Ga0466967_0336521 3300045976 Bacteria 1459
483 Ga0466967_0485282 3300045976 Bacteria 1211
484 Ga0495617_028853 3300046452 Bacteria 1866
485 Ga0495627_000054 3300046453 Bacteria 151899
486 Ga0495627_000164 3300046453 Bacteria 75744
487 Ga0495592_0360769 3300046454 Bacteria 929
488 Ga0495603_0000356 3300046455 Bacteria 24663
489 Ga0495603_0001798 3300046455 Bacteria 12664
490 Ga0495603_0007578 3300046455 Bacteria 6531
491 Ga0495603_0029388 3300046455 Bacteria 3314
492 Ga0495591_000002 3300046458 Bacteria 455013
493 Ga0495629_0000087 3300046459 Bacteria 81337
494 Ga0495629_0047708 3300046459 Bacteria 3004
495 Ga0495629_0122012 3300046459 Bacteria 1815
496 Ga0495629_0191217 3300046459 Bacteria 1417
497 Ga0495638_0019670 3300046460 Bacteria 4465
498 Ga0495638_0212043 3300046460 Bacteria 1087
499 Ga0495638_0215507 3300046460 Bacteria 1076
500 Ga0495641_0003485 3300046461 Bacteria 11729
501 Ga0495651_0002844 3300046462 Bacteria 13401
502 Ga0495651_0005413 3300046462 Bacteria 9739
503 Ga0495653_0000291 3300046463 Bacteria 40584
504 Ga0495653_0028857 3300046463 Bacteria 4436
505 Ga0495650_0004704 3300046471 Bacteria 9206
506 Ga0495580_0187728 3300046472 Bacteria 1426
507 Ga0495580_0463899 3300046472 Bacteria 849
508 Ga0495582_0004609 3300046473 Bacteria 7744
509 Ga0495582_0116310 3300046473 Bacteria 1504
510 Ga0495605_0000052 3300046474 Bacteria 162723
511 Ga0495605_0000550 3300046474 Bacteria 30682
512 Ga0495639_0000022 3300046475 Bacteria 72037
513 Ga0495662_0001463 3300046476 Bacteria 11692
514 Ga0495662_0002185 3300046476 Bacteria 9837
515 Ga0495662_0007605 3300046476 Bacteria 5347
516 Ga0495662_0014932 3300046476 Bacteria 3772
517 Ga0495664_0003293 3300046477 Bacteria 8786
518 Ga0495664_0073467 3300046477 Bacteria 2045
519 Ga0495664_0082815 3300046477 Bacteria 1925
520 Ga0495664_0102750 3300046477 Bacteria 1722
521 Ga0495664_0380693 3300046477 Bacteria 848
522 Ga0495585_0001175 3300046492 Bacteria 21290
523 Ga0495585_0017276 3300046492 Bacteria 4171
524 Ga0495585_0155881 3300046492 Bacteria 1188
525 Ga0495585_0169304 3300046492 Bacteria 1129
526 Ga0495594_0000169 3300046499 Bacteria 31347
527 Ga0495594_0018658 3300046499 Bacteria 3677
528 Ga0495607_0000045 3300046501 Bacteria 125217
529 Ga0495607_0000052 3300046501 Bacteria 118863
530 Ga0495607_0001929 3300046501 Bacteria 17511
531 Ga0495607_0008284 3300046501 Bacteria 7111
532 Ga0495607_0036302 3300046501 Bacteria 2970
533 Ga0495607_0072851 3300046501 Bacteria 1911
534 Ga0495607_0125200 3300046501 Bacteria 1344
535 Ga0495607_0282064 3300046501 Bacteria 788
536 Ga0495583_0000089 3300046506 Bacteria 163349
537 Ga0495583_0000747 3300046506 Bacteria 41311
538 Ga0495583_0008269 3300046506 Bacteria 6379
539 Ga0495606_0000155 3300046507 Bacteria 119163
540 Ga0495610_0036021 3300046512 Bacteria 2533
541 Ga0495610_0100317 3300046512 Bacteria 1298
542 Ga0495618_0053015 3300046514 Bacteria 2565
543 Ga0495618_0154568 3300046514 Bacteria 1465
544 Ga0495620_0007303 3300046515 Bacteria 6017
545 Ga0495620_0021420 3300046515 Bacteria 3139
546 Ga0495620_0032288 3300046515 Bacteria 2387
547 Ga0495628_0019565 3300046516 Bacteria 5595
548 Ga0495628_0032670 3300046516 Bacteria 4199
549 Ga0495630_0002076 3300046517 Bacteria 13929
550 Ga0495630_0003347 3300046517 Bacteria 11165
551 Ga0495631_0047180 3300046518 Bacteria 1892
552 Ga0495631_0051596 3300046518 Bacteria 1797
553 Ga0495631_0190039 3300046518 Bacteria 879
554 Ga0495632_0000158 3300046519 Bacteria 70148
555 Ga0495632_0003072 3300046519 Bacteria 12130
556 Ga0495632_0021156 3300046519 Bacteria 3508
557 Ga0495632_0034192 3300046519 Bacteria 2603
558 Ga0495637_0000143 3300046520 Bacteria 53795
559 Ga0495637_0001518 3300046520 Bacteria 13576
560 Ga0495637_0001574 3300046520 Bacteria 13274
561 Ga0495637_0005149 3300046520 Bacteria 6700
562 Ga0495637_0018209 3300046520 Bacteria 3260
563 Ga0495637_0127525 3300046520 Bacteria 974
564 Ga0495643_0004652 3300046522 Bacteria 9535
565 Ga0495643_0014862 3300046522 Bacteria 4620
566 Ga0495652_0001618 3300046529 Bacteria 24581
567 Ga0495652_0055099 3300046529 Bacteria 3383
568 Ga0495654_0000664 3300046530 Bacteria 27101
569 Ga0495654_0038900 3300046530 Bacteria 2376
570 Ga0495654_0108210 3300046530 Bacteria 1271
571 Ga0495665_0004349 3300046531 Bacteria 7646
572 Ga0495640_0018265 3300046533 Bacteria 5207
573 Ga0495640_0050427 3300046533 Bacteria 2867
574 Ga0495640_0230048 3300046533 Bacteria 1166
575 Ga0495587_0018037 3300046536 Bacteria 4375
576 Ga0495609_0000033 3300046538 Bacteria 208889
577 Ga0495609_0119109 3300046538 Bacteria 1136
578 Ga0495621_0079636 3300046539 Bacteria 1220
579 Ga0495597_0000023 3300046542 Bacteria 149302
580 Ga0495597_0109430 3300046542 Bacteria 1160
581 Ga0495645_0205443 3300046543 Bacteria 1333
582 Ga0495645_0357339 3300046543 Bacteria 940
583 Ga0495622_0027208 3300046557 Bacteria 2669
584 Ga0495622_0089411 3300046557 Bacteria 1415
585 Ga0495633_0035203 3300046558 Bacteria 2405
586 Ga0495633_0116036 3300046558 Bacteria 1241
587 Ga0495667_0003542 3300046559 Bacteria 10484
588 Ga0495667_0258210 3300046559 Bacteria 1108
589 Ga0495656_0028697 3300046615 Bacteria 2234
590 Ga0495668_0007355 3300046616 Bacteria 7055
591 Ga0495668_0053528 3300046616 Bacteria 2231
592 Ga0495668_0071254 3300046616 Bacteria 1910
593 Ga0495634_0006461 3300046642 Bacteria 8908
594 Ga0495634_0008868 3300046642 Bacteria 7455
595 Ga0495634_0106683 3300046642 Bacteria 1805
596 Ga0495611_0112960 3300046648 Bacteria 1265
597 Ga0495635_0006054 3300046663 Bacteria 8437
598 Ga0495635_0008558 3300046663 Bacteria 7145
599 Ga0495635_0016099 3300046663 Bacteria 5222
600 Ga0495635_0192104 3300046663 Bacteria 1386
601 Ga0495635_0355194 3300046663 Bacteria 977
602 Ga0495659_0139015 3300046664 Bacteria 968
603 Ga0495661_0000039 3300046665 Bacteria 153539
604 Ga0495661_0001793 3300046665 Bacteria 17257
605 Ga0495661_0050072 3300046665 Bacteria 2531
606 Ga0495588_0003260 3300046674 Bacteria 7044
607 Ga0495588_0003708 3300046674 Bacteria 6689
608 Ga0495588_0021738 3300046674 Bacteria 3165
609 Ga0495657_0001338 3300046675 Bacteria 21439
610 Ga0495657_0016592 3300046675 Bacteria 5365
611 Ga0495657_0236014 3300046675 Bacteria 1105
612 Ga0495599_0111128 3300046678 Bacteria 1707
613 Ga0495599_0120783 3300046678 Bacteria 1629
614 Ga0495623_0058278 3300046679 Bacteria 2428
615 Ga0495623_0191924 3300046679 Bacteria 1180
616 Ga0495646_0017985 3300046680 Bacteria 4478
617 Ga0495646_0047000 3300046680 Bacteria 2629
618 Ga0495647_0000258 3300046681 Bacteria 14555
619 Ga0495647_0128098 3300046681 Bacteria 1073
620 Ga0495658_0001900 3300046683 Bacteria 10665
621 Ga0495658_0037206 3300046683 Bacteria 2689
622 Ga0495669_0068292 3300046684 Bacteria 1617
623 Ga0495613_0001802 3300046689 Bacteria 16281
624 Ga0495613_0006831 3300046689 Bacteria 8522
625 Ga0495613_0016830 3300046689 Bacteria 5444
626 Ga0495613_0051657 3300046689 Bacteria 3029
627 Ga0495613_0197246 3300046689 Bacteria 1421
628 Ga0495624_0010406 3300046690 Bacteria 6411
629 Ga0495624_0363465 3300046690 Bacteria 870
630 Ga0495670_0106107 3300046691 Bacteria 1451
631 Ga0495671_0057638 3300046692 Bacteria 1922
632 Ga0495671_0085585 3300046692 Bacteria 1544
633 Ga0495649_0000027 3300046694 Bacteria 164157
634 Ga0495589_0050869 3300046794 Bacteria 2049
635 Ga0495589_0087516 3300046794 Bacteria 1513
636 Ga0495600_0000502 3300046809 Bacteria 20307
637 Ga0495600_0008141 3300046809 Bacteria 6433
638 Ga0495660_0000088 3300046810 Bacteria 98970
639 Ga0495660_0002686 3300046810 Bacteria 11244
640 Ga0495660_0040126 3300046810 Bacteria 2596
641 Ga0495660_0068488 3300046810 Bacteria 1888
642 Ga0495660_0191960 3300046810 Bacteria 981
643 Ga0495581_0000161 3300047315 Bacteria 29999
644 Ga0495581_0148365 3300047315 Bacteria 1369
645 Ga0495581_0185012 3300047315 Bacteria 1218
646 Ga0495581_0307746 3300047315 Bacteria 926
647 Ga0495604_0001218 3300047317 Bacteria 21129
648 Ga0495604_0323100 3300047317 Bacteria 1031
649 Ga0495636_0036299 3300047318 Bacteria 2032
650 Ga0495636_0054455 3300047318 Bacteria 1681
651 Ga0495636_0060436 3300047318 Bacteria 1601
652 Ga0495636_0065561 3300047318 Bacteria 1543
653 Ga0495674_0000805 3300047319 Bacteria 29851
654 Ga0495674_0316402 3300047319 Bacteria 1272
655 Ga0495672_0001914 3300047320 Bacteria 19737
656 Ga0495672_0156755 3300047320 Bacteria 1175
657 Ga0495672_0210877 3300047320 Bacteria 965
658 Ga0495676_0001308 3300047321 Bacteria 21346
659 Ga0495676_0008498 3300047321 Bacteria 9408
660 Ga0495676_0008726 3300047321 Bacteria 9277
661 Ga0495676_0108391 3300047321 Bacteria 2043
662 Ga0495683_0000477 3300047323 Bacteria 31110
663 Ga0495683_0030623 3300047323 Bacteria 2745
664 Ga0495687_016952 3300047443 Bacteria 3648
665 Ga0495675_0276163 3300047444 Bacteria 1003
666 Ga0495677_0072921 3300047445 Bacteria 1281
667 Ga0495685_000326 3300047447 Bacteria 15300
668 Ga0495685_023846 3300047447 Bacteria 2106
669 Ga0495673_0000538 3300047469 Bacteria 39158
670 Ga0495673_0002632 3300047469 Bacteria 12431
671 Ga0495673_0027949 3300047469 Bacteria 2677
672 Ga0495673_0085478 3300047469 Bacteria 1298
673 Ga0495681_0005390 3300047470 Bacteria 8574
674 Ga0495681_0009660 3300047470 Bacteria 5923
675 Ga0495684_0009071 3300047471 Bacteria 7682
676 Ga0495684_0091838 3300047471 Bacteria 2300
677 Ga0495686_0058816 3300047472 Bacteria 2395
678 Ga0495686_0060909 3300047472 Bacteria 2345
679 Ga0495593_0000042 3300047673 Bacteria 51536
680 Ga0495593_0009905 3300047673 Bacteria 5526
681 Ga0495602_0018583 3300048088 Bacteria 6934
682 Ga0495602_0052900 3300048088 Bacteria 3602
683 Ga0495614_0013088 3300048089 Bacteria 3639
684 Ga0495614_0037092 3300048089 Bacteria 2091
685 Ga0495626_0048357 3300048091 Bacteria 1974
686 Ga0496100_0201352 3300048903 Bacteria 1451
687 Ga0496100_0292603 3300048903 Bacteria 1217
688 Ga0496101_0244026 3300048904 Bacteria 1398
689 Ga0496102_0131622 3300048905 Bacteria 2342
690 Ga0496102_0395634 3300048905 Bacteria 1299
691 Ga0496102_0505074 3300048905 Bacteria 1131
692 Ga0496102_0533068 3300048905 Bacteria 1097
693 Ga0496104_0208079 3300048907 Bacteria 1868
694 Ga0496104_0246582 3300048907 Bacteria 1699
695 Ga0496104_0277265 3300048907 Bacteria 1590
696 Ga0496105_0031202 3300048908 Bacteria 4369
697 Ga0496105_0194522 3300048908 Bacteria 1657
698 Ga0496105_0524199 3300048908 Bacteria 928
699 Ga0496106_0114914 3300048909 Bacteria 2099
700 Ga0496108_0119045 3300048911 Bacteria 2264
701 Ga0496108_0184516 3300048911 Bacteria 1807
702 Ga0496108_0195000 3300048911 Bacteria 1756
703 Ga0496109_0000315 3300048912 Bacteria 45480
704 Ga0496109_0050177 3300048912 Bacteria 3801
705 Ga0496109_0129545 3300048912 Bacteria 2354
706 Ga0496110_0025423 3300048913 Bacteria 5060
707 Ga0496110_0183440 3300048913 Bacteria 1900
708 Ga0496110_0343228 3300048913 Bacteria 1360
709 Ga0496111_0203039 3300048914 Bacteria 1473
710 Ga0496112_0120106 3300048915 Bacteria 2598
711 Ga0496114_0080195 3300048917 Bacteria 2756
712 Ga0496114_0084285 3300048917 Bacteria 2691
713 Ga0496114_0177389 3300048917 Bacteria 1859
714 Ga0496115_0075571 3300048918 Bacteria 2737
715 Ga0496115_0234876 3300048918 Bacteria 1511
716 Ga0496118_0007726 3300048921 Bacteria 11300
717 Ga0496119_0023262 3300048922 Bacteria 4404
718 Ga0496120_0024167 3300048923 Bacteria 3792
719 Ga0496121_0000216 3300048924 Bacteria 127028
720 Ga0496121_0000732 3300048924 Bacteria 60492
721 Ga0496121_0086391 3300048924 Bacteria 2465
722 Ga0496121_0178503 3300048924 Bacteria 1535
723 Ga0496122_0014961 3300048925 Bacteria 7460
724 Ga0496122_0114215 3300048925 Bacteria 1762
725 Ga0496123_0002036 3300048926 Bacteria 26111
726 Ga0496124_0017924 3300048927 Bacteria 6654
727 Ga0496124_0019937 3300048927 Bacteria 6218
728 Ga0496124_0054129 3300048927 Bacteria 3398
729 Ga0496124_0067580 3300048927 Bacteria 2974
730 Ga0496124_0220886 3300048927 Bacteria 1425
731 Ga0496125_0000073 3300048928 Bacteria 236928
732 Ga0496125_0056005 3300048928 Bacteria 3206
733 Ga0496125_0069774 3300048928 Bacteria 2755
734 Ga0496125_0196449 3300048928 Bacteria 1326
735 Ga0496126_0000265 3300048929 Bacteria 111370
736 Ga0496126_0031666 3300048929 Bacteria 4991
737 Ga0496126_0031676 3300048929 Bacteria 4991
738 Ga0496126_0044892 3300048929 Bacteria 4066
739 Ga0496126_0073769 3300048929 Bacteria 3032
740 Ga0496126_0147925 3300048929 Bacteria 2015
741 Ga0496126_0523434 3300048929 Bacteria 944
742 Ga0495678_000382 3300049459 Bacteria 44896
743 Ga0501031_0008935 3300049568 Bacteria 6514
744 Ga0501031_0116370 3300049568 Bacteria 1746
745 Ga0501032_0006631 3300049569 Bacteria 8500
746 Ga0501032_0008335 3300049569 Bacteria 7554
747 Ga0501032_0046226 3300049569 Bacteria 2942
748 Ga0501033_0009751 3300049570 Bacteria 7377
749 Ga0501033_0041468 3300049570 Bacteria 3434
750 Ga0501033_0046666 3300049570 Bacteria 3221
751 Ga0501033_0081015 3300049570 Bacteria 2381
752 Ga0501034_0025083 3300049571 Bacteria 6067
753 Ga0501034_0055215 3300049571 Bacteria 3997
754 Ga0501034_0175932 3300049571 Bacteria 2106
755 Ga0501034_0187441 3300049571 Bacteria 2031
756 Ga0501036_0055364 3300049572 Bacteria 3360
757 Ga0501037_0007818 3300049573 Bacteria 7829
758 Ga0501037_0038719 3300049573 Bacteria 3512
759 Ga0501037_0113684 3300049573 Bacteria 1949
760 Ga0501038_0023174 3300049574 Bacteria 5554
761 Ga0501042_0005265 3300049578 Bacteria 8312
762 Ga0501043_0069366 3300049579 Bacteria 2768
763 Ga0501043_0142027 3300049579 Bacteria 1880
764 Ga0501043_0240918 3300049579 Bacteria 1395
765 Ga0501043_0513239 3300049579 Bacteria 894
766 Ga0501046_0193743 3300049580 Bacteria 1515
767 Ga0501047_0004338 3300049581 Bacteria 13356
768 Ga0501047_0006647 3300049581 Bacteria 10870
769 Ga0501047_0067509 3300049581 Bacteria 3446
770 Ga0501047_0077803 3300049581 Bacteria 3190
771 Ga0501047_0084763 3300049581 Bacteria 3045
772 Ga0501047_0339601 3300049581 Bacteria 1340
773 Ga0501048_0062620 3300049582 Bacteria 2632
774 Ga0501070_0019514 3300049586 Bacteria 5686
775 Ga0501071_0744721 3300049587 Bacteria 755
776 Ga0501073_0072545 3300049589 Bacteria 2398
777 Ga0501074_0057245 3300049590 Bacteria 2808
778 Ga0501080_0146418 3300049742 Bacteria 2183
779 Ga0501080_0357704 3300049742 Bacteria 1317
780 Ga0501083_0000204 3300049744 Bacteria 38263
781 Ga0501083_0009486 3300049744 Bacteria 6874
782 Ga0501035_0159771 3300049822 Bacteria 1951
783 Ga0501035_0268908 3300049822 Bacteria 1443
784 Ga0501035_0370189 3300049822 Bacteria 1196
785 Ga0501044_0015713 3300049823 Bacteria 8153
786 Ga0501044_0032452 3300049823 Bacteria 5490
787 Ga0501044_0043867 3300049823 Bacteria 4644
788 Ga0501044_0050091 3300049823 Bacteria 4310
789 Ga0501044_0196854 3300049823 Bacteria 1975
790 nmdc:mga03683_175289_c1 3300050489 Bacteria 976
791 nmdc:mga03683_90668_c1 3300050489 Bacteria 1332
792 nmdc:mga03n38_234582_c1 3300050490 Bacteria 963
793 nmdc:mga03n38_24003_c1 3300050490 Bacteria 2489
794 nmdc:mga03n38_9938_c1 3300050490 Bacteria 3481
795 nmdc:mga00v17_206932_c1 3300050491 Bacteria 1269
796 nmdc:mga0yw44_112_c1 3300050492 Bacteria 28571
797 nmdc:mga0yw44_30078_c1 3300050492 Bacteria 3143
798 nmdc:mga0yw44_40667_c1 3300050492 Bacteria 2764
799 nmdc:mga0yw44_69281_c1 3300050492 Bacteria 2184
800 nmdc:mga06z11_2010_c1 3300050494 Bacteria 7704
801 nmdc:mga04h51_14870_c1 3300050495 Bacteria 2233
802 nmdc:mga07m45_167354_c1 3300050496 Bacteria 1277
803 nmdc:mga07m45_24588_c1 3300050496 Bacteria 3302
804 nmdc:mga05p37_113515_c1 3300050507 Bacteria 3331
805 nmdc:mga05p37_455255_c1 3300050507 Bacteria 1480
806 nmdc:mga05p37_886540_c1 3300050507 Unclassified 964
807 nmdc:mga09592_5411_c1 3300050508 Bacteria 10373
808 nmdc:mga0qj67_22672_c1 3300050509 Plasmid 4824
809 nmdc:mga06r32_228056_c1 3300050510 Unclassified 1851
810 nmdc:mga06r32_8006_c1 3300050510 Bacteria 9503
811 nmdc:mga08y16_14940_c1 3300050511 Bacteria 8166
812 nmdc:mga08y16_319880_c1 3300050511 Bacteria 1597
813 nmdc:mga08y16_339477_c1 3300050511 Bacteria 1544
814 nmdc:mga08y16_48705_c1 3300050511 Bacteria 4434
815 nmdc:mga0n895_41425_c1 3300050512 Bacteria 4478
816 nmdc:mga0rr50_24210_c1 3300050513 Bacteria 4202
817 nmdc:mga0rr50_361965_c1 3300050513 Bacteria 1221
818 nmdc:mga08x19_36329_c1 3300050514 Bacteria 3120
819 nmdc:mga0a205_168538_c1 3300050515 Bacteria 2085
820 nmdc:mga0a205_4768_c1 3300050515 Bacteria 12185
821 nmdc:mga0sz30_69541_c1 3300050516 Bacteria 1514
822 Ga0495601_0001643 3300053077 Bacteria 12333
823 Ga0495601_0067361 3300053077 Bacteria 2281
824 Ga0495612_0154630 3300053078 Bacteria 999
825 Ga0495612_0345945 3300053078 Bacteria 671
826 Ga0495619_0107364 3300053085 Bacteria 1904
827 Ga0500578_0155740 3300053086 Bacteria 1421
828 Ga0500643_061713 3300053087 Bacteria 1051
829 Ga0500583_0133758 3300053092 Bacteria 1230
830 Ga0500566_0037300 3300053094 Bacteria 2817
831 Ga0500640_031019 3300053095 Bacteria 2342
832 Ga0500641_0029541 3300053096 Bacteria 2148
833 Ga0500650_0158098 3300053098 Bacteria 1046
834 Ga0500553_142778 3300053101 Bacteria 940
835 Ga0500554_000216 3300053102 Bacteria 12313
836 Ga0500554_003422 3300053102 Bacteria 3247
837 Ga0500555_071087 3300053103 Bacteria 919
838 Ga0500569_117555 3300053109 Bacteria 883
839 Ga0500572_003499 3300053111 Bacteria 3582
840 Ga0500580_042563 3300053113 Bacteria 1922
841 Ga0500595_003430 3300053119 Bacteria 7403
842 Ga0500595_007000 3300053119 Bacteria 4727
843 Ga0500595_117009 3300053119 Bacteria 755
844 Ga0500614_054757 3300053123 Bacteria 1057
845 Ga0500618_000389 3300053125 Bacteria 30138
846 Ga0500618_009090 3300053125 Bacteria 2731
847 Ga0500628_038040 3300053129 Bacteria 1084
848 Ga0500642_0220743 3300053130 Bacteria 878
849 Ga0500652_010498 3300053131 Bacteria 3175
850 Ga0500658_0023991 3300053134 Bacteria 2334
851 Ga0500568_0074637 3300053139 Bacteria 1294
852 Ga0500573_0135194 3300053140 Bacteria 1362
853 Ga0500577_0081400 3300053142 Bacteria 1292
854 Ga0500589_155951 3300053147 Bacteria 923
855 Ga0500600_0003279 3300053149 Bacteria 9310
856 Ga0500603_000213 3300053150 Bacteria 15359
857 Ga0500616_0170829 3300053153 Bacteria 987
858 Ga0500624_002759 3300053157 Bacteria 2336
859 Ga0500634_0003973 3300053161 Bacteria 6724
860 Ga0500638_000053 3300053162 Bacteria 23611
861 Ga0500636_0000830 3300053177 Bacteria 16649
862 Ga0500637_0000149 3300053178 Bacteria 25364
863 Ga0500656_007270 3300053732 Bacteria 1146
864 Ga0500661_000226 3300055283 Bacteria 10060
865 Ga0501082_0298908 3300060353 Bacteria 1402
866 Ga0466962_0001430 3300061719 Bacteria 11124
867 Ga0466962_0062845 3300061719 Bacteria 1773

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003322 rootL2_10033936 rootL2_100339365 192
2 3300026088 Ga0207641_10585853 Ga0207641_105858532 193
3 3300053092 Ga0500583_0133758 Ga0500583_0133758_584_1219 197
4 3300050513 nmdc:mga0rr50_361965_c1 nmdc:mga0rr50_361965_c1_14_652 198
5 iso_pu_bacteria 640427133 640488705 206
6 3300035086 Ga0373934_0136200 Ga0373934_0136200_10_645 207
7 3300053078 Ga0495612_0345945 Ga0495612_0345945_19_654 207
8 3300045976 Ga0466967_0030588 Ga0466967_0030588_2614_3384 212
9 3300048915 Ga0496112_0120106 Ga0496112_0120106_1906_2586 212
10 3300053109 Ga0500569_117555 Ga0500569_117555_156_863 213
11 3300048928 Ga0496125_0196449 Ga0496125_0196449_163_924 214
12 3300039437 Ga0436365_0175813 Ga0436365_0175813_2024_2740 216
13 3300047318 Ga0495636_0060436 Ga0495636_0060436_11_721 216
14 3300046501 Ga0495607_0282064 Ga0495607_0282064_69_764 217
15 3300048924 Ga0496121_0178503 Ga0496121_0178503_812_1522 217
16 3300049571 Ga0501034_0025083 Ga0501034_0025083_4122_4871 217
17 3300049823 Ga0501044_0196854 Ga0501044_0196854_375_1124 217
18 3300053096 Ga0500641_0029541 Ga0500641_0029541_969_1730 217
19 3300053119 Ga0500595_117009 Ga0500595_117009_19_738 217
20 3300053130 Ga0500642_0220743 Ga0500642_0220743_70_831 217
21 3300005331 Ga0070670_100143050 Ga0070670_1001430502 218
22 3300009551 Ga0105238_10092613 Ga0105238_100926132 218
23 3300017792 Ga0163161_10221675 Ga0163161_102216752 218
24 3300031901 Ga0307406_10113393 Ga0307406_101133932 218
25 3300046460 Ga0495638_0212043 Ga0495638_0212043_196_957 218
26 3300046616 Ga0495668_0053528 Ga0495668_0053528_1092_1853 218
27 3300049587 Ga0501071_0744721 Ga0501071_0744721_25_741 218
28 3300050511 nmdc:mga08y16_319880_c1 nmdc:mga08y16_319880_c1_491_1252 218
29 3300053086 Ga0500578_0155740 Ga0500578_0155740_403_1164 218
30 3300053103 Ga0500555_071087 Ga0500555_071087_71_832 218
31 3300005719 Ga0068861_100296045 Ga0068861_1002960452 219
32 3300006042 Ga0075368_10079589 Ga0075368_100795892 219
33 3300006177 Ga0075362_10019548 Ga0075362_100195482 219
34 3300027866 Ga0209813_10084967 Ga0209813_100849671 219
35 3300031901 Ga0307406_10453554 Ga0307406_104535542 219
36 3300032004 Ga0307414_10053229 Ga0307414_100532293 219
37 3300046542 Ga0495597_0109430 Ga0495597_0109430_416_1144 219
38 3300046690 Ga0495624_0363465 Ga0495624_0363465_36_764 219
39 3300046810 Ga0495660_0068488 Ga0495660_0068488_143_883 219
40 3300047315 Ga0495581_0307746 Ga0495581_0307746_185_901 219
41 3300047472 Ga0495686_0058816 Ga0495686_0058816_1054_1821 219
42 3300050490 nmdc:mga03n38_24003_c1 nmdc:mga03n38_24003_c1_410_1117 219
43 3300050495 nmdc:mga04h51_14870_c1 nmdc:mga04h51_14870_c1_15_722 219
44 3300006038 Ga0075365_10063980 Ga0075365_100639803 220
45 3300006051 Ga0075364_10039785 Ga0075364_100397851 220
46 3300006177 Ga0075362_10066772 Ga0075362_100667723 220
47 3300006186 Ga0075369_10016597 Ga0075369_100165973 220
48 3300009098 Ga0105245_10690417 Ga0105245_106904172 220
49 3300026041 Ga0207639_10138747 Ga0207639_101387473 220
50 3300031730 Ga0307516_10004092 Ga0307516_100040924 220
51 3300046452 Ga0495617_028853 Ga0495617_028853_864_1634 220
52 3300048927 Ga0496124_0220886 Ga0496124_0220886_562_1332 220
53 3300050489 nmdc:mga03683_175289_c1 nmdc:mga03683_175289_c1_38_760 220
54 3300050489 nmdc:mga03683_90668_c1 nmdc:mga03683_90668_c1_515_1285 220
55 3300050491 nmdc:mga00v17_206932_c1 nmdc:mga00v17_206932_c1_54_776 220
56 3300050492 nmdc:mga0yw44_40667_c1 nmdc:mga0yw44_40667_c1_599_1369 220
57 3300050507 nmdc:mga05p37_113515_c1 nmdc:mga05p37_113515_c1_191_961 220
58 3300050515 nmdc:mga0a205_168538_c1 nmdc:mga0a205_168538_c1_1207_1974 220
59 3300050516 nmdc:mga0sz30_69541_c1 nmdc:mga0sz30_69541_c1_161_931 220
60 3300053087 Ga0500643_061713 Ga0500643_061713_271_1041 220
61 3300053142 Ga0500577_0081400 Ga0500577_0081400_23_793 220
62 3300053147 Ga0500589_155951 Ga0500589_155951_135_905 220
63 iso_pu_bacteria 2808606379 2808942693 220
64 3300005327 Ga0070658_10216466 Ga0070658_102164662 221
65 3300005334 Ga0068869_100250063 Ga0068869_1002500632 221
66 3300005353 Ga0070669_100086582 Ga0070669_1000865822 221
67 3300005457 Ga0070662_100372651 Ga0070662_1003726512 221
68 3300005843 Ga0068860_100129848 Ga0068860_1001298482 221
69 3300005844 Ga0068862_100086716 Ga0068862_1000867162 221
70 3300009092 Ga0105250_10175416 Ga0105250_101754161 221
71 3300009174 Ga0105241_10292487 Ga0105241_102924873 221
72 3300025923 Ga0207681_10084424 Ga0207681_100844242 221
73 3300025929 Ga0207664_10938293 Ga0207664_109382931 221
74 3300025933 Ga0207706_10126572 Ga0207706_101265722 221
75 3300025942 Ga0207689_10293197 Ga0207689_102931972 221
76 3300025972 Ga0207668_10164736 Ga0207668_101647362 221
77 3300026089 Ga0207648_10153106 Ga0207648_101531063 221
78 3300026118 Ga0207675_100157313 Ga0207675_1001573132 221
79 3300028380 Ga0268265_10111826 Ga0268265_101118262 221
80 3300044693 Ga0466961_0384301 Ga0466961_0384301_22_729 221
81 3300044735 Ga0466968_0086510 Ga0466968_0086510_22_729 221
82 3300048905 Ga0496102_0505074 Ga0496102_0505074_65_838 221
83 3300048917 Ga0496114_0084285 Ga0496114_0084285_640_1410 221
84 3300048924 Ga0496121_0086391 Ga0496121_0086391_1361_2134 221
85 3300005330 Ga0070690_100361843 Ga0070690_1003618432 222
86 3300005344 Ga0070661_100198869 Ga0070661_1001988691 222
87 3300005347 Ga0070668_100123061 Ga0070668_1001230612 222
88 3300005356 Ga0070674_100164204 Ga0070674_1001642041 222
89 3300005539 Ga0068853_100126244 Ga0068853_1001262442 222
90 3300005548 Ga0070665_100169556 Ga0070665_1001695562 222
91 3300005614 Ga0068856_100746448 Ga0068856_1007464481 222
92 3300005719 Ga0068861_100226373 Ga0068861_1002263732 222
93 3300005841 Ga0068863_100114888 Ga0068863_1001148882 222
94 3300005842 Ga0068858_100288269 Ga0068858_1002882692 222
95 3300006038 Ga0075365_10029915 Ga0075365_100299153 222
96 3300006051 Ga0075364_10078219 Ga0075364_100782192 222
97 3300006358 Ga0068871_100192267 Ga0068871_1001922672 222
98 3300007076 Ga0075435_100247358 Ga0075435_1002473582 222
99 3300009098 Ga0105245_10116651 Ga0105245_101166512 222
100 3300009148 Ga0105243_10108545 Ga0105243_101085452 222
101 3300009174 Ga0105241_10011484 Ga0105241_100114846 222
102 3300009545 Ga0105237_10317216 Ga0105237_103172162 222
103 3300010159 Ga0099796_10016663 Ga0099796_100166632 222
104 3300013308 Ga0157375_10807322 Ga0157375_108073222 222
105 3300014745 Ga0157377_10033791 Ga0157377_100337912 222
106 3300025911 Ga0207654_10014624 Ga0207654_100146242 222
107 3300026095 Ga0207676_10051154 Ga0207676_100511543 222
108 3300026116 Ga0207674_10317332 Ga0207674_103173322 222
109 3300026118 Ga0207675_100038277 Ga0207675_1000382773 222
110 3300028379 Ga0268266_10053275 Ga0268266_100532752 222
111 3300033180 Ga0307510_10203101 Ga0307510_102031011 222
112 3300038741 Ga0400488_14442 Ga0400488_14442_620_1330 222
113 3300041413 Ga0439465_0024664 Ga0439465_0024664_370_1191 222
114 3300046648 Ga0495611_0112960 Ga0495611_0112960_499_1227 222
115 3300048905 Ga0496102_0131622 Ga0496102_0131622_1247_2020 222
116 3300048907 Ga0496104_0246582 Ga0496104_0246582_914_1687 222
117 3300048909 Ga0496106_0114914 Ga0496106_0114914_1041_1814 222
118 3300048911 Ga0496108_0184516 Ga0496108_0184516_215_988 222
119 3300031824 Ga0307413_10029742 Ga0307413_100297423 223
120 3300042157 Ga0439458_0010452 Ga0439458_0010452_875_1651 223
121 3300046674 Ga0495588_0021738 Ga0495588_0021738_1541_2323 223
122 3300046810 Ga0495660_0191960 Ga0495660_0191960_38_820 223
123 3300047321 Ga0495676_0108391 Ga0495676_0108391_419_1201 223
124 3300047445 Ga0495677_0072921 Ga0495677_0072921_173_955 223
125 3300005457 Ga0070662_100138823 Ga0070662_1001388232 224
126 3300005535 Ga0070684_100333307 Ga0070684_1003333072 224
127 3300005983 Ga0081540_1002357 Ga0081540_10023577 224
128 3300009094 Ga0111539_10110632 Ga0111539_101106323 224
129 3300009551 Ga0105238_10192548 Ga0105238_101925482 224
130 3300010375 Ga0105239_10584221 Ga0105239_105842212 224
131 3300013105 Ga0157369_10010836 Ga0157369_100108363 224
132 3300014325 Ga0163163_10862600 Ga0163163_108626001 224
133 3300025904 Ga0207647_10154094 Ga0207647_101540942 224
134 3300025933 Ga0207706_10036247 Ga0207706_100362474 224
135 3300026067 Ga0207678_10036762 Ga0207678_100367624 224
136 3300026075 Ga0207708_10142716 Ga0207708_101427162 224
137 3300026118 Ga0207675_100052667 Ga0207675_1000526674 224
138 3300044683 Ga0466965_0048074 Ga0466965_0048074_1114_1890 224
139 3300046473 Ga0495582_0116310 Ga0495582_0116310_198_980 224
140 3300046518 Ga0495631_0190039 Ga0495631_0190039_45_827 224
141 3300046539 Ga0495621_0079636 Ga0495621_0079636_180_962 224
142 3300046557 Ga0495622_0089411 Ga0495622_0089411_190_972 224
143 3300046558 Ga0495633_0116036 Ga0495633_0116036_241_1023 224
144 3300046615 Ga0495656_0028697 Ga0495656_0028697_554_1336 224
145 3300046664 Ga0495659_0139015 Ga0495659_0139015_150_932 224
146 3300046684 Ga0495669_0068292 Ga0495669_0068292_793_1575 224
147 3300048905 Ga0496102_0395634 Ga0496102_0395634_146_928 224
148 3300048907 Ga0496104_0208079 Ga0496104_0208079_976_1749 224
149 3300048908 Ga0496105_0194522 Ga0496105_0194522_528_1301 224
150 3300048911 Ga0496108_0195000 Ga0496108_0195000_819_1592 224
151 3300048912 Ga0496109_0129545 Ga0496109_0129545_316_1089 224
152 3300048914 Ga0496111_0203039 Ga0496111_0203039_78_851 224
153 3300049569 Ga0501032_0006631 Ga0501032_0006631_4708_5424 224
154 3300049573 Ga0501037_0038719 Ga0501037_0038719_2167_2883 224
155 3300050511 nmdc:mga08y16_48705_c1 nmdc:mga08y16_48705_c1_920_1702 224
156 3300013306 Ga0163162_10815544 Ga0163162_108155442 225
157 3300041404 Ga0439436_0003644 Ga0439436_0003644_2345_3103 225
158 3300041406 Ga0439439_0001165 Ga0439439_0001165_1245_2003 225
159 3300041999 Ga0439433_0002581 Ga0439433_0002581_873_1631 225
160 3300042002 Ga0439442_008450 Ga0439442_008450_1293_2051 225
161 3300042014 Ga0439457_001044 Ga0439457_001044_2217_2975 225
162 3300042015 Ga0439462_0020429 Ga0439462_0020429_53_811 225
163 3300046518 Ga0495631_0051596 Ga0495631_0051596_24_746 225
164 3300048907 Ga0496104_0277265 Ga0496104_0277265_18_746 225
165 3300048925 Ga0496122_0114215 Ga0496122_0114215_602_1342 225
166 3300046520 Ga0495637_0127525 Ga0495637_0127525_231_953 226
167 3300005457 Ga0070662_100269236 Ga0070662_1002692362 227
168 3300005719 Ga0068861_100021041 Ga0068861_1000210412 227
169 3300006058 Ga0075432_10000367 Ga0075432_100003678 227
170 3300006844 Ga0075428_100009319 Ga0075428_1000093197 227
171 3300006846 Ga0075430_100133963 Ga0075430_1001339632 227
172 3300006852 Ga0075433_10004818 Ga0075433_1000481811 227
173 3300006871 Ga0075434_100007683 Ga0075434_1000076834 227
174 3300006880 Ga0075429_100014062 Ga0075429_1000140624 227
175 3300006881 Ga0068865_100148720 Ga0068865_1001487202 227
176 3300006914 Ga0075436_100029385 Ga0075436_1000293853 227
177 3300007076 Ga0075435_100002860 Ga0075435_1000028602 227
178 3300009094 Ga0111539_10010908 Ga0111539_100109086 227
179 3300009098 Ga0105245_10024804 Ga0105245_100248044 227
180 3300009147 Ga0114129_10015367 Ga0114129_100153675 227
181 3300009553 Ga0105249_10188211 Ga0105249_101882113 227
182 3300013306 Ga0163162_10380193 Ga0163162_103801932 227
183 3300013307 Ga0157372_10366859 Ga0157372_103668592 227
184 3300013307 Ga0157372_10541015 Ga0157372_105410152 227
185 3300025901 Ga0207688_10201075 Ga0207688_102010752 227
186 3300025924 Ga0207694_10159429 Ga0207694_101594292 227
187 3300025938 Ga0207704_10108668 Ga0207704_101086682 227
188 3300025961 Ga0207712_10274965 Ga0207712_102749652 227
189 3300026118 Ga0207675_100024426 Ga0207675_1000244264 227
190 3300027907 Ga0207428_10000706 Ga0207428_1000070627 227
191 3300033179 Ga0307507_10024788 Ga0307507_100247886 227
192 3300041405 Ga0439438_000453 Ga0439438_000453_13932_14657 227
193 3300050508 nmdc:mga09592_5411_c1 nmdc:mga09592_5411_c1_3131_3913 227
194 3300050510 nmdc:mga06r32_8006_c1 nmdc:mga06r32_8006_c1_5692_6474 227
195 3300050511 nmdc:mga08y16_14940_c1 nmdc:mga08y16_14940_c1_6748_7530 227
196 3300050512 nmdc:mga0n895_41425_c1 nmdc:mga0n895_41425_c1_860_1642 227
197 3300050513 nmdc:mga0rr50_24210_c1 nmdc:mga0rr50_24210_c1_1413_2195 227
198 3300050514 nmdc:mga08x19_36329_c1 nmdc:mga08x19_36329_c1_1084_1866 227
199 3300050515 nmdc:mga0a205_4768_c1 nmdc:mga0a205_4768_c1_2658_3440 227
200 3300006038 Ga0075365_10319331 Ga0075365_103193312 228
201 3300033180 Ga0307510_10212540 Ga0307510_102125402 228
202 3300044683 Ga0466965_0021514 Ga0466965_0021514_2281_3054 228
203 3300045976 Ga0466967_0485282 Ga0466967_0485282_18_761 228
204 3300005438 Ga0070701_10191800 Ga0070701_101918002 229
205 3300006038 Ga0075365_10057240 Ga0075365_100572402 229
206 3300025901 Ga0207688_10083853 Ga0207688_100838532 229
207 3300031456 Ga0307513_10197139 Ga0307513_101971392 229
208 3300045976 Ga0466967_0097359 Ga0466967_0097359_1408_2193 229
209 3300046515 Ga0495620_0032288 Ga0495620_0032288_1114_1875 229
210 3300046692 Ga0495671_0057638 Ga0495671_0057638_657_1418 229
211 3300048929 Ga0496126_0044892 Ga0496126_0044892_357_1118 229
212 3300050492 nmdc:mga0yw44_30078_c1 nmdc:mga0yw44_30078_c1_2237_2998 229
213 3300050496 nmdc:mga07m45_167354_c1 nmdc:mga07m45_167354_c1_500_1261 229
214 3300003758 Ga0055532_1007244 Ga0055532_10072441 230
215 3300025229 Ga0209147_101597 Ga0209147_1015975 230
216 3300035171 Ga0373946_0041580 Ga0373946_0041580_785_1555 230
217 3300005937 Ga0081455_10049743 Ga0081455_100497434 231
218 3300013297 Ga0157378_10007645 Ga0157378_100076452 231
219 3300028794 Ga0307515_10217621 Ga0307515_102176212 231
220 3300033180 Ga0307510_10015733 Ga0307510_1001573310 231
221 3300035692 Ga0373935_0477141 Ga0373935_0477141_50_811 231
222 3300039450 Ga0436363_1332597 Ga0436363_1332597_129_899 231
223 3300041456 Ga0451795_0444049 Ga0451795_0444049_724_1494 231
224 3300046455 Ga0495603_0001798 Ga0495603_0001798_2744_3514 231
225 3300046477 Ga0495664_0073467 Ga0495664_0073467_67_834 231
226 3300046477 Ga0495664_0380693 Ga0495664_0380693_62_823 231
227 3300046543 Ga0495645_0357339 Ga0495645_0357339_87_848 231
228 3300053102 Ga0500554_000216 Ga0500554_000216_7517_8287 231
229 3300053150 Ga0500603_000213 Ga0500603_000213_5975_6745 231
230 3300053178 Ga0500637_0000149 Ga0500637_0000149_20503_21273 231
231 3300060353 Ga0501082_0298908 Ga0501082_0298908_505_1275 231
232 iso_pu_bacteria 2917736166 2917739595 231
233 iso_pu_bacteria 651053060 651176754 231
234 iso_pu_bacteria 8057160832 8057161307 231
235 3300003751 Ga0055538_1000078 Ga0055538_100007852 232
236 3300005288 Ga0065714_10003968 Ga0065714_100039684 232
237 3300005844 Ga0068862_100259672 Ga0068862_1002596722 232
238 3300007788 Ga0099795_10082104 Ga0099795_100821042 232
239 3300009148 Ga0105243_10374442 Ga0105243_103744422 232
240 3300009551 Ga0105238_10254646 Ga0105238_102546462 232
241 3300026121 Ga0207683_10119042 Ga0207683_101190423 232
242 3300028380 Ga0268265_10283467 Ga0268265_102834672 232
243 3300035113 Ga0373936_0007027 Ga0373936_0007027_260_1030 232
244 3300035116 Ga0373945_0040951 Ga0373945_0040951_649_1419 232
245 3300035692 Ga0373935_0001717 Ga0373935_0001717_10660_11430 232
246 3300035695 Ga0373927_0001560 Ga0373927_0001560_7041_7811 232
247 3300035725 Ga0373947_0154875 Ga0373947_0154875_477_1247 232
248 3300036401 Ga0373937_0017600 Ga0373937_0017600_453_1223 232
249 3300037068 Ga0373925_0002416 Ga0373925_0002416_2142_2912 232
250 3300041494 Ga0451837_0485700 Ga0451837_0485700_1346_2140 232
251 3300046454 Ga0495592_0360769 Ga0495592_0360769_20_790 232
252 3300046455 Ga0495603_0000356 Ga0495603_0000356_22989_23759 232
253 3300046459 Ga0495629_0000087 Ga0495629_0000087_43734_44504 232
254 3300046461 Ga0495641_0003485 Ga0495641_0003485_7757_8527 232
255 3300046463 Ga0495653_0028857 Ga0495653_0028857_118_888 232
256 3300046473 Ga0495582_0004609 Ga0495582_0004609_1919_2689 232
257 3300046475 Ga0495639_0000022 Ga0495639_0000022_22171_22941 232
258 3300046476 Ga0495662_0001463 Ga0495662_0001463_827_1597 232
259 3300046477 Ga0495664_0082815 Ga0495664_0082815_118_888 232
260 3300046499 Ga0495594_0000169 Ga0495594_0000169_15052_15822 232
261 3300046506 Ga0495583_0008269 Ga0495583_0008269_3901_4641 232
262 3300046516 Ga0495628_0019565 Ga0495628_0019565_1999_2769 232
263 3300046517 Ga0495630_0002076 Ga0495630_0002076_9917_10687 232
264 3300046531 Ga0495665_0004349 Ga0495665_0004349_6472_7242 232
265 3300046533 Ga0495640_0018265 Ga0495640_0018265_2155_2925 232
266 3300046559 Ga0495667_0003542 Ga0495667_0003542_2805_3575 232
267 3300046642 Ga0495634_0006461 Ga0495634_0006461_1025_1795 232
268 3300046663 Ga0495635_0008558 Ga0495635_0008558_4092_4862 232
269 3300046674 Ga0495588_0003260 Ga0495588_0003260_2585_3355 232
270 3300046678 Ga0495599_0120783 Ga0495599_0120783_724_1494 232
271 3300046681 Ga0495647_0000258 Ga0495647_0000258_13226_13996 232
272 3300046683 Ga0495658_0001900 Ga0495658_0001900_3854_4624 232
273 3300046689 Ga0495613_0006831 Ga0495613_0006831_3883_4653 232
274 3300046690 Ga0495624_0010406 Ga0495624_0010406_2046_2816 232
275 3300047315 Ga0495581_0000161 Ga0495581_0000161_9909_10679 232
276 3300047319 Ga0495674_0000805 Ga0495674_0000805_25873_26643 232
277 3300047444 Ga0495675_0276163 Ga0495675_0276163_72_839 232
278 3300047471 Ga0495684_0091838 Ga0495684_0091838_1314_2084 232
279 3300047673 Ga0495593_0000042 Ga0495593_0000042_28759_29529 232
280 3300048089 Ga0495614_0013088 Ga0495614_0013088_1143_1913 232
281 3300048924 Ga0496121_0000732 Ga0496121_0000732_15429_16196 232
282 3300053077 Ga0495601_0067361 Ga0495601_0067361_146_916 232
283 3300053119 Ga0500595_007000 Ga0500595_007000_3203_3970 232
284 iso_pu_bacteria 2582581314 2585316902 232
285 iso_pu_bacteria 2643221690 2644502667 232
286 iso_pu_bacteria 2643221694 2644525041 232
287 iso_pu_bacteria 2643221722 2644669128 232
288 iso_pu_bacteria 8003314358 8003319539 232
289 3300003203 JGI25406J46586_10020592 JGI25406J46586_100205923 233
290 3300005329 Ga0070683_100010912 Ga0070683_1000109124 233
291 3300005331 Ga0070670_100304917 Ga0070670_1003049172 233
292 3300005331 Ga0070670_100462072 Ga0070670_1004620721 233
293 3300005337 Ga0070682_100063807 Ga0070682_1000638073 233
294 3300005344 Ga0070661_100105058 Ga0070661_1001050582 233
295 3300005458 Ga0070681_10085409 Ga0070681_100854094 233
296 3300005530 Ga0070679_100018059 Ga0070679_1000180593 233
297 3300005535 Ga0070684_100015276 Ga0070684_1000152765 233
298 3300005563 Ga0068855_100361771 Ga0068855_1003617712 233
299 3300005578 Ga0068854_100733481 Ga0068854_1007334811 233
300 3300005985 Ga0081539_10000366 Ga0081539_1000036658 233
301 3300013105 Ga0157369_10045795 Ga0157369_100457954 233
302 3300025297 Ga0209758_1028198 Ga0209758_10281982 233
303 3300025906 Ga0207699_10145127 Ga0207699_101451272 233
304 3300025912 Ga0207707_10001525 Ga0207707_1000152520 233
305 3300025913 Ga0207695_10185086 Ga0207695_101850862 233
306 3300025914 Ga0207671_10196832 Ga0207671_101968322 233
307 3300025917 Ga0207660_10009614 Ga0207660_100096144 233
308 3300025920 Ga0207649_10096185 Ga0207649_100961851 233
309 3300025921 Ga0207652_10042144 Ga0207652_100421442 233
310 3300025921 Ga0207652_10051372 Ga0207652_100513722 233
311 3300025942 Ga0207689_10109560 Ga0207689_101095602 233
312 3300025944 Ga0207661_10147736 Ga0207661_101477362 233
313 3300025944 Ga0207661_10852886 Ga0207661_108528861 233
314 3300025949 Ga0207667_10335745 Ga0207667_103357452 233
315 3300026041 Ga0207639_10198861 Ga0207639_101988612 233
316 3300026067 Ga0207678_10030951 Ga0207678_100309516 233
317 3300026116 Ga0207674_10020811 Ga0207674_100208117 233
318 3300031903 Ga0307407_10547107 Ga0307407_105471071 233
319 3300035111 Ga0373923_0194604 Ga0373923_0194604_11_781 233
320 3300035113 Ga0373936_0007241 Ga0373936_0007241_2082_2852 233
321 3300035171 Ga0373946_0291885 Ga0373946_0291885_11_781 233
322 3300035695 Ga0373927_0041650 Ga0373927_0041650_1918_2688 233
323 3300035725 Ga0373947_0052206 Ga0373947_0052206_571_1341 233
324 3300036401 Ga0373937_0164480 Ga0373937_0164480_446_1216 233
325 3300037068 Ga0373925_0171043 Ga0373925_0171043_320_1090 233
326 3300041405 Ga0439438_000829 Ga0439438_000829_2035_2781 233
327 3300041407 Ga0439447_001186 Ga0439447_001186_1752_2498 233
328 3300041411 Ga0439466_0011204 Ga0439466_0011204_1926_2672 233
329 3300042006 Ga0439432_002880 Ga0439432_002880_2012_2758 233
330 3300042010 Ga0439452_001698 Ga0439452_001698_6091_6837 233
331 3300042125 Ga0450923_001643 Ga0450923_001643_720_1466 233
332 3300042156 Ga0439446_0010479 Ga0439446_0010479_1666_2412 233
333 3300042435 Ga0439434_0031543 Ga0439434_0031543_828_1574 233
334 3300046459 Ga0495629_0191217 Ga0495629_0191217_548_1318 233
335 3300046472 Ga0495580_0187728 Ga0495580_0187728_474_1244 233
336 3300046477 Ga0495664_0102750 Ga0495664_0102750_797_1567 233
337 3300046533 Ga0495640_0230048 Ga0495640_0230048_327_1097 233
338 3300046543 Ga0495645_0205443 Ga0495645_0205443_89_859 233
339 3300046559 Ga0495667_0258210 Ga0495667_0258210_70_840 233
340 3300046642 Ga0495634_0106683 Ga0495634_0106683_62_832 233
341 3300046663 Ga0495635_0355194 Ga0495635_0355194_11_781 233
342 3300046675 Ga0495657_0236014 Ga0495657_0236014_272_1039 233
343 3300046681 Ga0495647_0128098 Ga0495647_0128098_238_1008 233
344 3300046683 Ga0495658_0037206 Ga0495658_0037206_509_1279 233
345 3300046689 Ga0495613_0197246 Ga0495613_0197246_156_926 233
346 3300047315 Ga0495581_0148365 Ga0495581_0148365_335_1105 233
347 3300047317 Ga0495604_0323100 Ga0495604_0323100_11_781 233
348 3300047319 Ga0495674_0316402 Ga0495674_0316402_491_1261 233
349 3300047471 Ga0495684_0009071 Ga0495684_0009071_6521_7291 233
350 3300048912 Ga0496109_0000315 Ga0496109_0000315_1074_1847 233
351 3300048929 Ga0496126_0073769 Ga0496126_0073769_915_1682 233
352 3300050490 nmdc:mga03n38_9938_c1 nmdc:mga03n38_9938_c1_2699_3466 233
353 3300053098 Ga0500650_0158098 Ga0500650_0158098_38_808 233
354 3300003215 JGI25153J46596_10005638 JGI25153J46596_100056388 234
355 3300005330 Ga0070690_100178577 Ga0070690_1001785772 234
356 3300005336 Ga0070680_100036774 Ga0070680_1000367745 234
357 3300005356 Ga0070674_100013133 Ga0070674_1000131332 234
358 3300005366 Ga0070659_100087500 Ga0070659_1000875003 234
359 3300005435 Ga0070714_100060184 Ga0070714_1000601844 234
360 3300005438 Ga0070701_10063609 Ga0070701_100636092 234
361 3300005455 Ga0070663_100100056 Ga0070663_1001000562 234
362 3300005456 Ga0070678_100089913 Ga0070678_1000899132 234
363 3300005458 Ga0070681_10206222 Ga0070681_102062223 234
364 3300005459 Ga0068867_100013927 Ga0068867_1000139272 234
365 3300005539 Ga0068853_100275185 Ga0068853_1002751852 234
366 3300005548 Ga0070665_100394545 Ga0070665_1003945452 234
367 3300005563 Ga0068855_100079887 Ga0068855_1000798875 234
368 3300005614 Ga0068856_100001981 Ga0068856_1000019815 234
369 3300005842 Ga0068858_100237967 Ga0068858_1002379672 234
370 3300005937 Ga0081455_10024373 Ga0081455_100243735 234
371 3300006028 Ga0070717_10361128 Ga0070717_103611281 234
372 3300006178 Ga0075367_10140894 Ga0075367_101408942 234
373 3300006881 Ga0068865_100101680 Ga0068865_1001016802 234
374 3300009148 Ga0105243_10077812 Ga0105243_100778122 234
375 3300009551 Ga0105238_10595616 Ga0105238_105956162 234
376 3300009553 Ga0105249_10617704 Ga0105249_106177041 234
377 3300013104 Ga0157370_10038272 Ga0157370_100382725 234
378 3300013297 Ga0157378_10172604 Ga0157378_101726042 234
379 3300013307 Ga0157372_10348336 Ga0157372_103483362 234
380 3300017792 Ga0163161_10245798 Ga0163161_102457982 234
381 3300025297 Ga0209758_1002140 Ga0209758_100214022 234
382 3300025909 Ga0207705_10133712 Ga0207705_101337122 234
383 3300025912 Ga0207707_10309072 Ga0207707_103090721 234
384 3300025915 Ga0207693_10156026 Ga0207693_101560262 234
385 3300025929 Ga0207664_10013023 Ga0207664_100130235 234
386 3300025934 Ga0207686_10280776 Ga0207686_102807762 234
387 3300025935 Ga0207709_10113826 Ga0207709_101138262 234
388 3300025937 Ga0207669_10034512 Ga0207669_100345122 234
389 3300025940 Ga0207691_10025136 Ga0207691_100251364 234
390 3300025949 Ga0207667_10130634 Ga0207667_101306341 234
391 3300025949 Ga0207667_10291644 Ga0207667_102916442 234
392 3300025972 Ga0207668_10073433 Ga0207668_100734332 234
393 3300026067 Ga0207678_10099875 Ga0207678_100998752 234
394 3300026078 Ga0207702_10000640 Ga0207702_1000064020 234
395 3300026089 Ga0207648_10050344 Ga0207648_100503442 234
396 3300026121 Ga0207683_10146839 Ga0207683_101468392 234
397 3300031616 Ga0307508_10299813 Ga0307508_102998131 234
398 3300031711 Ga0265314_10021126 Ga0265314_100211264 234
399 3300037418 Ga0395900_0081695 Ga0395900_0081695_2215_2985 234
400 3300037466 Ga0395898_0131206 Ga0395898_0131206_315_1085 234
401 3300037853 Ga0436364_0136448 Ga0436364_0136448_943_1713 234
402 3300039437 Ga0436365_1444934 Ga0436365_1444934_294_1064 234
403 3300046472 Ga0495580_0463899 Ga0495580_0463899_61_828 234
404 3300046794 Ga0495589_0087516 Ga0495589_0087516_578_1360 234
405 3300048904 Ga0496101_0244026 Ga0496101_0244026_59_841 234
406 3300048928 Ga0496125_0069774 Ga0496125_0069774_1980_2726 234
407 3300053102 Ga0500554_003422 Ga0500554_003422_1841_2611 234
408 3300053119 Ga0500595_003430 Ga0500595_003430_5069_5839 234
409 3300053162 Ga0500638_000053 Ga0500638_000053_12910_13680 234
410 3300055283 Ga0500661_000226 Ga0500661_000226_1482_2252 234
411 iso_pu_bacteria 2582581313 2585303428 234
412 iso_pu_bacteria 2784746763 2785345832 234
413 iso_pu_bacteria 2784746768 2785367055 234
414 iso_pu_bacteria 2786546132 2786668094 234
415 iso_pu_bacteria 2811994879 2812360407 234
416 iso_pu_bacteria 2811994917 2812482507 234
417 iso_pu_bacteria 2852635781 2852637622 234
418 iso_pu_bacteria 2862281513 2862289758 234
419 iso_pu_bacteria 2862382967 2862391686 234
420 iso_pu_bacteria 2863404153 2863407065 234
421 iso_pu_bacteria 2867428634 2867428656 234
422 iso_pu_bacteria 2912723979 2912726284 234
423 iso_pu_bacteria 2919506607 2919506850 234
424 iso_pu_bacteria 2946064051 2946065482 234
425 iso_pu_bacteria 2947224130 2947231928 234
426 iso_pu_bacteria 2954380949 2954388742 234
427 iso_pu_bacteria 2954673503 2954674382 234
428 iso_pu_bacteria 2954682443 2954689749 234
429 iso_pu_bacteria 2954691527 2954699532 234
430 iso_pu_bacteria 2954701450 2954702686 234
431 iso_pu_bacteria 8008558824 8008561216 234
432 iso_pu_bacteria 8048406513 8048408074 234
433 3300003316 rootH1_10018128 rootH1_1001812812 235
434 3300005436 Ga0070713_100007399 Ga0070713_1000073994 235
435 3300005455 Ga0070663_100001689 Ga0070663_10000168916 235
436 3300005546 Ga0070696_100274669 Ga0070696_1002746691 235
437 3300005843 Ga0068860_100365588 Ga0068860_1003655882 235
438 3300005983 Ga0081540_1001654 Ga0081540_100165414 235
439 3300006028 Ga0070717_10000850 Ga0070717_1000085014 235
440 3300006353 Ga0075370_10038370 Ga0075370_100383703 235
441 3300025711 Ga0207696_1000219 Ga0207696_100021951 235
442 3300025735 Ga0207713_1000036 Ga0207713_1000036197 235
443 3300025928 Ga0207700_10004989 Ga0207700_100049895 235
444 3300026023 Ga0207677_10110172 Ga0207677_101101722 235
445 3300026067 Ga0207678_10000232 Ga0207678_1000023211 235
446 3300028381 Ga0268264_10340706 Ga0268264_103407062 235
447 3300031824 Ga0307413_10067686 Ga0307413_100676862 235
448 3300032004 Ga0307414_10340183 Ga0307414_103401831 235
449 3300035695 Ga0373927_0148845 Ga0373927_0148845_207_977 235
450 3300039438 Ga0436360_1343606 Ga0436360_1343606_67_837 235
451 3300044694 Ga0466963_0045770 Ga0466963_0045770_157_927 235
452 3300045976 Ga0466967_0076913 Ga0466967_0076913_80_850 235
453 3300046460 Ga0495638_0019670 Ga0495638_0019670_1372_2154 235
454 3300046463 Ga0495653_0000291 Ga0495653_0000291_14182_14931 235
455 3300046492 Ga0495585_0001175 Ga0495585_0001175_9569_10318 235
456 3300046501 Ga0495607_0001929 Ga0495607_0001929_15071_15820 235
457 3300046507 Ga0495606_0000155 Ga0495606_0000155_46761_47510 235
458 3300046519 Ga0495632_0003072 Ga0495632_0003072_6176_6925 235
459 3300046520 Ga0495637_0001518 Ga0495637_0001518_6126_6875 235
460 3300046530 Ga0495654_0108210 Ga0495654_0108210_392_1141 235
461 3300046616 Ga0495668_0071254 Ga0495668_0071254_73_855 235
462 3300046665 Ga0495661_0000039 Ga0495661_0000039_70858_71607 235
463 3300046665 Ga0495661_0050072 Ga0495661_0050072_1311_2060 235
464 3300047321 Ga0495676_0008498 Ga0495676_0008498_1986_2735 235
465 3300047323 Ga0495683_0000477 Ga0495683_0000477_7883_8632 235
466 3300047469 Ga0495673_0085478 Ga0495673_0085478_189_971 235
467 3300048903 Ga0496100_0292603 Ga0496100_0292603_317_1081 235
468 3300048905 Ga0496102_0533068 Ga0496102_0533068_238_1002 235
469 3300048908 Ga0496105_0031202 Ga0496105_0031202_2810_3574 235
470 3300048913 Ga0496110_0183440 Ga0496110_0183440_355_1137 235
471 3300048917 Ga0496114_0177389 Ga0496114_0177389_288_1052 235
472 3300049580 Ga0501046_0193743 Ga0501046_0193743_488_1258 235
473 3300049581 Ga0501047_0006647 Ga0501047_0006647_8811_9581 235
474 3300049586 Ga0501070_0019514 Ga0501070_0019514_1447_2217 235
475 3300049589 Ga0501073_0072545 Ga0501073_0072545_505_1275 235
476 3300049590 Ga0501074_0057245 Ga0501074_0057245_1585_2355 235
477 3300049742 Ga0501080_0357704 Ga0501080_0357704_80_850 235
478 3300049823 Ga0501044_0043867 Ga0501044_0043867_3235_4005 235
479 3300050492 nmdc:mga0yw44_112_c1 nmdc:mga0yw44_112_c1_1413_2204 235
480 3300050496 nmdc:mga07m45_24588_c1 nmdc:mga07m45_24588_c1_1752_2534 235
481 3300053125 Ga0500618_009090 Ga0500618_009090_1792_2541 235
482 3300053139 Ga0500568_0074637 Ga0500568_0074637_14_796 235
483 iso_pu_bacteria 2867369537 2867370130 235
484 3300005355 Ga0070671_100064633 Ga0070671_1000646332 236
485 3300005843 Ga0068860_100325553 Ga0068860_1003255532 236
486 3300005937 Ga0081455_10067919 Ga0081455_100679192 236
487 3300005983 Ga0081540_1002242 Ga0081540_100224216 236
488 3300005983 Ga0081540_1004805 Ga0081540_10048057 236
489 3300010375 Ga0105239_10152156 Ga0105239_101521562 236
490 3300010375 Ga0105239_10193695 Ga0105239_101936953 236
491 3300013297 Ga0157378_10265492 Ga0157378_102654923 236
492 3300013307 Ga0157372_10000598 Ga0157372_1000059830 236
493 3300020082 Ga0206353_10369860 Ga0206353_103698601 236
494 3300025302 Ga0207426_1023168 Ga0207426_10231683 236
495 3300025735 Ga0207713_1007766 Ga0207713_10077666 236
496 3300025914 Ga0207671_10037138 Ga0207671_100371384 236
497 3300025924 Ga0207694_10273153 Ga0207694_102731532 236
498 3300025972 Ga0207668_10020551 Ga0207668_100205513 236
499 3300026041 Ga0207639_10037054 Ga0207639_100370543 236
500 3300027378 Ga0209981_1007580 Ga0209981_10075801 236
501 3300027552 Ga0209982_1001892 Ga0209982_10018923 236
502 3300027665 Ga0209983_1005466 Ga0209983_10054661 236
503 3300027682 Ga0209971_1000529 Ga0209971_10005299 236
504 3300028381 Ga0268264_10252543 Ga0268264_102525432 236
505 3300028794 Ga0307515_10078627 Ga0307515_100786273 236
506 3300030521 Ga0307511_10215903 Ga0307511_102159032 236
507 3300031238 Ga0265332_10074137 Ga0265332_100741372 236
508 3300031507 Ga0307509_10035904 Ga0307509_100359045 236
509 3300031616 Ga0307508_10261036 Ga0307508_102610362 236
510 3300031712 Ga0265342_10116338 Ga0265342_101163383 236
511 3300032004 Ga0307414_10000905 Ga0307414_100009055 236
512 3300044656 Ga0466969_0012942 Ga0466969_0012942_3204_3956 236
513 3300044658 Ga0466972_0001762 Ga0466972_0001762_7728_8480 236
514 3300044658 Ga0466972_0015460 Ga0466972_0015460_886_1638 236
515 3300044684 Ga0466966_0041891 Ga0466966_0041891_116_868 236
516 3300044693 Ga0466961_0005326 Ga0466961_0005326_22_774 236
517 3300044694 Ga0466963_0000336 Ga0466963_0000336_6125_6877 236
518 3300044735 Ga0466968_0006777 Ga0466968_0006777_32_784 236
519 3300044765 Ga0466970_0270686 Ga0466970_0270686_71_823 236
520 3300044842 Ga0466957_0052166 Ga0466957_0052166_1595_2347 236
521 3300045049 Ga0466959_0234125 Ga0466959_0234125_425_1177 236
522 3300048913 Ga0496110_0025423 Ga0496110_0025423_2486_3265 236
523 3300048918 Ga0496115_0075571 Ga0496115_0075571_559_1329 236
524 3300048927 Ga0496124_0017924 Ga0496124_0017924_2540_3319 236
525 3300048927 Ga0496124_0067580 Ga0496124_0067580_1995_2777 236
526 3300048928 Ga0496125_0056005 Ga0496125_0056005_2016_2795 236
527 3300048929 Ga0496126_0031666 Ga0496126_0031666_3334_4113 236
528 3300049568 Ga0501031_0008935 Ga0501031_0008935_5472_6224 236
529 3300049569 Ga0501032_0046226 Ga0501032_0046226_2002_2754 236
530 3300049570 Ga0501033_0009751 Ga0501033_0009751_1409_2161 236
531 3300049571 Ga0501034_0175932 Ga0501034_0175932_1081_1845 236
532 3300049571 Ga0501034_0187441 Ga0501034_0187441_613_1365 236
533 3300049572 Ga0501036_0055364 Ga0501036_0055364_1551_2303 236
534 3300049573 Ga0501037_0007818 Ga0501037_0007818_5368_6120 236
535 3300049574 Ga0501038_0023174 Ga0501038_0023174_3972_4724 236
536 3300049579 Ga0501043_0069366 Ga0501043_0069366_1478_2230 236
537 3300049581 Ga0501047_0077803 Ga0501047_0077803_1968_2732 236
538 3300049582 Ga0501048_0062620 Ga0501048_0062620_1527_2279 236
539 3300049823 Ga0501044_0032452 Ga0501044_0032452_332_1096 236
540 3300049823 Ga0501044_0050091 Ga0501044_0050091_3020_3772 236
541 3300061719 Ga0466962_0062845 Ga0466962_0062845_479_1231 236
542 iso_pu_bacteria 2599185155 2599327358 236
543 iso_pu_bacteria 2643221670 2644388987 236
544 iso_pu_bacteria 2984568884 2984570298 236
545 3300005435 Ga0070714_100059899 Ga0070714_1000598992 237
546 3300005436 Ga0070713_100335831 Ga0070713_1003358312 237
547 3300005548 Ga0070665_100041123 Ga0070665_1000411233 237
548 3300005983 Ga0081540_1035212 Ga0081540_10352123 237
549 3300025928 Ga0207700_10055356 Ga0207700_100553562 237
550 3300025929 Ga0207664_10492209 Ga0207664_104922092 237
551 3300030736 Ga0316180_1055335 Ga0316180_10553352 237
552 3300036712 Ga0316584_0317867 Ga0316584_0317867_285_1052 237
553 3300045976 Ga0466967_0146604 Ga0466967_0146604_820_1638 237
554 3300045976 Ga0466967_0336521 Ga0466967_0336521_119_928 237
555 3300046459 Ga0495629_0122012 Ga0495629_0122012_282_1037 237
556 3300046462 Ga0495651_0005413 Ga0495651_0005413_8047_8802 237
557 3300046476 Ga0495662_0002185 Ga0495662_0002185_7522_8277 237
558 3300046477 Ga0495664_0003293 Ga0495664_0003293_4314_5069 237
559 3300046514 Ga0495618_0154568 Ga0495618_0154568_170_925 237
560 3300046517 Ga0495630_0003347 Ga0495630_0003347_3078_3833 237
561 3300046529 Ga0495652_0055099 Ga0495652_0055099_1552_2307 237
562 3300046533 Ga0495640_0050427 Ga0495640_0050427_145_900 237
563 3300046536 Ga0495587_0018037 Ga0495587_0018037_1668_2423 237
564 3300046557 Ga0495622_0027208 Ga0495622_0027208_33_788 237
565 3300046642 Ga0495634_0008868 Ga0495634_0008868_4732_5487 237
566 3300046663 Ga0495635_0016099 Ga0495635_0016099_2518_3273 237
567 3300046675 Ga0495657_0001338 Ga0495657_0001338_1733_2488 237
568 3300046678 Ga0495599_0111128 Ga0495599_0111128_826_1581 237
569 3300046679 Ga0495623_0191924 Ga0495623_0191924_182_937 237
570 3300046680 Ga0495646_0017985 Ga0495646_0017985_1929_2684 237
571 3300046689 Ga0495613_0001802 Ga0495613_0001802_9309_10064 237
572 3300046809 Ga0495600_0000502 Ga0495600_0000502_14625_15380 237
573 3300047315 Ga0495581_0185012 Ga0495581_0185012_416_1171 237
574 3300047317 Ga0495604_0001218 Ga0495604_0001218_6803_7558 237
575 3300047321 Ga0495676_0008726 Ga0495676_0008726_3866_4621 237
576 3300047673 Ga0495593_0009905 Ga0495593_0009905_2802_3557 237
577 3300048088 Ga0495602_0018583 Ga0495602_0018583_3896_4651 237
578 3300048089 Ga0495614_0037092 Ga0495614_0037092_430_1185 237
579 3300048903 Ga0496100_0201352 Ga0496100_0201352_69_839 237
580 3300053095 Ga0500640_031019 Ga0500640_031019_281_1036 237
581 3300053101 Ga0500553_142778 Ga0500553_142778_114_869 237
582 3300053111 Ga0500572_003499 Ga0500572_003499_902_1657 237
583 3300053140 Ga0500573_0135194 Ga0500573_0135194_88_843 237
584 iso_pu_bacteria 2511231221 2512035316 237
585 iso_pu_bacteria 2512047086 2512529451 237
586 iso_pu_bacteria 2513237101 2513692126 237
587 iso_pu_bacteria 2643221634 2644196192 237
588 iso_pu_bacteria 2643221714 2644632471 237
589 iso_pu_bacteria 2808606359 2808847559 237
590 iso_pu_bacteria 2818991461 2819683200 237
591 iso_pu_bacteria 2899275550 2899279533 237
592 iso_pu_bacteria 2904504865 2904509152 237
593 iso_pu_bacteria 2946072368 2946073839 237
594 3300003578 Ga0006562J51391_1084840 Ga0006562J51391_10848403 238
595 3300005578 Ga0068854_100170182 Ga0068854_1001701822 238
596 3300006175 Ga0070712_100008065 Ga0070712_1000080652 238
597 3300006178 Ga0075367_10003283 Ga0075367_100032833 238
598 3300006948 Ga0099826_10143414 Ga0099826_101434142 238
599 3300011119 Ga0105246_10039933 Ga0105246_100399332 238
600 3300013105 Ga0157369_10002377 Ga0157369_1000237724 238
601 3300013105 Ga0157369_10119955 Ga0157369_101199553 238
602 3300014497 Ga0182008_10000543 Ga0182008_100005439 238
603 3300015262 Ga0182007_10023586 Ga0182007_100235863 238
604 3300025904 Ga0207647_10018809 Ga0207647_100188094 238
605 3300025906 Ga0207699_10049700 Ga0207699_100497002 238
606 3300025915 Ga0207693_10012101 Ga0207693_100121012 238
607 3300025928 Ga0207700_10348696 Ga0207700_103486962 238
608 3300028786 Ga0307517_10005855 Ga0307517_100058559 238
609 3300028794 Ga0307515_10068642 Ga0307515_100686424 238
610 3300030522 Ga0307512_10054085 Ga0307512_100540853 238
611 3300031456 Ga0307513_10425208 Ga0307513_104252082 238
612 3300031616 Ga0307508_10008307 Ga0307508_100083073 238
613 3300031649 Ga0307514_10006568 Ga0307514_100065686 238
614 3300031649 Ga0307514_10033166 Ga0307514_100331661 238
615 3300031730 Ga0307516_10002742 Ga0307516_1000274210 238
616 3300031838 Ga0307518_10025604 Ga0307518_100256045 238
617 3300032002 Ga0307416_100428202 Ga0307416_1004282022 238
618 3300033180 Ga0307510_10010654 Ga0307510_100106544 238
619 3300034816 Ga0373930_0003508 Ga0373930_0003508_430_1230 238
620 3300034817 Ga0373948_0017766 Ga0373948_0017766_334_1134 238
621 3300035084 Ga0373928_0000800 Ga0373928_0000800_4320_5120 238
622 3300035084 Ga0373928_0025680 Ga0373928_0025680_344_1144 238
623 3300035112 Ga0373932_0021501 Ga0373932_0021501_121_921 238
624 3300035691 Ga0373931_0000001 Ga0373931_0000001_551106_551906 238
625 3300035691 Ga0373931_0000038 Ga0373931_0000038_53536_54336 238
626 3300037466 Ga0395898_0008785 Ga0395898_0008785_3667_4425 238
627 3300041492 Ga0451835_0889745 Ga0451835_0889745_123_881 238
628 3300041512 Ga0451853_1195562 Ga0451853_1195562_1552_2319 238
629 3300042005 Ga0439448_0079991 Ga0439448_0079991_177_935 238
630 3300042007 Ga0439449_0001695 Ga0439449_0001695_6218_6976 238
631 3300042157 Ga0439458_0009563 Ga0439458_0009563_816_1574 238
632 3300044656 Ga0466969_0039102 Ga0466969_0039102_194_952 238
633 3300044658 Ga0466972_0003178 Ga0466972_0003178_831_1589 238
634 3300044683 Ga0466965_0000492 Ga0466965_0000492_3196_3954 238
635 3300044683 Ga0466965_0083212 Ga0466965_0083212_406_1164 238
636 3300044684 Ga0466966_0018718 Ga0466966_0018718_525_1283 238
637 3300044693 Ga0466961_0011622 Ga0466961_0011622_2179_2937 238
638 3300044694 Ga0466963_0000319 Ga0466963_0000319_10854_11612 238
639 3300044694 Ga0466963_0040999 Ga0466963_0040999_1967_2725 238
640 3300044706 Ga0466964_0000999 Ga0466964_0000999_7505_8263 238
641 3300044719 Ga0466971_0000247 Ga0466971_0000247_16530_17288 238
642 3300044765 Ga0466970_0000625 Ga0466970_0000625_11320_12078 238
643 3300044842 Ga0466957_0000837 Ga0466957_0000837_1022_1780 238
644 3300045049 Ga0466959_0104912 Ga0466959_0104912_925_1683 238
645 3300045049 Ga0466959_0105730 Ga0466959_0105730_397_1155 238
646 3300045836 Ga0466958_0001544 Ga0466958_0001544_3261_4019 238
647 3300045976 Ga0466967_0001364 Ga0466967_0001364_8656_9414 238
648 3300045976 Ga0466967_0099857 Ga0466967_0099857_1270_2028 238
649 3300046455 Ga0495603_0007578 Ga0495603_0007578_1138_1896 238
650 3300046459 Ga0495629_0047708 Ga0495629_0047708_179_937 238
651 3300046460 Ga0495638_0215507 Ga0495638_0215507_256_1047 238
652 3300046476 Ga0495662_0007605 Ga0495662_0007605_1010_1768 238
653 3300046476 Ga0495662_0014932 Ga0495662_0014932_381_1139 238
654 3300046492 Ga0495585_0017276 Ga0495585_0017276_260_1051 238
655 3300046499 Ga0495594_0018658 Ga0495594_0018658_644_1402 238
656 3300046501 Ga0495607_0072851 Ga0495607_0072851_85_876 238
657 3300046515 Ga0495620_0007303 Ga0495620_0007303_3950_4708 238
658 3300046522 Ga0495643_0004652 Ga0495643_0004652_4088_4846 238
659 3300046522 Ga0495643_0014862 Ga0495643_0014862_203_973 238
660 3300046538 Ga0495609_0119109 Ga0495609_0119109_115_906 238
661 3300046558 Ga0495633_0035203 Ga0495633_0035203_1119_1889 238
662 3300046663 Ga0495635_0192104 Ga0495635_0192104_20_778 238
663 3300046674 Ga0495588_0003708 Ga0495588_0003708_5196_5954 238
664 3300046675 Ga0495657_0016592 Ga0495657_0016592_2498_3256 238
665 3300046689 Ga0495613_0016830 Ga0495613_0016830_391_1149 238
666 3300046689 Ga0495613_0051657 Ga0495613_0051657_2023_2781 238
667 3300046794 Ga0495589_0050869 Ga0495589_0050869_1246_2004 238
668 3300046810 Ga0495660_0040126 Ga0495660_0040126_1807_2577 238
669 3300047318 Ga0495636_0036299 Ga0495636_0036299_701_1459 238
670 3300047318 Ga0495636_0054455 Ga0495636_0054455_886_1644 238
671 3300047318 Ga0495636_0065561 Ga0495636_0065561_682_1473 238
672 3300047320 Ga0495672_0156755 Ga0495672_0156755_169_927 238
673 3300047323 Ga0495683_0030623 Ga0495683_0030623_1623_2414 238
674 3300047443 Ga0495687_016952 Ga0495687_016952_489_1247 238
675 3300047447 Ga0495685_000326 Ga0495685_000326_7436_8206 238
676 3300047447 Ga0495685_023846 Ga0495685_023846_153_911 238
677 3300047470 Ga0495681_0005390 Ga0495681_0005390_4887_5657 238
678 3300047472 Ga0495686_0060909 Ga0495686_0060909_480_1238 238
679 3300048908 Ga0496105_0524199 Ga0496105_0524199_146_904 238
680 3300048911 Ga0496108_0119045 Ga0496108_0119045_885_1643 238
681 3300048912 Ga0496109_0050177 Ga0496109_0050177_2927_3685 238
682 3300048913 Ga0496110_0343228 Ga0496110_0343228_425_1183 238
683 3300048922 Ga0496119_0023262 Ga0496119_0023262_284_1039 238
684 3300048923 Ga0496120_0024167 Ga0496120_0024167_2750_3505 238
685 3300048925 Ga0496122_0014961 Ga0496122_0014961_2765_3520 238
686 3300048926 Ga0496123_0002036 Ga0496123_0002036_23395_24150 238
687 3300048928 Ga0496125_0000073 Ga0496125_0000073_23645_24400 238
688 3300048929 Ga0496126_0031676 Ga0496126_0031676_2248_3018 238
689 3300048929 Ga0496126_0147925 Ga0496126_0147925_191_946 238
690 3300048929 Ga0496126_0523434 Ga0496126_0523434_143_898 238
691 3300049570 Ga0501033_0041468 Ga0501033_0041468_1813_2574 238
692 3300049573 Ga0501037_0113684 Ga0501037_0113684_770_1531 238
693 3300049578 Ga0501042_0005265 Ga0501042_0005265_176_934 238
694 3300049579 Ga0501043_0513239 Ga0501043_0513239_94_855 238
695 3300049581 Ga0501047_0067509 Ga0501047_0067509_2271_3032 238
696 3300049581 Ga0501047_0084763 Ga0501047_0084763_1179_1937 238
697 3300049742 Ga0501080_0146418 Ga0501080_0146418_592_1350 238
698 3300049744 Ga0501083_0000204 Ga0501083_0000204_8683_9441 238
699 3300049744 Ga0501083_0009486 Ga0501083_0009486_2025_2888 238
700 3300049822 Ga0501035_0159771 Ga0501035_0159771_975_1736 238
701 3300049822 Ga0501035_0268908 Ga0501035_0268908_455_1213 238
702 3300049822 Ga0501035_0370189 Ga0501035_0370189_135_893 238
703 3300049823 Ga0501044_0015713 Ga0501044_0015713_5970_6728 238
704 3300050490 nmdc:mga03n38_234582_c1 nmdc:mga03n38_234582_c1_161_919 238
705 3300050494 nmdc:mga06z11_2010_c1 nmdc:mga06z11_2010_c1_1271_2029 238
706 3300053094 Ga0500566_0037300 Ga0500566_0037300_1202_1972 238
707 3300053113 Ga0500580_042563 Ga0500580_042563_603_1379 238
708 3300053123 Ga0500614_054757 Ga0500614_054757_143_925 238
709 3300053129 Ga0500628_038040 Ga0500628_038040_112_882 238
710 3300053131 Ga0500652_010498 Ga0500652_010498_165_935 238
711 3300053134 Ga0500658_0023991 Ga0500658_0023991_650_1420 238
712 3300053149 Ga0500600_0003279 Ga0500600_0003279_1222_1992 238
713 3300053153 Ga0500616_0170829 Ga0500616_0170829_204_974 238
714 3300053732 Ga0500656_007270 Ga0500656_007270_245_1015 238
715 3300061719 Ga0466962_0001430 Ga0466962_0001430_6654_7412 238
716 iso_pu_bacteria 2508501128 2509151775 238
717 iso_pu_bacteria 2643221587 2643946670 238
718 iso_pu_bacteria 2643221677 2644434474 238
719 iso_pu_bacteria 2767802112 2768644953 238
720 iso_pu_bacteria 2841957949 2841958283 238
721 iso_pu_bacteria 2844315083 2844318661 238
722 iso_pu_bacteria 2862178590 2862186349 238
723 iso_pu_bacteria 2876808645 2876810387 238
724 iso_pu_bacteria 2897803580 2897805097 238
725 iso_pu_bacteria 2899359706 2899361137 238
726 iso_pu_bacteria 2906602504 2906608520 238
727 iso_pu_bacteria 2922361189 2922368178 238
728 iso_pu_bacteria 2936002035 2936006294 238
729 iso_pu_bacteria 3006425503 3006428266 238
730 3300005327 Ga0070658_10000776 Ga0070658_1000077615 239
731 3300005328 Ga0070676_10029865 Ga0070676_100298652 239
732 3300005329 Ga0070683_100735749 Ga0070683_1007357491 239
733 3300005336 Ga0070680_100011979 Ga0070680_1000119795 239
734 3300005338 Ga0068868_100061827 Ga0068868_1000618274 239
735 3300005343 Ga0070687_100039063 Ga0070687_1000390632 239
736 3300005347 Ga0070668_100219142 Ga0070668_1002191422 239
737 3300005353 Ga0070669_100254844 Ga0070669_1002548442 239
738 3300005356 Ga0070674_100160811 Ga0070674_1001608113 239
739 3300005367 Ga0070667_100724239 Ga0070667_1007242391 239
740 3300005441 Ga0070700_100053995 Ga0070700_1000539955 239
741 3300005457 Ga0070662_100066983 Ga0070662_1000669833 239
742 3300005457 Ga0070662_100189766 Ga0070662_1001897662 239
743 3300005544 Ga0070686_100011330 Ga0070686_1000113304 239
744 3300005578 Ga0068854_100139147 Ga0068854_1001391473 239
745 3300005616 Ga0068852_100299550 Ga0068852_1002995502 239
746 3300005718 Ga0068866_10004618 Ga0068866_100046184 239
747 3300005718 Ga0068866_10033488 Ga0068866_100334883 239
748 3300005844 Ga0068862_100382985 Ga0068862_1003829852 239
749 3300006038 Ga0075365_10045983 Ga0075365_100459833 239
750 3300006051 Ga0075364_10321114 Ga0075364_103211142 239
751 3300006847 Ga0075431_100844292 Ga0075431_1008442921 239
752 3300006881 Ga0068865_100009881 Ga0068865_1000098814 239
753 3300006881 Ga0068865_100036225 Ga0068865_1000362257 239
754 3300009036 Ga0105244_10021312 Ga0105244_100213123 239
755 3300009553 Ga0105249_10054067 Ga0105249_100540673 239
756 3300012500 Ga0157314_1002520 Ga0157314_10025201 239
757 3300013297 Ga0157378_10333987 Ga0157378_103339872 239
758 3300013306 Ga0163162_10195665 Ga0163162_101956653 239
759 3300013307 Ga0157372_10082081 Ga0157372_100820812 239
760 3300017792 Ga0163161_10195097 Ga0163161_101950972 239
761 3300020082 Ga0206353_10722848 Ga0206353_107228484 239
762 3300025899 Ga0207642_10060145 Ga0207642_100601454 239
763 3300025901 Ga0207688_10070069 Ga0207688_100700692 239
764 3300025907 Ga0207645_10033287 Ga0207645_100332875 239
765 3300025909 Ga0207705_10000676 Ga0207705_1000067616 239
766 3300025917 Ga0207660_10008817 Ga0207660_100088174 239
767 3300025918 Ga0207662_10034565 Ga0207662_100345653 239
768 3300025933 Ga0207706_10020869 Ga0207706_100208692 239
769 3300025933 Ga0207706_10148626 Ga0207706_101486264 239
770 3300025937 Ga0207669_10056437 Ga0207669_100564373 239
771 3300025938 Ga0207704_10092144 Ga0207704_100921442 239
772 3300025940 Ga0207691_10237065 Ga0207691_102370653 239
773 3300025942 Ga0207689_10252184 Ga0207689_102521842 239
774 3300025961 Ga0207712_10010325 Ga0207712_100103255 239
775 3300025981 Ga0207640_10163924 Ga0207640_101639242 239
776 3300025981 Ga0207640_10787981 Ga0207640_107879811 239
777 3300025986 Ga0207658_10752442 Ga0207658_107524421 239
778 3300026023 Ga0207677_10118785 Ga0207677_101187852 239
779 3300026075 Ga0207708_10016735 Ga0207708_100167353 239
780 3300026075 Ga0207708_10053249 Ga0207708_100532493 239
781 3300026118 Ga0207675_100142806 Ga0207675_1001428063 239
782 3300044901 Ga0466960_0075425 Ga0466960_0075425_14_775 239
783 3300048917 Ga0496114_0080195 Ga0496114_0080195_330_1103 239
784 3300048918 Ga0496115_0234876 Ga0496115_0234876_144_917 239
785 3300048927 Ga0496124_0019937 Ga0496124_0019937_382_1143 239
786 3300050492 nmdc:mga0yw44_69281_c1 nmdc:mga0yw44_69281_c1_1094_1855 239
787 3300053157 Ga0500624_002759 Ga0500624_002759_70_846 239
788 3300053161 Ga0500634_0003973 Ga0500634_0003973_3297_4073 239
789 iso_pu_bacteria 2889033259 2889040278 239
790 iso_pu_bacteria 2904690495 2904696064 239
791 iso_pu_bacteria 2908756301 2908760696 239
792 iso_pu_bacteria 8006994254 8007000171 239
793 iso_pu_bacteria 8054002106 8054009181 239
794 3300003187 JGI25151J46595_10000290 JGI25151J46595_100002902 240
795 3300003187 JGI25151J46595_10000452 JGI25151J46595_100004528 240
796 3300003354 JGI25160J50197_1010453 JGI25160J50197_10104533 240
797 3300005546 Ga0070696_100094253 Ga0070696_1000942532 240
798 3300005983 Ga0081540_1062046 Ga0081540_10620462 240
799 3300009036 Ga0105244_10000125 Ga0105244_1000012538 240
800 3300009092 Ga0105250_10000082 Ga0105250_1000008249 240
801 3300009148 Ga0105243_10074411 Ga0105243_100744112 240
802 3300011119 Ga0105246_10141199 Ga0105246_101411992 240
803 3300025284 Ga0209130_1000723 Ga0209130_10007233 240
804 3300025294 Ga0209025_1000212 Ga0209025_100021265 240
805 3300025297 Ga0209758_1007630 Ga0209758_10076304 240
806 3300025302 Ga0207426_1000102 Ga0207426_100010230 240
807 3300042146 Ga0450907_010208 Ga0450907_010208_408_1175 240
808 3300044712 Ga0453684_0626590 Ga0453684_0626590_119_883 240
809 3300045049 Ga0466959_0048132 Ga0466959_0048132_33_857 240
810 3300048927 Ga0496124_0054129 Ga0496124_0054129_1410_2174 240
811 3300049568 Ga0501031_0116370 Ga0501031_0116370_653_1417 240
812 3300049569 Ga0501032_0008335 Ga0501032_0008335_5286_6110 240
813 3300049570 Ga0501033_0046666 Ga0501033_0046666_857_1621 240
814 3300049571 Ga0501034_0055215 Ga0501034_0055215_3196_3960 240
815 3300049581 Ga0501047_0339601 Ga0501047_0339601_362_1216 240
816 iso_pu_bacteria 8006964411 8006970770 240
817 iso_pu_bacteria 8056673599 8056674235 240
818 3300003203 JGI25406J46586_10000004 JGI25406J46586_1000000495 241
819 3300005437 Ga0070710_10000700 Ga0070710_100007003 241
820 3300005985 Ga0081539_10000080 Ga0081539_1000008032 241
821 3300006051 Ga0075364_10003253 Ga0075364_100032537 241
822 3300009092 Ga0105250_10000007 Ga0105250_1000000746 241
823 3300025711 Ga0207696_1000029 Ga0207696_100002982 241
824 3300025898 Ga0207692_10006007 Ga0207692_100060073 241
825 3300025925 Ga0207650_10004248 Ga0207650_100042486 241
826 3300030731 Ga0316177_1032584 Ga0316177_10325844 241
827 3300030732 Ga0316176_1148195 Ga0316176_11481951 241
828 3300030733 Ga0314311_1152931 Ga0314311_11529312 241
829 3300038443 Ga0395901_0425572 Ga0395901_0425572_207_1004 241
830 3300044658 Ga0466972_0002122 Ga0466972_0002122_394_1173 241
831 3300044658 Ga0466972_0026339 Ga0466972_0026339_1254_2033 241
832 3300044683 Ga0466965_0109366 Ga0466965_0109366_336_1115 241
833 3300044684 Ga0466966_0048196 Ga0466966_0048196_218_1000 241
834 3300044693 Ga0466961_0025475 Ga0466961_0025475_375_1157 241
835 3300044719 Ga0466971_0035672 Ga0466971_0035672_345_1127 241
836 3300044735 Ga0466968_0032354 Ga0466968_0032354_405_1184 241
837 3300044842 Ga0466957_0363938 Ga0466957_0363938_32_814 241
838 3300044901 Ga0466960_0141952 Ga0466960_0141952_438_1217 241
839 3300045049 Ga0466959_0106306 Ga0466959_0106306_184_966 241
840 3300046492 Ga0495585_0169304 Ga0495585_0169304_97_864 241
841 3300046691 Ga0495670_0106107 Ga0495670_0106107_350_1135 241
842 3300047470 Ga0495681_0009660 Ga0495681_0009660_2072_2842 241
843 3300048921 Ga0496118_0007726 Ga0496118_0007726_10039_10806 241
844 3300048924 Ga0496121_0000216 Ga0496121_0000216_53684_54451 241
845 3300048929 Ga0496126_0000265 Ga0496126_0000265_15044_15811 241
846 3300053177 Ga0500636_0000830 Ga0500636_0000830_1035_1802 241
847 iso_pu_bacteria 2874604998 2874607606 241
848 iso_pu_bacteria 3001889506 3001891792 241
849 iso_pu_bacteria 8006984368 8006985619 241
850 3300009545 Ga0105237_10022833 Ga0105237_100228339 242
851 3300010375 Ga0105239_10015107 Ga0105239_100151073 242
852 3300013104 Ga0157370_10405659 Ga0157370_104056592 242
853 3300013105 Ga0157369_10012075 Ga0157369_100120753 242
854 3300025904 Ga0207647_10065042 Ga0207647_100650423 242
855 3300025914 Ga0207671_10062270 Ga0207671_100622703 242
856 3300025949 Ga0207667_10508063 Ga0207667_105080631 242
857 3300039437 Ga0436365_0944416 Ga0436365_0944416_1471_2241 242
858 3300041997 Ga0439431_0036423 Ga0439431_0036423_80_853 242
859 3300045976 Ga0466967_0114799 Ga0466967_0114799_188_958 242
860 3300046453 Ga0495627_000054 Ga0495627_000054_120398_121171 242
861 3300046453 Ga0495627_000164 Ga0495627_000164_39400_40173 242
862 3300046455 Ga0495603_0029388 Ga0495603_0029388_1584_2357 242
863 3300046492 Ga0495585_0155881 Ga0495585_0155881_262_1035 242
864 3300046501 Ga0495607_0000052 Ga0495607_0000052_103111_103884 242
865 3300046512 Ga0495610_0036021 Ga0495610_0036021_248_1021 242
866 3300046515 Ga0495620_0021420 Ga0495620_0021420_672_1445 242
867 3300046519 Ga0495632_0021156 Ga0495632_0021156_2691_3464 242
868 3300046519 Ga0495632_0034192 Ga0495632_0034192_45_818 242
869 3300046520 Ga0495637_0000143 Ga0495637_0000143_31203_31976 242
870 3300046520 Ga0495637_0018209 Ga0495637_0018209_2432_3205 242
871 3300046530 Ga0495654_0000664 Ga0495654_0000664_10162_10935 242
872 3300046530 Ga0495654_0038900 Ga0495654_0038900_171_944 242
873 3300046616 Ga0495668_0007355 Ga0495668_0007355_5188_5961 242
874 3300046692 Ga0495671_0085585 Ga0495671_0085585_666_1439 242
875 3300046694 Ga0495649_0000027 Ga0495649_0000027_62687_63460 242
876 3300046810 Ga0495660_0000088 Ga0495660_0000088_57129_57902 242
877 3300047320 Ga0495672_0001914 Ga0495672_0001914_4429_5202 242
878 3300047320 Ga0495672_0210877 Ga0495672_0210877_17_790 242
879 3300047321 Ga0495676_0001308 Ga0495676_0001308_4473_5246 242
880 3300047469 Ga0495673_0000538 Ga0495673_0000538_9453_10226 242
881 3300047469 Ga0495673_0002632 Ga0495673_0002632_8567_9340 242
882 3300048091 Ga0495626_0048357 Ga0495626_0048357_815_1585 242
883 3300049459 Ga0495678_000382 Ga0495678_000382_13048_13821 242
884 iso_pu_bacteria 2884994152 2884996622 242
885 3300005719 Ga0068861_100091331 Ga0068861_1000913312 243
886 3300006846 Ga0075430_100442087 Ga0075430_1004420871 243
887 3300009147 Ga0114129_10144631 Ga0114129_101446312 243
888 3300009147 Ga0114129_10524983 Ga0114129_105249832 243
889 3300014326 Ga0157380_10153017 Ga0157380_101530172 243
890 3300026075 Ga0207708_10255577 Ga0207708_102555772 243
891 3300026116 Ga0207674_10116606 Ga0207674_101166063 243
892 3300026118 Ga0207675_100311593 Ga0207675_1003115932 243
893 3300046458 Ga0495591_000002 Ga0495591_000002_134074_134892 243
894 3300046471 Ga0495650_0004704 Ga0495650_0004704_2129_2905 243
895 3300046474 Ga0495605_0000052 Ga0495605_0000052_73486_74262 243
896 3300046474 Ga0495605_0000550 Ga0495605_0000550_7266_8084 243
897 3300046501 Ga0495607_0000045 Ga0495607_0000045_117752_118570 243
898 3300046506 Ga0495583_0000089 Ga0495583_0000089_6719_7495 243
899 3300046512 Ga0495610_0100317 Ga0495610_0100317_241_1059 243
900 3300046519 Ga0495632_0000158 Ga0495632_0000158_62868_63644 243
901 3300046520 Ga0495637_0001574 Ga0495637_0001574_9977_10795 243
902 3300046520 Ga0495637_0005149 Ga0495637_0005149_3097_3873 243
903 3300046538 Ga0495609_0000033 Ga0495609_0000033_147017_147793 243
904 3300046542 Ga0495597_0000023 Ga0495597_0000023_142269_143087 243
905 3300046665 Ga0495661_0001793 Ga0495661_0001793_6600_7376 243
906 3300046810 Ga0495660_0002686 Ga0495660_0002686_3770_4588 243
907 3300047469 Ga0495673_0027949 Ga0495673_0027949_1751_2527 243
908 3300049570 Ga0501033_0081015 Ga0501033_0081015_1032_1895 243
909 3300049579 Ga0501043_0142027 Ga0501043_0142027_214_1077 243
910 3300049579 Ga0501043_0240918 Ga0501043_0240918_66_896 243
911 3300049581 Ga0501047_0004338 Ga0501047_0004338_6813_7643 243
912 3300050507 nmdc:mga05p37_455255_c1 nmdc:mga05p37_455255_c1_651_1427 243
913 3300050507 nmdc:mga05p37_886540_c1 nmdc:mga05p37_886540_c1_38_814 243
914 3300050509 nmdc:mga0qj67_22672_c1 nmdc:mga0qj67_22672_c1_951_1727 243
915 3300050510 nmdc:mga06r32_228056_c1 nmdc:mga06r32_228056_c1_940_1716 243
916 3300050511 nmdc:mga08y16_339477_c1 nmdc:mga08y16_339477_c1_732_1508 243
917 3300053125 Ga0500618_000389 Ga0500618_000389_21367_22170 243
918 3300031507 Ga0307509_10116051 Ga0307509_101160511 244
919 3300037471 Ga0395905_0001110 Ga0395905_0001110_12412_13197 244
920 3300046462 Ga0495651_0002844 Ga0495651_0002844_8368_9144 244
921 3300046501 Ga0495607_0036302 Ga0495607_0036302_647_1426 244
922 3300046514 Ga0495618_0053015 Ga0495618_0053015_90_866 244
923 3300046516 Ga0495628_0032670 Ga0495628_0032670_317_1093 244
924 3300046529 Ga0495652_0001618 Ga0495652_0001618_12190_12966 244
925 3300046663 Ga0495635_0006054 Ga0495635_0006054_2937_3713 244
926 3300046679 Ga0495623_0058278 Ga0495623_0058278_618_1394 244
927 3300046680 Ga0495646_0047000 Ga0495646_0047000_1719_2495 244
928 3300046809 Ga0495600_0008141 Ga0495600_0008141_2534_3310 244
929 3300048088 Ga0495602_0052900 Ga0495602_0052900_1762_2538 244
930 3300053077 Ga0495601_0001643 Ga0495601_0001643_9114_9890 244
931 3300053078 Ga0495612_0154630 Ga0495612_0154630_34_810 244
932 3300053085 Ga0495619_0107364 Ga0495619_0107364_133_909 244
933 3300006058 Ga0075432_10001438 Ga0075432_100014384 245
934 3300046501 Ga0495607_0125200 Ga0495607_0125200_470_1333 249
935 3300046506 Ga0495583_0000747 Ga0495583_0000747_23186_24049 249
936 3300046501 Ga0495607_0008284 Ga0495607_0008284_2177_3055 250
937 3300046518 Ga0495631_0047180 Ga0495631_0047180_144_1022 250
938 2162886012 MBSR1b_contig_5111757 MBSR1b_0085.00005260 252

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03746

LamB_YcsF

LamB/YcsF family

39

277

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1v6t-assembly1.cif.gz_A crystal structure of lactam utilization protein from pyrococcus horikoshii ot3 0.8717 10 246
2xu2-assembly1.cif.gz_A crystal structure of the hypothetical protein pa4511 from pseudomonas aeruginosa 0.8626 11 235
2dfa-assembly1.cif.gz_A crystal structure of lactam utilization protein from thermus thermophilus hb8 0.8593 10 247
1v6t-assembly1.cif.gz_A crystal structure of lactam utilization protein from pyrococcus horikoshii ot3 0.8275 10 246
2dfa-assembly1.cif.gz_A crystal structure of lactam utilization protein from thermus thermophilus hb8 0.8261 10 247
ID Description Score Start End Superfamily
af_Q2FXX2_1_250_3.20.20.370 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8923 10 247 3.20.20.370
1v6tA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8717 10 246 3.20.20.370
2x5eA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8623 11 235 3.20.20.370
2dfaA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8593 10 247 3.20.20.370
af_Q2FXX2_1_250_3.20.20.370 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8472 10 247 3.20.20.370
ID Description Score Start End GO Terms
AF-A0A645IXZ5-F1-model_v4 LamB/YcsF family protein 0.9913 158 246 GO:0005975
AF-A0A2N8EL15-F1-model_v4 deleted 0.987 97 174
AF-W4TG99-F1-model_v4 deleted 0.9854 160 248
AF-A0A5P0JK03-F1-model_v4 LamB/YcsF family protein 0.9853 109 218 GO:0005975
AF-A0A1V3X7X4-F1-model_v4 LamB/YcsF family protein 0.9841 141 248 GO:0005975

Feature Viewer

pLDDT pTM Quality
82.21 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map