F486127
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 934 | 431 | 915 | 225 |
Family's Representative Sequence
| Representative Sequence | 3300031727|Ga0316576_10083949|Ga0316576_100839491 |
| Length | 273 |
| Sequence | VQGTQNTILHMGCAEPLCTGAGALPVSASRDTERKTDILAMTFPLRIAPSILSADFARLGEEVRAVDAAGADWIHVDVMDGHFVPNITIGPDVVKALRPHSPKPFDVHLMIAPCDPYLEAFAKAGADIITVHVEAGPHLHRSLQAIRALGKRAGVTLNPGTPVSTIEPVIDMVDLILVMSVNPGFGGQQFITAALDKITRLRALAAGRPIEIEIDGGINPEIAPLVARAGANVLVAGNAVFKAGGAEGGGTEAYARNITAIRDAAAMARGEVV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 2 | 2617270889 | Nostoc punctiforme PCC 73102 | Isolate | Unclassified |
| 3 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 4 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 5 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 6 | 2831426010 | Nostoc sp. 106C | Isolate | Unclassified |
| 7 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 8 | 2848694841 | Nostoc sp. RF31YmG | Isolate | Unclassified |
| 9 | 2849660919 | Nostoc sp. T09 | Isolate | Unclassified |
| 10 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 11 | 2884298095 | Microvirga thermotolerans HR1 | Isolate | Rhizosphere |
| 12 | 2886627955 | Nostoc sp. PA-18-2419 JC1668 | Isolate | Unclassified |
| 13 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 14 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 15 | 2913844669 | Nostocales cyanobacterium LEGE 12452 | Isolate | Unclassified |
| 16 | 2913912277 | Desmonostoc muscorum LEGE 12446 | Isolate | Unclassified |
| 17 | 2913939268 | Nostoc sp. LEGE 12447 | Isolate | Unclassified |
| 18 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 19 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 20 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 21 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 22 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 23 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 24 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 25 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 26 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 27 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 28 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 29 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 30 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 31 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 70 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 73 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 75 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 76 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 77 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 78 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 79 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 80 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 81 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 82 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 83 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 84 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 85 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 86 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 87 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 88 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 90 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 92 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 93 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 94 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 95 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 96 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 97 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 98 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 99 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 100 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 102 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 114 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 128 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 130 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 131 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 132 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 194 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 195 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 196 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 197 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 198 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 199 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 200 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 201 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 202 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 203 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 204 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 205 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 206 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 207 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 208 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 209 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 210 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 211 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 212 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 213 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 214 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 215 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 216 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 217 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 218 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 219 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 220 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 221 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 222 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 223 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 224 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 225 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 226 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 227 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 228 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 229 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 230 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 231 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 232 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 233 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 234 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 235 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 236 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 237 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 238 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 239 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 240 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 241 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 242 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 243 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 244 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 245 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 246 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 247 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 248 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 249 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 250 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 251 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 252 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 253 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 254 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 255 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 256 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 257 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 258 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 259 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 260 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 261 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 262 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 263 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 264 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 265 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 266 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 267 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 268 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 269 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 270 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 271 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 272 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 273 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 274 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 275 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 276 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 332 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 333 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 334 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 335 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 336 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 337 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 338 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 339 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 340 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 341 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 342 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 343 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 344 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 345 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 346 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 347 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 348 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 349 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 350 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 351 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 352 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 353 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 354 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 355 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 379 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 380 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 381 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 382 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 383 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 384 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 385 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 386 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 387 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 388 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 392 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 393 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 394 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 395 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 396 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 400 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 401 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 402 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 403 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 404 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 408 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 409 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 410 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 411 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 417 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 418 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 419 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 420 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 421 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 422 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 423 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 424 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 425 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 426 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 427 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 428 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 429 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 430 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 431 | 642555144 | Nostoc punctiforme PCC 73102 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.43 |
| Metatranscriptomes | 0.54 |
| Isolates | 2.03 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.1 |
| Nodule | 0.32 |
| Rhizoplane | 8.99 |
| Rhizosphere | 84.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.53 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24752J21851_1000198 | 3300001976 | Bacteria | 8365 |
| 2 | JGI24740J21852_10005460 | 3300001979 | Bacteria | 5373 |
| 3 | JGI24740J21852_10018622 | 3300001979 | Bacteria | 2457 |
| 4 | JGI24739J22299_10006428 | 3300001989 | Bacteria | 4438 |
| 5 | JGI24737J22298_10033317 | 3300001990 | Bacteria | 1601 |
| 6 | JGI24735J21928_10005974 | 3300002067 | Bacteria | 4021 |
| 7 | JGI24735J21928_10007291 | 3300002067 | Bacteria | 3609 |
| 8 | JGI24750J21931_1002769 | 3300002070 | Bacteria | 2106 |
| 9 | JGI24748J21848_1000042 | 3300002074 | Bacteria | 62376 |
| 10 | JGI24749J21850_1020066 | 3300002076 | Bacteria | 944 |
| 11 | JGI24034J26672_10000035 | 3300002239 | Bacteria | 85548 |
| 12 | JGI24742J22300_10031650 | 3300002244 | Bacteria | 926 |
| 13 | Ga0055540_1006853 | 3300003792 | Bacteria | 4430 |
| 14 | Ga0058859_11244916 | 3300004798 | Bacteria | 864 |
| 15 | Ga0070658_10339213 | 3300005327 | Bacteria | 1285 |
| 16 | Ga0070690_100000009 | 3300005330 | Bacteria | 112447 |
| 17 | Ga0070690_100040895 | 3300005330 | Bacteria | 2934 |
| 18 | Ga0070670_100287174 | 3300005331 | Bacteria | 1437 |
| 19 | Ga0070677_10000155 | 3300005333 | Bacteria | 23197 |
| 20 | Ga0070666_10000006 | 3300005335 | Bacteria | 319173 |
| 21 | Ga0070666_10001803 | 3300005335 | Bacteria | 13038 |
| 22 | Ga0070680_100001660 | 3300005336 | Bacteria | 16265 |
| 23 | Ga0070680_100110382 | 3300005336 | Bacteria | 2289 |
| 24 | Ga0070680_100168740 | 3300005336 | Bacteria | 1841 |
| 25 | Ga0070682_100094964 | 3300005337 | Bacteria | 1957 |
| 26 | Ga0070660_100000064 | 3300005339 | Bacteria | 62554 |
| 27 | Ga0070660_100047236 | 3300005339 | Bacteria | 3302 |
| 28 | Ga0070660_100109866 | 3300005339 | Bacteria | 2193 |
| 29 | Ga0070660_100276101 | 3300005339 | Bacteria | 1374 |
| 30 | Ga0070660_100307567 | 3300005339 | Bacteria | 1300 |
| 31 | Ga0070660_100412668 | 3300005339 | Bacteria | 1117 |
| 32 | Ga0070689_100012742 | 3300005340 | Bacteria | 6069 |
| 33 | Ga0070689_100179282 | 3300005340 | Bacteria | 1720 |
| 34 | Ga0070691_10016128 | 3300005341 | Bacteria | 3433 |
| 35 | Ga0070687_100071737 | 3300005343 | Bacteria | 1862 |
| 36 | Ga0070687_100225626 | 3300005343 | Bacteria | 1150 |
| 37 | Ga0070661_100004993 | 3300005344 | Bacteria | 9138 |
| 38 | Ga0070668_100000539 | 3300005347 | Bacteria | 25247 |
| 39 | Ga0070668_100036683 | 3300005347 | Bacteria | 3742 |
| 40 | Ga0070668_100083683 | 3300005347 | Bacteria | 2505 |
| 41 | Ga0070668_100397584 | 3300005347 | Bacteria | 1176 |
| 42 | Ga0070669_100000095 | 3300005353 | Bacteria | 86930 |
| 43 | Ga0070669_100000280 | 3300005353 | Bacteria | 40554 |
| 44 | Ga0070675_100061783 | 3300005354 | Bacteria | 3094 |
| 45 | Ga0070675_100310794 | 3300005354 | Bacteria | 1390 |
| 46 | Ga0070671_100000005 | 3300005355 | Bacteria | 256547 |
| 47 | Ga0070671_100067244 | 3300005355 | Bacteria | 2988 |
| 48 | Ga0070671_100186306 | 3300005355 | Bacteria | 1758 |
| 49 | Ga0070674_100016308 | 3300005356 | Bacteria | 4656 |
| 50 | Ga0070673_100083073 | 3300005364 | Bacteria | 2601 |
| 51 | Ga0070688_100004996 | 3300005365 | Bacteria | 6945 |
| 52 | Ga0070688_100045907 | 3300005365 | Bacteria | 2703 |
| 53 | Ga0070659_100017634 | 3300005366 | Bacteria | 5378 |
| 54 | Ga0070659_100132082 | 3300005366 | Bacteria | 2028 |
| 55 | Ga0070659_100209567 | 3300005366 | Bacteria | 1606 |
| 56 | Ga0070667_100021629 | 3300005367 | Bacteria | 5338 |
| 57 | Ga0070667_100207098 | 3300005367 | Bacteria | 1742 |
| 58 | Ga0070714_100432594 | 3300005435 | Bacteria | 1248 |
| 59 | Ga0070713_100368594 | 3300005436 | Bacteria | 1336 |
| 60 | Ga0070710_10187201 | 3300005437 | Bacteria | 1300 |
| 61 | Ga0070700_100025794 | 3300005441 | Bacteria | 3464 |
| 62 | Ga0070694_100187145 | 3300005444 | Bacteria | 1535 |
| 63 | Ga0070708_100021449 | 3300005445 | Bacteria | 5462 |
| 64 | Ga0070663_100050356 | 3300005455 | Bacteria | 2962 |
| 65 | Ga0070663_100645155 | 3300005455 | Bacteria | 895 |
| 66 | Ga0070678_100049859 | 3300005456 | Bacteria | 3024 |
| 67 | Ga0070662_100251530 | 3300005457 | Bacteria | 1421 |
| 68 | Ga0070681_10013407 | 3300005458 | Bacteria | 8143 |
| 69 | Ga0070681_10024397 | 3300005458 | Bacteria | 6088 |
| 70 | Ga0070681_10046789 | 3300005458 | Bacteria | 4324 |
| 71 | Ga0070681_10167330 | 3300005458 | Bacteria | 2121 |
| 72 | Ga0070681_10194105 | 3300005458 | Bacteria | 1949 |
| 73 | Ga0070681_10199336 | 3300005458 | Bacteria | 1920 |
| 74 | Ga0070681_10272796 | 3300005458 | Bacteria | 1603 |
| 75 | Ga0070681_10506439 | 3300005458 | Bacteria | 1120 |
| 76 | Ga0070685_10000155 | 3300005466 | Bacteria | 45505 |
| 77 | Ga0070707_100136600 | 3300005468 | Bacteria | 2385 |
| 78 | Ga0070707_100332576 | 3300005468 | Bacteria | 1476 |
| 79 | Ga0070698_100003881 | 3300005471 | Bacteria | 16433 |
| 80 | Ga0070699_100082691 | 3300005518 | Bacteria | 2799 |
| 81 | Ga0070679_100108824 | 3300005530 | Bacteria | 2758 |
| 82 | Ga0070679_100165670 | 3300005530 | Bacteria | 2183 |
| 83 | Ga0070679_100245169 | 3300005530 | Bacteria | 1749 |
| 84 | Ga0070684_100153420 | 3300005535 | Bacteria | 2088 |
| 85 | Ga0070697_100298596 | 3300005536 | Bacteria | 1384 |
| 86 | Ga0068853_100784584 | 3300005539 | Bacteria | 912 |
| 87 | Ga0070686_100000091 | 3300005544 | Bacteria | 63232 |
| 88 | Ga0070665_100000019 | 3300005548 | Bacteria | 413972 |
| 89 | Ga0070665_100000148 | 3300005548 | Bacteria | 128573 |
| 90 | Ga0070665_100043313 | 3300005548 | Bacteria | 4523 |
| 91 | Ga0070665_100189335 | 3300005548 | Bacteria | 2059 |
| 92 | Ga0068855_100016827 | 3300005563 | Bacteria | 8794 |
| 93 | Ga0068855_100022850 | 3300005563 | Bacteria | 7496 |
| 94 | Ga0068855_100938848 | 3300005563 | Bacteria | 912 |
| 95 | Ga0070664_100016307 | 3300005564 | Bacteria | 6089 |
| 96 | Ga0070664_100486215 | 3300005564 | Bacteria | 1136 |
| 97 | Ga0068854_100459371 | 3300005578 | Bacteria | 1065 |
| 98 | Ga0068854_100504303 | 3300005578 | Bacteria | 1019 |
| 99 | Ga0068856_100490559 | 3300005614 | Bacteria | 1249 |
| 100 | Ga0068852_100007430 | 3300005616 | Bacteria | 7998 |
| 101 | Ga0068852_100042768 | 3300005616 | Bacteria | 3838 |
| 102 | Ga0068852_100092276 | 3300005616 | Bacteria | 2711 |
| 103 | Ga0068852_100639984 | 3300005616 | Bacteria | 1070 |
| 104 | Ga0068859_100022381 | 3300005617 | Bacteria | 6336 |
| 105 | Ga0068859_100213616 | 3300005617 | Bacteria | 2016 |
| 106 | Ga0068861_100012358 | 3300005719 | Bacteria | 5953 |
| 107 | Ga0068851_10077419 | 3300005834 | Bacteria | 1731 |
| 108 | Ga0068863_100000118 | 3300005841 | Bacteria | 82651 |
| 109 | Ga0068863_100014260 | 3300005841 | Bacteria | 7657 |
| 110 | Ga0068863_100316090 | 3300005841 | Bacteria | 1516 |
| 111 | Ga0068863_100523847 | 3300005841 | Bacteria | 1169 |
| 112 | Ga0068858_100000723 | 3300005842 | Bacteria | 34436 |
| 113 | Ga0068858_100002727 | 3300005842 | Bacteria | 17774 |
| 114 | Ga0068858_100005339 | 3300005842 | Bacteria | 12606 |
| 115 | Ga0068860_100000014 | 3300005843 | Bacteria | 319437 |
| 116 | Ga0068860_100001093 | 3300005843 | Bacteria | 29849 |
| 117 | Ga0068860_100134992 | 3300005843 | Bacteria | 2369 |
| 118 | Ga0068862_100000014 | 3300005844 | Bacteria | 251552 |
| 119 | Ga0068862_100000503 | 3300005844 | Bacteria | 41613 |
| 120 | Ga0068862_100001001 | 3300005844 | Bacteria | 27048 |
| 121 | Ga0081455_10002509 | 3300005937 | Bacteria | 21784 |
| 122 | Ga0081455_10064681 | 3300005937 | Bacteria | 3062 |
| 123 | Ga0081538_10068599 | 3300005981 | Bacteria | 1970 |
| 124 | Ga0081540_1014204 | 3300005983 | Bacteria | 5119 |
| 125 | Ga0081539_10014301 | 3300005985 | Bacteria | 5883 |
| 126 | Ga0070717_10854828 | 3300006028 | Bacteria | 828 |
| 127 | Ga0075365_10015277 | 3300006038 | Bacteria | 4640 |
| 128 | Ga0070712_100001034 | 3300006175 | Bacteria | 16789 |
| 129 | Ga0070712_100511112 | 3300006175 | Bacteria | 1008 |
| 130 | Ga0075367_10178454 | 3300006178 | Bacteria | 1324 |
| 131 | Ga0075367_10298417 | 3300006178 | Bacteria | 1014 |
| 132 | Ga0075366_10003290 | 3300006195 | Bacteria | 8495 |
| 133 | Ga0075366_10019985 | 3300006195 | Bacteria | 3882 |
| 134 | Ga0068871_100359928 | 3300006358 | Bacteria | 1289 |
| 135 | Ga0075428_100205281 | 3300006844 | Bacteria | 2130 |
| 136 | Ga0075428_100311554 | 3300006844 | Bacteria | 1692 |
| 137 | Ga0075431_100020447 | 3300006847 | Bacteria | 6762 |
| 138 | Ga0075431_100058054 | 3300006847 | Bacteria | 3991 |
| 139 | Ga0075433_10052600 | 3300006852 | Bacteria | 3549 |
| 140 | Ga0075433_10124576 | 3300006852 | Bacteria | 2289 |
| 141 | Ga0075434_100000986 | 3300006871 | Bacteria | 23010 |
| 142 | Ga0075434_100074790 | 3300006871 | Bacteria | 3381 |
| 143 | Ga0075434_100465951 | 3300006871 | Bacteria | 1285 |
| 144 | Ga0075429_100057848 | 3300006880 | Bacteria | 3376 |
| 145 | Ga0075436_100065280 | 3300006914 | Bacteria | 2516 |
| 146 | Ga0097620_100022380 | 3300006931 | Bacteria | 6336 |
| 147 | Ga0097620_100213618 | 3300006931 | Bacteria | 2016 |
| 148 | Ga0075435_100036045 | 3300007076 | Bacteria | 3929 |
| 149 | Ga0075435_100345783 | 3300007076 | Bacteria | 1274 |
| 150 | Ga0105240_10295843 | 3300009093 | Bacteria | 1854 |
| 151 | Ga0105240_10597732 | 3300009093 | Bacteria | 1215 |
| 152 | Ga0105240_10678746 | 3300009093 | Bacteria | 1127 |
| 153 | Ga0111539_10335230 | 3300009094 | Bacteria | 1761 |
| 154 | Ga0111539_10422510 | 3300009094 | Bacteria | 1552 |
| 155 | Ga0105245_10133351 | 3300009098 | Bacteria | 2332 |
| 156 | Ga0105247_10000830 | 3300009101 | Bacteria | 23517 |
| 157 | Ga0105247_10039951 | 3300009101 | Bacteria | 2867 |
| 158 | Ga0105247_10093791 | 3300009101 | Bacteria | 1909 |
| 159 | Ga0105247_10115726 | 3300009101 | Bacteria | 1731 |
| 160 | Ga0105247_10151643 | 3300009101 | Bacteria | 1528 |
| 161 | Ga0114129_10054562 | 3300009147 | Bacteria | 5603 |
| 162 | Ga0114129_11134092 | 3300009147 | Bacteria | 977 |
| 163 | Ga0105243_10138496 | 3300009148 | Bacteria | 2073 |
| 164 | Ga0105242_10096458 | 3300009176 | Bacteria | 2498 |
| 165 | Ga0105248_10028861 | 3300009177 | Bacteria | 6184 |
| 166 | Ga0105248_10056676 | 3300009177 | Bacteria | 4396 |
| 167 | Ga0105237_10047573 | 3300009545 | Bacteria | 4312 |
| 168 | Ga0105237_10078994 | 3300009545 | Bacteria | 3280 |
| 169 | Ga0105238_10416014 | 3300009551 | Bacteria | 1338 |
| 170 | Ga0105238_10454160 | 3300009551 | Bacteria | 1278 |
| 171 | Ga0105249_10000002 | 3300009553 | Bacteria | 376207 |
| 172 | Ga0105249_10000035 | 3300009553 | Bacteria | 201325 |
| 173 | Ga0105249_10385060 | 3300009553 | Bacteria | 1429 |
| 174 | Ga0105249_10416469 | 3300009553 | Bacteria | 1376 |
| 175 | Ga0099796_10010288 | 3300010159 | Bacteria | 2567 |
| 176 | Ga0105239_10034581 | 3300010375 | Bacteria | 5550 |
| 177 | Ga0157373_10022779 | 3300013100 | Bacteria | 4542 |
| 178 | Ga0157373_10105027 | 3300013100 | Bacteria | 1987 |
| 179 | Ga0157371_10147730 | 3300013102 | Bacteria | 1676 |
| 180 | Ga0157371_10269119 | 3300013102 | Bacteria | 1229 |
| 181 | Ga0157370_10014955 | 3300013104 | Bacteria | 7913 |
| 182 | Ga0157370_10028926 | 3300013104 | Bacteria | 5445 |
| 183 | Ga0157370_10112520 | 3300013104 | Bacteria | 2544 |
| 184 | Ga0157369_10000043 | 3300013105 | Bacteria | 180713 |
| 185 | Ga0157369_10007581 | 3300013105 | Bacteria | 12489 |
| 186 | Ga0157369_10094209 | 3300013105 | Bacteria | 3196 |
| 187 | Ga0157369_10111023 | 3300013105 | Bacteria | 2914 |
| 188 | Ga0157369_10847637 | 3300013105 | Bacteria | 938 |
| 189 | Ga0157374_10023802 | 3300013296 | Bacteria | 5483 |
| 190 | Ga0157378_10333651 | 3300013297 | Bacteria | 1477 |
| 191 | Ga0157378_10382343 | 3300013297 | Bacteria | 1383 |
| 192 | Ga0163162_10014044 | 3300013306 | Bacteria | 7827 |
| 193 | Ga0163162_10036563 | 3300013306 | Bacteria | 4895 |
| 194 | Ga0163162_10114980 | 3300013306 | Bacteria | 2790 |
| 195 | Ga0163162_10154001 | 3300013306 | Bacteria | 2418 |
| 196 | Ga0163162_10206538 | 3300013306 | Bacteria | 2093 |
| 197 | Ga0157372_10276084 | 3300013307 | Bacteria | 1953 |
| 198 | Ga0157375_11173984 | 3300013308 | Bacteria | 900 |
| 199 | Ga0163163_10005537 | 3300014325 | Bacteria | 10936 |
| 200 | Ga0163163_10019657 | 3300014325 | Bacteria | 6346 |
| 201 | Ga0157380_10004798 | 3300014326 | Bacteria | 9423 |
| 202 | Ga0157380_10062201 | 3300014326 | Bacteria | 2989 |
| 203 | Ga0157379_10008890 | 3300014968 | Bacteria | 8756 |
| 204 | Ga0157379_10405318 | 3300014968 | Bacteria | 1254 |
| 205 | Ga0157379_10455885 | 3300014968 | Bacteria | 1181 |
| 206 | Ga0157379_10581161 | 3300014968 | Bacteria | 1044 |
| 207 | Ga0182005_1064129 | 3300015265 | Bacteria | 1004 |
| 208 | Ga0163161_10000102 | 3300017792 | Bacteria | 81540 |
| 209 | Ga0213872_10014988 | 3300021361 | Bacteria | 3606 |
| 210 | Ga0213874_10062776 | 3300021377 | Bacteria | 1168 |
| 211 | Ga0213875_10150129 | 3300021388 | Bacteria | 1092 |
| 212 | Ga0209758_1000128 | 3300025297 | Bacteria | 186771 |
| 213 | Ga0207697_10009619 | 3300025315 | Bacteria | 4166 |
| 214 | Ga0207697_10013327 | 3300025315 | Bacteria | 3431 |
| 215 | Ga0207697_10055657 | 3300025315 | Bacteria | 1640 |
| 216 | Ga0207656_10078538 | 3300025321 | Bacteria | 1479 |
| 217 | Ga0207656_10102693 | 3300025321 | Bacteria | 1312 |
| 218 | Ga0207682_10000147 | 3300025893 | Bacteria | 31656 |
| 219 | Ga0207710_10022092 | 3300025900 | Bacteria | 2729 |
| 220 | Ga0207710_10029664 | 3300025900 | Bacteria | 2382 |
| 221 | Ga0207710_10092185 | 3300025900 | Bacteria | 1419 |
| 222 | Ga0207710_10122998 | 3300025900 | Bacteria | 1241 |
| 223 | Ga0207688_10002303 | 3300025901 | Bacteria | 10272 |
| 224 | Ga0207688_10157154 | 3300025901 | Bacteria | 1346 |
| 225 | Ga0207680_10000011 | 3300025903 | Bacteria | 391225 |
| 226 | Ga0207680_10024594 | 3300025903 | Bacteria | 3308 |
| 227 | Ga0207680_10201301 | 3300025903 | Bacteria | 1357 |
| 228 | Ga0207647_10008450 | 3300025904 | Bacteria | 7382 |
| 229 | Ga0207647_10055215 | 3300025904 | Bacteria | 2441 |
| 230 | Ga0207647_10207689 | 3300025904 | Bacteria | 1132 |
| 231 | Ga0207645_10022266 | 3300025907 | Bacteria | 4125 |
| 232 | Ga0207643_10027485 | 3300025908 | Bacteria | 3154 |
| 233 | Ga0207643_10180488 | 3300025908 | Bacteria | 1277 |
| 234 | Ga0207705_10000033 | 3300025909 | Bacteria | 223997 |
| 235 | Ga0207705_10180163 | 3300025909 | Bacteria | 1594 |
| 236 | Ga0207705_10310735 | 3300025909 | Bacteria | 1210 |
| 237 | Ga0207684_10479254 | 3300025910 | Bacteria | 1067 |
| 238 | Ga0207654_10000285 | 3300025911 | Bacteria | 30791 |
| 239 | Ga0207707_10016805 | 3300025912 | Bacteria | 6375 |
| 240 | Ga0207707_10150528 | 3300025912 | Bacteria | 2035 |
| 241 | Ga0207707_10159254 | 3300025912 | Bacteria | 1974 |
| 242 | Ga0207707_10605427 | 3300025912 | Bacteria | 927 |
| 243 | Ga0207695_10002074 | 3300025913 | Bacteria | 30558 |
| 244 | Ga0207671_10012192 | 3300025914 | Bacteria | 6934 |
| 245 | Ga0207693_10009479 | 3300025915 | Bacteria | 7929 |
| 246 | Ga0207693_10017330 | 3300025915 | Bacteria | 5744 |
| 247 | Ga0207693_10042503 | 3300025915 | Bacteria | 3577 |
| 248 | Ga0207693_10078129 | 3300025915 | Bacteria | 2591 |
| 249 | Ga0207693_10205671 | 3300025915 | Bacteria | 1548 |
| 250 | Ga0207660_10002059 | 3300025917 | Bacteria | 13360 |
| 251 | Ga0207660_10029613 | 3300025917 | Bacteria | 3758 |
| 252 | Ga0207660_10245440 | 3300025917 | Bacteria | 1412 |
| 253 | Ga0207662_10221508 | 3300025918 | Bacteria | 1232 |
| 254 | Ga0207657_10091569 | 3300025919 | Bacteria | 2535 |
| 255 | Ga0207657_10168929 | 3300025919 | Bacteria | 1773 |
| 256 | Ga0207649_10000444 | 3300025920 | Bacteria | 29932 |
| 257 | Ga0207649_10074284 | 3300025920 | Bacteria | 2181 |
| 258 | Ga0207649_10100090 | 3300025920 | Bacteria | 1916 |
| 259 | Ga0207652_10188151 | 3300025921 | Bacteria | 1856 |
| 260 | Ga0207646_10214716 | 3300025922 | Bacteria | 1737 |
| 261 | Ga0207681_10000096 | 3300025923 | Bacteria | 74995 |
| 262 | Ga0207681_10000112 | 3300025923 | Bacteria | 68723 |
| 263 | Ga0207681_10021738 | 3300025923 | Bacteria | 4083 |
| 264 | Ga0207681_10323687 | 3300025923 | Bacteria | 1227 |
| 265 | Ga0207694_10004187 | 3300025924 | Bacteria | 11314 |
| 266 | Ga0207694_10198752 | 3300025924 | Bacteria | 1630 |
| 267 | Ga0207687_10019713 | 3300025927 | Bacteria | 4471 |
| 268 | Ga0207687_10051601 | 3300025927 | Bacteria | 2868 |
| 269 | Ga0207700_10023911 | 3300025928 | Bacteria | 4223 |
| 270 | Ga0207664_10286062 | 3300025929 | Bacteria | 1448 |
| 271 | Ga0207664_10878560 | 3300025929 | Bacteria | 805 |
| 272 | Ga0207644_10000008 | 3300025931 | Bacteria | 354219 |
| 273 | Ga0207644_10009210 | 3300025931 | Bacteria | 6476 |
| 274 | Ga0207644_10014179 | 3300025931 | Bacteria | 5331 |
| 275 | Ga0207644_10351399 | 3300025931 | Bacteria | 1197 |
| 276 | Ga0207690_10011704 | 3300025932 | Bacteria | 5246 |
| 277 | Ga0207706_10109808 | 3300025933 | Bacteria | 2427 |
| 278 | Ga0207706_10123536 | 3300025933 | Bacteria | 2277 |
| 279 | Ga0207706_10278816 | 3300025933 | Bacteria | 1458 |
| 280 | Ga0207706_10298024 | 3300025933 | Bacteria | 1405 |
| 281 | Ga0207686_10076118 | 3300025934 | Bacteria | 2175 |
| 282 | Ga0207686_10127490 | 3300025934 | Bacteria | 1741 |
| 283 | Ga0207709_10252546 | 3300025935 | Bacteria | 1289 |
| 284 | Ga0207670_10006506 | 3300025936 | Bacteria | 6485 |
| 285 | Ga0207670_10061467 | 3300025936 | Bacteria | 2563 |
| 286 | Ga0207704_10249315 | 3300025938 | Bacteria | 1332 |
| 287 | Ga0207665_10370326 | 3300025939 | Bacteria | 1085 |
| 288 | Ga0207691_10042109 | 3300025940 | Bacteria | 4211 |
| 289 | Ga0207691_10429741 | 3300025940 | Bacteria | 1125 |
| 290 | Ga0207711_10020384 | 3300025941 | Bacteria | 5527 |
| 291 | Ga0207711_10056159 | 3300025941 | Bacteria | 3382 |
| 292 | Ga0207711_10165981 | 3300025941 | Bacteria | 2001 |
| 293 | Ga0207689_10072495 | 3300025942 | Bacteria | 2829 |
| 294 | Ga0207661_10174628 | 3300025944 | Bacteria | 1872 |
| 295 | Ga0207661_10349253 | 3300025944 | Bacteria | 1334 |
| 296 | Ga0207679_10029237 | 3300025945 | Bacteria | 3835 |
| 297 | Ga0207679_10191126 | 3300025945 | Bacteria | 1702 |
| 298 | Ga0207667_10007324 | 3300025949 | Bacteria | 13282 |
| 299 | Ga0207667_10012362 | 3300025949 | Bacteria | 9844 |
| 300 | Ga0207667_10022285 | 3300025949 | Bacteria | 7001 |
| 301 | Ga0207667_10042471 | 3300025949 | Bacteria | 4832 |
| 302 | Ga0207667_10074478 | 3300025949 | Bacteria | 3527 |
| 303 | Ga0207651_10109481 | 3300025960 | Bacteria | 2070 |
| 304 | Ga0207712_10000002 | 3300025961 | Bacteria | 706628 |
| 305 | Ga0207712_10000013 | 3300025961 | Bacteria | 391208 |
| 306 | Ga0207712_10079828 | 3300025961 | Bacteria | 2378 |
| 307 | Ga0207668_10007115 | 3300025972 | Bacteria | 6639 |
| 308 | Ga0207668_10066392 | 3300025972 | Bacteria | 2557 |
| 309 | Ga0207668_10096978 | 3300025972 | Bacteria | 2181 |
| 310 | Ga0207640_10063192 | 3300025981 | Bacteria | 2459 |
| 311 | Ga0207640_10215809 | 3300025981 | Bacteria | 1465 |
| 312 | Ga0207640_10591692 | 3300025981 | Bacteria | 938 |
| 313 | Ga0207658_10000689 | 3300025986 | Bacteria | 29444 |
| 314 | Ga0207658_10102311 | 3300025986 | Bacteria | 2247 |
| 315 | Ga0207658_10163505 | 3300025986 | Bacteria | 1826 |
| 316 | Ga0207703_10001006 | 3300026035 | Bacteria | 27062 |
| 317 | Ga0207703_10009748 | 3300026035 | Bacteria | 7537 |
| 318 | Ga0207703_10013788 | 3300026035 | Bacteria | 6300 |
| 319 | Ga0207703_10136533 | 3300026035 | Bacteria | 2124 |
| 320 | Ga0207639_10043651 | 3300026041 | Bacteria | 3367 |
| 321 | Ga0207639_10261723 | 3300026041 | Bacteria | 1513 |
| 322 | Ga0207639_10616822 | 3300026041 | Bacteria | 1001 |
| 323 | Ga0207678_10320833 | 3300026067 | Bacteria | 1333 |
| 324 | Ga0207708_10036299 | 3300026075 | Bacteria | 3752 |
| 325 | Ga0207708_10043986 | 3300026075 | Bacteria | 3403 |
| 326 | Ga0207702_10007648 | 3300026078 | Bacteria | 9194 |
| 327 | Ga0207702_10307501 | 3300026078 | Bacteria | 1506 |
| 328 | Ga0207641_10000101 | 3300026088 | Bacteria | 122493 |
| 329 | Ga0207641_10003069 | 3300026088 | Bacteria | 15060 |
| 330 | Ga0207676_10001834 | 3300026095 | Bacteria | 15561 |
| 331 | Ga0207674_10030099 | 3300026116 | Bacteria | 5710 |
| 332 | Ga0207674_10039328 | 3300026116 | Bacteria | 4904 |
| 333 | Ga0207674_10231985 | 3300026116 | Bacteria | 1793 |
| 334 | Ga0207674_10445601 | 3300026116 | Bacteria | 1251 |
| 335 | Ga0207674_10581922 | 3300026116 | Bacteria | 1081 |
| 336 | Ga0207675_100011489 | 3300026118 | Bacteria | 8284 |
| 337 | Ga0207675_100118534 | 3300026118 | Bacteria | 2503 |
| 338 | Ga0207683_10095843 | 3300026121 | Bacteria | 2645 |
| 339 | Ga0207683_10148744 | 3300026121 | Bacteria | 2113 |
| 340 | Ga0207698_10001849 | 3300026142 | Bacteria | 12360 |
| 341 | Ga0207698_10013844 | 3300026142 | Bacteria | 5340 |
| 342 | Ga0207698_10038387 | 3300026142 | Bacteria | 3538 |
| 343 | Ga0268266_10000025 | 3300028379 | Bacteria | 477143 |
| 344 | Ga0268266_10000626 | 3300028379 | Bacteria | 48011 |
| 345 | Ga0268266_10108335 | 3300028379 | Bacteria | 2458 |
| 346 | Ga0268266_10137786 | 3300028379 | Bacteria | 2187 |
| 347 | Ga0268266_10942846 | 3300028379 | Bacteria | 835 |
| 348 | Ga0268265_10000048 | 3300028380 | Bacteria | 178523 |
| 349 | Ga0268265_10000316 | 3300028380 | Bacteria | 53175 |
| 350 | Ga0268265_10000975 | 3300028380 | Bacteria | 26114 |
| 351 | Ga0268264_10000037 | 3300028381 | Bacteria | 391116 |
| 352 | Ga0268264_10000439 | 3300028381 | Bacteria | 57339 |
| 353 | Ga0268264_10161279 | 3300028381 | Bacteria | 2020 |
| 354 | Ga0265760_10026725 | 3300031090 | Bacteria | 1689 |
| 355 | Ga0265328_10070937 | 3300031239 | Bacteria | 1281 |
| 356 | Ga0265329_10046276 | 3300031242 | Bacteria | 1390 |
| 357 | Ga0265340_10022791 | 3300031247 | Bacteria | 3198 |
| 358 | Ga0265340_10029387 | 3300031247 | Bacteria | 2760 |
| 359 | Ga0265339_10058674 | 3300031249 | Bacteria | 2077 |
| 360 | Ga0265339_10195298 | 3300031249 | Bacteria | 1001 |
| 361 | Ga0265331_10002807 | 3300031250 | Bacteria | 11548 |
| 362 | Ga0265331_10019075 | 3300031250 | Bacteria | 3545 |
| 363 | Ga0307513_10494841 | 3300031456 | Bacteria | 940 |
| 364 | Ga0265313_10000021 | 3300031595 | Bacteria | 144949 |
| 365 | Ga0316575_10106133 | 3300031665 | Bacteria | 1144 |
| 366 | Ga0316579_10153587 | 3300031691 | Bacteria | 1111 |
| 367 | Ga0265314_10000279 | 3300031711 | Bacteria | 74300 |
| 368 | Ga0265314_10025954 | 3300031711 | Bacteria | 4411 |
| 369 | Ga0265314_10058157 | 3300031711 | Bacteria | 2650 |
| 370 | Ga0265342_10009824 | 3300031712 | Bacteria | 6694 |
| 371 | Ga0265342_10065920 | 3300031712 | Bacteria | 2121 |
| 372 | Ga0316576_10083949 | 3300031727 | Bacteria | 2367 |
| 373 | Ga0316578_10038730 | 3300031728 | Bacteria | 2751 |
| 374 | Ga0307405_10555396 | 3300031731 | Bacteria | 930 |
| 375 | Ga0307413_10220122 | 3300031824 | Bacteria | 1386 |
| 376 | Ga0307412_10144788 | 3300031911 | Bacteria | 1745 |
| 377 | Ga0307412_10225018 | 3300031911 | Bacteria | 1441 |
| 378 | Ga0307412_10302574 | 3300031911 | Bacteria | 1265 |
| 379 | Ga0307409_100079291 | 3300031995 | Bacteria | 2646 |
| 380 | Ga0307414_10057088 | 3300032004 | Bacteria | 2742 |
| 381 | Ga0307414_10071542 | 3300032004 | Bacteria | 2502 |
| 382 | Ga0307414_10229974 | 3300032004 | Bacteria | 1528 |
| 383 | Ga0307411_10563347 | 3300032005 | Bacteria | 974 |
| 384 | Ga0307415_100252775 | 3300032126 | Bacteria | 1433 |
| 385 | Ga0316583_10001287 | 3300032133 | Bacteria | 8297 |
| 386 | Ga0316593_10033295 | 3300032168 | Bacteria | 1686 |
| 387 | Ga0307510_10000248 | 3300033180 | Bacteria | 48764 |
| 388 | Ga0316592_1012612 | 3300033524 | Bacteria | 1735 |
| 389 | Ga0316592_1056016 | 3300033524 | Bacteria | 882 |
| 390 | Ga0373930_0035672 | 3300034816 | Bacteria | 1040 |
| 391 | Ga0373958_0024349 | 3300034819 | Bacteria | 1145 |
| 392 | Ga0373959_0045163 | 3300034820 | Bacteria | 936 |
| 393 | Ga0373938_0090185 | 3300034957 | Bacteria | 757 |
| 394 | Ga0373926_0005063 | 3300035083 | Bacteria | 4329 |
| 395 | Ga0373926_0008334 | 3300035083 | Bacteria | 3447 |
| 396 | Ga0373929_0012346 | 3300035085 | Bacteria | 1623 |
| 397 | Ga0373940_0080405 | 3300035088 | Bacteria | 963 |
| 398 | Ga0373944_0002213 | 3300035089 | Bacteria | 4942 |
| 399 | Ga0373923_0041409 | 3300035111 | Bacteria | 1899 |
| 400 | Ga0373923_0050859 | 3300035111 | Bacteria | 1737 |
| 401 | Ga0373923_0085332 | 3300035111 | Bacteria | 1374 |
| 402 | Ga0373932_0151554 | 3300035112 | Bacteria | 796 |
| 403 | Ga0373936_0067593 | 3300035113 | Bacteria | 1469 |
| 404 | Ga0373941_0090086 | 3300035115 | Bacteria | 1051 |
| 405 | Ga0373945_0012237 | 3300035116 | Bacteria | 2846 |
| 406 | Ga0373953_0213947 | 3300035117 | Bacteria | 834 |
| 407 | Ga0373954_0039018 | 3300035118 | Bacteria | 2210 |
| 408 | Ga0373954_0127770 | 3300035118 | Bacteria | 1236 |
| 409 | Ga0373957_0204054 | 3300035120 | Bacteria | 824 |
| 410 | Ga0373943_0000038 | 3300035170 | Bacteria | 44091 |
| 411 | Ga0373943_0006907 | 3300035170 | Bacteria | 5091 |
| 412 | Ga0373943_0084078 | 3300035170 | Bacteria | 1637 |
| 413 | Ga0373946_0003198 | 3300035171 | Bacteria | 5809 |
| 414 | Ga0373955_0045922 | 3300035172 | Bacteria | 2359 |
| 415 | Ga0373955_0173865 | 3300035172 | Bacteria | 1276 |
| 416 | Ga0373942_0052239 | 3300035207 | Bacteria | 1149 |
| 417 | Ga0373961_0028678 | 3300035241 | Bacteria | 1536 |
| 418 | Ga0316574_0473080 | 3300035398 | Bacteria | 783 |
| 419 | Ga0373924_0043034 | 3300035410 | Bacteria | 1854 |
| 420 | Ga0373931_0197657 | 3300035691 | Bacteria | 1199 |
| 421 | Ga0373931_0381779 | 3300035691 | Bacteria | 888 |
| 422 | Ga0373931_0393176 | 3300035691 | Bacteria | 876 |
| 423 | Ga0373935_0274025 | 3300035692 | Bacteria | 1186 |
| 424 | Ga0373935_0297920 | 3300035692 | Bacteria | 1139 |
| 425 | Ga0373927_0000651 | 3300035695 | Bacteria | 26320 |
| 426 | Ga0373927_0025823 | 3300035695 | Bacteria | 3840 |
| 427 | Ga0373927_0230645 | 3300035695 | Bacteria | 1216 |
| 428 | Ga0373927_0263089 | 3300035695 | Bacteria | 1134 |
| 429 | Ga0373933_0024606 | 3300035724 | Bacteria | 3447 |
| 430 | Ga0373947_0000024 | 3300035725 | Bacteria | 87027 |
| 431 | Ga0373947_0013366 | 3300035725 | Bacteria | 4704 |
| 432 | Ga0373947_0091793 | 3300035725 | Bacteria | 1895 |
| 433 | Ga0373947_0094215 | 3300035725 | Bacteria | 1872 |
| 434 | Ga0373947_0131845 | 3300035725 | Bacteria | 1596 |
| 435 | Ga0373937_0005793 | 3300036401 | Bacteria | 10619 |
| 436 | Ga0373937_0020159 | 3300036401 | Bacteria | 5975 |
| 437 | Ga0373937_0580248 | 3300036401 | Bacteria | 1065 |
| 438 | Ga0316582_0018667 | 3300036647 | Bacteria | 4042 |
| 439 | Ga0316584_0007550 | 3300036712 | Bacteria | 7450 |
| 440 | Ga0373925_0018395 | 3300037068 | Bacteria | 5079 |
| 441 | Ga0373925_0153430 | 3300037068 | Bacteria | 1810 |
| 442 | Ga0373925_0491408 | 3300037068 | Bacteria | 1007 |
| 443 | Ga0395899_0000137 | 3300037312 | Bacteria | 111924 |
| 444 | Ga0395899_0125111 | 3300037312 | Bacteria | 1839 |
| 445 | Ga0395900_0000108 | 3300037418 | Bacteria | 147706 |
| 446 | Ga0395900_0018679 | 3300037418 | Bacteria | 7070 |
| 447 | Ga0395900_0032943 | 3300037418 | Bacteria | 5331 |
| 448 | Ga0395900_0034968 | 3300037418 | Bacteria | 5175 |
| 449 | Ga0395900_0043072 | 3300037418 | Bacteria | 4651 |
| 450 | Ga0395900_0045893 | 3300037418 | Bacteria | 4500 |
| 451 | Ga0395900_0170835 | 3300037418 | Bacteria | 2213 |
| 452 | Ga0395898_0000632 | 3300037466 | Bacteria | 64373 |
| 453 | Ga0395898_0024358 | 3300037466 | Bacteria | 6104 |
| 454 | Ga0395898_0044477 | 3300037466 | Bacteria | 4370 |
| 455 | Ga0395898_0053895 | 3300037466 | Bacteria | 3926 |
| 456 | Ga0395905_0000780 | 3300037471 | Bacteria | 41824 |
| 457 | Ga0395905_0096596 | 3300037471 | Bacteria | 2774 |
| 458 | Ga0436364_0013094 | 3300037853 | Bacteria | 1884 |
| 459 | Ga0436364_0195157 | 3300037853 | Bacteria | 17364 |
| 460 | Ga0436364_0526272 | 3300037853 | Bacteria | 3502 |
| 461 | Ga0436364_1108265 | 3300037853 | Bacteria | 5139 |
| 462 | Ga0395901_0000050 | 3300038443 | Bacteria | 171046 |
| 463 | Ga0395901_0000086 | 3300038443 | Bacteria | 125359 |
| 464 | Ga0395901_0026198 | 3300038443 | Bacteria | 5985 |
| 465 | Ga0395901_0051291 | 3300038443 | Bacteria | 4289 |
| 466 | Ga0395901_0244060 | 3300038443 | Bacteria | 1872 |
| 467 | Ga0395901_0390029 | 3300038443 | Bacteria | 1432 |
| 468 | Ga0395901_0485823 | 3300038443 | Bacteria | 1259 |
| 469 | Ga0400483_136809 | 3300039062 | Bacteria | 1317 |
| 470 | Ga0400483_206045 | 3300039062 | Bacteria | 1699 |
| 471 | Ga0436365_1896329 | 3300039437 | Bacteria | 9698 |
| 472 | Ga0436360_0048356 | 3300039438 | Bacteria | 1363 |
| 473 | Ga0436360_1007073 | 3300039438 | Bacteria | 1324 |
| 474 | Ga0436361_0009329 | 3300039447 | Bacteria | 997 |
| 475 | Ga0436361_0194635 | 3300039447 | Bacteria | 1532 |
| 476 | Ga0436361_0231853 | 3300039447 | Bacteria | 1892 |
| 477 | Ga0436361_0770494 | 3300039447 | Bacteria | 1510 |
| 478 | Ga0436363_0211911 | 3300039450 | Bacteria | 50385 |
| 479 | Ga0436363_0576058 | 3300039450 | Bacteria | 3507 |
| 480 | Ga0439448_0027222 | 3300042005 | Bacteria | 1801 |
| 481 | Ga0439448_0160677 | 3300042005 | Bacteria | 782 |
| 482 | Ga0439456_017035 | 3300042013 | Bacteria | 1522 |
| 483 | Ga0453683_0002196 | 3300044673 | Bacteria | 15517 |
| 484 | Ga0466966_0020726 | 3300044684 | Bacteria | 4320 |
| 485 | Ga0466961_0012256 | 3300044693 | Bacteria | 5483 |
| 486 | Ga0466963_0034953 | 3300044694 | Bacteria | 3272 |
| 487 | Ga0466963_0068019 | 3300044694 | Bacteria | 2391 |
| 488 | Ga0453684_0028704 | 3300044712 | Bacteria | 7925 |
| 489 | Ga0453684_0105894 | 3300044712 | Bacteria | 3429 |
| 490 | Ga0453684_0494753 | 3300044712 | Bacteria | 1355 |
| 491 | Ga0453684_0870126 | 3300044712 | Bacteria | 967 |
| 492 | Ga0466971_0017973 | 3300044719 | Bacteria | 3131 |
| 493 | Ga0466970_0009668 | 3300044765 | Bacteria | 4879 |
| 494 | Ga0466957_0055470 | 3300044842 | Bacteria | 2422 |
| 495 | Ga0466960_0134560 | 3300044901 | Bacteria | 1308 |
| 496 | Ga0466959_0008062 | 3300045049 | Bacteria | 7424 |
| 497 | Ga0451576_0001224 | 3300045051 | Bacteria | 45523 |
| 498 | Ga0451576_0004466 | 3300045051 | Bacteria | 18128 |
| 499 | Ga0451576_0012315 | 3300045051 | Bacteria | 9617 |
| 500 | Ga0451576_0156267 | 3300045051 | Bacteria | 2379 |
| 501 | Ga0451576_0186575 | 3300045051 | Bacteria | 2165 |
| 502 | Ga0466958_0002196 | 3300045836 | Bacteria | 9718 |
| 503 | Ga0466967_0032500 | 3300045976 | Bacteria | 4407 |
| 504 | Ga0466967_0438975 | 3300045976 | Bacteria | 1274 |
| 505 | Ga0495592_0008885 | 3300046454 | Bacteria | 7546 |
| 506 | Ga0495603_0022743 | 3300046455 | Bacteria | 3793 |
| 507 | Ga0495603_0098291 | 3300046455 | Bacteria | 1709 |
| 508 | Ga0495629_0001636 | 3300046459 | Bacteria | 17607 |
| 509 | Ga0495629_0015778 | 3300046459 | Bacteria | 5425 |
| 510 | Ga0495629_0412197 | 3300046459 | Bacteria | 917 |
| 511 | Ga0495629_0431396 | 3300046459 | Bacteria | 894 |
| 512 | Ga0495638_0001117 | 3300046460 | Bacteria | 26096 |
| 513 | Ga0495638_0064102 | 3300046460 | Bacteria | 2264 |
| 514 | Ga0495641_0037738 | 3300046461 | Bacteria | 2262 |
| 515 | Ga0495651_0000860 | 3300046462 | Bacteria | 23547 |
| 516 | Ga0495651_0085272 | 3300046462 | Bacteria | 2379 |
| 517 | Ga0495653_0002396 | 3300046463 | Bacteria | 14921 |
| 518 | Ga0495580_0082128 | 3300046472 | Bacteria | 2246 |
| 519 | Ga0495582_0127994 | 3300046473 | Bacteria | 1434 |
| 520 | Ga0495639_0029254 | 3300046475 | Bacteria | 2445 |
| 521 | Ga0495662_0041905 | 3300046476 | Bacteria | 2210 |
| 522 | Ga0495662_0215780 | 3300046476 | Bacteria | 946 |
| 523 | Ga0495664_0014194 | 3300046477 | Bacteria | 4513 |
| 524 | Ga0495664_0231080 | 3300046477 | Bacteria | 1119 |
| 525 | Ga0495584_0054269 | 3300046491 | Bacteria | 2017 |
| 526 | Ga0495584_0182285 | 3300046491 | Bacteria | 1067 |
| 527 | Ga0495585_0011012 | 3300046492 | Bacteria | 5370 |
| 528 | Ga0495594_0005510 | 3300046499 | Bacteria | 6499 |
| 529 | Ga0495607_0004756 | 3300046501 | Bacteria | 9927 |
| 530 | Ga0495608_0002790 | 3300046511 | Bacteria | 12541 |
| 531 | Ga0495608_0093221 | 3300046511 | Bacteria | 1946 |
| 532 | Ga0495620_0122087 | 3300046515 | Bacteria | 1026 |
| 533 | Ga0495628_0016517 | 3300046516 | Bacteria | 6155 |
| 534 | Ga0495628_0322965 | 3300046516 | Bacteria | 1139 |
| 535 | Ga0495628_0341313 | 3300046516 | Bacteria | 1102 |
| 536 | Ga0495628_0690018 | 3300046516 | Bacteria | 722 |
| 537 | Ga0495630_0102927 | 3300046517 | Bacteria | 2161 |
| 538 | Ga0495630_0121908 | 3300046517 | Bacteria | 1978 |
| 539 | Ga0495630_0264974 | 3300046517 | Bacteria | 1313 |
| 540 | Ga0495637_0016075 | 3300046520 | Bacteria | 3503 |
| 541 | Ga0495637_0043659 | 3300046520 | Bacteria | 1912 |
| 542 | Ga0495643_0080976 | 3300046522 | Bacteria | 1689 |
| 543 | Ga0495644_0003154 | 3300046523 | Bacteria | 6519 |
| 544 | Ga0495644_0097544 | 3300046523 | Bacteria | 1111 |
| 545 | Ga0495648_0075932 | 3300046524 | Bacteria | 1931 |
| 546 | Ga0495666_0020658 | 3300046526 | Bacteria | 3261 |
| 547 | Ga0495666_0174480 | 3300046526 | Bacteria | 994 |
| 548 | Ga0495652_0009824 | 3300046529 | Bacteria | 8674 |
| 549 | Ga0495652_0062137 | 3300046529 | Bacteria | 3150 |
| 550 | Ga0495652_0381484 | 3300046529 | Bacteria | 1002 |
| 551 | Ga0495665_0013078 | 3300046531 | Bacteria | 4494 |
| 552 | Ga0495665_0026036 | 3300046531 | Bacteria | 3142 |
| 553 | Ga0495640_0027323 | 3300046533 | Bacteria | 4116 |
| 554 | Ga0495640_0039590 | 3300046533 | Bacteria | 3306 |
| 555 | Ga0495640_0085978 | 3300046533 | Bacteria | 2083 |
| 556 | Ga0495587_0005187 | 3300046536 | Bacteria | 8514 |
| 557 | Ga0495645_0290115 | 3300046543 | Bacteria | 1073 |
| 558 | Ga0495667_0001836 | 3300046559 | Bacteria | 14089 |
| 559 | Ga0495667_0263455 | 3300046559 | Bacteria | 1096 |
| 560 | Ga0495667_0354623 | 3300046559 | Bacteria | 926 |
| 561 | Ga0495656_0005971 | 3300046615 | Bacteria | 4236 |
| 562 | Ga0495634_0016406 | 3300046642 | Bacteria | 5299 |
| 563 | Ga0495625_0070430 | 3300046660 | Bacteria | 2455 |
| 564 | Ga0495625_0200594 | 3300046660 | Bacteria | 1317 |
| 565 | Ga0495635_0008770 | 3300046663 | Bacteria | 7060 |
| 566 | Ga0495635_0241348 | 3300046663 | Bacteria | 1219 |
| 567 | Ga0495635_0388504 | 3300046663 | Bacteria | 928 |
| 568 | Ga0495657_0198990 | 3300046675 | Bacteria | 1222 |
| 569 | Ga0495599_0004247 | 3300046678 | Bacteria | 8464 |
| 570 | Ga0495623_0002702 | 3300046679 | Bacteria | 11722 |
| 571 | Ga0495646_0003305 | 3300046680 | Bacteria | 10032 |
| 572 | Ga0495647_0002950 | 3300046681 | Bacteria | 5395 |
| 573 | Ga0495647_0018044 | 3300046681 | Bacteria | 2505 |
| 574 | Ga0495658_0014556 | 3300046683 | Bacteria | 4023 |
| 575 | Ga0495613_0074116 | 3300046689 | Bacteria | 2479 |
| 576 | Ga0495613_0157226 | 3300046689 | Bacteria | 1619 |
| 577 | Ga0495624_0004781 | 3300046690 | Bacteria | 9849 |
| 578 | Ga0495624_0086224 | 3300046690 | Bacteria | 1939 |
| 579 | Ga0495670_0001709 | 3300046691 | Bacteria | 10800 |
| 580 | Ga0495670_0008540 | 3300046691 | Bacteria | 5043 |
| 581 | Ga0495670_0084260 | 3300046691 | Bacteria | 1622 |
| 582 | Ga0495600_0157468 | 3300046809 | Bacteria | 1469 |
| 583 | Ga0495600_0309258 | 3300046809 | Bacteria | 996 |
| 584 | Ga0495581_0013861 | 3300047315 | Bacteria | 4672 |
| 585 | Ga0495581_0101832 | 3300047315 | Bacteria | 1669 |
| 586 | Ga0495581_0158978 | 3300047315 | Bacteria | 1321 |
| 587 | Ga0495604_0001315 | 3300047317 | Bacteria | 20297 |
| 588 | Ga0495604_0093810 | 3300047317 | Bacteria | 2220 |
| 589 | Ga0495674_0000145 | 3300047319 | Bacteria | 54755 |
| 590 | Ga0495674_0106941 | 3300047319 | Bacteria | 2375 |
| 591 | Ga0495672_0111331 | 3300047320 | Bacteria | 1469 |
| 592 | Ga0495676_0015903 | 3300047321 | Bacteria | 6687 |
| 593 | Ga0495676_0113249 | 3300047321 | Bacteria | 1986 |
| 594 | Ga0495676_0130375 | 3300047321 | Bacteria | 1816 |
| 595 | Ga0495676_0202922 | 3300047321 | Bacteria | 1377 |
| 596 | Ga0495680_0003388 | 3300047322 | Bacteria | 15738 |
| 597 | Ga0495680_0145384 | 3300047322 | Bacteria | 1732 |
| 598 | Ga0495675_0003692 | 3300047444 | Bacteria | 9253 |
| 599 | Ga0495675_0388210 | 3300047444 | Bacteria | 815 |
| 600 | Ga0495677_0019390 | 3300047445 | Bacteria | 2466 |
| 601 | Ga0495684_0000209 | 3300047471 | Bacteria | 45383 |
| 602 | Ga0495684_0022282 | 3300047471 | Bacteria | 4877 |
| 603 | Ga0495684_0114332 | 3300047471 | Bacteria | 2035 |
| 604 | Ga0495684_0218547 | 3300047471 | Bacteria | 1398 |
| 605 | Ga0495602_0010058 | 3300048088 | Bacteria | 9819 |
| 606 | Ga0495602_0357651 | 3300048088 | Bacteria | 1052 |
| 607 | Ga0496100_0039775 | 3300048903 | Bacteria | 2987 |
| 608 | Ga0496100_0049795 | 3300048903 | Bacteria | 2711 |
| 609 | Ga0496100_0117889 | 3300048903 | Bacteria | 1854 |
| 610 | Ga0496100_0373458 | 3300048903 | Bacteria | 1082 |
| 611 | Ga0496100_0451373 | 3300048903 | Bacteria | 986 |
| 612 | Ga0496101_0003779 | 3300048904 | Bacteria | 9459 |
| 613 | Ga0496101_0031548 | 3300048904 | Bacteria | 3726 |
| 614 | Ga0496101_0371114 | 3300048904 | Bacteria | 1125 |
| 615 | Ga0496102_0012833 | 3300048905 | Bacteria | 7252 |
| 616 | Ga0496102_0017546 | 3300048905 | Bacteria | 6269 |
| 617 | Ga0496102_0143856 | 3300048905 | Bacteria | 2237 |
| 618 | Ga0496102_0169470 | 3300048905 | Bacteria | 2055 |
| 619 | Ga0496102_0200919 | 3300048905 | Bacteria | 1879 |
| 620 | Ga0496102_0593267 | 3300048905 | Bacteria | 1031 |
| 621 | Ga0496103_0003334 | 3300048906 | Bacteria | 9820 |
| 622 | Ga0496104_0002148 | 3300048907 | Bacteria | 17117 |
| 623 | Ga0496104_0003136 | 3300048907 | Bacteria | 14255 |
| 624 | Ga0496104_0009810 | 3300048907 | Bacteria | 8535 |
| 625 | Ga0496104_0026954 | 3300048907 | Bacteria | 5313 |
| 626 | Ga0496104_0042587 | 3300048907 | Bacteria | 4262 |
| 627 | Ga0496104_0055314 | 3300048907 | Bacteria | 3752 |
| 628 | Ga0496104_0104710 | 3300048907 | Bacteria | 2711 |
| 629 | Ga0496104_0106466 | 3300048907 | Bacteria | 2687 |
| 630 | Ga0496104_0232421 | 3300048907 | Bacteria | 1756 |
| 631 | Ga0496105_0000882 | 3300048908 | Bacteria | 20534 |
| 632 | Ga0496105_0012680 | 3300048908 | Bacteria | 6676 |
| 633 | Ga0496105_0013528 | 3300048908 | Bacteria | 6482 |
| 634 | Ga0496105_0017190 | 3300048908 | Bacteria | 5793 |
| 635 | Ga0496105_0029423 | 3300048908 | Bacteria | 4496 |
| 636 | Ga0496105_0043061 | 3300048908 | Bacteria | 3723 |
| 637 | Ga0496105_0309730 | 3300048908 | Bacteria | 1268 |
| 638 | Ga0496105_0421979 | 3300048908 | Bacteria | 1056 |
| 639 | Ga0496106_0002149 | 3300048909 | Bacteria | 14729 |
| 640 | Ga0496106_0002837 | 3300048909 | Bacteria | 12860 |
| 641 | Ga0496106_0095642 | 3300048909 | Bacteria | 2298 |
| 642 | Ga0496106_0193717 | 3300048909 | Bacteria | 1616 |
| 643 | Ga0496107_0005939 | 3300048910 | Bacteria | 8367 |
| 644 | Ga0496107_0010755 | 3300048910 | Bacteria | 6364 |
| 645 | Ga0496107_0011930 | 3300048910 | Bacteria | 6068 |
| 646 | Ga0496107_0033374 | 3300048910 | Bacteria | 3682 |
| 647 | Ga0496108_0006835 | 3300048911 | Bacteria | 9230 |
| 648 | Ga0496108_0011301 | 3300048911 | Bacteria | 7254 |
| 649 | Ga0496108_0049348 | 3300048911 | Bacteria | 3520 |
| 650 | Ga0496109_0005176 | 3300048912 | Bacteria | 10887 |
| 651 | Ga0496109_0017543 | 3300048912 | Bacteria | 6275 |
| 652 | Ga0496109_0022885 | 3300048912 | Bacteria | 5538 |
| 653 | Ga0496109_0119498 | 3300048912 | Bacteria | 2454 |
| 654 | Ga0496109_0128459 | 3300048912 | Bacteria | 2364 |
| 655 | Ga0496109_0162856 | 3300048912 | Bacteria | 2090 |
| 656 | Ga0496110_0004030 | 3300048913 | Bacteria | 11329 |
| 657 | Ga0496110_0013474 | 3300048913 | Bacteria | 6761 |
| 658 | Ga0496110_0034708 | 3300048913 | Bacteria | 4371 |
| 659 | Ga0496110_0098102 | 3300048913 | Bacteria | 2625 |
| 660 | Ga0496110_0187090 | 3300048913 | Bacteria | 1880 |
| 661 | Ga0496110_0221215 | 3300048913 | Bacteria | 1722 |
| 662 | Ga0496111_0010614 | 3300048914 | Bacteria | 6188 |
| 663 | Ga0496111_0017179 | 3300048914 | Bacteria | 4998 |
| 664 | Ga0496111_0175123 | 3300048914 | Bacteria | 1595 |
| 665 | Ga0496111_0206854 | 3300048914 | Bacteria | 1458 |
| 666 | Ga0496111_0273777 | 3300048914 | Bacteria | 1252 |
| 667 | Ga0496111_0468431 | 3300048914 | Bacteria | 929 |
| 668 | Ga0496112_0002737 | 3300048915 | Bacteria | 14280 |
| 669 | Ga0496112_0008660 | 3300048915 | Bacteria | 9123 |
| 670 | Ga0496112_0034196 | 3300048915 | Bacteria | 4945 |
| 671 | Ga0496112_0057103 | 3300048915 | Bacteria | 3842 |
| 672 | Ga0496112_0072266 | 3300048915 | Bacteria | 3410 |
| 673 | Ga0496112_0093100 | 3300048915 | Bacteria | 2984 |
| 674 | Ga0496112_0098327 | 3300048915 | Bacteria | 2896 |
| 675 | Ga0496112_0157400 | 3300048915 | Bacteria | 2238 |
| 676 | Ga0496112_0285303 | 3300048915 | Bacteria | 1597 |
| 677 | Ga0496112_0327421 | 3300048915 | Bacteria | 1476 |
| 678 | Ga0496113_0003871 | 3300048916 | Bacteria | 9062 |
| 679 | Ga0496113_0009682 | 3300048916 | Bacteria | 6329 |
| 680 | Ga0496113_0055224 | 3300048916 | Bacteria | 2976 |
| 681 | Ga0496113_0406263 | 3300048916 | Bacteria | 1093 |
| 682 | Ga0496113_0414392 | 3300048916 | Bacteria | 1082 |
| 683 | Ga0496113_0486196 | 3300048916 | Bacteria | 991 |
| 684 | Ga0496114_0245324 | 3300048917 | Bacteria | 1576 |
| 685 | Ga0496114_0299955 | 3300048917 | Bacteria | 1418 |
| 686 | Ga0496115_0001345 | 3300048918 | Bacteria | 17523 |
| 687 | Ga0496115_0065665 | 3300048918 | Bacteria | 2931 |
| 688 | Ga0496115_0198692 | 3300048918 | Bacteria | 1656 |
| 689 | Ga0496115_0212947 | 3300048918 | Bacteria | 1596 |
| 690 | Ga0496115_0434223 | 3300048918 | Bacteria | 1062 |
| 691 | Ga0496117_0037727 | 3300048920 | Bacteria | 3595 |
| 692 | Ga0496118_0078175 | 3300048921 | Bacteria | 2342 |
| 693 | Ga0496125_0205690 | 3300048928 | Bacteria | 1284 |
| 694 | Ga0496126_0001890 | 3300048929 | Bacteria | 30241 |
| 695 | Ga0496126_0517092 | 3300048929 | Bacteria | 952 |
| 696 | Ga0501290_000271 | 3300049513 | Bacteria | 8525 |
| 697 | Ga0501292_000003 | 3300049515 | Bacteria | 161908 |
| 698 | Ga0501294_000455 | 3300049517 | Bacteria | 4826 |
| 699 | Ga0501300_000439 | 3300049523 | Bacteria | 6324 |
| 700 | Ga0501032_0004263 | 3300049569 | Bacteria | 10800 |
| 701 | Ga0501032_0021362 | 3300049569 | Bacteria | 4499 |
| 702 | Ga0501032_0091875 | 3300049569 | Bacteria | 2013 |
| 703 | Ga0501032_0099781 | 3300049569 | Bacteria | 1923 |
| 704 | Ga0501032_0106862 | 3300049569 | Bacteria | 1853 |
| 705 | Ga0501032_0140434 | 3300049569 | Bacteria | 1591 |
| 706 | Ga0501032_0341181 | 3300049569 | Bacteria | 965 |
| 707 | Ga0501032_0493815 | 3300049569 | Bacteria | 782 |
| 708 | Ga0501033_0033047 | 3300049570 | Bacteria | 3884 |
| 709 | Ga0501033_0043744 | 3300049570 | Bacteria | 3334 |
| 710 | Ga0501033_0086125 | 3300049570 | Bacteria | 2300 |
| 711 | Ga0501033_0110581 | 3300049570 | Bacteria | 2000 |
| 712 | Ga0501033_0216789 | 3300049570 | Bacteria | 1363 |
| 713 | Ga0501033_0258270 | 3300049570 | Bacteria | 1233 |
| 714 | Ga0501034_0001899 | 3300049571 | Bacteria | 26478 |
| 715 | Ga0501034_0024465 | 3300049571 | Bacteria | 6144 |
| 716 | Ga0501034_0025674 | 3300049571 | Bacteria | 6000 |
| 717 | Ga0501034_0045159 | 3300049571 | Bacteria | 4453 |
| 718 | Ga0501034_0052705 | 3300049571 | Bacteria | 4098 |
| 719 | Ga0501034_0081133 | 3300049571 | Bacteria | 3246 |
| 720 | Ga0501034_0093965 | 3300049571 | Bacteria | 2995 |
| 721 | Ga0501034_0143844 | 3300049571 | Bacteria | 2363 |
| 722 | Ga0501034_0243790 | 3300049571 | Bacteria | 1742 |
| 723 | Ga0501034_0571233 | 3300049571 | Bacteria | 1038 |
| 724 | Ga0501036_0003218 | 3300049572 | Bacteria | 13028 |
| 725 | Ga0501036_0020141 | 3300049572 | Bacteria | 5601 |
| 726 | Ga0501036_0067993 | 3300049572 | Bacteria | 3014 |
| 727 | Ga0501036_0075584 | 3300049572 | Bacteria | 2848 |
| 728 | Ga0501036_0247731 | 3300049572 | Bacteria | 1493 |
| 729 | Ga0501036_0648907 | 3300049572 | Bacteria | 874 |
| 730 | Ga0501037_0229598 | 3300049573 | Bacteria | 1303 |
| 731 | Ga0501037_0238688 | 3300049573 | Bacteria | 1274 |
| 732 | Ga0501038_0050512 | 3300049574 | Bacteria | 3592 |
| 733 | Ga0501038_0061324 | 3300049574 | Bacteria | 3216 |
| 734 | Ga0501038_0100002 | 3300049574 | Bacteria | 2417 |
| 735 | Ga0501038_0129631 | 3300049574 | Bacteria | 2072 |
| 736 | Ga0501038_0153588 | 3300049574 | Bacteria | 1875 |
| 737 | Ga0501038_0536318 | 3300049574 | Bacteria | 891 |
| 738 | Ga0501038_0566408 | 3300049574 | Bacteria | 862 |
| 739 | Ga0501039_0120913 | 3300049575 | Bacteria | 2052 |
| 740 | Ga0501039_0138114 | 3300049575 | Bacteria | 1914 |
| 741 | Ga0501040_0027148 | 3300049576 | Bacteria | 3853 |
| 742 | Ga0501042_0018714 | 3300049578 | Bacteria | 4800 |
| 743 | Ga0501042_0052098 | 3300049578 | Bacteria | 2919 |
| 744 | Ga0501042_0176734 | 3300049578 | Bacteria | 1540 |
| 745 | Ga0501042_0251988 | 3300049578 | Bacteria | 1274 |
| 746 | Ga0501043_0000380 | 3300049579 | Bacteria | 40427 |
| 747 | Ga0501043_0021924 | 3300049579 | Bacteria | 5009 |
| 748 | Ga0501043_0030658 | 3300049579 | Bacteria | 4227 |
| 749 | Ga0501043_0059130 | 3300049579 | Bacteria | 3007 |
| 750 | Ga0501043_0085612 | 3300049579 | Bacteria | 2476 |
| 751 | Ga0501043_0223860 | 3300049579 | Bacteria | 1455 |
| 752 | Ga0501043_0291908 | 3300049579 | Bacteria | 1248 |
| 753 | Ga0501046_0010856 | 3300049580 | Bacteria | 7807 |
| 754 | Ga0501046_0011538 | 3300049580 | Bacteria | 7555 |
| 755 | Ga0501046_0012127 | 3300049580 | Bacteria | 7348 |
| 756 | Ga0501046_0266618 | 3300049580 | Bacteria | 1257 |
| 757 | Ga0501046_0296737 | 3300049580 | Bacteria | 1181 |
| 758 | Ga0501047_0007528 | 3300049581 | Bacteria | 10253 |
| 759 | Ga0501047_0018522 | 3300049581 | Bacteria | 6677 |
| 760 | Ga0501047_0020095 | 3300049581 | Bacteria | 6413 |
| 761 | Ga0501047_0045295 | 3300049581 | Bacteria | 4253 |
| 762 | Ga0501047_0091556 | 3300049581 | Bacteria | 2919 |
| 763 | Ga0501047_0115158 | 3300049581 | Bacteria | 2570 |
| 764 | Ga0501047_0133669 | 3300049581 | Bacteria | 2361 |
| 765 | Ga0501047_0245573 | 3300049581 | Bacteria | 1639 |
| 766 | Ga0501047_0304642 | 3300049581 | Bacteria | 1435 |
| 767 | Ga0501047_0465015 | 3300049581 | Bacteria | 1093 |
| 768 | Ga0501048_0000424 | 3300049582 | Bacteria | 29683 |
| 769 | Ga0501048_0037378 | 3300049582 | Bacteria | 3486 |
| 770 | Ga0501048_0241404 | 3300049582 | Bacteria | 1282 |
| 771 | Ga0501067_0000224 | 3300049583 | Bacteria | 31442 |
| 772 | Ga0501067_0003270 | 3300049583 | Bacteria | 8920 |
| 773 | Ga0501067_0234834 | 3300049583 | Bacteria | 1020 |
| 774 | Ga0501068_0006315 | 3300049584 | Bacteria | 6528 |
| 775 | Ga0501069_0000251 | 3300049585 | Bacteria | 24244 |
| 776 | Ga0501069_0034265 | 3300049585 | Bacteria | 2796 |
| 777 | Ga0501069_0080190 | 3300049585 | Bacteria | 1838 |
| 778 | Ga0501069_0336743 | 3300049585 | Bacteria | 888 |
| 779 | Ga0501070_0003929 | 3300049586 | Bacteria | 12811 |
| 780 | Ga0501070_0007814 | 3300049586 | Bacteria | 9066 |
| 781 | Ga0501070_0009582 | 3300049586 | Bacteria | 8180 |
| 782 | Ga0501070_0035482 | 3300049586 | Bacteria | 4167 |
| 783 | Ga0501070_0077965 | 3300049586 | Bacteria | 2742 |
| 784 | Ga0501070_0194580 | 3300049586 | Bacteria | 1666 |
| 785 | Ga0501070_0574693 | 3300049586 | Bacteria | 900 |
| 786 | Ga0501071_0024156 | 3300049587 | Bacteria | 4250 |
| 787 | Ga0501071_0087704 | 3300049587 | Bacteria | 2283 |
| 788 | Ga0501071_0281177 | 3300049587 | Bacteria | 1259 |
| 789 | Ga0501072_0379588 | 3300049588 | Bacteria | 1121 |
| 790 | Ga0501073_0005963 | 3300049589 | Bacteria | 9091 |
| 791 | Ga0501073_0011271 | 3300049589 | Bacteria | 6540 |
| 792 | Ga0501073_0035524 | 3300049589 | Bacteria | 3542 |
| 793 | Ga0501073_0049686 | 3300049589 | Bacteria | 2940 |
| 794 | Ga0501073_0111398 | 3300049589 | Bacteria | 1898 |
| 795 | Ga0501073_0161388 | 3300049589 | Bacteria | 1553 |
| 796 | Ga0501073_0194619 | 3300049589 | Bacteria | 1402 |
| 797 | Ga0501073_0363937 | 3300049589 | Bacteria | 999 |
| 798 | Ga0501074_0006850 | 3300049590 | Bacteria | 8232 |
| 799 | Ga0501074_0015486 | 3300049590 | Bacteria | 5543 |
| 800 | Ga0501074_0082702 | 3300049590 | Bacteria | 2302 |
| 801 | Ga0501074_0104132 | 3300049590 | Bacteria | 2031 |
| 802 | Ga0501074_0359330 | 3300049590 | Bacteria | 1033 |
| 803 | Ga0501076_0347310 | 3300049592 | Bacteria | 1218 |
| 804 | Ga0501077_0139924 | 3300049593 | Bacteria | 1535 |
| 805 | Ga0501206_004121 | 3300049653 | Bacteria | 1845 |
| 806 | Ga0501222_000807 | 3300049662 | Bacteria | 4505 |
| 807 | Ga0501223_000796 | 3300049663 | Bacteria | 7476 |
| 808 | Ga0501224_001001 | 3300049664 | Bacteria | 3662 |
| 809 | Ga0501227_001098 | 3300049665 | Bacteria | 6021 |
| 810 | Ga0501252_008839 | 3300049682 | Bacteria | 1165 |
| 811 | Ga0501257_020712 | 3300049686 | Bacteria | 1546 |
| 812 | Ga0501259_000913 | 3300049688 | Bacteria | 4870 |
| 813 | Ga0501261_000066 | 3300049690 | Bacteria | 18533 |
| 814 | Ga0501225_0016325 | 3300049705 | Bacteria | 2064 |
| 815 | Ga0501079_0096855 | 3300049741 | Bacteria | 2287 |
| 816 | Ga0501079_0377315 | 3300049741 | Bacteria | 1112 |
| 817 | Ga0501079_0633420 | 3300049741 | Bacteria | 842 |
| 818 | Ga0501080_0000112 | 3300049742 | Bacteria | 56408 |
| 819 | Ga0501080_0003244 | 3300049742 | Bacteria | 14351 |
| 820 | Ga0501080_0018241 | 3300049742 | Bacteria | 6494 |
| 821 | Ga0501080_0056888 | 3300049742 | Bacteria | 3641 |
| 822 | Ga0501080_0130513 | 3300049742 | Bacteria | 2326 |
| 823 | Ga0501080_0225582 | 3300049742 | Bacteria | 1713 |
| 824 | Ga0501083_0007146 | 3300049744 | Bacteria | 7928 |
| 825 | Ga0501083_0010656 | 3300049744 | Bacteria | 6469 |
| 826 | Ga0501083_0046768 | 3300049744 | Bacteria | 2925 |
| 827 | Ga0501083_0068040 | 3300049744 | Bacteria | 2370 |
| 828 | Ga0501083_0173071 | 3300049744 | Bacteria | 1411 |
| 829 | Ga0501241_051067 | 3300049758 | Bacteria | 817 |
| 830 | Ga0501279_000040 | 3300049775 | Bacteria | 29044 |
| 831 | Ga0501280_000144 | 3300049776 | Bacteria | 18384 |
| 832 | Ga0501281_00385 | 3300049777 | Bacteria | 4428 |
| 833 | Ga0501282_000071 | 3300049778 | Bacteria | 12013 |
| 834 | Ga0501035_0014537 | 3300049822 | Bacteria | 7267 |
| 835 | Ga0501035_0025766 | 3300049822 | Bacteria | 5390 |
| 836 | Ga0501035_0027254 | 3300049822 | Bacteria | 5222 |
| 837 | Ga0501035_0029360 | 3300049822 | Bacteria | 5014 |
| 838 | Ga0501035_0351949 | 3300049822 | Bacteria | 1232 |
| 839 | Ga0501044_0000658 | 3300049823 | Bacteria | 41690 |
| 840 | Ga0501044_0003453 | 3300049823 | Bacteria | 17799 |
| 841 | Ga0501044_0020081 | 3300049823 | Bacteria | 7133 |
| 842 | Ga0501044_0025440 | 3300049823 | Bacteria | 6273 |
| 843 | Ga0501044_0057121 | 3300049823 | Bacteria | 4005 |
| 844 | Ga0501044_0062271 | 3300049823 | Bacteria | 3813 |
| 845 | Ga0501044_0068185 | 3300049823 | Bacteria | 3624 |
| 846 | Ga0501044_0193914 | 3300049823 | Bacteria | 1992 |
| 847 | Ga0501044_0217258 | 3300049823 | Bacteria | 1863 |
| 848 | Ga0501044_0279089 | 3300049823 | Bacteria | 1605 |
| 849 | Ga0501044_0751910 | 3300049823 | Bacteria | 857 |
| 850 | Ga0501045_0056418 | 3300049824 | Bacteria | 2872 |
| 851 | Ga0501045_0093089 | 3300049824 | Bacteria | 2229 |
| 852 | nmdc:mga03683_27069_c1 | 3300050489 | Bacteria | 2267 |
| 853 | nmdc:mga00v17_385813_c1 | 3300050491 | Bacteria | 911 |
| 854 | nmdc:mga0yw44_30437_c1 | 3300050492 | Bacteria | 3128 |
| 855 | nmdc:mga0k408_2287_c1 | 3300050493 | Bacteria | 10222 |
| 856 | nmdc:mga0k408_95314_c1 | 3300050493 | Bacteria | 1751 |
| 857 | nmdc:mga05p37_43907_c1 | 3300050507 | Bacteria | 5499 |
| 858 | nmdc:mga05p37_751430_c1 | 3300050507 | Bacteria | 1075 |
| 859 | nmdc:mga09592_503163_c1 | 3300050508 | Bacteria | 1043 |
| 860 | nmdc:mga06r32_207952_c1 | 3300050510 | Bacteria | 1945 |
| 861 | nmdc:mga06r32_213150_c1 | 3300050510 | Bacteria | 1919 |
| 862 | nmdc:mga08y16_303449_c1 | 3300050511 | Bacteria | 1645 |
| 863 | nmdc:mga08y16_44774_c1 | 3300050511 | Bacteria | 4638 |
| 864 | nmdc:mga08y16_636227_c1 | 3300050511 | Bacteria | 1072 |
| 865 | nmdc:mga0n895_125963_c1 | 3300050512 | Bacteria | 2585 |
| 866 | nmdc:mga0n895_2174_c1 | 3300050512 | Bacteria | 15166 |
| 867 | nmdc:mga0n895_72521_c1 | 3300050512 | Bacteria | 3416 |
| 868 | nmdc:mga0rr50_19771_c1 | 3300050513 | Bacteria | 4555 |
| 869 | nmdc:mga08x19_59086_c1 | 3300050514 | Bacteria | 2482 |
| 870 | nmdc:mga0a205_325893_c1 | 3300050515 | Bacteria | 1406 |
| 871 | nmdc:mga0a205_62019_c1 | 3300050515 | Bacteria | 3612 |
| 872 | Ga0495601_0000947 | 3300053077 | Bacteria | 15805 |
| 873 | Ga0495601_0015896 | 3300053077 | Bacteria | 4554 |
| 874 | Ga0495601_0028555 | 3300053077 | Bacteria | 3456 |
| 875 | Ga0495601_0031852 | 3300053077 | Bacteria | 3279 |
| 876 | Ga0495612_0000797 | 3300053078 | Bacteria | 12820 |
| 877 | Ga0495612_0004285 | 3300053078 | Bacteria | 5921 |
| 878 | Ga0495612_0059162 | 3300053078 | Bacteria | 1584 |
| 879 | Ga0495612_0092251 | 3300053078 | Bacteria | 1284 |
| 880 | Ga0495655_0017666 | 3300053083 | Bacteria | 1557 |
| 881 | Ga0495595_0001078 | 3300053084 | Bacteria | 10554 |
| 882 | Ga0495595_0035101 | 3300053084 | Bacteria | 2271 |
| 883 | Ga0495595_0173151 | 3300053084 | Bacteria | 1069 |
| 884 | Ga0495595_0285484 | 3300053084 | Bacteria | 829 |
| 885 | Ga0495619_0001656 | 3300053085 | Bacteria | 14704 |
| 886 | Ga0495619_0030530 | 3300053085 | Bacteria | 3489 |
| 887 | Ga0500643_019996 | 3300053087 | Bacteria | 2197 |
| 888 | Ga0500647_0131142 | 3300053091 | Bacteria | 1181 |
| 889 | Ga0500555_044219 | 3300053103 | Bacteria | 1233 |
| 890 | Ga0500556_0017319 | 3300053104 | Bacteria | 2256 |
| 891 | Ga0500556_0117629 | 3300053104 | Bacteria | 1035 |
| 892 | Ga0500642_0086461 | 3300053130 | Bacteria | 1445 |
| 893 | Ga0500655_000033 | 3300053133 | Bacteria | 38482 |
| 894 | Ga0500658_0002175 | 3300053134 | Bacteria | 7615 |
| 895 | Ga0500568_0000406 | 3300053139 | Bacteria | 32845 |
| 896 | Ga0500590_013244 | 3300053148 | Bacteria | 4228 |
| 897 | Ga0500604_0000583 | 3300053151 | Bacteria | 10047 |
| 898 | Ga0500616_0000084 | 3300053153 | Bacteria | 195562 |
| 899 | Ga0500616_0000161 | 3300053153 | Bacteria | 111424 |
| 900 | Ga0500616_0000805 | 3300053153 | Bacteria | 35836 |
| 901 | Ga0500616_0011661 | 3300053153 | Bacteria | 5178 |
| 902 | Ga0500616_0231333 | 3300053153 | Bacteria | 800 |
| 903 | Ga0500587_000809 | 3300053739 | Bacteria | 4080 |
| 904 | Ga0501084_0004384 | 3300054114 | Bacteria | 11505 |
| 905 | Ga0501084_0076860 | 3300054114 | Bacteria | 2799 |
| 906 | Ga0501084_0090968 | 3300054114 | Bacteria | 2562 |
| 907 | Ga0501084_0094190 | 3300054114 | Bacteria | 2514 |
| 908 | Ga0501084_0114033 | 3300054114 | Bacteria | 2272 |
| 909 | Ga0501082_0006226 | 3300060353 | Bacteria | 10361 |
| 910 | Ga0501082_0011332 | 3300060353 | Bacteria | 7664 |
| 911 | Ga0501082_0111262 | 3300060353 | Bacteria | 2370 |
| 912 | Ga0501082_0128860 | 3300060353 | Bacteria | 2195 |
| 913 | Ga0501082_0384604 | 3300060353 | Bacteria | 1224 |
| 914 | Ga0501082_0503484 | 3300060353 | Bacteria | 1059 |
| 915 | Ga0530510_0097350 | 3300061734 | Bacteria | 2151 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300034820 | Ga0373959_0045163 | Ga0373959_0045163_348_926 | 178 |
| 2 | 3300053153 | Ga0500616_0011661 | Ga0500616_0011661_431_1126 | 191 |
| 3 | 3300005458 | Ga0070681_10167330 | Ga0070681_101673302 | 192 |
| 4 | 3300006871 | Ga0075434_100074790 | Ga0075434_1000747903 | 192 |
| 5 | 3300046543 | Ga0495645_0290115 | Ga0495645_0290115_15_701 | 194 |
| 6 | 3300039447 | Ga0436361_0009329 | Ga0436361_0009329_61_795 | 195 |
| 7 | 3300046517 | Ga0495630_0121908 | Ga0495630_0121908_1243_1968 | 195 |
| 8 | 3300035695 | Ga0373927_0230645 | Ga0373927_0230645_173_913 | 196 |
| 9 | 3300035725 | Ga0373947_0131845 | Ga0373947_0131845_145_885 | 196 |
| 10 | 3300037068 | Ga0373925_0491408 | Ga0373925_0491408_222_962 | 196 |
| 11 | 3300046459 | Ga0495629_0015778 | Ga0495629_0015778_3354_4094 | 196 |
| 12 | 3300046462 | Ga0495651_0085272 | Ga0495651_0085272_921_1661 | 196 |
| 13 | 3300046477 | Ga0495664_0231080 | Ga0495664_0231080_196_936 | 196 |
| 14 | 3300046511 | Ga0495608_0093221 | Ga0495608_0093221_472_1212 | 196 |
| 15 | 3300046516 | Ga0495628_0341313 | Ga0495628_0341313_220_960 | 196 |
| 16 | 3300046529 | Ga0495652_0062137 | Ga0495652_0062137_786_1526 | 196 |
| 17 | 3300046533 | Ga0495640_0039590 | Ga0495640_0039590_52_792 | 196 |
| 18 | 3300046559 | Ga0495667_0263455 | Ga0495667_0263455_24_764 | 196 |
| 19 | 3300046809 | Ga0495600_0157468 | Ga0495600_0157468_599_1339 | 196 |
| 20 | 3300047317 | Ga0495604_0093810 | Ga0495604_0093810_545_1285 | 196 |
| 21 | 3300047322 | Ga0495680_0145384 | Ga0495680_0145384_21_761 | 196 |
| 22 | 3300047471 | Ga0495684_0218547 | Ga0495684_0218547_200_940 | 196 |
| 23 | 3300048088 | Ga0495602_0357651 | Ga0495602_0357651_10_750 | 196 |
| 24 | 3300053078 | Ga0495612_0092251 | Ga0495612_0092251_246_986 | 196 |
| 25 | 3300053084 | Ga0495595_0035101 | Ga0495595_0035101_550_1290 | 196 |
| 26 | 3300021388 | Ga0213875_10150129 | Ga0213875_101501292 | 197 |
| 27 | 3300037853 | Ga0436364_0526272 | Ga0436364_0526272_776_1507 | 197 |
| 28 | 3300039450 | Ga0436363_0211911 | Ga0436363_0211911_45030_45761 | 197 |
| 29 | 3300050512 | nmdc:mga0n895_72521_c1 | nmdc:mga0n895_72521_c1_2296_3009 | 197 |
| 30 | 3300039062 | Ga0400483_206045 | Ga0400483_206045_1049_1687 | 198 |
| 31 | 3300049571 | Ga0501034_0025674 | Ga0501034_0025674_3115_3801 | 198 |
| 32 | 3300006871 | Ga0075434_100000986 | Ga0075434_1000009864 | 199 |
| 33 | 3300007076 | Ga0075435_100036045 | Ga0075435_1000360453 | 199 |
| 34 | 3300050512 | nmdc:mga0n895_2174_c1 | nmdc:mga0n895_2174_c1_3892_4569 | 199 |
| 35 | 3300050513 | nmdc:mga0rr50_19771_c1 | nmdc:mga0rr50_19771_c1_775_1452 | 199 |
| 36 | 3300054114 | Ga0501084_0090968 | Ga0501084_0090968_1476_2228 | 199 |
| 37 | 3300031090 | Ga0265760_10026725 | Ga0265760_100267253 | 200 |
| 38 | 3300048916 | Ga0496113_0414392 | Ga0496113_0414392_252_932 | 200 |
| 39 | 3300048918 | Ga0496115_0212947 | Ga0496115_0212947_188_928 | 200 |
| 40 | 3300037312 | Ga0395899_0000137 | Ga0395899_0000137_81509_82177 | 201 |
| 41 | 3300037418 | Ga0395900_0000108 | Ga0395900_0000108_91127_91795 | 201 |
| 42 | 3300037466 | Ga0395898_0000632 | Ga0395898_0000632_29748_30416 | 201 |
| 43 | 3300037471 | Ga0395905_0000780 | Ga0395905_0000780_28412_29080 | 201 |
| 44 | 3300038443 | Ga0395901_0000050 | Ga0395901_0000050_111984_112652 | 201 |
| 45 | 3300039447 | Ga0436361_0770494 | Ga0436361_0770494_513_1199 | 201 |
| 46 | 3300005341 | Ga0070691_10016128 | Ga0070691_100161284 | 202 |
| 47 | 3300005441 | Ga0070700_100025794 | Ga0070700_1000257943 | 202 |
| 48 | 3300005444 | Ga0070694_100187145 | Ga0070694_1001871452 | 202 |
| 49 | 3300006175 | Ga0070712_100511112 | Ga0070712_1005111122 | 202 |
| 50 | 3300026075 | Ga0207708_10036299 | Ga0207708_100362992 | 202 |
| 51 | 3300046529 | Ga0495652_0381484 | Ga0495652_0381484_192_911 | 202 |
| 52 | 3300046533 | Ga0495640_0085978 | Ga0495640_0085978_1305_2024 | 202 |
| 53 | 3300047319 | Ga0495674_0106941 | Ga0495674_0106941_265_984 | 202 |
| 54 | 3300049589 | Ga0501073_0363937 | Ga0501073_0363937_189_875 | 202 |
| 55 | 3300053078 | Ga0495612_0059162 | Ga0495612_0059162_837_1556 | 202 |
| 56 | 3300053085 | Ga0495619_0030530 | Ga0495619_0030530_1464_2183 | 202 |
| 57 | 3300046477 | Ga0495664_0014194 | Ga0495664_0014194_2282_3022 | 203 |
| 58 | 3300005445 | Ga0070708_100021449 | Ga0070708_1000214493 | 204 |
| 59 | 3300005468 | Ga0070707_100332576 | Ga0070707_1003325762 | 204 |
| 60 | 3300005471 | Ga0070698_100003881 | Ga0070698_1000038816 | 204 |
| 61 | 3300005518 | Ga0070699_100082691 | Ga0070699_1000826913 | 204 |
| 62 | 3300006847 | Ga0075431_100058054 | Ga0075431_1000580544 | 204 |
| 63 | 3300006852 | Ga0075433_10124576 | Ga0075433_101245762 | 204 |
| 64 | 3300009553 | Ga0105249_10416469 | Ga0105249_104164692 | 204 |
| 65 | 3300025922 | Ga0207646_10214716 | Ga0207646_102147162 | 204 |
| 66 | 3300025933 | Ga0207706_10278816 | Ga0207706_102788162 | 204 |
| 67 | 3300025961 | Ga0207712_10079828 | Ga0207712_100798283 | 204 |
| 68 | 3300035120 | Ga0373957_0204054 | Ga0373957_0204054_52_732 | 204 |
| 69 | 3300049580 | Ga0501046_0266618 | Ga0501046_0266618_277_960 | 204 |
| 70 | 3300050511 | nmdc:mga08y16_303449_c1 | nmdc:mga08y16_303449_c1_387_1070 | 204 |
| 71 | 3300050515 | nmdc:mga0a205_325893_c1 | nmdc:mga0a205_325893_c1_630_1310 | 204 |
| 72 | 3300039447 | Ga0436361_0231853 | Ga0436361_0231853_147_887 | 205 |
| 73 | 3300047315 | Ga0495581_0101832 | Ga0495581_0101832_942_1628 | 205 |
| 74 | 3300005435 | Ga0070714_100432594 | Ga0070714_1004325941 | 206 |
| 75 | 3300013307 | Ga0157372_10276084 | Ga0157372_102760843 | 206 |
| 76 | 3300035111 | Ga0373923_0050859 | Ga0373923_0050859_15_755 | 206 |
| 77 | 3300035117 | Ga0373953_0213947 | Ga0373953_0213947_80_820 | 206 |
| 78 | 3300035118 | Ga0373954_0039018 | Ga0373954_0039018_1295_2035 | 206 |
| 79 | 3300035410 | Ga0373924_0043034 | Ga0373924_0043034_935_1675 | 206 |
| 80 | 3300035724 | Ga0373933_0024606 | Ga0373933_0024606_2299_3039 | 206 |
| 81 | 3300035725 | Ga0373947_0091793 | Ga0373947_0091793_384_1124 | 206 |
| 82 | 3300036401 | Ga0373937_0005793 | Ga0373937_0005793_7388_8128 | 206 |
| 83 | 3300037068 | Ga0373925_0018395 | Ga0373925_0018395_2215_2955 | 206 |
| 84 | 3300038443 | Ga0395901_0390029 | Ga0395901_0390029_611_1360 | 206 |
| 85 | 3300046454 | Ga0495592_0008885 | Ga0495592_0008885_1351_2091 | 206 |
| 86 | 3300046459 | Ga0495629_0001636 | Ga0495629_0001636_5350_6090 | 206 |
| 87 | 3300046462 | Ga0495651_0000860 | Ga0495651_0000860_8170_8910 | 206 |
| 88 | 3300046463 | Ga0495653_0002396 | Ga0495653_0002396_2693_3433 | 206 |
| 89 | 3300046511 | Ga0495608_0002790 | Ga0495608_0002790_9880_10620 | 206 |
| 90 | 3300046516 | Ga0495628_0016517 | Ga0495628_0016517_2087_2827 | 206 |
| 91 | 3300046529 | Ga0495652_0009824 | Ga0495652_0009824_1967_2707 | 206 |
| 92 | 3300046533 | Ga0495640_0027323 | Ga0495640_0027323_3334_4074 | 206 |
| 93 | 3300046536 | Ga0495587_0005187 | Ga0495587_0005187_1726_2466 | 206 |
| 94 | 3300046559 | Ga0495667_0001836 | Ga0495667_0001836_8395_9135 | 206 |
| 95 | 3300046642 | Ga0495634_0016406 | Ga0495634_0016406_814_1554 | 206 |
| 96 | 3300046663 | Ga0495635_0008770 | Ga0495635_0008770_4107_4847 | 206 |
| 97 | 3300046678 | Ga0495599_0004247 | Ga0495599_0004247_2814_3554 | 206 |
| 98 | 3300046679 | Ga0495623_0002702 | Ga0495623_0002702_5035_5775 | 206 |
| 99 | 3300046680 | Ga0495646_0003305 | Ga0495646_0003305_7451_8191 | 206 |
| 100 | 3300047317 | Ga0495604_0001315 | Ga0495604_0001315_18961_19701 | 206 |
| 101 | 3300047319 | Ga0495674_0000145 | Ga0495674_0000145_18697_19437 | 206 |
| 102 | 3300047321 | Ga0495676_0130375 | Ga0495676_0130375_180_920 | 206 |
| 103 | 3300047322 | Ga0495680_0003388 | Ga0495680_0003388_4089_4829 | 206 |
| 104 | 3300047444 | Ga0495675_0003692 | Ga0495675_0003692_6156_6896 | 206 |
| 105 | 3300047471 | Ga0495684_0022282 | Ga0495684_0022282_3885_4625 | 206 |
| 106 | 3300048088 | Ga0495602_0010058 | Ga0495602_0010058_4021_4761 | 206 |
| 107 | 3300053077 | Ga0495601_0000947 | Ga0495601_0000947_8043_8783 | 206 |
| 108 | 3300053078 | Ga0495612_0004285 | Ga0495612_0004285_4728_5468 | 206 |
| 109 | 3300053084 | Ga0495595_0001078 | Ga0495595_0001078_4902_5642 | 206 |
| 110 | 3300025981 | Ga0207640_10591692 | Ga0207640_105916921 | 207 |
| 111 | 3300047320 | Ga0495672_0111331 | Ga0495672_0111331_374_1102 | 207 |
| 112 | 3300005347 | Ga0070668_100397584 | Ga0070668_1003975842 | 209 |
| 113 | 3300005354 | Ga0070675_100061783 | Ga0070675_1000617832 | 209 |
| 114 | 3300005356 | Ga0070674_100016308 | Ga0070674_1000163083 | 209 |
| 115 | 3300053153 | Ga0500616_0000084 | Ga0500616_0000084_167414_168115 | 209 |
| 116 | 3300031239 | Ga0265328_10070937 | Ga0265328_100709372 | 210 |
| 117 | 3300031242 | Ga0265329_10046276 | Ga0265329_100462762 | 210 |
| 118 | 3300031249 | Ga0265339_10058674 | Ga0265339_100586742 | 210 |
| 119 | 3300031250 | Ga0265331_10002807 | Ga0265331_100028078 | 210 |
| 120 | 3300031595 | Ga0265313_10000021 | Ga0265313_1000002127 | 210 |
| 121 | 3300031712 | Ga0265342_10065920 | Ga0265342_100659202 | 210 |
| 122 | 3300035083 | Ga0373926_0005063 | Ga0373926_0005063_145_831 | 210 |
| 123 | 3300035116 | Ga0373945_0012237 | Ga0373945_0012237_683_1369 | 210 |
| 124 | 3300035170 | Ga0373943_0000038 | Ga0373943_0000038_19456_20142 | 210 |
| 125 | 3300035695 | Ga0373927_0000651 | Ga0373927_0000651_14399_15085 | 210 |
| 126 | 3300035725 | Ga0373947_0000024 | Ga0373947_0000024_55816_56502 | 210 |
| 127 | 3300046459 | Ga0495629_0412197 | Ga0495629_0412197_117_803 | 210 |
| 128 | 3300046472 | Ga0495580_0082128 | Ga0495580_0082128_1401_2087 | 210 |
| 129 | 3300046475 | Ga0495639_0029254 | Ga0495639_0029254_129_815 | 210 |
| 130 | 3300046526 | Ga0495666_0174480 | Ga0495666_0174480_229_915 | 210 |
| 131 | 3300046531 | Ga0495665_0013078 | Ga0495665_0013078_3416_4102 | 210 |
| 132 | 3300046683 | Ga0495658_0014556 | Ga0495658_0014556_1807_2493 | 210 |
| 133 | 3300046690 | Ga0495624_0004781 | Ga0495624_0004781_3526_4212 | 210 |
| 134 | 3300047315 | Ga0495581_0013861 | Ga0495581_0013861_1013_1699 | 210 |
| 135 | 3300047315 | Ga0495581_0158978 | Ga0495581_0158978_180_866 | 210 |
| 136 | 3300047321 | Ga0495676_0202922 | Ga0495676_0202922_395_1081 | 210 |
| 137 | 3300047471 | Ga0495684_0000209 | Ga0495684_0000209_12198_12884 | 210 |
| 138 | iso_pu_bacteria | 2643221547 | 2643755515 | 212 |
| 139 | 3300031247 | Ga0265340_10029387 | Ga0265340_100293871 | 213 |
| 140 | 3300045051 | Ga0451576_0001224 | Ga0451576_0001224_40699_41382 | 213 |
| 141 | 3300045051 | Ga0451576_0012315 | Ga0451576_0012315_8600_9283 | 213 |
| 142 | 3300045051 | Ga0451576_0186575 | Ga0451576_0186575_166_849 | 213 |
| 143 | 3300046461 | Ga0495641_0037738 | Ga0495641_0037738_10_705 | 213 |
| 144 | 3300005337 | Ga0070682_100094964 | Ga0070682_1000949642 | 214 |
| 145 | 3300009101 | Ga0105247_10151643 | Ga0105247_101516432 | 214 |
| 146 | 3300013297 | Ga0157378_10382343 | Ga0157378_103823432 | 214 |
| 147 | 3300014968 | Ga0157379_10581161 | Ga0157379_105811612 | 214 |
| 148 | 3300035692 | Ga0373935_0274025 | Ga0373935_0274025_204_920 | 214 |
| 149 | 3300035695 | Ga0373927_0263089 | Ga0373927_0263089_37_753 | 214 |
| 150 | 3300035725 | Ga0373947_0094215 | Ga0373947_0094215_121_837 | 214 |
| 151 | 3300036401 | Ga0373937_0580248 | Ga0373937_0580248_90_770 | 214 |
| 152 | 3300046476 | Ga0495662_0215780 | Ga0495662_0215780_188_904 | 214 |
| 153 | 3300046492 | Ga0495585_0011012 | Ga0495585_0011012_3257_3973 | 214 |
| 154 | 3300046501 | Ga0495607_0004756 | Ga0495607_0004756_2751_3467 | 214 |
| 155 | 3300046517 | Ga0495630_0102927 | Ga0495630_0102927_526_1242 | 214 |
| 156 | 3300046520 | Ga0495637_0016075 | Ga0495637_0016075_114_830 | 214 |
| 157 | 3300046523 | Ga0495644_0003154 | Ga0495644_0003154_950_1666 | 214 |
| 158 | 3300046531 | Ga0495665_0026036 | Ga0495665_0026036_1375_2091 | 214 |
| 159 | 3300046615 | Ga0495656_0005971 | Ga0495656_0005971_2738_3454 | 214 |
| 160 | 3300046663 | Ga0495635_0241348 | Ga0495635_0241348_57_773 | 214 |
| 161 | 3300046681 | Ga0495647_0002950 | Ga0495647_0002950_4653_5369 | 214 |
| 162 | 3300046690 | Ga0495624_0086224 | Ga0495624_0086224_867_1583 | 214 |
| 163 | 3300046691 | Ga0495670_0008540 | Ga0495670_0008540_2774_3490 | 214 |
| 164 | 3300047321 | Ga0495676_0113249 | Ga0495676_0113249_1257_1973 | 214 |
| 165 | 3300047471 | Ga0495684_0114332 | Ga0495684_0114332_1068_1784 | 214 |
| 166 | 3300049569 | Ga0501032_0021362 | Ga0501032_0021362_1469_2128 | 214 |
| 167 | 3300049569 | Ga0501032_0140434 | Ga0501032_0140434_870_1529 | 214 |
| 168 | 3300049570 | Ga0501033_0033047 | Ga0501033_0033047_1531_2190 | 214 |
| 169 | 3300049571 | Ga0501034_0052705 | Ga0501034_0052705_222_881 | 214 |
| 170 | 3300049571 | Ga0501034_0081133 | Ga0501034_0081133_1666_2325 | 214 |
| 171 | 3300049574 | Ga0501038_0061324 | Ga0501038_0061324_2325_2984 | 214 |
| 172 | 3300049574 | Ga0501038_0129631 | Ga0501038_0129631_669_1328 | 214 |
| 173 | 3300049579 | Ga0501043_0291908 | Ga0501043_0291908_549_1208 | 214 |
| 174 | 3300049581 | Ga0501047_0045295 | Ga0501047_0045295_3313_3972 | 214 |
| 175 | 3300049581 | Ga0501047_0304642 | Ga0501047_0304642_262_921 | 214 |
| 176 | 3300049585 | Ga0501069_0080190 | Ga0501069_0080190_838_1497 | 214 |
| 177 | 3300049586 | Ga0501070_0035482 | Ga0501070_0035482_2738_3397 | 214 |
| 178 | 3300049586 | Ga0501070_0077965 | Ga0501070_0077965_1423_2082 | 214 |
| 179 | 3300049586 | Ga0501070_0194580 | Ga0501070_0194580_87_746 | 214 |
| 180 | 3300049589 | Ga0501073_0194619 | Ga0501073_0194619_618_1277 | 214 |
| 181 | 3300049590 | Ga0501074_0082702 | Ga0501074_0082702_1254_1913 | 214 |
| 182 | 3300049741 | Ga0501079_0377315 | Ga0501079_0377315_86_757 | 214 |
| 183 | 3300049742 | Ga0501080_0056888 | Ga0501080_0056888_293_952 | 214 |
| 184 | 3300049823 | Ga0501044_0057121 | Ga0501044_0057121_1435_2094 | 214 |
| 185 | 3300049823 | Ga0501044_0193914 | Ga0501044_0193914_274_933 | 214 |
| 186 | 3300053077 | Ga0495601_0015896 | Ga0495601_0015896_2854_3570 | 214 |
| 187 | 3300053078 | Ga0495612_0000797 | Ga0495612_0000797_1788_2504 | 214 |
| 188 | 3300053085 | Ga0495619_0001656 | Ga0495619_0001656_2858_3574 | 214 |
| 189 | iso_pu_bacteria | 2508501050 | 2508735756 | 214 |
| 190 | iso_pu_bacteria | 2738541317 | 2738946168 | 214 |
| 191 | iso_pu_bacteria | 2775506901 | 2776259030 | 214 |
| 192 | iso_pu_bacteria | 2835312727 | 2835313563 | 214 |
| 193 | iso_pu_bacteria | 2882456835 | 2882461521 | 214 |
| 194 | iso_pu_bacteria | 2884298095 | 2884299721 | 214 |
| 195 | iso_pu_bacteria | 2913308742 | 2913311247 | 214 |
| 196 | 3300004798 | Ga0058859_11244916 | Ga0058859_112449161 | 215 |
| 197 | 3300005340 | Ga0070689_100179282 | Ga0070689_1001792821 | 215 |
| 198 | 3300005347 | Ga0070668_100000539 | Ga0070668_1000005394 | 215 |
| 199 | 3300005366 | Ga0070659_100209567 | Ga0070659_1002095672 | 215 |
| 200 | 3300005367 | Ga0070667_100207098 | Ga0070667_1002070982 | 215 |
| 201 | 3300005844 | Ga0068862_100001001 | Ga0068862_10000100112 | 215 |
| 202 | 3300006178 | Ga0075367_10298417 | Ga0075367_102984172 | 215 |
| 203 | 3300009551 | Ga0105238_10416014 | Ga0105238_104160141 | 215 |
| 204 | 3300010159 | Ga0099796_10010288 | Ga0099796_100102882 | 215 |
| 205 | 3300013105 | Ga0157369_10007581 | Ga0157369_100075813 | 215 |
| 206 | 3300013306 | Ga0163162_10114980 | Ga0163162_101149802 | 215 |
| 207 | 3300021377 | Ga0213874_10062776 | Ga0213874_100627762 | 215 |
| 208 | 3300025912 | Ga0207707_10150528 | Ga0207707_101505282 | 215 |
| 209 | 3300025915 | Ga0207693_10017330 | Ga0207693_100173307 | 215 |
| 210 | 3300025915 | Ga0207693_10078129 | Ga0207693_100781291 | 215 |
| 211 | 3300025928 | Ga0207700_10023911 | Ga0207700_100239115 | 215 |
| 212 | 3300025931 | Ga0207644_10351399 | Ga0207644_103513992 | 215 |
| 213 | 3300025972 | Ga0207668_10007115 | Ga0207668_100071154 | 215 |
| 214 | 3300025986 | Ga0207658_10163505 | Ga0207658_101635052 | 215 |
| 215 | 3300028380 | Ga0268265_10000975 | Ga0268265_100009752 | 215 |
| 216 | 3300031665 | Ga0316575_10106133 | Ga0316575_101061332 | 215 |
| 217 | 3300032133 | Ga0316583_10001287 | Ga0316583_100012878 | 215 |
| 218 | 3300032168 | Ga0316593_10033295 | Ga0316593_100332952 | 215 |
| 219 | 3300033524 | Ga0316592_1012612 | Ga0316592_10126122 | 215 |
| 220 | 3300033524 | Ga0316592_1056016 | Ga0316592_10560161 | 215 |
| 221 | 3300035111 | Ga0373923_0085332 | Ga0373923_0085332_368_1075 | 215 |
| 222 | 3300035113 | Ga0373936_0067593 | Ga0373936_0067593_682_1368 | 215 |
| 223 | 3300037853 | Ga0436364_1108265 | Ga0436364_1108265_1168_1875 | 215 |
| 224 | 3300039062 | Ga0400483_136809 | Ga0400483_136809_289_990 | 215 |
| 225 | 3300039438 | Ga0436360_0048356 | Ga0436360_0048356_44_721 | 215 |
| 226 | 3300039450 | Ga0436363_0576058 | Ga0436363_0576058_620_1297 | 215 |
| 227 | 3300042005 | Ga0439448_0160677 | Ga0439448_0160677_33_707 | 215 |
| 228 | 3300044673 | Ga0453683_0002196 | Ga0453683_0002196_7592_8299 | 215 |
| 229 | 3300044712 | Ga0453684_0028704 | Ga0453684_0028704_1752_2459 | 215 |
| 230 | 3300045051 | Ga0451576_0004466 | Ga0451576_0004466_8711_9418 | 215 |
| 231 | 3300049569 | Ga0501032_0004263 | Ga0501032_0004263_2130_2819 | 215 |
| 232 | 3300049569 | Ga0501032_0091875 | Ga0501032_0091875_898_1572 | 215 |
| 233 | 3300049569 | Ga0501032_0099781 | Ga0501032_0099781_63_737 | 215 |
| 234 | 3300049569 | Ga0501032_0493815 | Ga0501032_0493815_82_756 | 215 |
| 235 | 3300049570 | Ga0501033_0043744 | Ga0501033_0043744_2038_2727 | 215 |
| 236 | 3300049570 | Ga0501033_0216789 | Ga0501033_0216789_198_872 | 215 |
| 237 | 3300049571 | Ga0501034_0001899 | Ga0501034_0001899_21840_22514 | 215 |
| 238 | 3300049571 | Ga0501034_0024465 | Ga0501034_0024465_3185_3859 | 215 |
| 239 | 3300049571 | Ga0501034_0143844 | Ga0501034_0143844_1325_1999 | 215 |
| 240 | 3300049571 | Ga0501034_0243790 | Ga0501034_0243790_611_1285 | 215 |
| 241 | 3300049571 | Ga0501034_0571233 | Ga0501034_0571233_203_892 | 215 |
| 242 | 3300049572 | Ga0501036_0003218 | Ga0501036_0003218_4664_5338 | 215 |
| 243 | 3300049572 | Ga0501036_0020141 | Ga0501036_0020141_2633_3307 | 215 |
| 244 | 3300049572 | Ga0501036_0247731 | Ga0501036_0247731_267_956 | 215 |
| 245 | 3300049574 | Ga0501038_0153588 | Ga0501038_0153588_162_836 | 215 |
| 246 | 3300049575 | Ga0501039_0120913 | Ga0501039_0120913_1211_1885 | 215 |
| 247 | 3300049578 | Ga0501042_0176734 | Ga0501042_0176734_731_1405 | 215 |
| 248 | 3300049578 | Ga0501042_0251988 | Ga0501042_0251988_145_819 | 215 |
| 249 | 3300049579 | Ga0501043_0000380 | Ga0501043_0000380_22196_22870 | 215 |
| 250 | 3300049579 | Ga0501043_0021924 | Ga0501043_0021924_3563_4237 | 215 |
| 251 | 3300049579 | Ga0501043_0030658 | Ga0501043_0030658_2750_3424 | 215 |
| 252 | 3300049579 | Ga0501043_0059130 | Ga0501043_0059130_869_1558 | 215 |
| 253 | 3300049580 | Ga0501046_0010856 | Ga0501046_0010856_3283_3972 | 215 |
| 254 | 3300049580 | Ga0501046_0012127 | Ga0501046_0012127_788_1462 | 215 |
| 255 | 3300049581 | Ga0501047_0018522 | Ga0501047_0018522_4658_5332 | 215 |
| 256 | 3300049581 | Ga0501047_0020095 | Ga0501047_0020095_3446_4120 | 215 |
| 257 | 3300049581 | Ga0501047_0115158 | Ga0501047_0115158_1426_2115 | 215 |
| 258 | 3300049582 | Ga0501048_0000424 | Ga0501048_0000424_24293_24967 | 215 |
| 259 | 3300049582 | Ga0501048_0241404 | Ga0501048_0241404_527_1201 | 215 |
| 260 | 3300049583 | Ga0501067_0234834 | Ga0501067_0234834_84_773 | 215 |
| 261 | 3300049585 | Ga0501069_0000251 | Ga0501069_0000251_15688_16377 | 215 |
| 262 | 3300049586 | Ga0501070_0003929 | Ga0501070_0003929_202_891 | 215 |
| 263 | 3300049586 | Ga0501070_0007814 | Ga0501070_0007814_824_1498 | 215 |
| 264 | 3300049586 | Ga0501070_0009582 | Ga0501070_0009582_6631_7305 | 215 |
| 265 | 3300049587 | Ga0501071_0087704 | Ga0501071_0087704_846_1520 | 215 |
| 266 | 3300049589 | Ga0501073_0005963 | Ga0501073_0005963_6400_7089 | 215 |
| 267 | 3300049589 | Ga0501073_0049686 | Ga0501073_0049686_295_969 | 215 |
| 268 | 3300049590 | Ga0501074_0006850 | Ga0501074_0006850_2994_3668 | 215 |
| 269 | 3300049590 | Ga0501074_0015486 | Ga0501074_0015486_1621_2310 | 215 |
| 270 | 3300049590 | Ga0501074_0359330 | Ga0501074_0359330_283_957 | 215 |
| 271 | 3300049592 | Ga0501076_0347310 | Ga0501076_0347310_284_943 | 215 |
| 272 | 3300049741 | Ga0501079_0633420 | Ga0501079_0633420_99_788 | 215 |
| 273 | 3300049742 | Ga0501080_0000112 | Ga0501080_0000112_23297_23971 | 215 |
| 274 | 3300049742 | Ga0501080_0003244 | Ga0501080_0003244_11251_11940 | 215 |
| 275 | 3300049742 | Ga0501080_0018241 | Ga0501080_0018241_4980_5654 | 215 |
| 276 | 3300049744 | Ga0501083_0007146 | Ga0501083_0007146_2587_3261 | 215 |
| 277 | 3300049744 | Ga0501083_0010656 | Ga0501083_0010656_3994_4683 | 215 |
| 278 | 3300049822 | Ga0501035_0014537 | Ga0501035_0014537_2453_3127 | 215 |
| 279 | 3300049822 | Ga0501035_0029360 | Ga0501035_0029360_3465_4154 | 215 |
| 280 | 3300049823 | Ga0501044_0003453 | Ga0501044_0003453_11015_11689 | 215 |
| 281 | 3300049823 | Ga0501044_0025440 | Ga0501044_0025440_1562_2251 | 215 |
| 282 | 3300049823 | Ga0501044_0062271 | Ga0501044_0062271_2554_3228 | 215 |
| 283 | 3300049823 | Ga0501044_0279089 | Ga0501044_0279089_131_805 | 215 |
| 284 | 3300049823 | Ga0501044_0751910 | Ga0501044_0751910_28_702 | 215 |
| 285 | 3300050510 | nmdc:mga06r32_207952_c1 | nmdc:mga06r32_207952_c1_372_1052 | 215 |
| 286 | 3300053087 | Ga0500643_019996 | Ga0500643_019996_158_835 | 215 |
| 287 | 3300053103 | Ga0500555_044219 | Ga0500555_044219_316_1017 | 215 |
| 288 | 3300054114 | Ga0501084_0114033 | Ga0501084_0114033_1013_1702 | 215 |
| 289 | 3300060353 | Ga0501082_0006226 | Ga0501082_0006226_8110_8799 | 215 |
| 290 | 3300060353 | Ga0501082_0503484 | Ga0501082_0503484_308_982 | 215 |
| 291 | iso_pu_bacteria | 2617270889 | 2617913383 | 215 |
| 292 | iso_pu_bacteria | 2831426010 | 2831428310 | 215 |
| 293 | iso_pu_bacteria | 2848694841 | 2848698472 | 215 |
| 294 | iso_pu_bacteria | 2849660919 | 2849666178 | 215 |
| 295 | iso_pu_bacteria | 2886627955 | 2886633913 | 215 |
| 296 | iso_pu_bacteria | 2913844669 | 2913845598 | 215 |
| 297 | iso_pu_bacteria | 2913912277 | 2913917531 | 215 |
| 298 | iso_pu_bacteria | 2913939268 | 2913941558 | 215 |
| 299 | iso_pu_bacteria | 2919450847 | 2919455263 | 215 |
| 300 | iso_pu_bacteria | 642555144 | 642600782 | 215 |
| 301 | 3300005530 | Ga0070679_100245169 | Ga0070679_1002451692 | 216 |
| 302 | 3300005841 | Ga0068863_100523847 | Ga0068863_1005238472 | 216 |
| 303 | 3300006852 | Ga0075433_10052600 | Ga0075433_100526004 | 216 |
| 304 | 3300009094 | Ga0111539_10335230 | Ga0111539_103352301 | 216 |
| 305 | 3300025915 | Ga0207693_10042503 | Ga0207693_100425034 | 216 |
| 306 | 3300025929 | Ga0207664_10286062 | Ga0207664_102860622 | 216 |
| 307 | 3300031247 | Ga0265340_10022791 | Ga0265340_100227913 | 216 |
| 308 | 3300031249 | Ga0265339_10195298 | Ga0265339_101952981 | 216 |
| 309 | 3300031691 | Ga0316579_10153587 | Ga0316579_101535872 | 216 |
| 310 | 3300031711 | Ga0265314_10000279 | Ga0265314_1000027924 | 216 |
| 311 | 3300031711 | Ga0265314_10025954 | Ga0265314_100259545 | 216 |
| 312 | 3300035398 | Ga0316574_0473080 | Ga0316574_0473080_77_751 | 216 |
| 313 | 3300037312 | Ga0395899_0125111 | Ga0395899_0125111_936_1613 | 216 |
| 314 | 3300037418 | Ga0395900_0018679 | Ga0395900_0018679_4318_4995 | 216 |
| 315 | 3300037466 | Ga0395898_0024358 | Ga0395898_0024358_1557_2234 | 216 |
| 316 | 3300038443 | Ga0395901_0051291 | Ga0395901_0051291_2535_3212 | 216 |
| 317 | 3300046675 | Ga0495657_0198990 | Ga0495657_0198990_495_1193 | 216 |
| 318 | 3300049574 | Ga0501038_0536318 | Ga0501038_0536318_43_720 | 216 |
| 319 | 3300049581 | Ga0501047_0465015 | Ga0501047_0465015_214_891 | 216 |
| 320 | 3300049589 | Ga0501073_0035524 | Ga0501073_0035524_2762_3439 | 216 |
| 321 | 3300049744 | Ga0501083_0068040 | Ga0501083_0068040_1210_1887 | 216 |
| 322 | 3300050511 | nmdc:mga08y16_44774_c1 | nmdc:mga08y16_44774_c1_228_941 | 216 |
| 323 | 3300060353 | Ga0501082_0128860 | Ga0501082_0128860_58_735 | 216 |
| 324 | 3300002067 | JGI24735J21928_10007291 | JGI24735J21928_100072912 | 217 |
| 325 | 3300003792 | Ga0055540_1006853 | Ga0055540_10068535 | 217 |
| 326 | 3300005327 | Ga0070658_10339213 | Ga0070658_103392131 | 217 |
| 327 | 3300005339 | Ga0070660_100000064 | Ga0070660_10000006464 | 217 |
| 328 | 3300005339 | Ga0070660_100276101 | Ga0070660_1002761012 | 217 |
| 329 | 3300005339 | Ga0070660_100412668 | Ga0070660_1004126682 | 217 |
| 330 | 3300005436 | Ga0070713_100368594 | Ga0070713_1003685942 | 217 |
| 331 | 3300005455 | Ga0070663_100050356 | Ga0070663_1000503564 | 217 |
| 332 | 3300005455 | Ga0070663_100645155 | Ga0070663_1006451552 | 217 |
| 333 | 3300005458 | Ga0070681_10024397 | Ga0070681_100243972 | 217 |
| 334 | 3300005458 | Ga0070681_10194105 | Ga0070681_101941052 | 217 |
| 335 | 3300005468 | Ga0070707_100136600 | Ga0070707_1001366002 | 217 |
| 336 | 3300005530 | Ga0070679_100108824 | Ga0070679_1001088242 | 217 |
| 337 | 3300005536 | Ga0070697_100298596 | Ga0070697_1002985962 | 217 |
| 338 | 3300005539 | Ga0068853_100784584 | Ga0068853_1007845841 | 217 |
| 339 | 3300006871 | Ga0075434_100465951 | Ga0075434_1004659512 | 217 |
| 340 | 3300009147 | Ga0114129_11134092 | Ga0114129_111340922 | 217 |
| 341 | 3300013104 | Ga0157370_10028926 | Ga0157370_100289265 | 217 |
| 342 | 3300014325 | Ga0163163_10005537 | Ga0163163_1000553710 | 217 |
| 343 | 3300021361 | Ga0213872_10014988 | Ga0213872_100149882 | 217 |
| 344 | 3300025910 | Ga0207684_10479254 | Ga0207684_104792541 | 217 |
| 345 | 3300035170 | Ga0373943_0084078 | Ga0373943_0084078_700_1383 | 217 |
| 346 | 3300035695 | Ga0373927_0025823 | Ga0373927_0025823_2934_3626 | 217 |
| 347 | 3300039447 | Ga0436361_0194635 | Ga0436361_0194635_744_1424 | 217 |
| 348 | 3300046459 | Ga0495629_0431396 | Ga0495629_0431396_42_734 | 217 |
| 349 | 3300048903 | Ga0496100_0117889 | Ga0496100_0117889_1142_1825 | 217 |
| 350 | 3300048904 | Ga0496101_0371114 | Ga0496101_0371114_294_977 | 217 |
| 351 | 3300048907 | Ga0496104_0003136 | Ga0496104_0003136_11842_12525 | 217 |
| 352 | 3300048908 | Ga0496105_0000882 | Ga0496105_0000882_14096_14779 | 217 |
| 353 | 3300048912 | Ga0496109_0017543 | Ga0496109_0017543_3050_3733 | 217 |
| 354 | 3300048913 | Ga0496110_0004030 | Ga0496110_0004030_5756_6439 | 217 |
| 355 | 3300048914 | Ga0496111_0010614 | Ga0496111_0010614_4704_5387 | 217 |
| 356 | 3300048914 | Ga0496111_0468431 | Ga0496111_0468431_195_875 | 217 |
| 357 | 3300048915 | Ga0496112_0002737 | Ga0496112_0002737_13551_14234 | 217 |
| 358 | 3300048916 | Ga0496113_0003871 | Ga0496113_0003871_2652_3335 | 217 |
| 359 | 3300048917 | Ga0496114_0245324 | Ga0496114_0245324_513_1196 | 217 |
| 360 | 3300048918 | Ga0496115_0001345 | Ga0496115_0001345_7753_8436 | 217 |
| 361 | 3300049581 | Ga0501047_0091556 | Ga0501047_0091556_1166_1831 | 217 |
| 362 | 3300049822 | Ga0501035_0025766 | Ga0501035_0025766_2633_3298 | 217 |
| 363 | 3300050515 | nmdc:mga0a205_62019_c1 | nmdc:mga0a205_62019_c1_709_1389 | 217 |
| 364 | 3300005330 | Ga0070690_100040895 | Ga0070690_1000408952 | 218 |
| 365 | 3300005336 | Ga0070680_100110382 | Ga0070680_1001103822 | 218 |
| 366 | 3300005340 | Ga0070689_100012742 | Ga0070689_1000127426 | 218 |
| 367 | 3300005354 | Ga0070675_100310794 | Ga0070675_1003107942 | 218 |
| 368 | 3300005355 | Ga0070671_100067244 | Ga0070671_1000672441 | 218 |
| 369 | 3300005364 | Ga0070673_100083073 | Ga0070673_1000830732 | 218 |
| 370 | 3300005365 | Ga0070688_100045907 | Ga0070688_1000459073 | 218 |
| 371 | 3300005437 | Ga0070710_10187201 | Ga0070710_101872012 | 218 |
| 372 | 3300005456 | Ga0070678_100049859 | Ga0070678_1000498593 | 218 |
| 373 | 3300005458 | Ga0070681_10013407 | Ga0070681_100134073 | 218 |
| 374 | 3300005458 | Ga0070681_10046789 | Ga0070681_100467893 | 218 |
| 375 | 3300005458 | Ga0070681_10199336 | Ga0070681_101993362 | 218 |
| 376 | 3300005458 | Ga0070681_10506439 | Ga0070681_105064391 | 218 |
| 377 | 3300005530 | Ga0070679_100165670 | Ga0070679_1001656702 | 218 |
| 378 | 3300005563 | Ga0068855_100022850 | Ga0068855_1000228503 | 218 |
| 379 | 3300005563 | Ga0068855_100938848 | Ga0068855_1009388481 | 218 |
| 380 | 3300005616 | Ga0068852_100042768 | Ga0068852_1000427683 | 218 |
| 381 | 3300005616 | Ga0068852_100639984 | Ga0068852_1006399842 | 218 |
| 382 | 3300005617 | Ga0068859_100213616 | Ga0068859_1002136163 | 218 |
| 383 | 3300005937 | Ga0081455_10002509 | Ga0081455_100025094 | 218 |
| 384 | 3300005937 | Ga0081455_10064681 | Ga0081455_100646812 | 218 |
| 385 | 3300005981 | Ga0081538_10068599 | Ga0081538_100685992 | 218 |
| 386 | 3300005983 | Ga0081540_1014204 | Ga0081540_10142042 | 218 |
| 387 | 3300006028 | Ga0070717_10854828 | Ga0070717_108548282 | 218 |
| 388 | 3300006038 | Ga0075365_10015277 | Ga0075365_100152773 | 218 |
| 389 | 3300006175 | Ga0070712_100001034 | Ga0070712_10000103414 | 218 |
| 390 | 3300006178 | Ga0075367_10178454 | Ga0075367_101784542 | 218 |
| 391 | 3300006195 | Ga0075366_10003290 | Ga0075366_100032906 | 218 |
| 392 | 3300006195 | Ga0075366_10019985 | Ga0075366_100199852 | 218 |
| 393 | 3300006358 | Ga0068871_100359928 | Ga0068871_1003599282 | 218 |
| 394 | 3300006844 | Ga0075428_100205281 | Ga0075428_1002052812 | 218 |
| 395 | 3300006844 | Ga0075428_100311554 | Ga0075428_1003115542 | 218 |
| 396 | 3300006847 | Ga0075431_100020447 | Ga0075431_1000204471 | 218 |
| 397 | 3300006880 | Ga0075429_100057848 | Ga0075429_1000578482 | 218 |
| 398 | 3300006914 | Ga0075436_100065280 | Ga0075436_1000652802 | 218 |
| 399 | 3300006931 | Ga0097620_100213618 | Ga0097620_1002136183 | 218 |
| 400 | 3300007076 | Ga0075435_100345783 | Ga0075435_1003457831 | 218 |
| 401 | 3300009093 | Ga0105240_10597732 | Ga0105240_105977322 | 218 |
| 402 | 3300009094 | Ga0111539_10422510 | Ga0111539_104225102 | 218 |
| 403 | 3300009098 | Ga0105245_10133351 | Ga0105245_101333513 | 218 |
| 404 | 3300009101 | Ga0105247_10039951 | Ga0105247_100399512 | 218 |
| 405 | 3300009101 | Ga0105247_10115726 | Ga0105247_101157261 | 218 |
| 406 | 3300009147 | Ga0114129_10054562 | Ga0114129_100545624 | 218 |
| 407 | 3300009148 | Ga0105243_10138496 | Ga0105243_101384962 | 218 |
| 408 | 3300009176 | Ga0105242_10096458 | Ga0105242_100964583 | 218 |
| 409 | 3300009177 | Ga0105248_10056676 | Ga0105248_100566762 | 218 |
| 410 | 3300009545 | Ga0105237_10047573 | Ga0105237_100475732 | 218 |
| 411 | 3300009551 | Ga0105238_10454160 | Ga0105238_104541602 | 218 |
| 412 | 3300009553 | Ga0105249_10385060 | Ga0105249_103850602 | 218 |
| 413 | 3300013105 | Ga0157369_10847637 | Ga0157369_108476371 | 218 |
| 414 | 3300013297 | Ga0157378_10333651 | Ga0157378_103336512 | 218 |
| 415 | 3300013306 | Ga0163162_10206538 | Ga0163162_102065382 | 218 |
| 416 | 3300014326 | Ga0157380_10062201 | Ga0157380_100622011 | 218 |
| 417 | 3300014968 | Ga0157379_10405318 | Ga0157379_104053182 | 218 |
| 418 | 3300014968 | Ga0157379_10455885 | Ga0157379_104558852 | 218 |
| 419 | 3300015265 | Ga0182005_1064129 | Ga0182005_10641291 | 218 |
| 420 | 3300025297 | Ga0209758_1000128 | Ga0209758_1000128174 | 218 |
| 421 | 3300025321 | Ga0207656_10102693 | Ga0207656_101026932 | 218 |
| 422 | 3300025900 | Ga0207710_10029664 | Ga0207710_100296642 | 218 |
| 423 | 3300025901 | Ga0207688_10002303 | Ga0207688_100023034 | 218 |
| 424 | 3300025901 | Ga0207688_10157154 | Ga0207688_101571542 | 218 |
| 425 | 3300025903 | Ga0207680_10201301 | Ga0207680_102013012 | 218 |
| 426 | 3300025904 | Ga0207647_10207689 | Ga0207647_102076892 | 218 |
| 427 | 3300025907 | Ga0207645_10022266 | Ga0207645_100222662 | 218 |
| 428 | 3300025908 | Ga0207643_10027485 | Ga0207643_100274853 | 218 |
| 429 | 3300025908 | Ga0207643_10180488 | Ga0207643_101804882 | 218 |
| 430 | 3300025909 | Ga0207705_10310735 | Ga0207705_103107352 | 218 |
| 431 | 3300025912 | Ga0207707_10016805 | Ga0207707_100168056 | 218 |
| 432 | 3300025912 | Ga0207707_10159254 | Ga0207707_101592542 | 218 |
| 433 | 3300025912 | Ga0207707_10605427 | Ga0207707_106054272 | 218 |
| 434 | 3300025915 | Ga0207693_10009479 | Ga0207693_100094799 | 218 |
| 435 | 3300025915 | Ga0207693_10205671 | Ga0207693_102056712 | 218 |
| 436 | 3300025917 | Ga0207660_10029613 | Ga0207660_100296132 | 218 |
| 437 | 3300025920 | Ga0207649_10100090 | Ga0207649_101000902 | 218 |
| 438 | 3300025921 | Ga0207652_10188151 | Ga0207652_101881512 | 218 |
| 439 | 3300025923 | Ga0207681_10021738 | Ga0207681_100217382 | 218 |
| 440 | 3300025927 | Ga0207687_10051601 | Ga0207687_100516012 | 218 |
| 441 | 3300025929 | Ga0207664_10878560 | Ga0207664_108785601 | 218 |
| 442 | 3300025933 | Ga0207706_10298024 | Ga0207706_102980242 | 218 |
| 443 | 3300025934 | Ga0207686_10076118 | Ga0207686_100761182 | 218 |
| 444 | 3300025934 | Ga0207686_10127490 | Ga0207686_101274902 | 218 |
| 445 | 3300025935 | Ga0207709_10252546 | Ga0207709_102525461 | 218 |
| 446 | 3300025936 | Ga0207670_10006506 | Ga0207670_100065066 | 218 |
| 447 | 3300025936 | Ga0207670_10061467 | Ga0207670_100614672 | 218 |
| 448 | 3300025938 | Ga0207704_10249315 | Ga0207704_102493152 | 218 |
| 449 | 3300025939 | Ga0207665_10370326 | Ga0207665_103703261 | 218 |
| 450 | 3300025940 | Ga0207691_10042109 | Ga0207691_100421091 | 218 |
| 451 | 3300025940 | Ga0207691_10429741 | Ga0207691_104297412 | 218 |
| 452 | 3300025941 | Ga0207711_10020384 | Ga0207711_100203843 | 218 |
| 453 | 3300025942 | Ga0207689_10072495 | Ga0207689_100724952 | 218 |
| 454 | 3300025960 | Ga0207651_10109481 | Ga0207651_101094812 | 218 |
| 455 | 3300026035 | Ga0207703_10136533 | Ga0207703_101365333 | 218 |
| 456 | 3300026041 | Ga0207639_10261723 | Ga0207639_102617232 | 218 |
| 457 | 3300026075 | Ga0207708_10043986 | Ga0207708_100439862 | 218 |
| 458 | 3300026116 | Ga0207674_10445601 | Ga0207674_104456012 | 218 |
| 459 | 3300026118 | Ga0207675_100118534 | Ga0207675_1001185342 | 218 |
| 460 | 3300026121 | Ga0207683_10095843 | Ga0207683_100958432 | 218 |
| 461 | 3300026121 | Ga0207683_10148744 | Ga0207683_101487442 | 218 |
| 462 | 3300028379 | Ga0268266_10942846 | Ga0268266_109428462 | 218 |
| 463 | 3300028381 | Ga0268264_10161279 | Ga0268264_101612793 | 218 |
| 464 | 3300031250 | Ga0265331_10019075 | Ga0265331_100190752 | 218 |
| 465 | 3300031711 | Ga0265314_10058157 | Ga0265314_100581572 | 218 |
| 466 | 3300031712 | Ga0265342_10009824 | Ga0265342_100098246 | 218 |
| 467 | 3300031727 | Ga0316576_10083949 | Ga0316576_100839491 | 218 |
| 468 | 3300031728 | Ga0316578_10038730 | Ga0316578_100387302 | 218 |
| 469 | 3300031911 | Ga0307412_10144788 | Ga0307412_101447882 | 218 |
| 470 | 3300032004 | Ga0307414_10057088 | Ga0307414_100570883 | 218 |
| 471 | 3300032126 | Ga0307415_100252775 | Ga0307415_1002527752 | 218 |
| 472 | 3300034816 | Ga0373930_0035672 | Ga0373930_0035672_188_871 | 218 |
| 473 | 3300034819 | Ga0373958_0024349 | Ga0373958_0024349_41_724 | 218 |
| 474 | 3300034957 | Ga0373938_0090185 | Ga0373938_0090185_59_742 | 218 |
| 475 | 3300035083 | Ga0373926_0008334 | Ga0373926_0008334_651_1337 | 218 |
| 476 | 3300035085 | Ga0373929_0012346 | Ga0373929_0012346_153_836 | 218 |
| 477 | 3300035088 | Ga0373940_0080405 | Ga0373940_0080405_95_778 | 218 |
| 478 | 3300035089 | Ga0373944_0002213 | Ga0373944_0002213_3290_3976 | 218 |
| 479 | 3300035111 | Ga0373923_0041409 | Ga0373923_0041409_1075_1761 | 218 |
| 480 | 3300035112 | Ga0373932_0151554 | Ga0373932_0151554_74_757 | 218 |
| 481 | 3300035115 | Ga0373941_0090086 | Ga0373941_0090086_158_841 | 218 |
| 482 | 3300035118 | Ga0373954_0127770 | Ga0373954_0127770_105_791 | 218 |
| 483 | 3300035170 | Ga0373943_0006907 | Ga0373943_0006907_1383_2069 | 218 |
| 484 | 3300035171 | Ga0373946_0003198 | Ga0373946_0003198_2570_3256 | 218 |
| 485 | 3300035172 | Ga0373955_0045922 | Ga0373955_0045922_761_1447 | 218 |
| 486 | 3300035172 | Ga0373955_0173865 | Ga0373955_0173865_276_962 | 218 |
| 487 | 3300035207 | Ga0373942_0052239 | Ga0373942_0052239_431_1114 | 218 |
| 488 | 3300035241 | Ga0373961_0028678 | Ga0373961_0028678_33_716 | 218 |
| 489 | 3300035691 | Ga0373931_0197657 | Ga0373931_0197657_452_1135 | 218 |
| 490 | 3300035691 | Ga0373931_0381779 | Ga0373931_0381779_166_849 | 218 |
| 491 | 3300035691 | Ga0373931_0393176 | Ga0373931_0393176_130_813 | 218 |
| 492 | 3300035692 | Ga0373935_0297920 | Ga0373935_0297920_30_713 | 218 |
| 493 | 3300035725 | Ga0373947_0013366 | Ga0373947_0013366_2519_3205 | 218 |
| 494 | 3300036401 | Ga0373937_0020159 | Ga0373937_0020159_2831_3517 | 218 |
| 495 | 3300036647 | Ga0316582_0018667 | Ga0316582_0018667_1894_2685 | 218 |
| 496 | 3300036712 | Ga0316584_0007550 | Ga0316584_0007550_914_1705 | 218 |
| 497 | 3300037068 | Ga0373925_0153430 | Ga0373925_0153430_722_1408 | 218 |
| 498 | 3300037471 | Ga0395905_0096596 | Ga0395905_0096596_758_1459 | 218 |
| 499 | 3300037853 | Ga0436364_0013094 | Ga0436364_0013094_516_1202 | 218 |
| 500 | 3300037853 | Ga0436364_0195157 | Ga0436364_0195157_3437_4123 | 218 |
| 501 | 3300038443 | Ga0395901_0485823 | Ga0395901_0485823_362_1063 | 218 |
| 502 | 3300039438 | Ga0436360_1007073 | Ga0436360_1007073_214_900 | 218 |
| 503 | 3300042013 | Ga0439456_017035 | Ga0439456_017035_134_817 | 218 |
| 504 | 3300044712 | Ga0453684_0870126 | Ga0453684_0870126_54_737 | 218 |
| 505 | 3300044901 | Ga0466960_0134560 | Ga0466960_0134560_325_996 | 218 |
| 506 | 3300045976 | Ga0466967_0032500 | Ga0466967_0032500_947_1633 | 218 |
| 507 | 3300046455 | Ga0495603_0022743 | Ga0495603_0022743_2225_2911 | 218 |
| 508 | 3300046455 | Ga0495603_0098291 | Ga0495603_0098291_157_843 | 218 |
| 509 | 3300046460 | Ga0495638_0064102 | Ga0495638_0064102_467_1153 | 218 |
| 510 | 3300046473 | Ga0495582_0127994 | Ga0495582_0127994_545_1243 | 218 |
| 511 | 3300046476 | Ga0495662_0041905 | Ga0495662_0041905_191_877 | 218 |
| 512 | 3300046491 | Ga0495584_0054269 | Ga0495584_0054269_1200_1886 | 218 |
| 513 | 3300046491 | Ga0495584_0182285 | Ga0495584_0182285_262_948 | 218 |
| 514 | 3300046499 | Ga0495594_0005510 | Ga0495594_0005510_3250_3936 | 218 |
| 515 | 3300046515 | Ga0495620_0122087 | Ga0495620_0122087_15_701 | 218 |
| 516 | 3300046516 | Ga0495628_0322965 | Ga0495628_0322965_248_934 | 218 |
| 517 | 3300046516 | Ga0495628_0690018 | Ga0495628_0690018_17_700 | 218 |
| 518 | 3300046517 | Ga0495630_0264974 | Ga0495630_0264974_558_1241 | 218 |
| 519 | 3300046523 | Ga0495644_0097544 | Ga0495644_0097544_254_940 | 218 |
| 520 | 3300046526 | Ga0495666_0020658 | Ga0495666_0020658_2264_2950 | 218 |
| 521 | 3300046559 | Ga0495667_0354623 | Ga0495667_0354623_90_776 | 218 |
| 522 | 3300046663 | Ga0495635_0388504 | Ga0495635_0388504_182_865 | 218 |
| 523 | 3300046681 | Ga0495647_0018044 | Ga0495647_0018044_1201_1887 | 218 |
| 524 | 3300046689 | Ga0495613_0074116 | Ga0495613_0074116_1478_2164 | 218 |
| 525 | 3300046689 | Ga0495613_0157226 | Ga0495613_0157226_92_790 | 218 |
| 526 | 3300046809 | Ga0495600_0309258 | Ga0495600_0309258_245_928 | 218 |
| 527 | 3300047321 | Ga0495676_0015903 | Ga0495676_0015903_3657_4343 | 218 |
| 528 | 3300047444 | Ga0495675_0388210 | Ga0495675_0388210_17_700 | 218 |
| 529 | 3300048903 | Ga0496100_0039775 | Ga0496100_0039775_1239_1925 | 218 |
| 530 | 3300048903 | Ga0496100_0049795 | Ga0496100_0049795_1039_1722 | 218 |
| 531 | 3300048903 | Ga0496100_0373458 | Ga0496100_0373458_252_938 | 218 |
| 532 | 3300048903 | Ga0496100_0451373 | Ga0496100_0451373_160_846 | 218 |
| 533 | 3300048904 | Ga0496101_0003779 | Ga0496101_0003779_3420_4106 | 218 |
| 534 | 3300048905 | Ga0496102_0012833 | Ga0496102_0012833_5902_6588 | 218 |
| 535 | 3300048905 | Ga0496102_0143856 | Ga0496102_0143856_936_1625 | 218 |
| 536 | 3300048905 | Ga0496102_0200919 | Ga0496102_0200919_965_1648 | 218 |
| 537 | 3300048905 | Ga0496102_0593267 | Ga0496102_0593267_327_1013 | 218 |
| 538 | 3300048907 | Ga0496104_0002148 | Ga0496104_0002148_12506_13195 | 218 |
| 539 | 3300048907 | Ga0496104_0009810 | Ga0496104_0009810_152_835 | 218 |
| 540 | 3300048907 | Ga0496104_0026954 | Ga0496104_0026954_2783_3469 | 218 |
| 541 | 3300048907 | Ga0496104_0104710 | Ga0496104_0104710_515_1201 | 218 |
| 542 | 3300048907 | Ga0496104_0106466 | Ga0496104_0106466_179_865 | 218 |
| 543 | 3300048907 | Ga0496104_0232421 | Ga0496104_0232421_769_1455 | 218 |
| 544 | 3300048908 | Ga0496105_0013528 | Ga0496105_0013528_2911_3597 | 218 |
| 545 | 3300048908 | Ga0496105_0017190 | Ga0496105_0017190_4704_5390 | 218 |
| 546 | 3300048908 | Ga0496105_0029423 | Ga0496105_0029423_490_1173 | 218 |
| 547 | 3300048908 | Ga0496105_0421979 | Ga0496105_0421979_182_868 | 218 |
| 548 | 3300048909 | Ga0496106_0002149 | Ga0496106_0002149_250_936 | 218 |
| 549 | 3300048909 | Ga0496106_0095642 | Ga0496106_0095642_1050_1733 | 218 |
| 550 | 3300048909 | Ga0496106_0193717 | Ga0496106_0193717_738_1424 | 218 |
| 551 | 3300048910 | Ga0496107_0005939 | Ga0496107_0005939_6201_6887 | 218 |
| 552 | 3300048910 | Ga0496107_0033374 | Ga0496107_0033374_720_1403 | 218 |
| 553 | 3300048911 | Ga0496108_0006835 | Ga0496108_0006835_4267_4953 | 218 |
| 554 | 3300048911 | Ga0496108_0011301 | Ga0496108_0011301_5853_6536 | 218 |
| 555 | 3300048911 | Ga0496108_0049348 | Ga0496108_0049348_138_824 | 218 |
| 556 | 3300048912 | Ga0496109_0005176 | Ga0496109_0005176_2252_2938 | 218 |
| 557 | 3300048912 | Ga0496109_0022885 | Ga0496109_0022885_3109_3795 | 218 |
| 558 | 3300048912 | Ga0496109_0119498 | Ga0496109_0119498_1027_1710 | 218 |
| 559 | 3300048912 | Ga0496109_0162856 | Ga0496109_0162856_1115_1804 | 218 |
| 560 | 3300048913 | Ga0496110_0013474 | Ga0496110_0013474_2042_2728 | 218 |
| 561 | 3300048913 | Ga0496110_0034708 | Ga0496110_0034708_970_1656 | 218 |
| 562 | 3300048913 | Ga0496110_0098102 | Ga0496110_0098102_828_1511 | 218 |
| 563 | 3300048913 | Ga0496110_0187090 | Ga0496110_0187090_1030_1716 | 218 |
| 564 | 3300048914 | Ga0496111_0017179 | Ga0496111_0017179_2821_3507 | 218 |
| 565 | 3300048914 | Ga0496111_0206854 | Ga0496111_0206854_727_1413 | 218 |
| 566 | 3300048914 | Ga0496111_0273777 | Ga0496111_0273777_247_930 | 218 |
| 567 | 3300048915 | Ga0496112_0008660 | Ga0496112_0008660_6714_7400 | 218 |
| 568 | 3300048915 | Ga0496112_0034196 | Ga0496112_0034196_689_1375 | 218 |
| 569 | 3300048915 | Ga0496112_0057103 | Ga0496112_0057103_2764_3450 | 218 |
| 570 | 3300048915 | Ga0496112_0072266 | Ga0496112_0072266_1475_2161 | 218 |
| 571 | 3300048915 | Ga0496112_0093100 | Ga0496112_0093100_356_1102 | 218 |
| 572 | 3300048915 | Ga0496112_0098327 | Ga0496112_0098327_789_1472 | 218 |
| 573 | 3300048915 | Ga0496112_0157400 | Ga0496112_0157400_38_724 | 218 |
| 574 | 3300048915 | Ga0496112_0285303 | Ga0496112_0285303_307_990 | 218 |
| 575 | 3300048915 | Ga0496112_0327421 | Ga0496112_0327421_662_1345 | 218 |
| 576 | 3300048916 | Ga0496113_0009682 | Ga0496113_0009682_4837_5523 | 218 |
| 577 | 3300048916 | Ga0496113_0055224 | Ga0496113_0055224_1466_2152 | 218 |
| 578 | 3300048916 | Ga0496113_0406263 | Ga0496113_0406263_216_902 | 218 |
| 579 | 3300048916 | Ga0496113_0486196 | Ga0496113_0486196_93_776 | 218 |
| 580 | 3300048917 | Ga0496114_0299955 | Ga0496114_0299955_461_1144 | 218 |
| 581 | 3300048918 | Ga0496115_0065665 | Ga0496115_0065665_896_1582 | 218 |
| 582 | 3300048918 | Ga0496115_0198692 | Ga0496115_0198692_779_1465 | 218 |
| 583 | 3300048918 | Ga0496115_0434223 | Ga0496115_0434223_308_991 | 218 |
| 584 | 3300048929 | Ga0496126_0517092 | Ga0496126_0517092_189_872 | 218 |
| 585 | 3300049569 | Ga0501032_0106862 | Ga0501032_0106862_524_1207 | 218 |
| 586 | 3300049569 | Ga0501032_0341181 | Ga0501032_0341181_40_741 | 218 |
| 587 | 3300049570 | Ga0501033_0086125 | Ga0501033_0086125_100_783 | 218 |
| 588 | 3300049570 | Ga0501033_0110581 | Ga0501033_0110581_854_1540 | 218 |
| 589 | 3300049570 | Ga0501033_0258270 | Ga0501033_0258270_43_744 | 218 |
| 590 | 3300049571 | Ga0501034_0045159 | Ga0501034_0045159_976_1659 | 218 |
| 591 | 3300049571 | Ga0501034_0093965 | Ga0501034_0093965_1144_1845 | 218 |
| 592 | 3300049572 | Ga0501036_0067993 | Ga0501036_0067993_235_918 | 218 |
| 593 | 3300049572 | Ga0501036_0075584 | Ga0501036_0075584_1274_1975 | 218 |
| 594 | 3300049572 | Ga0501036_0648907 | Ga0501036_0648907_83_769 | 218 |
| 595 | 3300049573 | Ga0501037_0229598 | Ga0501037_0229598_184_933 | 218 |
| 596 | 3300049573 | Ga0501037_0238688 | Ga0501037_0238688_493_1194 | 218 |
| 597 | 3300049574 | Ga0501038_0050512 | Ga0501038_0050512_1628_2311 | 218 |
| 598 | 3300049574 | Ga0501038_0100002 | Ga0501038_0100002_1587_2270 | 218 |
| 599 | 3300049574 | Ga0501038_0566408 | Ga0501038_0566408_138_839 | 218 |
| 600 | 3300049575 | Ga0501039_0138114 | Ga0501039_0138114_1034_1717 | 218 |
| 601 | 3300049576 | Ga0501040_0027148 | Ga0501040_0027148_282_983 | 218 |
| 602 | 3300049578 | Ga0501042_0018714 | Ga0501042_0018714_319_1002 | 218 |
| 603 | 3300049578 | Ga0501042_0052098 | Ga0501042_0052098_2082_2783 | 218 |
| 604 | 3300049579 | Ga0501043_0085612 | Ga0501043_0085612_741_1442 | 218 |
| 605 | 3300049579 | Ga0501043_0223860 | Ga0501043_0223860_294_995 | 218 |
| 606 | 3300049580 | Ga0501046_0011538 | Ga0501046_0011538_1712_2395 | 218 |
| 607 | 3300049580 | Ga0501046_0296737 | Ga0501046_0296737_146_832 | 218 |
| 608 | 3300049581 | Ga0501047_0007528 | Ga0501047_0007528_2848_3534 | 218 |
| 609 | 3300049581 | Ga0501047_0133669 | Ga0501047_0133669_275_958 | 218 |
| 610 | 3300049581 | Ga0501047_0245573 | Ga0501047_0245573_449_1150 | 218 |
| 611 | 3300049582 | Ga0501048_0037378 | Ga0501048_0037378_1361_2044 | 218 |
| 612 | 3300049583 | Ga0501067_0000224 | Ga0501067_0000224_23563_24231 | 218 |
| 613 | 3300049583 | Ga0501067_0003270 | Ga0501067_0003270_7111_7812 | 218 |
| 614 | 3300049584 | Ga0501068_0006315 | Ga0501068_0006315_4559_5242 | 218 |
| 615 | 3300049585 | Ga0501069_0034265 | Ga0501069_0034265_128_811 | 218 |
| 616 | 3300049585 | Ga0501069_0336743 | Ga0501069_0336743_131_799 | 218 |
| 617 | 3300049586 | Ga0501070_0574693 | Ga0501070_0574693_158_844 | 218 |
| 618 | 3300049587 | Ga0501071_0024156 | Ga0501071_0024156_2137_2820 | 218 |
| 619 | 3300049587 | Ga0501071_0281177 | Ga0501071_0281177_108_809 | 218 |
| 620 | 3300049588 | Ga0501072_0379588 | Ga0501072_0379588_20_721 | 218 |
| 621 | 3300049589 | Ga0501073_0011271 | Ga0501073_0011271_4220_4903 | 218 |
| 622 | 3300049589 | Ga0501073_0111398 | Ga0501073_0111398_459_1127 | 218 |
| 623 | 3300049589 | Ga0501073_0161388 | Ga0501073_0161388_544_1230 | 218 |
| 624 | 3300049590 | Ga0501074_0104132 | Ga0501074_0104132_1093_1776 | 218 |
| 625 | 3300049593 | Ga0501077_0139924 | Ga0501077_0139924_102_788 | 218 |
| 626 | 3300049682 | Ga0501252_008839 | Ga0501252_008839_457_1128 | 218 |
| 627 | 3300049741 | Ga0501079_0096855 | Ga0501079_0096855_767_1468 | 218 |
| 628 | 3300049742 | Ga0501080_0130513 | Ga0501080_0130513_1333_2001 | 218 |
| 629 | 3300049742 | Ga0501080_0225582 | Ga0501080_0225582_989_1690 | 218 |
| 630 | 3300049744 | Ga0501083_0046768 | Ga0501083_0046768_1187_1888 | 218 |
| 631 | 3300049744 | Ga0501083_0173071 | Ga0501083_0173071_432_1115 | 218 |
| 632 | 3300049758 | Ga0501241_051067 | Ga0501241_051067_36_725 | 218 |
| 633 | 3300049822 | Ga0501035_0027254 | Ga0501035_0027254_1732_2415 | 218 |
| 634 | 3300049822 | Ga0501035_0351949 | Ga0501035_0351949_169_855 | 218 |
| 635 | 3300049823 | Ga0501044_0000658 | Ga0501044_0000658_23075_23758 | 218 |
| 636 | 3300049823 | Ga0501044_0020081 | Ga0501044_0020081_3663_4346 | 218 |
| 637 | 3300049823 | Ga0501044_0068185 | Ga0501044_0068185_2503_3186 | 218 |
| 638 | 3300049823 | Ga0501044_0217258 | Ga0501044_0217258_416_1117 | 218 |
| 639 | 3300049824 | Ga0501045_0056418 | Ga0501045_0056418_868_1569 | 218 |
| 640 | 3300049824 | Ga0501045_0093089 | Ga0501045_0093089_452_1138 | 218 |
| 641 | 3300050489 | nmdc:mga03683_27069_c1 | nmdc:mga03683_27069_c1_16_702 | 218 |
| 642 | 3300050491 | nmdc:mga00v17_385813_c1 | nmdc:mga00v17_385813_c1_113_799 | 218 |
| 643 | 3300050492 | nmdc:mga0yw44_30437_c1 | nmdc:mga0yw44_30437_c1_2263_2949 | 218 |
| 644 | 3300050493 | nmdc:mga0k408_2287_c1 | nmdc:mga0k408_2287_c1_4538_5221 | 218 |
| 645 | 3300050493 | nmdc:mga0k408_95314_c1 | nmdc:mga0k408_95314_c1_53_736 | 218 |
| 646 | 3300050507 | nmdc:mga05p37_43907_c1 | nmdc:mga05p37_43907_c1_1731_2417 | 218 |
| 647 | 3300050507 | nmdc:mga05p37_751430_c1 | nmdc:mga05p37_751430_c1_327_1013 | 218 |
| 648 | 3300050508 | nmdc:mga09592_503163_c1 | nmdc:mga09592_503163_c1_127_813 | 218 |
| 649 | 3300050510 | nmdc:mga06r32_213150_c1 | nmdc:mga06r32_213150_c1_677_1363 | 218 |
| 650 | 3300050511 | nmdc:mga08y16_636227_c1 | nmdc:mga08y16_636227_c1_359_1042 | 218 |
| 651 | 3300050512 | nmdc:mga0n895_125963_c1 | nmdc:mga0n895_125963_c1_611_1327 | 218 |
| 652 | 3300050514 | nmdc:mga08x19_59086_c1 | nmdc:mga08x19_59086_c1_1000_1686 | 218 |
| 653 | 3300053077 | Ga0495601_0028555 | Ga0495601_0028555_945_1631 | 218 |
| 654 | 3300053077 | Ga0495601_0031852 | Ga0495601_0031852_1077_1766 | 218 |
| 655 | 3300053083 | Ga0495655_0017666 | Ga0495655_0017666_152_838 | 218 |
| 656 | 3300053084 | Ga0495595_0173151 | Ga0495595_0173151_218_907 | 218 |
| 657 | 3300053084 | Ga0495595_0285484 | Ga0495595_0285484_87_773 | 218 |
| 658 | 3300053104 | Ga0500556_0017319 | Ga0500556_0017319_1561_2220 | 218 |
| 659 | 3300053104 | Ga0500556_0117629 | Ga0500556_0117629_285_974 | 218 |
| 660 | 3300053130 | Ga0500642_0086461 | Ga0500642_0086461_618_1301 | 218 |
| 661 | 3300053153 | Ga0500616_0000805 | Ga0500616_0000805_24654_25343 | 218 |
| 662 | 3300053153 | Ga0500616_0231333 | Ga0500616_0231333_66_749 | 218 |
| 663 | 3300054114 | Ga0501084_0004384 | Ga0501084_0004384_606_1289 | 218 |
| 664 | 3300054114 | Ga0501084_0076860 | Ga0501084_0076860_1256_1942 | 218 |
| 665 | 3300054114 | Ga0501084_0094190 | Ga0501084_0094190_1804_2472 | 218 |
| 666 | 3300060353 | Ga0501082_0011332 | Ga0501082_0011332_5284_5952 | 218 |
| 667 | 3300060353 | Ga0501082_0111262 | Ga0501082_0111262_706_1407 | 218 |
| 668 | 3300060353 | Ga0501082_0384604 | Ga0501082_0384604_279_962 | 218 |
| 669 | 3300061734 | Ga0530510_0097350 | Ga0530510_0097350_655_1341 | 218 |
| 670 | iso_pu_bacteria | 2894232714 | 2894240136 | 218 |
| 671 | 3300001979 | JGI24740J21852_10018622 | JGI24740J21852_100186222 | 219 |
| 672 | 3300001990 | JGI24737J22298_10033317 | JGI24737J22298_100333172 | 219 |
| 673 | 3300005331 | Ga0070670_100287174 | Ga0070670_1002871742 | 219 |
| 674 | 3300005333 | Ga0070677_10000155 | Ga0070677_1000015520 | 219 |
| 675 | 3300005335 | Ga0070666_10001803 | Ga0070666_100018031 | 219 |
| 676 | 3300005336 | Ga0070680_100001660 | Ga0070680_1000016606 | 219 |
| 677 | 3300005336 | Ga0070680_100168740 | Ga0070680_1001687402 | 219 |
| 678 | 3300005339 | Ga0070660_100047236 | Ga0070660_1000472361 | 219 |
| 679 | 3300005339 | Ga0070660_100109866 | Ga0070660_1001098662 | 219 |
| 680 | 3300005343 | Ga0070687_100071737 | Ga0070687_1000717372 | 219 |
| 681 | 3300005344 | Ga0070661_100004993 | Ga0070661_1000049931 | 219 |
| 682 | 3300005347 | Ga0070668_100036683 | Ga0070668_1000366832 | 219 |
| 683 | 3300005353 | Ga0070669_100000280 | Ga0070669_10000028034 | 219 |
| 684 | 3300005355 | Ga0070671_100000005 | Ga0070671_100000005126 | 219 |
| 685 | 3300005366 | Ga0070659_100017634 | Ga0070659_1000176344 | 219 |
| 686 | 3300005457 | Ga0070662_100251530 | Ga0070662_1002515302 | 219 |
| 687 | 3300005458 | Ga0070681_10272796 | Ga0070681_102727962 | 219 |
| 688 | 3300005535 | Ga0070684_100153420 | Ga0070684_1001534203 | 219 |
| 689 | 3300005548 | Ga0070665_100000148 | Ga0070665_100000148145 | 219 |
| 690 | 3300005548 | Ga0070665_100043313 | Ga0070665_1000433134 | 219 |
| 691 | 3300005548 | Ga0070665_100189335 | Ga0070665_1001893352 | 219 |
| 692 | 3300005563 | Ga0068855_100016827 | Ga0068855_1000168273 | 219 |
| 693 | 3300005564 | Ga0070664_100016307 | Ga0070664_1000163076 | 219 |
| 694 | 3300005578 | Ga0068854_100459371 | Ga0068854_1004593711 | 219 |
| 695 | 3300005578 | Ga0068854_100504303 | Ga0068854_1005043031 | 219 |
| 696 | 3300005616 | Ga0068852_100007430 | Ga0068852_1000074307 | 219 |
| 697 | 3300005616 | Ga0068852_100092276 | Ga0068852_1000922765 | 219 |
| 698 | 3300005617 | Ga0068859_100022381 | Ga0068859_1000223813 | 219 |
| 699 | 3300005841 | Ga0068863_100316090 | Ga0068863_1003160902 | 219 |
| 700 | 3300005842 | Ga0068858_100005339 | Ga0068858_1000053397 | 219 |
| 701 | 3300005843 | Ga0068860_100134992 | Ga0068860_1001349923 | 219 |
| 702 | 3300005985 | Ga0081539_10014301 | Ga0081539_100143014 | 219 |
| 703 | 3300006931 | Ga0097620_100022380 | Ga0097620_1000223806 | 219 |
| 704 | 3300009093 | Ga0105240_10295843 | Ga0105240_102958432 | 219 |
| 705 | 3300010375 | Ga0105239_10034581 | Ga0105239_100345817 | 219 |
| 706 | 3300013100 | Ga0157373_10022779 | Ga0157373_100227791 | 219 |
| 707 | 3300013102 | Ga0157371_10147730 | Ga0157371_101477301 | 219 |
| 708 | 3300013102 | Ga0157371_10269119 | Ga0157371_102691192 | 219 |
| 709 | 3300013104 | Ga0157370_10112520 | Ga0157370_101125204 | 219 |
| 710 | 3300013105 | Ga0157369_10000043 | Ga0157369_10000043134 | 219 |
| 711 | 3300013105 | Ga0157369_10111023 | Ga0157369_101110233 | 219 |
| 712 | 3300013296 | Ga0157374_10023802 | Ga0157374_100238023 | 219 |
| 713 | 3300013306 | Ga0163162_10036563 | Ga0163162_100365636 | 219 |
| 714 | 3300013308 | Ga0157375_11173984 | Ga0157375_111739841 | 219 |
| 715 | 3300025315 | Ga0207697_10013327 | Ga0207697_100133273 | 219 |
| 716 | 3300025315 | Ga0207697_10055657 | Ga0207697_100556572 | 219 |
| 717 | 3300025893 | Ga0207682_10000147 | Ga0207682_1000014728 | 219 |
| 718 | 3300025903 | Ga0207680_10024594 | Ga0207680_100245944 | 219 |
| 719 | 3300025904 | Ga0207647_10055215 | Ga0207647_100552152 | 219 |
| 720 | 3300025909 | Ga0207705_10000033 | Ga0207705_10000033201 | 219 |
| 721 | 3300025909 | Ga0207705_10180163 | Ga0207705_101801632 | 219 |
| 722 | 3300025917 | Ga0207660_10002059 | Ga0207660_100020595 | 219 |
| 723 | 3300025917 | Ga0207660_10245440 | Ga0207660_102454402 | 219 |
| 724 | 3300025919 | Ga0207657_10168929 | Ga0207657_101689293 | 219 |
| 725 | 3300025920 | Ga0207649_10000444 | Ga0207649_1000044423 | 219 |
| 726 | 3300025923 | Ga0207681_10000096 | Ga0207681_1000009638 | 219 |
| 727 | 3300025923 | Ga0207681_10323687 | Ga0207681_103236872 | 219 |
| 728 | 3300025924 | Ga0207694_10198752 | Ga0207694_101987522 | 219 |
| 729 | 3300025927 | Ga0207687_10019713 | Ga0207687_100197133 | 219 |
| 730 | 3300025931 | Ga0207644_10000008 | Ga0207644_10000008199 | 219 |
| 731 | 3300025931 | Ga0207644_10014179 | Ga0207644_100141796 | 219 |
| 732 | 3300025932 | Ga0207690_10011704 | Ga0207690_100117042 | 219 |
| 733 | 3300025933 | Ga0207706_10109808 | Ga0207706_101098082 | 219 |
| 734 | 3300025941 | Ga0207711_10165981 | Ga0207711_101659813 | 219 |
| 735 | 3300025944 | Ga0207661_10174628 | Ga0207661_101746283 | 219 |
| 736 | 3300025944 | Ga0207661_10349253 | Ga0207661_103492532 | 219 |
| 737 | 3300025945 | Ga0207679_10029237 | Ga0207679_100292374 | 219 |
| 738 | 3300025949 | Ga0207667_10007324 | Ga0207667_100073247 | 219 |
| 739 | 3300025949 | Ga0207667_10012362 | Ga0207667_1001236210 | 219 |
| 740 | 3300025949 | Ga0207667_10022285 | Ga0207667_100222853 | 219 |
| 741 | 3300025949 | Ga0207667_10042471 | Ga0207667_100424712 | 219 |
| 742 | 3300025972 | Ga0207668_10096978 | Ga0207668_100969782 | 219 |
| 743 | 3300025981 | Ga0207640_10215809 | Ga0207640_102158092 | 219 |
| 744 | 3300025986 | Ga0207658_10102311 | Ga0207658_101023112 | 219 |
| 745 | 3300026035 | Ga0207703_10013788 | Ga0207703_100137882 | 219 |
| 746 | 3300026041 | Ga0207639_10616822 | Ga0207639_106168222 | 219 |
| 747 | 3300026067 | Ga0207678_10320833 | Ga0207678_103208332 | 219 |
| 748 | 3300026078 | Ga0207702_10307501 | Ga0207702_103075012 | 219 |
| 749 | 3300026116 | Ga0207674_10030099 | Ga0207674_100300994 | 219 |
| 750 | 3300026116 | Ga0207674_10039328 | Ga0207674_100393282 | 219 |
| 751 | 3300026142 | Ga0207698_10001849 | Ga0207698_1000184910 | 219 |
| 752 | 3300026142 | Ga0207698_10013844 | Ga0207698_100138445 | 219 |
| 753 | 3300028379 | Ga0268266_10000626 | Ga0268266_100006269 | 219 |
| 754 | 3300028379 | Ga0268266_10108335 | Ga0268266_101083352 | 219 |
| 755 | 3300028379 | Ga0268266_10137786 | Ga0268266_101377863 | 219 |
| 756 | 3300031731 | Ga0307405_10555396 | Ga0307405_105553962 | 219 |
| 757 | 3300031824 | Ga0307413_10220122 | Ga0307413_102201222 | 219 |
| 758 | 3300031911 | Ga0307412_10225018 | Ga0307412_102250182 | 219 |
| 759 | 3300031911 | Ga0307412_10302574 | Ga0307412_103025742 | 219 |
| 760 | 3300031995 | Ga0307409_100079291 | Ga0307409_1000792912 | 219 |
| 761 | 3300032004 | Ga0307414_10071542 | Ga0307414_100715423 | 219 |
| 762 | 3300032004 | Ga0307414_10229974 | Ga0307414_102299742 | 219 |
| 763 | 3300032005 | Ga0307411_10563347 | Ga0307411_105633472 | 219 |
| 764 | 3300037418 | Ga0395900_0032943 | Ga0395900_0032943_4616_5278 | 219 |
| 765 | 3300037418 | Ga0395900_0034968 | Ga0395900_0034968_4316_4978 | 219 |
| 766 | 3300037418 | Ga0395900_0043072 | Ga0395900_0043072_1189_1851 | 219 |
| 767 | 3300037418 | Ga0395900_0045893 | Ga0395900_0045893_1562_2224 | 219 |
| 768 | 3300037418 | Ga0395900_0170835 | Ga0395900_0170835_922_1584 | 219 |
| 769 | 3300037466 | Ga0395898_0044477 | Ga0395898_0044477_58_720 | 219 |
| 770 | 3300037466 | Ga0395898_0053895 | Ga0395898_0053895_1185_1847 | 219 |
| 771 | 3300038443 | Ga0395901_0000086 | Ga0395901_0000086_83914_84576 | 219 |
| 772 | 3300038443 | Ga0395901_0026198 | Ga0395901_0026198_888_1550 | 219 |
| 773 | 3300038443 | Ga0395901_0244060 | Ga0395901_0244060_321_983 | 219 |
| 774 | 3300039437 | Ga0436365_1896329 | Ga0436365_1896329_6376_7035 | 219 |
| 775 | 3300042005 | Ga0439448_0027222 | Ga0439448_0027222_500_1162 | 219 |
| 776 | 3300044684 | Ga0466966_0020726 | Ga0466966_0020726_2023_2685 | 219 |
| 777 | 3300044693 | Ga0466961_0012256 | Ga0466961_0012256_1635_2297 | 219 |
| 778 | 3300044694 | Ga0466963_0034953 | Ga0466963_0034953_1347_2009 | 219 |
| 779 | 3300044694 | Ga0466963_0068019 | Ga0466963_0068019_1695_2354 | 219 |
| 780 | 3300044712 | Ga0453684_0105894 | Ga0453684_0105894_1036_1698 | 219 |
| 781 | 3300044712 | Ga0453684_0494753 | Ga0453684_0494753_195_857 | 219 |
| 782 | 3300044719 | Ga0466971_0017973 | Ga0466971_0017973_770_1432 | 219 |
| 783 | 3300044765 | Ga0466970_0009668 | Ga0466970_0009668_3629_4291 | 219 |
| 784 | 3300044842 | Ga0466957_0055470 | Ga0466957_0055470_1221_1880 | 219 |
| 785 | 3300045049 | Ga0466959_0008062 | Ga0466959_0008062_2023_2685 | 219 |
| 786 | 3300045051 | Ga0451576_0156267 | Ga0451576_0156267_514_1176 | 219 |
| 787 | 3300045836 | Ga0466958_0002196 | Ga0466958_0002196_6179_6841 | 219 |
| 788 | 3300045976 | Ga0466967_0438975 | Ga0466967_0438975_550_1209 | 219 |
| 789 | 3300046660 | Ga0495625_0200594 | Ga0495625_0200594_466_1125 | 219 |
| 790 | 3300046691 | Ga0495670_0001709 | Ga0495670_0001709_3396_4055 | 219 |
| 791 | 3300048904 | Ga0496101_0031548 | Ga0496101_0031548_1566_2252 | 219 |
| 792 | 3300048905 | Ga0496102_0169470 | Ga0496102_0169470_426_1112 | 219 |
| 793 | 3300048907 | Ga0496104_0055314 | Ga0496104_0055314_2318_3004 | 219 |
| 794 | 3300048908 | Ga0496105_0043061 | Ga0496105_0043061_85_771 | 219 |
| 795 | 3300048908 | Ga0496105_0309730 | Ga0496105_0309730_419_1081 | 219 |
| 796 | 3300048909 | Ga0496106_0002837 | Ga0496106_0002837_11612_12298 | 219 |
| 797 | 3300048910 | Ga0496107_0011930 | Ga0496107_0011930_673_1359 | 219 |
| 798 | 3300048929 | Ga0496126_0001890 | Ga0496126_0001890_20228_20893 | 219 |
| 799 | 3300053139 | Ga0500568_0000406 | Ga0500568_0000406_22332_22991 | 219 |
| 800 | 3300053151 | Ga0500604_0000583 | Ga0500604_0000583_7430_8089 | 219 |
| 801 | 3300053153 | Ga0500616_0000161 | Ga0500616_0000161_7265_7924 | 219 |
| 802 | 3300053739 | Ga0500587_000809 | Ga0500587_000809_200_859 | 219 |
| 803 | 3300001976 | JGI24752J21851_1000198 | JGI24752J21851_10001982 | 220 |
| 804 | 3300001979 | JGI24740J21852_10005460 | JGI24740J21852_100054603 | 220 |
| 805 | 3300001989 | JGI24739J22299_10006428 | JGI24739J22299_100064283 | 220 |
| 806 | 3300002067 | JGI24735J21928_10005974 | JGI24735J21928_100059742 | 220 |
| 807 | 3300002070 | JGI24750J21931_1002769 | JGI24750J21931_10027692 | 220 |
| 808 | 3300002074 | JGI24748J21848_1000042 | JGI24748J21848_100004244 | 220 |
| 809 | 3300002076 | JGI24749J21850_1020066 | JGI24749J21850_10200662 | 220 |
| 810 | 3300002239 | JGI24034J26672_10000035 | JGI24034J26672_1000003543 | 220 |
| 811 | 3300002244 | JGI24742J22300_10031650 | JGI24742J22300_100316502 | 220 |
| 812 | 3300005330 | Ga0070690_100000009 | Ga0070690_10000000995 | 220 |
| 813 | 3300005335 | Ga0070666_10000006 | Ga0070666_10000006136 | 220 |
| 814 | 3300005339 | Ga0070660_100307567 | Ga0070660_1003075671 | 220 |
| 815 | 3300005343 | Ga0070687_100225626 | Ga0070687_1002256261 | 220 |
| 816 | 3300005347 | Ga0070668_100083683 | Ga0070668_1000836832 | 220 |
| 817 | 3300005353 | Ga0070669_100000095 | Ga0070669_10000009569 | 220 |
| 818 | 3300005355 | Ga0070671_100186306 | Ga0070671_1001863061 | 220 |
| 819 | 3300005365 | Ga0070688_100004996 | Ga0070688_1000049962 | 220 |
| 820 | 3300005366 | Ga0070659_100132082 | Ga0070659_1001320822 | 220 |
| 821 | 3300005367 | Ga0070667_100021629 | Ga0070667_1000216294 | 220 |
| 822 | 3300005466 | Ga0070685_10000155 | Ga0070685_1000015521 | 220 |
| 823 | 3300005544 | Ga0070686_100000091 | Ga0070686_10000009169 | 220 |
| 824 | 3300005548 | Ga0070665_100000019 | Ga0070665_100000019248 | 220 |
| 825 | 3300005564 | Ga0070664_100486215 | Ga0070664_1004862152 | 220 |
| 826 | 3300005614 | Ga0068856_100490559 | Ga0068856_1004905592 | 220 |
| 827 | 3300005719 | Ga0068861_100012358 | Ga0068861_1000123587 | 220 |
| 828 | 3300005834 | Ga0068851_10077419 | Ga0068851_100774192 | 220 |
| 829 | 3300005841 | Ga0068863_100000118 | Ga0068863_10000011894 | 220 |
| 830 | 3300005841 | Ga0068863_100014260 | Ga0068863_1000142603 | 220 |
| 831 | 3300005842 | Ga0068858_100000723 | Ga0068858_10000072315 | 220 |
| 832 | 3300005842 | Ga0068858_100002727 | Ga0068858_1000027272 | 220 |
| 833 | 3300005843 | Ga0068860_100000014 | Ga0068860_100000014135 | 220 |
| 834 | 3300005843 | Ga0068860_100001093 | Ga0068860_1000010937 | 220 |
| 835 | 3300005844 | Ga0068862_100000014 | Ga0068862_100000014169 | 220 |
| 836 | 3300005844 | Ga0068862_100000503 | Ga0068862_10000050315 | 220 |
| 837 | 3300009093 | Ga0105240_10678746 | Ga0105240_106787462 | 220 |
| 838 | 3300009101 | Ga0105247_10000830 | Ga0105247_100008308 | 220 |
| 839 | 3300009101 | Ga0105247_10093791 | Ga0105247_100937912 | 220 |
| 840 | 3300009177 | Ga0105248_10028861 | Ga0105248_100288613 | 220 |
| 841 | 3300009545 | Ga0105237_10078994 | Ga0105237_100789942 | 220 |
| 842 | 3300009553 | Ga0105249_10000002 | Ga0105249_10000002228 | 220 |
| 843 | 3300009553 | Ga0105249_10000035 | Ga0105249_10000035197 | 220 |
| 844 | 3300013100 | Ga0157373_10105027 | Ga0157373_101050272 | 220 |
| 845 | 3300013104 | Ga0157370_10014955 | Ga0157370_100149555 | 220 |
| 846 | 3300013105 | Ga0157369_10094209 | Ga0157369_100942092 | 220 |
| 847 | 3300013306 | Ga0163162_10014044 | Ga0163162_100140448 | 220 |
| 848 | 3300013306 | Ga0163162_10154001 | Ga0163162_101540013 | 220 |
| 849 | 3300014325 | Ga0163163_10019657 | Ga0163163_100196576 | 220 |
| 850 | 3300014326 | Ga0157380_10004798 | Ga0157380_100047983 | 220 |
| 851 | 3300014968 | Ga0157379_10008890 | Ga0157379_100088902 | 220 |
| 852 | 3300017792 | Ga0163161_10000102 | Ga0163161_1000010281 | 220 |
| 853 | 3300025315 | Ga0207697_10009619 | Ga0207697_100096194 | 220 |
| 854 | 3300025321 | Ga0207656_10078538 | Ga0207656_100785382 | 220 |
| 855 | 3300025900 | Ga0207710_10022092 | Ga0207710_100220922 | 220 |
| 856 | 3300025900 | Ga0207710_10092185 | Ga0207710_100921852 | 220 |
| 857 | 3300025900 | Ga0207710_10122998 | Ga0207710_101229982 | 220 |
| 858 | 3300025903 | Ga0207680_10000011 | Ga0207680_10000011134 | 220 |
| 859 | 3300025904 | Ga0207647_10008450 | Ga0207647_100084504 | 220 |
| 860 | 3300025911 | Ga0207654_10000285 | Ga0207654_1000028525 | 220 |
| 861 | 3300025913 | Ga0207695_10002074 | Ga0207695_1000207425 | 220 |
| 862 | 3300025914 | Ga0207671_10012192 | Ga0207671_100121924 | 220 |
| 863 | 3300025918 | Ga0207662_10221508 | Ga0207662_102215082 | 220 |
| 864 | 3300025919 | Ga0207657_10091569 | Ga0207657_100915692 | 220 |
| 865 | 3300025920 | Ga0207649_10074284 | Ga0207649_100742842 | 220 |
| 866 | 3300025923 | Ga0207681_10000112 | Ga0207681_1000011215 | 220 |
| 867 | 3300025924 | Ga0207694_10004187 | Ga0207694_100041874 | 220 |
| 868 | 3300025931 | Ga0207644_10009210 | Ga0207644_100092106 | 220 |
| 869 | 3300025933 | Ga0207706_10123536 | Ga0207706_101235362 | 220 |
| 870 | 3300025941 | Ga0207711_10056159 | Ga0207711_100561593 | 220 |
| 871 | 3300025945 | Ga0207679_10191126 | Ga0207679_101911262 | 220 |
| 872 | 3300025949 | Ga0207667_10074478 | Ga0207667_100744783 | 220 |
| 873 | 3300025961 | Ga0207712_10000002 | Ga0207712_10000002600 | 220 |
| 874 | 3300025961 | Ga0207712_10000013 | Ga0207712_10000013134 | 220 |
| 875 | 3300025972 | Ga0207668_10066392 | Ga0207668_100663924 | 220 |
| 876 | 3300025981 | Ga0207640_10063192 | Ga0207640_100631922 | 220 |
| 877 | 3300025986 | Ga0207658_10000689 | Ga0207658_1000068918 | 220 |
| 878 | 3300026035 | Ga0207703_10001006 | Ga0207703_100010061 | 220 |
| 879 | 3300026035 | Ga0207703_10009748 | Ga0207703_100097482 | 220 |
| 880 | 3300026041 | Ga0207639_10043651 | Ga0207639_100436514 | 220 |
| 881 | 3300026078 | Ga0207702_10007648 | Ga0207702_100076484 | 220 |
| 882 | 3300026088 | Ga0207641_10000101 | Ga0207641_1000010161 | 220 |
| 883 | 3300026088 | Ga0207641_10003069 | Ga0207641_1000306916 | 220 |
| 884 | 3300026095 | Ga0207676_10001834 | Ga0207676_100018345 | 220 |
| 885 | 3300026116 | Ga0207674_10231985 | Ga0207674_102319852 | 220 |
| 886 | 3300026116 | Ga0207674_10581922 | Ga0207674_105819222 | 220 |
| 887 | 3300026118 | Ga0207675_100011489 | Ga0207675_1000114897 | 220 |
| 888 | 3300026142 | Ga0207698_10038387 | Ga0207698_100383874 | 220 |
| 889 | 3300028379 | Ga0268266_10000025 | Ga0268266_10000025253 | 220 |
| 890 | 3300028380 | Ga0268265_10000048 | Ga0268265_1000004838 | 220 |
| 891 | 3300028380 | Ga0268265_10000316 | Ga0268265_1000031639 | 220 |
| 892 | 3300028381 | Ga0268264_10000037 | Ga0268264_10000037134 | 220 |
| 893 | 3300028381 | Ga0268264_10000439 | Ga0268264_1000043916 | 220 |
| 894 | 3300031456 | Ga0307513_10494841 | Ga0307513_104948412 | 220 |
| 895 | 3300033180 | Ga0307510_10000248 | Ga0307510_1000024819 | 220 |
| 896 | 3300046460 | Ga0495638_0001117 | Ga0495638_0001117_22041_22703 | 220 |
| 897 | 3300046520 | Ga0495637_0043659 | Ga0495637_0043659_975_1649 | 220 |
| 898 | 3300046522 | Ga0495643_0080976 | Ga0495643_0080976_305_979 | 220 |
| 899 | 3300046524 | Ga0495648_0075932 | Ga0495648_0075932_1084_1761 | 220 |
| 900 | 3300046660 | Ga0495625_0070430 | Ga0495625_0070430_1274_1951 | 220 |
| 901 | 3300046691 | Ga0495670_0084260 | Ga0495670_0084260_817_1479 | 220 |
| 902 | 3300047445 | Ga0495677_0019390 | Ga0495677_0019390_1587_2264 | 220 |
| 903 | 3300048905 | Ga0496102_0017546 | Ga0496102_0017546_1123_1785 | 220 |
| 904 | 3300048906 | Ga0496103_0003334 | Ga0496103_0003334_883_1545 | 220 |
| 905 | 3300048907 | Ga0496104_0042587 | Ga0496104_0042587_777_1439 | 220 |
| 906 | 3300048908 | Ga0496105_0012680 | Ga0496105_0012680_4179_4841 | 220 |
| 907 | 3300048910 | Ga0496107_0010755 | Ga0496107_0010755_2177_2839 | 220 |
| 908 | 3300048912 | Ga0496109_0128459 | Ga0496109_0128459_170_832 | 220 |
| 909 | 3300048913 | Ga0496110_0221215 | Ga0496110_0221215_190_852 | 220 |
| 910 | 3300048914 | Ga0496111_0175123 | Ga0496111_0175123_298_960 | 220 |
| 911 | 3300048920 | Ga0496117_0037727 | Ga0496117_0037727_2839_3501 | 220 |
| 912 | 3300048921 | Ga0496118_0078175 | Ga0496118_0078175_1399_2061 | 220 |
| 913 | 3300048928 | Ga0496125_0205690 | Ga0496125_0205690_244_906 | 220 |
| 914 | 3300049513 | Ga0501290_000271 | Ga0501290_000271_3832_4494 | 220 |
| 915 | 3300049515 | Ga0501292_000003 | Ga0501292_000003_3483_4145 | 220 |
| 916 | 3300049517 | Ga0501294_000455 | Ga0501294_000455_3302_3964 | 220 |
| 917 | 3300049523 | Ga0501300_000439 | Ga0501300_000439_1125_1787 | 220 |
| 918 | 3300049653 | Ga0501206_004121 | Ga0501206_004121_980_1642 | 220 |
| 919 | 3300049662 | Ga0501222_000807 | Ga0501222_000807_3032_3694 | 220 |
| 920 | 3300049663 | Ga0501223_000796 | Ga0501223_000796_6236_6898 | 220 |
| 921 | 3300049664 | Ga0501224_001001 | Ga0501224_001001_2536_3198 | 220 |
| 922 | 3300049665 | Ga0501227_001098 | Ga0501227_001098_2818_3480 | 220 |
| 923 | 3300049686 | Ga0501257_020712 | Ga0501257_020712_579_1241 | 220 |
| 924 | 3300049688 | Ga0501259_000913 | Ga0501259_000913_659_1321 | 220 |
| 925 | 3300049690 | Ga0501261_000066 | Ga0501261_000066_5542_6204 | 220 |
| 926 | 3300049705 | Ga0501225_0016325 | Ga0501225_0016325_687_1349 | 220 |
| 927 | 3300049775 | Ga0501279_000040 | Ga0501279_000040_3529_4191 | 220 |
| 928 | 3300049776 | Ga0501280_000144 | Ga0501280_000144_7497_8159 | 220 |
| 929 | 3300049777 | Ga0501281_00385 | Ga0501281_00385_49_711 | 220 |
| 930 | 3300049778 | Ga0501282_000071 | Ga0501282_000071_6210_6872 | 220 |
| 931 | 3300053091 | Ga0500647_0131142 | Ga0500647_0131142_372_1046 | 220 |
| 932 | 3300053133 | Ga0500655_000033 | Ga0500655_000033_33995_34669 | 220 |
| 933 | 3300053134 | Ga0500658_0002175 | Ga0500658_0002175_2789_3451 | 220 |
| 934 | 3300053148 | Ga0500590_013244 | Ga0500590_013244_369_1043 | 220 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2fli-assembly1.cif.gz_E | the crystal structure of d-ribulose 5-phosphate 3-epimerase from streptococus pyogenes complexed with d-xylitol 5-phosphate | 0.9789 | 5 | 218 |
| 1tqj-assembly1.cif.gz_E | crystal structure of d-ribulose 5-phosphate 3-epimerase from synechocystis to 1.6 angstrom resolution | 0.9743 | 4 | 218 |
| 1tqj-assembly1.cif.gz_B | crystal structure of d-ribulose 5-phosphate 3-epimerase from synechocystis to 1.6 angstrom resolution | 0.974 | 4 | 220 |
| 1tqj-assembly1.cif.gz_F | crystal structure of d-ribulose 5-phosphate 3-epimerase from synechocystis to 1.6 angstrom resolution | 0.9711 | 4 | 218 |
| 3inp-assembly1.cif.gz_A | 2.05 angstrom resolution crystal structure of d-ribulose-phosphate 3-epimerase from francisella tularensis. | 0.9707 | 5 | 218 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2fliC00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9791 | 3 | 218 | 3.20.20.70 |
| af_P0AG07_1_223_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9725 | 4 | 218 | 3.20.20.70 |
| 1tqjD00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9698 | 4 | 220 | 3.20.20.70 |
| af_Q58093_1_217_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9695 | 5 | 218 | 3.20.20.70 |
| af_P9WI51_4_223_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9569 | 3 | 218 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W6EV29-F1-model_v4 | Ribulose-phosphate 3-epimerase (EC 5.1.3.1) | 0.9929 | 5 | 219 |
GO:0004750
GO:0006098 GO:0019323 GO:0046872 |
| AF-A0A162JL25-F1-model_v4 | Ribulose-phosphate 3-epimerase (EC 5.1.3.1) | 0.991 | 1 | 218 |
GO:0004750
GO:0006098 GO:0019323 GO:0046872 |
| AF-A0A844ZET1-F1-model_v4 | Ribulose-phosphate 3-epimerase (EC 5.1.3.1) | 0.9909 | 5 | 220 |
GO:0004750
GO:0006098 GO:0019323 GO:0046872 |
| AF-A0A1I4C0L9-F1-model_v4 | Ribulose-phosphate 3-epimerase (EC 5.1.3.1) | 0.9896 | 3 | 218 |
GO:0004750
GO:0006098 GO:0019323 GO:0046872 |
| AF-A0A382V2T8-F1-model_v4 | ribulose-phosphate 3-epimerase (EC 5.1.3.1) | 0.9891 | 3 | 199 |
GO:0004750
GO:0005975 GO:0006098 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar