F486127

General Info

Members Datasets Scaffolds Average Seq Length
934 431 915 225

Family's Representative Sequence

Representative Sequence 3300031727|Ga0316576_10083949|Ga0316576_100839491
Length 273
Sequence VQGTQNTILHMGCAEPLCTGAGALPVSASRDTERKTDILAMTFPLRIAPSILSADFARLGEEVRAVDAAGADWIHVDVMDGHFVPNITIGPDVVKALRPHSPKPFDVHLMIAPCDPYLEAFAKAGADIITVHVEAGPHLHRSLQAIRALGKRAGVTLNPGTPVSTIEPVIDMVDLILVMSVNPGFGGQQFITAALDKITRLRALAAGRPIEIEIDGGINPEIAPLVARAGANVLVAGNAVFKAGGAEGGGTEAYARNITAIRDAAAMARGEVV

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2617270889 Nostoc punctiforme PCC 73102 Isolate Unclassified
3 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
4 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
5 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
6 2831426010 Nostoc sp. 106C Isolate Unclassified
7 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
8 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
9 2849660919 Nostoc sp. T09 Isolate Unclassified
10 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
11 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
12 2886627955 Nostoc sp. PA-18-2419 JC1668 Isolate Unclassified
13 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
14 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
15 2913844669 Nostocales cyanobacterium LEGE 12452 Isolate Unclassified
16 2913912277 Desmonostoc muscorum LEGE 12446 Isolate Unclassified
17 2913939268 Nostoc sp. LEGE 12447 Isolate Unclassified
18 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
19 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
20 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
21 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
22 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
23 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
24 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
25 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
26 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
27 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
28 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
29 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
30 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
37 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
38 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
39 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
40 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
41 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
42 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
43 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
44 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
45 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
46 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
47 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
48 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
49 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
50 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
51 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
52 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
53 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
54 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
55 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
56 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
57 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
58 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
59 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
60 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
61 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
62 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
63 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
64 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
65 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
66 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
67 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
68 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
69 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
70 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
71 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
72 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
73 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
74 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
75 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
76 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
77 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
78 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
79 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
85 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
86 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
87 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
88 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
89 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
90 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
91 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
92 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
93 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
94 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
95 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
96 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
97 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
98 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
99 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
102 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
103 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
105 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
106 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
111 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
112 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
113 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
114 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
115 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
116 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
117 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
118 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
119 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
120 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
123 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
124 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
125 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
126 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
127 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
128 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
129 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
130 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
131 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
132 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
133 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
195 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
196 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
197 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
198 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
199 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
200 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
201 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
202 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
203 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
204 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
205 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
206 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
207 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
208 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
209 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
210 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
211 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
212 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
213 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
214 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
215 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
217 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
219 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
220 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
221 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
222 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
223 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
224 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
225 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
226 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
227 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
228 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
229 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
230 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
231 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
232 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
233 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
234 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
235 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
236 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
237 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
238 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
239 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
240 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
241 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
242 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
243 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
244 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
245 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
246 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
247 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
248 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
249 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
250 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
251 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
252 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
253 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
254 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
255 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
256 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
257 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
258 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
259 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
260 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
261 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
262 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
263 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
264 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
265 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
266 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
267 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
268 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
269 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
270 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
271 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
272 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
273 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
274 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
275 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
276 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
277 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
278 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
279 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
280 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
281 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
282 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
283 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
284 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
285 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
286 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
287 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
288 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
289 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
290 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
291 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
292 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
293 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
294 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
295 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
296 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
297 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
298 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
299 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
300 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
301 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
302 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
303 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
304 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
305 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
306 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
307 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
308 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
309 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
310 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
311 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
312 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
313 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
314 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
315 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
316 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
317 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
318 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
319 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
320 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
321 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
322 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
323 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
324 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
325 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
326 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
327 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
328 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
329 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
330 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
331 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
332 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
333 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
334 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
335 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
336 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
337 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
338 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
339 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
340 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
341 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
342 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
343 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
344 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
345 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
346 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
347 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
348 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
349 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
350 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
351 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
352 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
353 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
354 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
355 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
359 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
362 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
363 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
364 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
366 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
368 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
369 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
370 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
371 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
372 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
373 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
374 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
375 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
376 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
377 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
378 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
379 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
380 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
381 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
382 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
383 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
384 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
385 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
386 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
387 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
388 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
389 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
390 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
391 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
392 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
393 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
394 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
395 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
396 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
397 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
398 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
399 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
400 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
401 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
402 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
403 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
404 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
405 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
406 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
407 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
408 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
409 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
410 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
411 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
412 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
413 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
414 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
415 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
416 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
417 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
418 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
419 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
420 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
421 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
422 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
423 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
424 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
425 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
426 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
427 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
428 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
429 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
430 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
431 642555144 Nostoc punctiforme PCC 73102 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.43
Metatranscriptomes 0.54
Isolates 2.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.1
Nodule 0.32
Rhizoplane 8.99
Rhizosphere 84.05
Stem 0
Stem Tuber 0
Unclassified 3.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1000198 3300001976 Bacteria 8365
2 JGI24740J21852_10005460 3300001979 Bacteria 5373
3 JGI24740J21852_10018622 3300001979 Bacteria 2457
4 JGI24739J22299_10006428 3300001989 Bacteria 4438
5 JGI24737J22298_10033317 3300001990 Bacteria 1601
6 JGI24735J21928_10005974 3300002067 Bacteria 4021
7 JGI24735J21928_10007291 3300002067 Bacteria 3609
8 JGI24750J21931_1002769 3300002070 Bacteria 2106
9 JGI24748J21848_1000042 3300002074 Bacteria 62376
10 JGI24749J21850_1020066 3300002076 Bacteria 944
11 JGI24034J26672_10000035 3300002239 Bacteria 85548
12 JGI24742J22300_10031650 3300002244 Bacteria 926
13 Ga0055540_1006853 3300003792 Bacteria 4430
14 Ga0058859_11244916 3300004798 Bacteria 864
15 Ga0070658_10339213 3300005327 Bacteria 1285
16 Ga0070690_100000009 3300005330 Bacteria 112447
17 Ga0070690_100040895 3300005330 Bacteria 2934
18 Ga0070670_100287174 3300005331 Bacteria 1437
19 Ga0070677_10000155 3300005333 Bacteria 23197
20 Ga0070666_10000006 3300005335 Bacteria 319173
21 Ga0070666_10001803 3300005335 Bacteria 13038
22 Ga0070680_100001660 3300005336 Bacteria 16265
23 Ga0070680_100110382 3300005336 Bacteria 2289
24 Ga0070680_100168740 3300005336 Bacteria 1841
25 Ga0070682_100094964 3300005337 Bacteria 1957
26 Ga0070660_100000064 3300005339 Bacteria 62554
27 Ga0070660_100047236 3300005339 Bacteria 3302
28 Ga0070660_100109866 3300005339 Bacteria 2193
29 Ga0070660_100276101 3300005339 Bacteria 1374
30 Ga0070660_100307567 3300005339 Bacteria 1300
31 Ga0070660_100412668 3300005339 Bacteria 1117
32 Ga0070689_100012742 3300005340 Bacteria 6069
33 Ga0070689_100179282 3300005340 Bacteria 1720
34 Ga0070691_10016128 3300005341 Bacteria 3433
35 Ga0070687_100071737 3300005343 Bacteria 1862
36 Ga0070687_100225626 3300005343 Bacteria 1150
37 Ga0070661_100004993 3300005344 Bacteria 9138
38 Ga0070668_100000539 3300005347 Bacteria 25247
39 Ga0070668_100036683 3300005347 Bacteria 3742
40 Ga0070668_100083683 3300005347 Bacteria 2505
41 Ga0070668_100397584 3300005347 Bacteria 1176
42 Ga0070669_100000095 3300005353 Bacteria 86930
43 Ga0070669_100000280 3300005353 Bacteria 40554
44 Ga0070675_100061783 3300005354 Bacteria 3094
45 Ga0070675_100310794 3300005354 Bacteria 1390
46 Ga0070671_100000005 3300005355 Bacteria 256547
47 Ga0070671_100067244 3300005355 Bacteria 2988
48 Ga0070671_100186306 3300005355 Bacteria 1758
49 Ga0070674_100016308 3300005356 Bacteria 4656
50 Ga0070673_100083073 3300005364 Bacteria 2601
51 Ga0070688_100004996 3300005365 Bacteria 6945
52 Ga0070688_100045907 3300005365 Bacteria 2703
53 Ga0070659_100017634 3300005366 Bacteria 5378
54 Ga0070659_100132082 3300005366 Bacteria 2028
55 Ga0070659_100209567 3300005366 Bacteria 1606
56 Ga0070667_100021629 3300005367 Bacteria 5338
57 Ga0070667_100207098 3300005367 Bacteria 1742
58 Ga0070714_100432594 3300005435 Bacteria 1248
59 Ga0070713_100368594 3300005436 Bacteria 1336
60 Ga0070710_10187201 3300005437 Bacteria 1300
61 Ga0070700_100025794 3300005441 Bacteria 3464
62 Ga0070694_100187145 3300005444 Bacteria 1535
63 Ga0070708_100021449 3300005445 Bacteria 5462
64 Ga0070663_100050356 3300005455 Bacteria 2962
65 Ga0070663_100645155 3300005455 Bacteria 895
66 Ga0070678_100049859 3300005456 Bacteria 3024
67 Ga0070662_100251530 3300005457 Bacteria 1421
68 Ga0070681_10013407 3300005458 Bacteria 8143
69 Ga0070681_10024397 3300005458 Bacteria 6088
70 Ga0070681_10046789 3300005458 Bacteria 4324
71 Ga0070681_10167330 3300005458 Bacteria 2121
72 Ga0070681_10194105 3300005458 Bacteria 1949
73 Ga0070681_10199336 3300005458 Bacteria 1920
74 Ga0070681_10272796 3300005458 Bacteria 1603
75 Ga0070681_10506439 3300005458 Bacteria 1120
76 Ga0070685_10000155 3300005466 Bacteria 45505
77 Ga0070707_100136600 3300005468 Bacteria 2385
78 Ga0070707_100332576 3300005468 Bacteria 1476
79 Ga0070698_100003881 3300005471 Bacteria 16433
80 Ga0070699_100082691 3300005518 Bacteria 2799
81 Ga0070679_100108824 3300005530 Bacteria 2758
82 Ga0070679_100165670 3300005530 Bacteria 2183
83 Ga0070679_100245169 3300005530 Bacteria 1749
84 Ga0070684_100153420 3300005535 Bacteria 2088
85 Ga0070697_100298596 3300005536 Bacteria 1384
86 Ga0068853_100784584 3300005539 Bacteria 912
87 Ga0070686_100000091 3300005544 Bacteria 63232
88 Ga0070665_100000019 3300005548 Bacteria 413972
89 Ga0070665_100000148 3300005548 Bacteria 128573
90 Ga0070665_100043313 3300005548 Bacteria 4523
91 Ga0070665_100189335 3300005548 Bacteria 2059
92 Ga0068855_100016827 3300005563 Bacteria 8794
93 Ga0068855_100022850 3300005563 Bacteria 7496
94 Ga0068855_100938848 3300005563 Bacteria 912
95 Ga0070664_100016307 3300005564 Bacteria 6089
96 Ga0070664_100486215 3300005564 Bacteria 1136
97 Ga0068854_100459371 3300005578 Bacteria 1065
98 Ga0068854_100504303 3300005578 Bacteria 1019
99 Ga0068856_100490559 3300005614 Bacteria 1249
100 Ga0068852_100007430 3300005616 Bacteria 7998
101 Ga0068852_100042768 3300005616 Bacteria 3838
102 Ga0068852_100092276 3300005616 Bacteria 2711
103 Ga0068852_100639984 3300005616 Bacteria 1070
104 Ga0068859_100022381 3300005617 Bacteria 6336
105 Ga0068859_100213616 3300005617 Bacteria 2016
106 Ga0068861_100012358 3300005719 Bacteria 5953
107 Ga0068851_10077419 3300005834 Bacteria 1731
108 Ga0068863_100000118 3300005841 Bacteria 82651
109 Ga0068863_100014260 3300005841 Bacteria 7657
110 Ga0068863_100316090 3300005841 Bacteria 1516
111 Ga0068863_100523847 3300005841 Bacteria 1169
112 Ga0068858_100000723 3300005842 Bacteria 34436
113 Ga0068858_100002727 3300005842 Bacteria 17774
114 Ga0068858_100005339 3300005842 Bacteria 12606
115 Ga0068860_100000014 3300005843 Bacteria 319437
116 Ga0068860_100001093 3300005843 Bacteria 29849
117 Ga0068860_100134992 3300005843 Bacteria 2369
118 Ga0068862_100000014 3300005844 Bacteria 251552
119 Ga0068862_100000503 3300005844 Bacteria 41613
120 Ga0068862_100001001 3300005844 Bacteria 27048
121 Ga0081455_10002509 3300005937 Bacteria 21784
122 Ga0081455_10064681 3300005937 Bacteria 3062
123 Ga0081538_10068599 3300005981 Bacteria 1970
124 Ga0081540_1014204 3300005983 Bacteria 5119
125 Ga0081539_10014301 3300005985 Bacteria 5883
126 Ga0070717_10854828 3300006028 Bacteria 828
127 Ga0075365_10015277 3300006038 Bacteria 4640
128 Ga0070712_100001034 3300006175 Bacteria 16789
129 Ga0070712_100511112 3300006175 Bacteria 1008
130 Ga0075367_10178454 3300006178 Bacteria 1324
131 Ga0075367_10298417 3300006178 Bacteria 1014
132 Ga0075366_10003290 3300006195 Bacteria 8495
133 Ga0075366_10019985 3300006195 Bacteria 3882
134 Ga0068871_100359928 3300006358 Bacteria 1289
135 Ga0075428_100205281 3300006844 Bacteria 2130
136 Ga0075428_100311554 3300006844 Bacteria 1692
137 Ga0075431_100020447 3300006847 Bacteria 6762
138 Ga0075431_100058054 3300006847 Bacteria 3991
139 Ga0075433_10052600 3300006852 Bacteria 3549
140 Ga0075433_10124576 3300006852 Bacteria 2289
141 Ga0075434_100000986 3300006871 Bacteria 23010
142 Ga0075434_100074790 3300006871 Bacteria 3381
143 Ga0075434_100465951 3300006871 Bacteria 1285
144 Ga0075429_100057848 3300006880 Bacteria 3376
145 Ga0075436_100065280 3300006914 Bacteria 2516
146 Ga0097620_100022380 3300006931 Bacteria 6336
147 Ga0097620_100213618 3300006931 Bacteria 2016
148 Ga0075435_100036045 3300007076 Bacteria 3929
149 Ga0075435_100345783 3300007076 Bacteria 1274
150 Ga0105240_10295843 3300009093 Bacteria 1854
151 Ga0105240_10597732 3300009093 Bacteria 1215
152 Ga0105240_10678746 3300009093 Bacteria 1127
153 Ga0111539_10335230 3300009094 Bacteria 1761
154 Ga0111539_10422510 3300009094 Bacteria 1552
155 Ga0105245_10133351 3300009098 Bacteria 2332
156 Ga0105247_10000830 3300009101 Bacteria 23517
157 Ga0105247_10039951 3300009101 Bacteria 2867
158 Ga0105247_10093791 3300009101 Bacteria 1909
159 Ga0105247_10115726 3300009101 Bacteria 1731
160 Ga0105247_10151643 3300009101 Bacteria 1528
161 Ga0114129_10054562 3300009147 Bacteria 5603
162 Ga0114129_11134092 3300009147 Bacteria 977
163 Ga0105243_10138496 3300009148 Bacteria 2073
164 Ga0105242_10096458 3300009176 Bacteria 2498
165 Ga0105248_10028861 3300009177 Bacteria 6184
166 Ga0105248_10056676 3300009177 Bacteria 4396
167 Ga0105237_10047573 3300009545 Bacteria 4312
168 Ga0105237_10078994 3300009545 Bacteria 3280
169 Ga0105238_10416014 3300009551 Bacteria 1338
170 Ga0105238_10454160 3300009551 Bacteria 1278
171 Ga0105249_10000002 3300009553 Bacteria 376207
172 Ga0105249_10000035 3300009553 Bacteria 201325
173 Ga0105249_10385060 3300009553 Bacteria 1429
174 Ga0105249_10416469 3300009553 Bacteria 1376
175 Ga0099796_10010288 3300010159 Bacteria 2567
176 Ga0105239_10034581 3300010375 Bacteria 5550
177 Ga0157373_10022779 3300013100 Bacteria 4542
178 Ga0157373_10105027 3300013100 Bacteria 1987
179 Ga0157371_10147730 3300013102 Bacteria 1676
180 Ga0157371_10269119 3300013102 Bacteria 1229
181 Ga0157370_10014955 3300013104 Bacteria 7913
182 Ga0157370_10028926 3300013104 Bacteria 5445
183 Ga0157370_10112520 3300013104 Bacteria 2544
184 Ga0157369_10000043 3300013105 Bacteria 180713
185 Ga0157369_10007581 3300013105 Bacteria 12489
186 Ga0157369_10094209 3300013105 Bacteria 3196
187 Ga0157369_10111023 3300013105 Bacteria 2914
188 Ga0157369_10847637 3300013105 Bacteria 938
189 Ga0157374_10023802 3300013296 Bacteria 5483
190 Ga0157378_10333651 3300013297 Bacteria 1477
191 Ga0157378_10382343 3300013297 Bacteria 1383
192 Ga0163162_10014044 3300013306 Bacteria 7827
193 Ga0163162_10036563 3300013306 Bacteria 4895
194 Ga0163162_10114980 3300013306 Bacteria 2790
195 Ga0163162_10154001 3300013306 Bacteria 2418
196 Ga0163162_10206538 3300013306 Bacteria 2093
197 Ga0157372_10276084 3300013307 Bacteria 1953
198 Ga0157375_11173984 3300013308 Bacteria 900
199 Ga0163163_10005537 3300014325 Bacteria 10936
200 Ga0163163_10019657 3300014325 Bacteria 6346
201 Ga0157380_10004798 3300014326 Bacteria 9423
202 Ga0157380_10062201 3300014326 Bacteria 2989
203 Ga0157379_10008890 3300014968 Bacteria 8756
204 Ga0157379_10405318 3300014968 Bacteria 1254
205 Ga0157379_10455885 3300014968 Bacteria 1181
206 Ga0157379_10581161 3300014968 Bacteria 1044
207 Ga0182005_1064129 3300015265 Bacteria 1004
208 Ga0163161_10000102 3300017792 Bacteria 81540
209 Ga0213872_10014988 3300021361 Bacteria 3606
210 Ga0213874_10062776 3300021377 Bacteria 1168
211 Ga0213875_10150129 3300021388 Bacteria 1092
212 Ga0209758_1000128 3300025297 Bacteria 186771
213 Ga0207697_10009619 3300025315 Bacteria 4166
214 Ga0207697_10013327 3300025315 Bacteria 3431
215 Ga0207697_10055657 3300025315 Bacteria 1640
216 Ga0207656_10078538 3300025321 Bacteria 1479
217 Ga0207656_10102693 3300025321 Bacteria 1312
218 Ga0207682_10000147 3300025893 Bacteria 31656
219 Ga0207710_10022092 3300025900 Bacteria 2729
220 Ga0207710_10029664 3300025900 Bacteria 2382
221 Ga0207710_10092185 3300025900 Bacteria 1419
222 Ga0207710_10122998 3300025900 Bacteria 1241
223 Ga0207688_10002303 3300025901 Bacteria 10272
224 Ga0207688_10157154 3300025901 Bacteria 1346
225 Ga0207680_10000011 3300025903 Bacteria 391225
226 Ga0207680_10024594 3300025903 Bacteria 3308
227 Ga0207680_10201301 3300025903 Bacteria 1357
228 Ga0207647_10008450 3300025904 Bacteria 7382
229 Ga0207647_10055215 3300025904 Bacteria 2441
230 Ga0207647_10207689 3300025904 Bacteria 1132
231 Ga0207645_10022266 3300025907 Bacteria 4125
232 Ga0207643_10027485 3300025908 Bacteria 3154
233 Ga0207643_10180488 3300025908 Bacteria 1277
234 Ga0207705_10000033 3300025909 Bacteria 223997
235 Ga0207705_10180163 3300025909 Bacteria 1594
236 Ga0207705_10310735 3300025909 Bacteria 1210
237 Ga0207684_10479254 3300025910 Bacteria 1067
238 Ga0207654_10000285 3300025911 Bacteria 30791
239 Ga0207707_10016805 3300025912 Bacteria 6375
240 Ga0207707_10150528 3300025912 Bacteria 2035
241 Ga0207707_10159254 3300025912 Bacteria 1974
242 Ga0207707_10605427 3300025912 Bacteria 927
243 Ga0207695_10002074 3300025913 Bacteria 30558
244 Ga0207671_10012192 3300025914 Bacteria 6934
245 Ga0207693_10009479 3300025915 Bacteria 7929
246 Ga0207693_10017330 3300025915 Bacteria 5744
247 Ga0207693_10042503 3300025915 Bacteria 3577
248 Ga0207693_10078129 3300025915 Bacteria 2591
249 Ga0207693_10205671 3300025915 Bacteria 1548
250 Ga0207660_10002059 3300025917 Bacteria 13360
251 Ga0207660_10029613 3300025917 Bacteria 3758
252 Ga0207660_10245440 3300025917 Bacteria 1412
253 Ga0207662_10221508 3300025918 Bacteria 1232
254 Ga0207657_10091569 3300025919 Bacteria 2535
255 Ga0207657_10168929 3300025919 Bacteria 1773
256 Ga0207649_10000444 3300025920 Bacteria 29932
257 Ga0207649_10074284 3300025920 Bacteria 2181
258 Ga0207649_10100090 3300025920 Bacteria 1916
259 Ga0207652_10188151 3300025921 Bacteria 1856
260 Ga0207646_10214716 3300025922 Bacteria 1737
261 Ga0207681_10000096 3300025923 Bacteria 74995
262 Ga0207681_10000112 3300025923 Bacteria 68723
263 Ga0207681_10021738 3300025923 Bacteria 4083
264 Ga0207681_10323687 3300025923 Bacteria 1227
265 Ga0207694_10004187 3300025924 Bacteria 11314
266 Ga0207694_10198752 3300025924 Bacteria 1630
267 Ga0207687_10019713 3300025927 Bacteria 4471
268 Ga0207687_10051601 3300025927 Bacteria 2868
269 Ga0207700_10023911 3300025928 Bacteria 4223
270 Ga0207664_10286062 3300025929 Bacteria 1448
271 Ga0207664_10878560 3300025929 Bacteria 805
272 Ga0207644_10000008 3300025931 Bacteria 354219
273 Ga0207644_10009210 3300025931 Bacteria 6476
274 Ga0207644_10014179 3300025931 Bacteria 5331
275 Ga0207644_10351399 3300025931 Bacteria 1197
276 Ga0207690_10011704 3300025932 Bacteria 5246
277 Ga0207706_10109808 3300025933 Bacteria 2427
278 Ga0207706_10123536 3300025933 Bacteria 2277
279 Ga0207706_10278816 3300025933 Bacteria 1458
280 Ga0207706_10298024 3300025933 Bacteria 1405
281 Ga0207686_10076118 3300025934 Bacteria 2175
282 Ga0207686_10127490 3300025934 Bacteria 1741
283 Ga0207709_10252546 3300025935 Bacteria 1289
284 Ga0207670_10006506 3300025936 Bacteria 6485
285 Ga0207670_10061467 3300025936 Bacteria 2563
286 Ga0207704_10249315 3300025938 Bacteria 1332
287 Ga0207665_10370326 3300025939 Bacteria 1085
288 Ga0207691_10042109 3300025940 Bacteria 4211
289 Ga0207691_10429741 3300025940 Bacteria 1125
290 Ga0207711_10020384 3300025941 Bacteria 5527
291 Ga0207711_10056159 3300025941 Bacteria 3382
292 Ga0207711_10165981 3300025941 Bacteria 2001
293 Ga0207689_10072495 3300025942 Bacteria 2829
294 Ga0207661_10174628 3300025944 Bacteria 1872
295 Ga0207661_10349253 3300025944 Bacteria 1334
296 Ga0207679_10029237 3300025945 Bacteria 3835
297 Ga0207679_10191126 3300025945 Bacteria 1702
298 Ga0207667_10007324 3300025949 Bacteria 13282
299 Ga0207667_10012362 3300025949 Bacteria 9844
300 Ga0207667_10022285 3300025949 Bacteria 7001
301 Ga0207667_10042471 3300025949 Bacteria 4832
302 Ga0207667_10074478 3300025949 Bacteria 3527
303 Ga0207651_10109481 3300025960 Bacteria 2070
304 Ga0207712_10000002 3300025961 Bacteria 706628
305 Ga0207712_10000013 3300025961 Bacteria 391208
306 Ga0207712_10079828 3300025961 Bacteria 2378
307 Ga0207668_10007115 3300025972 Bacteria 6639
308 Ga0207668_10066392 3300025972 Bacteria 2557
309 Ga0207668_10096978 3300025972 Bacteria 2181
310 Ga0207640_10063192 3300025981 Bacteria 2459
311 Ga0207640_10215809 3300025981 Bacteria 1465
312 Ga0207640_10591692 3300025981 Bacteria 938
313 Ga0207658_10000689 3300025986 Bacteria 29444
314 Ga0207658_10102311 3300025986 Bacteria 2247
315 Ga0207658_10163505 3300025986 Bacteria 1826
316 Ga0207703_10001006 3300026035 Bacteria 27062
317 Ga0207703_10009748 3300026035 Bacteria 7537
318 Ga0207703_10013788 3300026035 Bacteria 6300
319 Ga0207703_10136533 3300026035 Bacteria 2124
320 Ga0207639_10043651 3300026041 Bacteria 3367
321 Ga0207639_10261723 3300026041 Bacteria 1513
322 Ga0207639_10616822 3300026041 Bacteria 1001
323 Ga0207678_10320833 3300026067 Bacteria 1333
324 Ga0207708_10036299 3300026075 Bacteria 3752
325 Ga0207708_10043986 3300026075 Bacteria 3403
326 Ga0207702_10007648 3300026078 Bacteria 9194
327 Ga0207702_10307501 3300026078 Bacteria 1506
328 Ga0207641_10000101 3300026088 Bacteria 122493
329 Ga0207641_10003069 3300026088 Bacteria 15060
330 Ga0207676_10001834 3300026095 Bacteria 15561
331 Ga0207674_10030099 3300026116 Bacteria 5710
332 Ga0207674_10039328 3300026116 Bacteria 4904
333 Ga0207674_10231985 3300026116 Bacteria 1793
334 Ga0207674_10445601 3300026116 Bacteria 1251
335 Ga0207674_10581922 3300026116 Bacteria 1081
336 Ga0207675_100011489 3300026118 Bacteria 8284
337 Ga0207675_100118534 3300026118 Bacteria 2503
338 Ga0207683_10095843 3300026121 Bacteria 2645
339 Ga0207683_10148744 3300026121 Bacteria 2113
340 Ga0207698_10001849 3300026142 Bacteria 12360
341 Ga0207698_10013844 3300026142 Bacteria 5340
342 Ga0207698_10038387 3300026142 Bacteria 3538
343 Ga0268266_10000025 3300028379 Bacteria 477143
344 Ga0268266_10000626 3300028379 Bacteria 48011
345 Ga0268266_10108335 3300028379 Bacteria 2458
346 Ga0268266_10137786 3300028379 Bacteria 2187
347 Ga0268266_10942846 3300028379 Bacteria 835
348 Ga0268265_10000048 3300028380 Bacteria 178523
349 Ga0268265_10000316 3300028380 Bacteria 53175
350 Ga0268265_10000975 3300028380 Bacteria 26114
351 Ga0268264_10000037 3300028381 Bacteria 391116
352 Ga0268264_10000439 3300028381 Bacteria 57339
353 Ga0268264_10161279 3300028381 Bacteria 2020
354 Ga0265760_10026725 3300031090 Bacteria 1689
355 Ga0265328_10070937 3300031239 Bacteria 1281
356 Ga0265329_10046276 3300031242 Bacteria 1390
357 Ga0265340_10022791 3300031247 Bacteria 3198
358 Ga0265340_10029387 3300031247 Bacteria 2760
359 Ga0265339_10058674 3300031249 Bacteria 2077
360 Ga0265339_10195298 3300031249 Bacteria 1001
361 Ga0265331_10002807 3300031250 Bacteria 11548
362 Ga0265331_10019075 3300031250 Bacteria 3545
363 Ga0307513_10494841 3300031456 Bacteria 940
364 Ga0265313_10000021 3300031595 Bacteria 144949
365 Ga0316575_10106133 3300031665 Bacteria 1144
366 Ga0316579_10153587 3300031691 Bacteria 1111
367 Ga0265314_10000279 3300031711 Bacteria 74300
368 Ga0265314_10025954 3300031711 Bacteria 4411
369 Ga0265314_10058157 3300031711 Bacteria 2650
370 Ga0265342_10009824 3300031712 Bacteria 6694
371 Ga0265342_10065920 3300031712 Bacteria 2121
372 Ga0316576_10083949 3300031727 Bacteria 2367
373 Ga0316578_10038730 3300031728 Bacteria 2751
374 Ga0307405_10555396 3300031731 Bacteria 930
375 Ga0307413_10220122 3300031824 Bacteria 1386
376 Ga0307412_10144788 3300031911 Bacteria 1745
377 Ga0307412_10225018 3300031911 Bacteria 1441
378 Ga0307412_10302574 3300031911 Bacteria 1265
379 Ga0307409_100079291 3300031995 Bacteria 2646
380 Ga0307414_10057088 3300032004 Bacteria 2742
381 Ga0307414_10071542 3300032004 Bacteria 2502
382 Ga0307414_10229974 3300032004 Bacteria 1528
383 Ga0307411_10563347 3300032005 Bacteria 974
384 Ga0307415_100252775 3300032126 Bacteria 1433
385 Ga0316583_10001287 3300032133 Bacteria 8297
386 Ga0316593_10033295 3300032168 Bacteria 1686
387 Ga0307510_10000248 3300033180 Bacteria 48764
388 Ga0316592_1012612 3300033524 Bacteria 1735
389 Ga0316592_1056016 3300033524 Bacteria 882
390 Ga0373930_0035672 3300034816 Bacteria 1040
391 Ga0373958_0024349 3300034819 Bacteria 1145
392 Ga0373959_0045163 3300034820 Bacteria 936
393 Ga0373938_0090185 3300034957 Bacteria 757
394 Ga0373926_0005063 3300035083 Bacteria 4329
395 Ga0373926_0008334 3300035083 Bacteria 3447
396 Ga0373929_0012346 3300035085 Bacteria 1623
397 Ga0373940_0080405 3300035088 Bacteria 963
398 Ga0373944_0002213 3300035089 Bacteria 4942
399 Ga0373923_0041409 3300035111 Bacteria 1899
400 Ga0373923_0050859 3300035111 Bacteria 1737
401 Ga0373923_0085332 3300035111 Bacteria 1374
402 Ga0373932_0151554 3300035112 Bacteria 796
403 Ga0373936_0067593 3300035113 Bacteria 1469
404 Ga0373941_0090086 3300035115 Bacteria 1051
405 Ga0373945_0012237 3300035116 Bacteria 2846
406 Ga0373953_0213947 3300035117 Bacteria 834
407 Ga0373954_0039018 3300035118 Bacteria 2210
408 Ga0373954_0127770 3300035118 Bacteria 1236
409 Ga0373957_0204054 3300035120 Bacteria 824
410 Ga0373943_0000038 3300035170 Bacteria 44091
411 Ga0373943_0006907 3300035170 Bacteria 5091
412 Ga0373943_0084078 3300035170 Bacteria 1637
413 Ga0373946_0003198 3300035171 Bacteria 5809
414 Ga0373955_0045922 3300035172 Bacteria 2359
415 Ga0373955_0173865 3300035172 Bacteria 1276
416 Ga0373942_0052239 3300035207 Bacteria 1149
417 Ga0373961_0028678 3300035241 Bacteria 1536
418 Ga0316574_0473080 3300035398 Bacteria 783
419 Ga0373924_0043034 3300035410 Bacteria 1854
420 Ga0373931_0197657 3300035691 Bacteria 1199
421 Ga0373931_0381779 3300035691 Bacteria 888
422 Ga0373931_0393176 3300035691 Bacteria 876
423 Ga0373935_0274025 3300035692 Bacteria 1186
424 Ga0373935_0297920 3300035692 Bacteria 1139
425 Ga0373927_0000651 3300035695 Bacteria 26320
426 Ga0373927_0025823 3300035695 Bacteria 3840
427 Ga0373927_0230645 3300035695 Bacteria 1216
428 Ga0373927_0263089 3300035695 Bacteria 1134
429 Ga0373933_0024606 3300035724 Bacteria 3447
430 Ga0373947_0000024 3300035725 Bacteria 87027
431 Ga0373947_0013366 3300035725 Bacteria 4704
432 Ga0373947_0091793 3300035725 Bacteria 1895
433 Ga0373947_0094215 3300035725 Bacteria 1872
434 Ga0373947_0131845 3300035725 Bacteria 1596
435 Ga0373937_0005793 3300036401 Bacteria 10619
436 Ga0373937_0020159 3300036401 Bacteria 5975
437 Ga0373937_0580248 3300036401 Bacteria 1065
438 Ga0316582_0018667 3300036647 Bacteria 4042
439 Ga0316584_0007550 3300036712 Bacteria 7450
440 Ga0373925_0018395 3300037068 Bacteria 5079
441 Ga0373925_0153430 3300037068 Bacteria 1810
442 Ga0373925_0491408 3300037068 Bacteria 1007
443 Ga0395899_0000137 3300037312 Bacteria 111924
444 Ga0395899_0125111 3300037312 Bacteria 1839
445 Ga0395900_0000108 3300037418 Bacteria 147706
446 Ga0395900_0018679 3300037418 Bacteria 7070
447 Ga0395900_0032943 3300037418 Bacteria 5331
448 Ga0395900_0034968 3300037418 Bacteria 5175
449 Ga0395900_0043072 3300037418 Bacteria 4651
450 Ga0395900_0045893 3300037418 Bacteria 4500
451 Ga0395900_0170835 3300037418 Bacteria 2213
452 Ga0395898_0000632 3300037466 Bacteria 64373
453 Ga0395898_0024358 3300037466 Bacteria 6104
454 Ga0395898_0044477 3300037466 Bacteria 4370
455 Ga0395898_0053895 3300037466 Bacteria 3926
456 Ga0395905_0000780 3300037471 Bacteria 41824
457 Ga0395905_0096596 3300037471 Bacteria 2774
458 Ga0436364_0013094 3300037853 Bacteria 1884
459 Ga0436364_0195157 3300037853 Bacteria 17364
460 Ga0436364_0526272 3300037853 Bacteria 3502
461 Ga0436364_1108265 3300037853 Bacteria 5139
462 Ga0395901_0000050 3300038443 Bacteria 171046
463 Ga0395901_0000086 3300038443 Bacteria 125359
464 Ga0395901_0026198 3300038443 Bacteria 5985
465 Ga0395901_0051291 3300038443 Bacteria 4289
466 Ga0395901_0244060 3300038443 Bacteria 1872
467 Ga0395901_0390029 3300038443 Bacteria 1432
468 Ga0395901_0485823 3300038443 Bacteria 1259
469 Ga0400483_136809 3300039062 Bacteria 1317
470 Ga0400483_206045 3300039062 Bacteria 1699
471 Ga0436365_1896329 3300039437 Bacteria 9698
472 Ga0436360_0048356 3300039438 Bacteria 1363
473 Ga0436360_1007073 3300039438 Bacteria 1324
474 Ga0436361_0009329 3300039447 Bacteria 997
475 Ga0436361_0194635 3300039447 Bacteria 1532
476 Ga0436361_0231853 3300039447 Bacteria 1892
477 Ga0436361_0770494 3300039447 Bacteria 1510
478 Ga0436363_0211911 3300039450 Bacteria 50385
479 Ga0436363_0576058 3300039450 Bacteria 3507
480 Ga0439448_0027222 3300042005 Bacteria 1801
481 Ga0439448_0160677 3300042005 Bacteria 782
482 Ga0439456_017035 3300042013 Bacteria 1522
483 Ga0453683_0002196 3300044673 Bacteria 15517
484 Ga0466966_0020726 3300044684 Bacteria 4320
485 Ga0466961_0012256 3300044693 Bacteria 5483
486 Ga0466963_0034953 3300044694 Bacteria 3272
487 Ga0466963_0068019 3300044694 Bacteria 2391
488 Ga0453684_0028704 3300044712 Bacteria 7925
489 Ga0453684_0105894 3300044712 Bacteria 3429
490 Ga0453684_0494753 3300044712 Bacteria 1355
491 Ga0453684_0870126 3300044712 Bacteria 967
492 Ga0466971_0017973 3300044719 Bacteria 3131
493 Ga0466970_0009668 3300044765 Bacteria 4879
494 Ga0466957_0055470 3300044842 Bacteria 2422
495 Ga0466960_0134560 3300044901 Bacteria 1308
496 Ga0466959_0008062 3300045049 Bacteria 7424
497 Ga0451576_0001224 3300045051 Bacteria 45523
498 Ga0451576_0004466 3300045051 Bacteria 18128
499 Ga0451576_0012315 3300045051 Bacteria 9617
500 Ga0451576_0156267 3300045051 Bacteria 2379
501 Ga0451576_0186575 3300045051 Bacteria 2165
502 Ga0466958_0002196 3300045836 Bacteria 9718
503 Ga0466967_0032500 3300045976 Bacteria 4407
504 Ga0466967_0438975 3300045976 Bacteria 1274
505 Ga0495592_0008885 3300046454 Bacteria 7546
506 Ga0495603_0022743 3300046455 Bacteria 3793
507 Ga0495603_0098291 3300046455 Bacteria 1709
508 Ga0495629_0001636 3300046459 Bacteria 17607
509 Ga0495629_0015778 3300046459 Bacteria 5425
510 Ga0495629_0412197 3300046459 Bacteria 917
511 Ga0495629_0431396 3300046459 Bacteria 894
512 Ga0495638_0001117 3300046460 Bacteria 26096
513 Ga0495638_0064102 3300046460 Bacteria 2264
514 Ga0495641_0037738 3300046461 Bacteria 2262
515 Ga0495651_0000860 3300046462 Bacteria 23547
516 Ga0495651_0085272 3300046462 Bacteria 2379
517 Ga0495653_0002396 3300046463 Bacteria 14921
518 Ga0495580_0082128 3300046472 Bacteria 2246
519 Ga0495582_0127994 3300046473 Bacteria 1434
520 Ga0495639_0029254 3300046475 Bacteria 2445
521 Ga0495662_0041905 3300046476 Bacteria 2210
522 Ga0495662_0215780 3300046476 Bacteria 946
523 Ga0495664_0014194 3300046477 Bacteria 4513
524 Ga0495664_0231080 3300046477 Bacteria 1119
525 Ga0495584_0054269 3300046491 Bacteria 2017
526 Ga0495584_0182285 3300046491 Bacteria 1067
527 Ga0495585_0011012 3300046492 Bacteria 5370
528 Ga0495594_0005510 3300046499 Bacteria 6499
529 Ga0495607_0004756 3300046501 Bacteria 9927
530 Ga0495608_0002790 3300046511 Bacteria 12541
531 Ga0495608_0093221 3300046511 Bacteria 1946
532 Ga0495620_0122087 3300046515 Bacteria 1026
533 Ga0495628_0016517 3300046516 Bacteria 6155
534 Ga0495628_0322965 3300046516 Bacteria 1139
535 Ga0495628_0341313 3300046516 Bacteria 1102
536 Ga0495628_0690018 3300046516 Bacteria 722
537 Ga0495630_0102927 3300046517 Bacteria 2161
538 Ga0495630_0121908 3300046517 Bacteria 1978
539 Ga0495630_0264974 3300046517 Bacteria 1313
540 Ga0495637_0016075 3300046520 Bacteria 3503
541 Ga0495637_0043659 3300046520 Bacteria 1912
542 Ga0495643_0080976 3300046522 Bacteria 1689
543 Ga0495644_0003154 3300046523 Bacteria 6519
544 Ga0495644_0097544 3300046523 Bacteria 1111
545 Ga0495648_0075932 3300046524 Bacteria 1931
546 Ga0495666_0020658 3300046526 Bacteria 3261
547 Ga0495666_0174480 3300046526 Bacteria 994
548 Ga0495652_0009824 3300046529 Bacteria 8674
549 Ga0495652_0062137 3300046529 Bacteria 3150
550 Ga0495652_0381484 3300046529 Bacteria 1002
551 Ga0495665_0013078 3300046531 Bacteria 4494
552 Ga0495665_0026036 3300046531 Bacteria 3142
553 Ga0495640_0027323 3300046533 Bacteria 4116
554 Ga0495640_0039590 3300046533 Bacteria 3306
555 Ga0495640_0085978 3300046533 Bacteria 2083
556 Ga0495587_0005187 3300046536 Bacteria 8514
557 Ga0495645_0290115 3300046543 Bacteria 1073
558 Ga0495667_0001836 3300046559 Bacteria 14089
559 Ga0495667_0263455 3300046559 Bacteria 1096
560 Ga0495667_0354623 3300046559 Bacteria 926
561 Ga0495656_0005971 3300046615 Bacteria 4236
562 Ga0495634_0016406 3300046642 Bacteria 5299
563 Ga0495625_0070430 3300046660 Bacteria 2455
564 Ga0495625_0200594 3300046660 Bacteria 1317
565 Ga0495635_0008770 3300046663 Bacteria 7060
566 Ga0495635_0241348 3300046663 Bacteria 1219
567 Ga0495635_0388504 3300046663 Bacteria 928
568 Ga0495657_0198990 3300046675 Bacteria 1222
569 Ga0495599_0004247 3300046678 Bacteria 8464
570 Ga0495623_0002702 3300046679 Bacteria 11722
571 Ga0495646_0003305 3300046680 Bacteria 10032
572 Ga0495647_0002950 3300046681 Bacteria 5395
573 Ga0495647_0018044 3300046681 Bacteria 2505
574 Ga0495658_0014556 3300046683 Bacteria 4023
575 Ga0495613_0074116 3300046689 Bacteria 2479
576 Ga0495613_0157226 3300046689 Bacteria 1619
577 Ga0495624_0004781 3300046690 Bacteria 9849
578 Ga0495624_0086224 3300046690 Bacteria 1939
579 Ga0495670_0001709 3300046691 Bacteria 10800
580 Ga0495670_0008540 3300046691 Bacteria 5043
581 Ga0495670_0084260 3300046691 Bacteria 1622
582 Ga0495600_0157468 3300046809 Bacteria 1469
583 Ga0495600_0309258 3300046809 Bacteria 996
584 Ga0495581_0013861 3300047315 Bacteria 4672
585 Ga0495581_0101832 3300047315 Bacteria 1669
586 Ga0495581_0158978 3300047315 Bacteria 1321
587 Ga0495604_0001315 3300047317 Bacteria 20297
588 Ga0495604_0093810 3300047317 Bacteria 2220
589 Ga0495674_0000145 3300047319 Bacteria 54755
590 Ga0495674_0106941 3300047319 Bacteria 2375
591 Ga0495672_0111331 3300047320 Bacteria 1469
592 Ga0495676_0015903 3300047321 Bacteria 6687
593 Ga0495676_0113249 3300047321 Bacteria 1986
594 Ga0495676_0130375 3300047321 Bacteria 1816
595 Ga0495676_0202922 3300047321 Bacteria 1377
596 Ga0495680_0003388 3300047322 Bacteria 15738
597 Ga0495680_0145384 3300047322 Bacteria 1732
598 Ga0495675_0003692 3300047444 Bacteria 9253
599 Ga0495675_0388210 3300047444 Bacteria 815
600 Ga0495677_0019390 3300047445 Bacteria 2466
601 Ga0495684_0000209 3300047471 Bacteria 45383
602 Ga0495684_0022282 3300047471 Bacteria 4877
603 Ga0495684_0114332 3300047471 Bacteria 2035
604 Ga0495684_0218547 3300047471 Bacteria 1398
605 Ga0495602_0010058 3300048088 Bacteria 9819
606 Ga0495602_0357651 3300048088 Bacteria 1052
607 Ga0496100_0039775 3300048903 Bacteria 2987
608 Ga0496100_0049795 3300048903 Bacteria 2711
609 Ga0496100_0117889 3300048903 Bacteria 1854
610 Ga0496100_0373458 3300048903 Bacteria 1082
611 Ga0496100_0451373 3300048903 Bacteria 986
612 Ga0496101_0003779 3300048904 Bacteria 9459
613 Ga0496101_0031548 3300048904 Bacteria 3726
614 Ga0496101_0371114 3300048904 Bacteria 1125
615 Ga0496102_0012833 3300048905 Bacteria 7252
616 Ga0496102_0017546 3300048905 Bacteria 6269
617 Ga0496102_0143856 3300048905 Bacteria 2237
618 Ga0496102_0169470 3300048905 Bacteria 2055
619 Ga0496102_0200919 3300048905 Bacteria 1879
620 Ga0496102_0593267 3300048905 Bacteria 1031
621 Ga0496103_0003334 3300048906 Bacteria 9820
622 Ga0496104_0002148 3300048907 Bacteria 17117
623 Ga0496104_0003136 3300048907 Bacteria 14255
624 Ga0496104_0009810 3300048907 Bacteria 8535
625 Ga0496104_0026954 3300048907 Bacteria 5313
626 Ga0496104_0042587 3300048907 Bacteria 4262
627 Ga0496104_0055314 3300048907 Bacteria 3752
628 Ga0496104_0104710 3300048907 Bacteria 2711
629 Ga0496104_0106466 3300048907 Bacteria 2687
630 Ga0496104_0232421 3300048907 Bacteria 1756
631 Ga0496105_0000882 3300048908 Bacteria 20534
632 Ga0496105_0012680 3300048908 Bacteria 6676
633 Ga0496105_0013528 3300048908 Bacteria 6482
634 Ga0496105_0017190 3300048908 Bacteria 5793
635 Ga0496105_0029423 3300048908 Bacteria 4496
636 Ga0496105_0043061 3300048908 Bacteria 3723
637 Ga0496105_0309730 3300048908 Bacteria 1268
638 Ga0496105_0421979 3300048908 Bacteria 1056
639 Ga0496106_0002149 3300048909 Bacteria 14729
640 Ga0496106_0002837 3300048909 Bacteria 12860
641 Ga0496106_0095642 3300048909 Bacteria 2298
642 Ga0496106_0193717 3300048909 Bacteria 1616
643 Ga0496107_0005939 3300048910 Bacteria 8367
644 Ga0496107_0010755 3300048910 Bacteria 6364
645 Ga0496107_0011930 3300048910 Bacteria 6068
646 Ga0496107_0033374 3300048910 Bacteria 3682
647 Ga0496108_0006835 3300048911 Bacteria 9230
648 Ga0496108_0011301 3300048911 Bacteria 7254
649 Ga0496108_0049348 3300048911 Bacteria 3520
650 Ga0496109_0005176 3300048912 Bacteria 10887
651 Ga0496109_0017543 3300048912 Bacteria 6275
652 Ga0496109_0022885 3300048912 Bacteria 5538
653 Ga0496109_0119498 3300048912 Bacteria 2454
654 Ga0496109_0128459 3300048912 Bacteria 2364
655 Ga0496109_0162856 3300048912 Bacteria 2090
656 Ga0496110_0004030 3300048913 Bacteria 11329
657 Ga0496110_0013474 3300048913 Bacteria 6761
658 Ga0496110_0034708 3300048913 Bacteria 4371
659 Ga0496110_0098102 3300048913 Bacteria 2625
660 Ga0496110_0187090 3300048913 Bacteria 1880
661 Ga0496110_0221215 3300048913 Bacteria 1722
662 Ga0496111_0010614 3300048914 Bacteria 6188
663 Ga0496111_0017179 3300048914 Bacteria 4998
664 Ga0496111_0175123 3300048914 Bacteria 1595
665 Ga0496111_0206854 3300048914 Bacteria 1458
666 Ga0496111_0273777 3300048914 Bacteria 1252
667 Ga0496111_0468431 3300048914 Bacteria 929
668 Ga0496112_0002737 3300048915 Bacteria 14280
669 Ga0496112_0008660 3300048915 Bacteria 9123
670 Ga0496112_0034196 3300048915 Bacteria 4945
671 Ga0496112_0057103 3300048915 Bacteria 3842
672 Ga0496112_0072266 3300048915 Bacteria 3410
673 Ga0496112_0093100 3300048915 Bacteria 2984
674 Ga0496112_0098327 3300048915 Bacteria 2896
675 Ga0496112_0157400 3300048915 Bacteria 2238
676 Ga0496112_0285303 3300048915 Bacteria 1597
677 Ga0496112_0327421 3300048915 Bacteria 1476
678 Ga0496113_0003871 3300048916 Bacteria 9062
679 Ga0496113_0009682 3300048916 Bacteria 6329
680 Ga0496113_0055224 3300048916 Bacteria 2976
681 Ga0496113_0406263 3300048916 Bacteria 1093
682 Ga0496113_0414392 3300048916 Bacteria 1082
683 Ga0496113_0486196 3300048916 Bacteria 991
684 Ga0496114_0245324 3300048917 Bacteria 1576
685 Ga0496114_0299955 3300048917 Bacteria 1418
686 Ga0496115_0001345 3300048918 Bacteria 17523
687 Ga0496115_0065665 3300048918 Bacteria 2931
688 Ga0496115_0198692 3300048918 Bacteria 1656
689 Ga0496115_0212947 3300048918 Bacteria 1596
690 Ga0496115_0434223 3300048918 Bacteria 1062
691 Ga0496117_0037727 3300048920 Bacteria 3595
692 Ga0496118_0078175 3300048921 Bacteria 2342
693 Ga0496125_0205690 3300048928 Bacteria 1284
694 Ga0496126_0001890 3300048929 Bacteria 30241
695 Ga0496126_0517092 3300048929 Bacteria 952
696 Ga0501290_000271 3300049513 Bacteria 8525
697 Ga0501292_000003 3300049515 Bacteria 161908
698 Ga0501294_000455 3300049517 Bacteria 4826
699 Ga0501300_000439 3300049523 Bacteria 6324
700 Ga0501032_0004263 3300049569 Bacteria 10800
701 Ga0501032_0021362 3300049569 Bacteria 4499
702 Ga0501032_0091875 3300049569 Bacteria 2013
703 Ga0501032_0099781 3300049569 Bacteria 1923
704 Ga0501032_0106862 3300049569 Bacteria 1853
705 Ga0501032_0140434 3300049569 Bacteria 1591
706 Ga0501032_0341181 3300049569 Bacteria 965
707 Ga0501032_0493815 3300049569 Bacteria 782
708 Ga0501033_0033047 3300049570 Bacteria 3884
709 Ga0501033_0043744 3300049570 Bacteria 3334
710 Ga0501033_0086125 3300049570 Bacteria 2300
711 Ga0501033_0110581 3300049570 Bacteria 2000
712 Ga0501033_0216789 3300049570 Bacteria 1363
713 Ga0501033_0258270 3300049570 Bacteria 1233
714 Ga0501034_0001899 3300049571 Bacteria 26478
715 Ga0501034_0024465 3300049571 Bacteria 6144
716 Ga0501034_0025674 3300049571 Bacteria 6000
717 Ga0501034_0045159 3300049571 Bacteria 4453
718 Ga0501034_0052705 3300049571 Bacteria 4098
719 Ga0501034_0081133 3300049571 Bacteria 3246
720 Ga0501034_0093965 3300049571 Bacteria 2995
721 Ga0501034_0143844 3300049571 Bacteria 2363
722 Ga0501034_0243790 3300049571 Bacteria 1742
723 Ga0501034_0571233 3300049571 Bacteria 1038
724 Ga0501036_0003218 3300049572 Bacteria 13028
725 Ga0501036_0020141 3300049572 Bacteria 5601
726 Ga0501036_0067993 3300049572 Bacteria 3014
727 Ga0501036_0075584 3300049572 Bacteria 2848
728 Ga0501036_0247731 3300049572 Bacteria 1493
729 Ga0501036_0648907 3300049572 Bacteria 874
730 Ga0501037_0229598 3300049573 Bacteria 1303
731 Ga0501037_0238688 3300049573 Bacteria 1274
732 Ga0501038_0050512 3300049574 Bacteria 3592
733 Ga0501038_0061324 3300049574 Bacteria 3216
734 Ga0501038_0100002 3300049574 Bacteria 2417
735 Ga0501038_0129631 3300049574 Bacteria 2072
736 Ga0501038_0153588 3300049574 Bacteria 1875
737 Ga0501038_0536318 3300049574 Bacteria 891
738 Ga0501038_0566408 3300049574 Bacteria 862
739 Ga0501039_0120913 3300049575 Bacteria 2052
740 Ga0501039_0138114 3300049575 Bacteria 1914
741 Ga0501040_0027148 3300049576 Bacteria 3853
742 Ga0501042_0018714 3300049578 Bacteria 4800
743 Ga0501042_0052098 3300049578 Bacteria 2919
744 Ga0501042_0176734 3300049578 Bacteria 1540
745 Ga0501042_0251988 3300049578 Bacteria 1274
746 Ga0501043_0000380 3300049579 Bacteria 40427
747 Ga0501043_0021924 3300049579 Bacteria 5009
748 Ga0501043_0030658 3300049579 Bacteria 4227
749 Ga0501043_0059130 3300049579 Bacteria 3007
750 Ga0501043_0085612 3300049579 Bacteria 2476
751 Ga0501043_0223860 3300049579 Bacteria 1455
752 Ga0501043_0291908 3300049579 Bacteria 1248
753 Ga0501046_0010856 3300049580 Bacteria 7807
754 Ga0501046_0011538 3300049580 Bacteria 7555
755 Ga0501046_0012127 3300049580 Bacteria 7348
756 Ga0501046_0266618 3300049580 Bacteria 1257
757 Ga0501046_0296737 3300049580 Bacteria 1181
758 Ga0501047_0007528 3300049581 Bacteria 10253
759 Ga0501047_0018522 3300049581 Bacteria 6677
760 Ga0501047_0020095 3300049581 Bacteria 6413
761 Ga0501047_0045295 3300049581 Bacteria 4253
762 Ga0501047_0091556 3300049581 Bacteria 2919
763 Ga0501047_0115158 3300049581 Bacteria 2570
764 Ga0501047_0133669 3300049581 Bacteria 2361
765 Ga0501047_0245573 3300049581 Bacteria 1639
766 Ga0501047_0304642 3300049581 Bacteria 1435
767 Ga0501047_0465015 3300049581 Bacteria 1093
768 Ga0501048_0000424 3300049582 Bacteria 29683
769 Ga0501048_0037378 3300049582 Bacteria 3486
770 Ga0501048_0241404 3300049582 Bacteria 1282
771 Ga0501067_0000224 3300049583 Bacteria 31442
772 Ga0501067_0003270 3300049583 Bacteria 8920
773 Ga0501067_0234834 3300049583 Bacteria 1020
774 Ga0501068_0006315 3300049584 Bacteria 6528
775 Ga0501069_0000251 3300049585 Bacteria 24244
776 Ga0501069_0034265 3300049585 Bacteria 2796
777 Ga0501069_0080190 3300049585 Bacteria 1838
778 Ga0501069_0336743 3300049585 Bacteria 888
779 Ga0501070_0003929 3300049586 Bacteria 12811
780 Ga0501070_0007814 3300049586 Bacteria 9066
781 Ga0501070_0009582 3300049586 Bacteria 8180
782 Ga0501070_0035482 3300049586 Bacteria 4167
783 Ga0501070_0077965 3300049586 Bacteria 2742
784 Ga0501070_0194580 3300049586 Bacteria 1666
785 Ga0501070_0574693 3300049586 Bacteria 900
786 Ga0501071_0024156 3300049587 Bacteria 4250
787 Ga0501071_0087704 3300049587 Bacteria 2283
788 Ga0501071_0281177 3300049587 Bacteria 1259
789 Ga0501072_0379588 3300049588 Bacteria 1121
790 Ga0501073_0005963 3300049589 Bacteria 9091
791 Ga0501073_0011271 3300049589 Bacteria 6540
792 Ga0501073_0035524 3300049589 Bacteria 3542
793 Ga0501073_0049686 3300049589 Bacteria 2940
794 Ga0501073_0111398 3300049589 Bacteria 1898
795 Ga0501073_0161388 3300049589 Bacteria 1553
796 Ga0501073_0194619 3300049589 Bacteria 1402
797 Ga0501073_0363937 3300049589 Bacteria 999
798 Ga0501074_0006850 3300049590 Bacteria 8232
799 Ga0501074_0015486 3300049590 Bacteria 5543
800 Ga0501074_0082702 3300049590 Bacteria 2302
801 Ga0501074_0104132 3300049590 Bacteria 2031
802 Ga0501074_0359330 3300049590 Bacteria 1033
803 Ga0501076_0347310 3300049592 Bacteria 1218
804 Ga0501077_0139924 3300049593 Bacteria 1535
805 Ga0501206_004121 3300049653 Bacteria 1845
806 Ga0501222_000807 3300049662 Bacteria 4505
807 Ga0501223_000796 3300049663 Bacteria 7476
808 Ga0501224_001001 3300049664 Bacteria 3662
809 Ga0501227_001098 3300049665 Bacteria 6021
810 Ga0501252_008839 3300049682 Bacteria 1165
811 Ga0501257_020712 3300049686 Bacteria 1546
812 Ga0501259_000913 3300049688 Bacteria 4870
813 Ga0501261_000066 3300049690 Bacteria 18533
814 Ga0501225_0016325 3300049705 Bacteria 2064
815 Ga0501079_0096855 3300049741 Bacteria 2287
816 Ga0501079_0377315 3300049741 Bacteria 1112
817 Ga0501079_0633420 3300049741 Bacteria 842
818 Ga0501080_0000112 3300049742 Bacteria 56408
819 Ga0501080_0003244 3300049742 Bacteria 14351
820 Ga0501080_0018241 3300049742 Bacteria 6494
821 Ga0501080_0056888 3300049742 Bacteria 3641
822 Ga0501080_0130513 3300049742 Bacteria 2326
823 Ga0501080_0225582 3300049742 Bacteria 1713
824 Ga0501083_0007146 3300049744 Bacteria 7928
825 Ga0501083_0010656 3300049744 Bacteria 6469
826 Ga0501083_0046768 3300049744 Bacteria 2925
827 Ga0501083_0068040 3300049744 Bacteria 2370
828 Ga0501083_0173071 3300049744 Bacteria 1411
829 Ga0501241_051067 3300049758 Bacteria 817
830 Ga0501279_000040 3300049775 Bacteria 29044
831 Ga0501280_000144 3300049776 Bacteria 18384
832 Ga0501281_00385 3300049777 Bacteria 4428
833 Ga0501282_000071 3300049778 Bacteria 12013
834 Ga0501035_0014537 3300049822 Bacteria 7267
835 Ga0501035_0025766 3300049822 Bacteria 5390
836 Ga0501035_0027254 3300049822 Bacteria 5222
837 Ga0501035_0029360 3300049822 Bacteria 5014
838 Ga0501035_0351949 3300049822 Bacteria 1232
839 Ga0501044_0000658 3300049823 Bacteria 41690
840 Ga0501044_0003453 3300049823 Bacteria 17799
841 Ga0501044_0020081 3300049823 Bacteria 7133
842 Ga0501044_0025440 3300049823 Bacteria 6273
843 Ga0501044_0057121 3300049823 Bacteria 4005
844 Ga0501044_0062271 3300049823 Bacteria 3813
845 Ga0501044_0068185 3300049823 Bacteria 3624
846 Ga0501044_0193914 3300049823 Bacteria 1992
847 Ga0501044_0217258 3300049823 Bacteria 1863
848 Ga0501044_0279089 3300049823 Bacteria 1605
849 Ga0501044_0751910 3300049823 Bacteria 857
850 Ga0501045_0056418 3300049824 Bacteria 2872
851 Ga0501045_0093089 3300049824 Bacteria 2229
852 nmdc:mga03683_27069_c1 3300050489 Bacteria 2267
853 nmdc:mga00v17_385813_c1 3300050491 Bacteria 911
854 nmdc:mga0yw44_30437_c1 3300050492 Bacteria 3128
855 nmdc:mga0k408_2287_c1 3300050493 Bacteria 10222
856 nmdc:mga0k408_95314_c1 3300050493 Bacteria 1751
857 nmdc:mga05p37_43907_c1 3300050507 Bacteria 5499
858 nmdc:mga05p37_751430_c1 3300050507 Bacteria 1075
859 nmdc:mga09592_503163_c1 3300050508 Bacteria 1043
860 nmdc:mga06r32_207952_c1 3300050510 Bacteria 1945
861 nmdc:mga06r32_213150_c1 3300050510 Bacteria 1919
862 nmdc:mga08y16_303449_c1 3300050511 Bacteria 1645
863 nmdc:mga08y16_44774_c1 3300050511 Bacteria 4638
864 nmdc:mga08y16_636227_c1 3300050511 Bacteria 1072
865 nmdc:mga0n895_125963_c1 3300050512 Bacteria 2585
866 nmdc:mga0n895_2174_c1 3300050512 Bacteria 15166
867 nmdc:mga0n895_72521_c1 3300050512 Bacteria 3416
868 nmdc:mga0rr50_19771_c1 3300050513 Bacteria 4555
869 nmdc:mga08x19_59086_c1 3300050514 Bacteria 2482
870 nmdc:mga0a205_325893_c1 3300050515 Bacteria 1406
871 nmdc:mga0a205_62019_c1 3300050515 Bacteria 3612
872 Ga0495601_0000947 3300053077 Bacteria 15805
873 Ga0495601_0015896 3300053077 Bacteria 4554
874 Ga0495601_0028555 3300053077 Bacteria 3456
875 Ga0495601_0031852 3300053077 Bacteria 3279
876 Ga0495612_0000797 3300053078 Bacteria 12820
877 Ga0495612_0004285 3300053078 Bacteria 5921
878 Ga0495612_0059162 3300053078 Bacteria 1584
879 Ga0495612_0092251 3300053078 Bacteria 1284
880 Ga0495655_0017666 3300053083 Bacteria 1557
881 Ga0495595_0001078 3300053084 Bacteria 10554
882 Ga0495595_0035101 3300053084 Bacteria 2271
883 Ga0495595_0173151 3300053084 Bacteria 1069
884 Ga0495595_0285484 3300053084 Bacteria 829
885 Ga0495619_0001656 3300053085 Bacteria 14704
886 Ga0495619_0030530 3300053085 Bacteria 3489
887 Ga0500643_019996 3300053087 Bacteria 2197
888 Ga0500647_0131142 3300053091 Bacteria 1181
889 Ga0500555_044219 3300053103 Bacteria 1233
890 Ga0500556_0017319 3300053104 Bacteria 2256
891 Ga0500556_0117629 3300053104 Bacteria 1035
892 Ga0500642_0086461 3300053130 Bacteria 1445
893 Ga0500655_000033 3300053133 Bacteria 38482
894 Ga0500658_0002175 3300053134 Bacteria 7615
895 Ga0500568_0000406 3300053139 Bacteria 32845
896 Ga0500590_013244 3300053148 Bacteria 4228
897 Ga0500604_0000583 3300053151 Bacteria 10047
898 Ga0500616_0000084 3300053153 Bacteria 195562
899 Ga0500616_0000161 3300053153 Bacteria 111424
900 Ga0500616_0000805 3300053153 Bacteria 35836
901 Ga0500616_0011661 3300053153 Bacteria 5178
902 Ga0500616_0231333 3300053153 Bacteria 800
903 Ga0500587_000809 3300053739 Bacteria 4080
904 Ga0501084_0004384 3300054114 Bacteria 11505
905 Ga0501084_0076860 3300054114 Bacteria 2799
906 Ga0501084_0090968 3300054114 Bacteria 2562
907 Ga0501084_0094190 3300054114 Bacteria 2514
908 Ga0501084_0114033 3300054114 Bacteria 2272
909 Ga0501082_0006226 3300060353 Bacteria 10361
910 Ga0501082_0011332 3300060353 Bacteria 7664
911 Ga0501082_0111262 3300060353 Bacteria 2370
912 Ga0501082_0128860 3300060353 Bacteria 2195
913 Ga0501082_0384604 3300060353 Bacteria 1224
914 Ga0501082_0503484 3300060353 Bacteria 1059
915 Ga0530510_0097350 3300061734 Bacteria 2151

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300034820 Ga0373959_0045163 Ga0373959_0045163_348_926 178
2 3300053153 Ga0500616_0011661 Ga0500616_0011661_431_1126 191
3 3300005458 Ga0070681_10167330 Ga0070681_101673302 192
4 3300006871 Ga0075434_100074790 Ga0075434_1000747903 192
5 3300046543 Ga0495645_0290115 Ga0495645_0290115_15_701 194
6 3300039447 Ga0436361_0009329 Ga0436361_0009329_61_795 195
7 3300046517 Ga0495630_0121908 Ga0495630_0121908_1243_1968 195
8 3300035695 Ga0373927_0230645 Ga0373927_0230645_173_913 196
9 3300035725 Ga0373947_0131845 Ga0373947_0131845_145_885 196
10 3300037068 Ga0373925_0491408 Ga0373925_0491408_222_962 196
11 3300046459 Ga0495629_0015778 Ga0495629_0015778_3354_4094 196
12 3300046462 Ga0495651_0085272 Ga0495651_0085272_921_1661 196
13 3300046477 Ga0495664_0231080 Ga0495664_0231080_196_936 196
14 3300046511 Ga0495608_0093221 Ga0495608_0093221_472_1212 196
15 3300046516 Ga0495628_0341313 Ga0495628_0341313_220_960 196
16 3300046529 Ga0495652_0062137 Ga0495652_0062137_786_1526 196
17 3300046533 Ga0495640_0039590 Ga0495640_0039590_52_792 196
18 3300046559 Ga0495667_0263455 Ga0495667_0263455_24_764 196
19 3300046809 Ga0495600_0157468 Ga0495600_0157468_599_1339 196
20 3300047317 Ga0495604_0093810 Ga0495604_0093810_545_1285 196
21 3300047322 Ga0495680_0145384 Ga0495680_0145384_21_761 196
22 3300047471 Ga0495684_0218547 Ga0495684_0218547_200_940 196
23 3300048088 Ga0495602_0357651 Ga0495602_0357651_10_750 196
24 3300053078 Ga0495612_0092251 Ga0495612_0092251_246_986 196
25 3300053084 Ga0495595_0035101 Ga0495595_0035101_550_1290 196
26 3300021388 Ga0213875_10150129 Ga0213875_101501292 197
27 3300037853 Ga0436364_0526272 Ga0436364_0526272_776_1507 197
28 3300039450 Ga0436363_0211911 Ga0436363_0211911_45030_45761 197
29 3300050512 nmdc:mga0n895_72521_c1 nmdc:mga0n895_72521_c1_2296_3009 197
30 3300039062 Ga0400483_206045 Ga0400483_206045_1049_1687 198
31 3300049571 Ga0501034_0025674 Ga0501034_0025674_3115_3801 198
32 3300006871 Ga0075434_100000986 Ga0075434_1000009864 199
33 3300007076 Ga0075435_100036045 Ga0075435_1000360453 199
34 3300050512 nmdc:mga0n895_2174_c1 nmdc:mga0n895_2174_c1_3892_4569 199
35 3300050513 nmdc:mga0rr50_19771_c1 nmdc:mga0rr50_19771_c1_775_1452 199
36 3300054114 Ga0501084_0090968 Ga0501084_0090968_1476_2228 199
37 3300031090 Ga0265760_10026725 Ga0265760_100267253 200
38 3300048916 Ga0496113_0414392 Ga0496113_0414392_252_932 200
39 3300048918 Ga0496115_0212947 Ga0496115_0212947_188_928 200
40 3300037312 Ga0395899_0000137 Ga0395899_0000137_81509_82177 201
41 3300037418 Ga0395900_0000108 Ga0395900_0000108_91127_91795 201
42 3300037466 Ga0395898_0000632 Ga0395898_0000632_29748_30416 201
43 3300037471 Ga0395905_0000780 Ga0395905_0000780_28412_29080 201
44 3300038443 Ga0395901_0000050 Ga0395901_0000050_111984_112652 201
45 3300039447 Ga0436361_0770494 Ga0436361_0770494_513_1199 201
46 3300005341 Ga0070691_10016128 Ga0070691_100161284 202
47 3300005441 Ga0070700_100025794 Ga0070700_1000257943 202
48 3300005444 Ga0070694_100187145 Ga0070694_1001871452 202
49 3300006175 Ga0070712_100511112 Ga0070712_1005111122 202
50 3300026075 Ga0207708_10036299 Ga0207708_100362992 202
51 3300046529 Ga0495652_0381484 Ga0495652_0381484_192_911 202
52 3300046533 Ga0495640_0085978 Ga0495640_0085978_1305_2024 202
53 3300047319 Ga0495674_0106941 Ga0495674_0106941_265_984 202
54 3300049589 Ga0501073_0363937 Ga0501073_0363937_189_875 202
55 3300053078 Ga0495612_0059162 Ga0495612_0059162_837_1556 202
56 3300053085 Ga0495619_0030530 Ga0495619_0030530_1464_2183 202
57 3300046477 Ga0495664_0014194 Ga0495664_0014194_2282_3022 203
58 3300005445 Ga0070708_100021449 Ga0070708_1000214493 204
59 3300005468 Ga0070707_100332576 Ga0070707_1003325762 204
60 3300005471 Ga0070698_100003881 Ga0070698_1000038816 204
61 3300005518 Ga0070699_100082691 Ga0070699_1000826913 204
62 3300006847 Ga0075431_100058054 Ga0075431_1000580544 204
63 3300006852 Ga0075433_10124576 Ga0075433_101245762 204
64 3300009553 Ga0105249_10416469 Ga0105249_104164692 204
65 3300025922 Ga0207646_10214716 Ga0207646_102147162 204
66 3300025933 Ga0207706_10278816 Ga0207706_102788162 204
67 3300025961 Ga0207712_10079828 Ga0207712_100798283 204
68 3300035120 Ga0373957_0204054 Ga0373957_0204054_52_732 204
69 3300049580 Ga0501046_0266618 Ga0501046_0266618_277_960 204
70 3300050511 nmdc:mga08y16_303449_c1 nmdc:mga08y16_303449_c1_387_1070 204
71 3300050515 nmdc:mga0a205_325893_c1 nmdc:mga0a205_325893_c1_630_1310 204
72 3300039447 Ga0436361_0231853 Ga0436361_0231853_147_887 205
73 3300047315 Ga0495581_0101832 Ga0495581_0101832_942_1628 205
74 3300005435 Ga0070714_100432594 Ga0070714_1004325941 206
75 3300013307 Ga0157372_10276084 Ga0157372_102760843 206
76 3300035111 Ga0373923_0050859 Ga0373923_0050859_15_755 206
77 3300035117 Ga0373953_0213947 Ga0373953_0213947_80_820 206
78 3300035118 Ga0373954_0039018 Ga0373954_0039018_1295_2035 206
79 3300035410 Ga0373924_0043034 Ga0373924_0043034_935_1675 206
80 3300035724 Ga0373933_0024606 Ga0373933_0024606_2299_3039 206
81 3300035725 Ga0373947_0091793 Ga0373947_0091793_384_1124 206
82 3300036401 Ga0373937_0005793 Ga0373937_0005793_7388_8128 206
83 3300037068 Ga0373925_0018395 Ga0373925_0018395_2215_2955 206
84 3300038443 Ga0395901_0390029 Ga0395901_0390029_611_1360 206
85 3300046454 Ga0495592_0008885 Ga0495592_0008885_1351_2091 206
86 3300046459 Ga0495629_0001636 Ga0495629_0001636_5350_6090 206
87 3300046462 Ga0495651_0000860 Ga0495651_0000860_8170_8910 206
88 3300046463 Ga0495653_0002396 Ga0495653_0002396_2693_3433 206
89 3300046511 Ga0495608_0002790 Ga0495608_0002790_9880_10620 206
90 3300046516 Ga0495628_0016517 Ga0495628_0016517_2087_2827 206
91 3300046529 Ga0495652_0009824 Ga0495652_0009824_1967_2707 206
92 3300046533 Ga0495640_0027323 Ga0495640_0027323_3334_4074 206
93 3300046536 Ga0495587_0005187 Ga0495587_0005187_1726_2466 206
94 3300046559 Ga0495667_0001836 Ga0495667_0001836_8395_9135 206
95 3300046642 Ga0495634_0016406 Ga0495634_0016406_814_1554 206
96 3300046663 Ga0495635_0008770 Ga0495635_0008770_4107_4847 206
97 3300046678 Ga0495599_0004247 Ga0495599_0004247_2814_3554 206
98 3300046679 Ga0495623_0002702 Ga0495623_0002702_5035_5775 206
99 3300046680 Ga0495646_0003305 Ga0495646_0003305_7451_8191 206
100 3300047317 Ga0495604_0001315 Ga0495604_0001315_18961_19701 206
101 3300047319 Ga0495674_0000145 Ga0495674_0000145_18697_19437 206
102 3300047321 Ga0495676_0130375 Ga0495676_0130375_180_920 206
103 3300047322 Ga0495680_0003388 Ga0495680_0003388_4089_4829 206
104 3300047444 Ga0495675_0003692 Ga0495675_0003692_6156_6896 206
105 3300047471 Ga0495684_0022282 Ga0495684_0022282_3885_4625 206
106 3300048088 Ga0495602_0010058 Ga0495602_0010058_4021_4761 206
107 3300053077 Ga0495601_0000947 Ga0495601_0000947_8043_8783 206
108 3300053078 Ga0495612_0004285 Ga0495612_0004285_4728_5468 206
109 3300053084 Ga0495595_0001078 Ga0495595_0001078_4902_5642 206
110 3300025981 Ga0207640_10591692 Ga0207640_105916921 207
111 3300047320 Ga0495672_0111331 Ga0495672_0111331_374_1102 207
112 3300005347 Ga0070668_100397584 Ga0070668_1003975842 209
113 3300005354 Ga0070675_100061783 Ga0070675_1000617832 209
114 3300005356 Ga0070674_100016308 Ga0070674_1000163083 209
115 3300053153 Ga0500616_0000084 Ga0500616_0000084_167414_168115 209
116 3300031239 Ga0265328_10070937 Ga0265328_100709372 210
117 3300031242 Ga0265329_10046276 Ga0265329_100462762 210
118 3300031249 Ga0265339_10058674 Ga0265339_100586742 210
119 3300031250 Ga0265331_10002807 Ga0265331_100028078 210
120 3300031595 Ga0265313_10000021 Ga0265313_1000002127 210
121 3300031712 Ga0265342_10065920 Ga0265342_100659202 210
122 3300035083 Ga0373926_0005063 Ga0373926_0005063_145_831 210
123 3300035116 Ga0373945_0012237 Ga0373945_0012237_683_1369 210
124 3300035170 Ga0373943_0000038 Ga0373943_0000038_19456_20142 210
125 3300035695 Ga0373927_0000651 Ga0373927_0000651_14399_15085 210
126 3300035725 Ga0373947_0000024 Ga0373947_0000024_55816_56502 210
127 3300046459 Ga0495629_0412197 Ga0495629_0412197_117_803 210
128 3300046472 Ga0495580_0082128 Ga0495580_0082128_1401_2087 210
129 3300046475 Ga0495639_0029254 Ga0495639_0029254_129_815 210
130 3300046526 Ga0495666_0174480 Ga0495666_0174480_229_915 210
131 3300046531 Ga0495665_0013078 Ga0495665_0013078_3416_4102 210
132 3300046683 Ga0495658_0014556 Ga0495658_0014556_1807_2493 210
133 3300046690 Ga0495624_0004781 Ga0495624_0004781_3526_4212 210
134 3300047315 Ga0495581_0013861 Ga0495581_0013861_1013_1699 210
135 3300047315 Ga0495581_0158978 Ga0495581_0158978_180_866 210
136 3300047321 Ga0495676_0202922 Ga0495676_0202922_395_1081 210
137 3300047471 Ga0495684_0000209 Ga0495684_0000209_12198_12884 210
138 iso_pu_bacteria 2643221547 2643755515 212
139 3300031247 Ga0265340_10029387 Ga0265340_100293871 213
140 3300045051 Ga0451576_0001224 Ga0451576_0001224_40699_41382 213
141 3300045051 Ga0451576_0012315 Ga0451576_0012315_8600_9283 213
142 3300045051 Ga0451576_0186575 Ga0451576_0186575_166_849 213
143 3300046461 Ga0495641_0037738 Ga0495641_0037738_10_705 213
144 3300005337 Ga0070682_100094964 Ga0070682_1000949642 214
145 3300009101 Ga0105247_10151643 Ga0105247_101516432 214
146 3300013297 Ga0157378_10382343 Ga0157378_103823432 214
147 3300014968 Ga0157379_10581161 Ga0157379_105811612 214
148 3300035692 Ga0373935_0274025 Ga0373935_0274025_204_920 214
149 3300035695 Ga0373927_0263089 Ga0373927_0263089_37_753 214
150 3300035725 Ga0373947_0094215 Ga0373947_0094215_121_837 214
151 3300036401 Ga0373937_0580248 Ga0373937_0580248_90_770 214
152 3300046476 Ga0495662_0215780 Ga0495662_0215780_188_904 214
153 3300046492 Ga0495585_0011012 Ga0495585_0011012_3257_3973 214
154 3300046501 Ga0495607_0004756 Ga0495607_0004756_2751_3467 214
155 3300046517 Ga0495630_0102927 Ga0495630_0102927_526_1242 214
156 3300046520 Ga0495637_0016075 Ga0495637_0016075_114_830 214
157 3300046523 Ga0495644_0003154 Ga0495644_0003154_950_1666 214
158 3300046531 Ga0495665_0026036 Ga0495665_0026036_1375_2091 214
159 3300046615 Ga0495656_0005971 Ga0495656_0005971_2738_3454 214
160 3300046663 Ga0495635_0241348 Ga0495635_0241348_57_773 214
161 3300046681 Ga0495647_0002950 Ga0495647_0002950_4653_5369 214
162 3300046690 Ga0495624_0086224 Ga0495624_0086224_867_1583 214
163 3300046691 Ga0495670_0008540 Ga0495670_0008540_2774_3490 214
164 3300047321 Ga0495676_0113249 Ga0495676_0113249_1257_1973 214
165 3300047471 Ga0495684_0114332 Ga0495684_0114332_1068_1784 214
166 3300049569 Ga0501032_0021362 Ga0501032_0021362_1469_2128 214
167 3300049569 Ga0501032_0140434 Ga0501032_0140434_870_1529 214
168 3300049570 Ga0501033_0033047 Ga0501033_0033047_1531_2190 214
169 3300049571 Ga0501034_0052705 Ga0501034_0052705_222_881 214
170 3300049571 Ga0501034_0081133 Ga0501034_0081133_1666_2325 214
171 3300049574 Ga0501038_0061324 Ga0501038_0061324_2325_2984 214
172 3300049574 Ga0501038_0129631 Ga0501038_0129631_669_1328 214
173 3300049579 Ga0501043_0291908 Ga0501043_0291908_549_1208 214
174 3300049581 Ga0501047_0045295 Ga0501047_0045295_3313_3972 214
175 3300049581 Ga0501047_0304642 Ga0501047_0304642_262_921 214
176 3300049585 Ga0501069_0080190 Ga0501069_0080190_838_1497 214
177 3300049586 Ga0501070_0035482 Ga0501070_0035482_2738_3397 214
178 3300049586 Ga0501070_0077965 Ga0501070_0077965_1423_2082 214
179 3300049586 Ga0501070_0194580 Ga0501070_0194580_87_746 214
180 3300049589 Ga0501073_0194619 Ga0501073_0194619_618_1277 214
181 3300049590 Ga0501074_0082702 Ga0501074_0082702_1254_1913 214
182 3300049741 Ga0501079_0377315 Ga0501079_0377315_86_757 214
183 3300049742 Ga0501080_0056888 Ga0501080_0056888_293_952 214
184 3300049823 Ga0501044_0057121 Ga0501044_0057121_1435_2094 214
185 3300049823 Ga0501044_0193914 Ga0501044_0193914_274_933 214
186 3300053077 Ga0495601_0015896 Ga0495601_0015896_2854_3570 214
187 3300053078 Ga0495612_0000797 Ga0495612_0000797_1788_2504 214
188 3300053085 Ga0495619_0001656 Ga0495619_0001656_2858_3574 214
189 iso_pu_bacteria 2508501050 2508735756 214
190 iso_pu_bacteria 2738541317 2738946168 214
191 iso_pu_bacteria 2775506901 2776259030 214
192 iso_pu_bacteria 2835312727 2835313563 214
193 iso_pu_bacteria 2882456835 2882461521 214
194 iso_pu_bacteria 2884298095 2884299721 214
195 iso_pu_bacteria 2913308742 2913311247 214
196 3300004798 Ga0058859_11244916 Ga0058859_112449161 215
197 3300005340 Ga0070689_100179282 Ga0070689_1001792821 215
198 3300005347 Ga0070668_100000539 Ga0070668_1000005394 215
199 3300005366 Ga0070659_100209567 Ga0070659_1002095672 215
200 3300005367 Ga0070667_100207098 Ga0070667_1002070982 215
201 3300005844 Ga0068862_100001001 Ga0068862_10000100112 215
202 3300006178 Ga0075367_10298417 Ga0075367_102984172 215
203 3300009551 Ga0105238_10416014 Ga0105238_104160141 215
204 3300010159 Ga0099796_10010288 Ga0099796_100102882 215
205 3300013105 Ga0157369_10007581 Ga0157369_100075813 215
206 3300013306 Ga0163162_10114980 Ga0163162_101149802 215
207 3300021377 Ga0213874_10062776 Ga0213874_100627762 215
208 3300025912 Ga0207707_10150528 Ga0207707_101505282 215
209 3300025915 Ga0207693_10017330 Ga0207693_100173307 215
210 3300025915 Ga0207693_10078129 Ga0207693_100781291 215
211 3300025928 Ga0207700_10023911 Ga0207700_100239115 215
212 3300025931 Ga0207644_10351399 Ga0207644_103513992 215
213 3300025972 Ga0207668_10007115 Ga0207668_100071154 215
214 3300025986 Ga0207658_10163505 Ga0207658_101635052 215
215 3300028380 Ga0268265_10000975 Ga0268265_100009752 215
216 3300031665 Ga0316575_10106133 Ga0316575_101061332 215
217 3300032133 Ga0316583_10001287 Ga0316583_100012878 215
218 3300032168 Ga0316593_10033295 Ga0316593_100332952 215
219 3300033524 Ga0316592_1012612 Ga0316592_10126122 215
220 3300033524 Ga0316592_1056016 Ga0316592_10560161 215
221 3300035111 Ga0373923_0085332 Ga0373923_0085332_368_1075 215
222 3300035113 Ga0373936_0067593 Ga0373936_0067593_682_1368 215
223 3300037853 Ga0436364_1108265 Ga0436364_1108265_1168_1875 215
224 3300039062 Ga0400483_136809 Ga0400483_136809_289_990 215
225 3300039438 Ga0436360_0048356 Ga0436360_0048356_44_721 215
226 3300039450 Ga0436363_0576058 Ga0436363_0576058_620_1297 215
227 3300042005 Ga0439448_0160677 Ga0439448_0160677_33_707 215
228 3300044673 Ga0453683_0002196 Ga0453683_0002196_7592_8299 215
229 3300044712 Ga0453684_0028704 Ga0453684_0028704_1752_2459 215
230 3300045051 Ga0451576_0004466 Ga0451576_0004466_8711_9418 215
231 3300049569 Ga0501032_0004263 Ga0501032_0004263_2130_2819 215
232 3300049569 Ga0501032_0091875 Ga0501032_0091875_898_1572 215
233 3300049569 Ga0501032_0099781 Ga0501032_0099781_63_737 215
234 3300049569 Ga0501032_0493815 Ga0501032_0493815_82_756 215
235 3300049570 Ga0501033_0043744 Ga0501033_0043744_2038_2727 215
236 3300049570 Ga0501033_0216789 Ga0501033_0216789_198_872 215
237 3300049571 Ga0501034_0001899 Ga0501034_0001899_21840_22514 215
238 3300049571 Ga0501034_0024465 Ga0501034_0024465_3185_3859 215
239 3300049571 Ga0501034_0143844 Ga0501034_0143844_1325_1999 215
240 3300049571 Ga0501034_0243790 Ga0501034_0243790_611_1285 215
241 3300049571 Ga0501034_0571233 Ga0501034_0571233_203_892 215
242 3300049572 Ga0501036_0003218 Ga0501036_0003218_4664_5338 215
243 3300049572 Ga0501036_0020141 Ga0501036_0020141_2633_3307 215
244 3300049572 Ga0501036_0247731 Ga0501036_0247731_267_956 215
245 3300049574 Ga0501038_0153588 Ga0501038_0153588_162_836 215
246 3300049575 Ga0501039_0120913 Ga0501039_0120913_1211_1885 215
247 3300049578 Ga0501042_0176734 Ga0501042_0176734_731_1405 215
248 3300049578 Ga0501042_0251988 Ga0501042_0251988_145_819 215
249 3300049579 Ga0501043_0000380 Ga0501043_0000380_22196_22870 215
250 3300049579 Ga0501043_0021924 Ga0501043_0021924_3563_4237 215
251 3300049579 Ga0501043_0030658 Ga0501043_0030658_2750_3424 215
252 3300049579 Ga0501043_0059130 Ga0501043_0059130_869_1558 215
253 3300049580 Ga0501046_0010856 Ga0501046_0010856_3283_3972 215
254 3300049580 Ga0501046_0012127 Ga0501046_0012127_788_1462 215
255 3300049581 Ga0501047_0018522 Ga0501047_0018522_4658_5332 215
256 3300049581 Ga0501047_0020095 Ga0501047_0020095_3446_4120 215
257 3300049581 Ga0501047_0115158 Ga0501047_0115158_1426_2115 215
258 3300049582 Ga0501048_0000424 Ga0501048_0000424_24293_24967 215
259 3300049582 Ga0501048_0241404 Ga0501048_0241404_527_1201 215
260 3300049583 Ga0501067_0234834 Ga0501067_0234834_84_773 215
261 3300049585 Ga0501069_0000251 Ga0501069_0000251_15688_16377 215
262 3300049586 Ga0501070_0003929 Ga0501070_0003929_202_891 215
263 3300049586 Ga0501070_0007814 Ga0501070_0007814_824_1498 215
264 3300049586 Ga0501070_0009582 Ga0501070_0009582_6631_7305 215
265 3300049587 Ga0501071_0087704 Ga0501071_0087704_846_1520 215
266 3300049589 Ga0501073_0005963 Ga0501073_0005963_6400_7089 215
267 3300049589 Ga0501073_0049686 Ga0501073_0049686_295_969 215
268 3300049590 Ga0501074_0006850 Ga0501074_0006850_2994_3668 215
269 3300049590 Ga0501074_0015486 Ga0501074_0015486_1621_2310 215
270 3300049590 Ga0501074_0359330 Ga0501074_0359330_283_957 215
271 3300049592 Ga0501076_0347310 Ga0501076_0347310_284_943 215
272 3300049741 Ga0501079_0633420 Ga0501079_0633420_99_788 215
273 3300049742 Ga0501080_0000112 Ga0501080_0000112_23297_23971 215
274 3300049742 Ga0501080_0003244 Ga0501080_0003244_11251_11940 215
275 3300049742 Ga0501080_0018241 Ga0501080_0018241_4980_5654 215
276 3300049744 Ga0501083_0007146 Ga0501083_0007146_2587_3261 215
277 3300049744 Ga0501083_0010656 Ga0501083_0010656_3994_4683 215
278 3300049822 Ga0501035_0014537 Ga0501035_0014537_2453_3127 215
279 3300049822 Ga0501035_0029360 Ga0501035_0029360_3465_4154 215
280 3300049823 Ga0501044_0003453 Ga0501044_0003453_11015_11689 215
281 3300049823 Ga0501044_0025440 Ga0501044_0025440_1562_2251 215
282 3300049823 Ga0501044_0062271 Ga0501044_0062271_2554_3228 215
283 3300049823 Ga0501044_0279089 Ga0501044_0279089_131_805 215
284 3300049823 Ga0501044_0751910 Ga0501044_0751910_28_702 215
285 3300050510 nmdc:mga06r32_207952_c1 nmdc:mga06r32_207952_c1_372_1052 215
286 3300053087 Ga0500643_019996 Ga0500643_019996_158_835 215
287 3300053103 Ga0500555_044219 Ga0500555_044219_316_1017 215
288 3300054114 Ga0501084_0114033 Ga0501084_0114033_1013_1702 215
289 3300060353 Ga0501082_0006226 Ga0501082_0006226_8110_8799 215
290 3300060353 Ga0501082_0503484 Ga0501082_0503484_308_982 215
291 iso_pu_bacteria 2617270889 2617913383 215
292 iso_pu_bacteria 2831426010 2831428310 215
293 iso_pu_bacteria 2848694841 2848698472 215
294 iso_pu_bacteria 2849660919 2849666178 215
295 iso_pu_bacteria 2886627955 2886633913 215
296 iso_pu_bacteria 2913844669 2913845598 215
297 iso_pu_bacteria 2913912277 2913917531 215
298 iso_pu_bacteria 2913939268 2913941558 215
299 iso_pu_bacteria 2919450847 2919455263 215
300 iso_pu_bacteria 642555144 642600782 215
301 3300005530 Ga0070679_100245169 Ga0070679_1002451692 216
302 3300005841 Ga0068863_100523847 Ga0068863_1005238472 216
303 3300006852 Ga0075433_10052600 Ga0075433_100526004 216
304 3300009094 Ga0111539_10335230 Ga0111539_103352301 216
305 3300025915 Ga0207693_10042503 Ga0207693_100425034 216
306 3300025929 Ga0207664_10286062 Ga0207664_102860622 216
307 3300031247 Ga0265340_10022791 Ga0265340_100227913 216
308 3300031249 Ga0265339_10195298 Ga0265339_101952981 216
309 3300031691 Ga0316579_10153587 Ga0316579_101535872 216
310 3300031711 Ga0265314_10000279 Ga0265314_1000027924 216
311 3300031711 Ga0265314_10025954 Ga0265314_100259545 216
312 3300035398 Ga0316574_0473080 Ga0316574_0473080_77_751 216
313 3300037312 Ga0395899_0125111 Ga0395899_0125111_936_1613 216
314 3300037418 Ga0395900_0018679 Ga0395900_0018679_4318_4995 216
315 3300037466 Ga0395898_0024358 Ga0395898_0024358_1557_2234 216
316 3300038443 Ga0395901_0051291 Ga0395901_0051291_2535_3212 216
317 3300046675 Ga0495657_0198990 Ga0495657_0198990_495_1193 216
318 3300049574 Ga0501038_0536318 Ga0501038_0536318_43_720 216
319 3300049581 Ga0501047_0465015 Ga0501047_0465015_214_891 216
320 3300049589 Ga0501073_0035524 Ga0501073_0035524_2762_3439 216
321 3300049744 Ga0501083_0068040 Ga0501083_0068040_1210_1887 216
322 3300050511 nmdc:mga08y16_44774_c1 nmdc:mga08y16_44774_c1_228_941 216
323 3300060353 Ga0501082_0128860 Ga0501082_0128860_58_735 216
324 3300002067 JGI24735J21928_10007291 JGI24735J21928_100072912 217
325 3300003792 Ga0055540_1006853 Ga0055540_10068535 217
326 3300005327 Ga0070658_10339213 Ga0070658_103392131 217
327 3300005339 Ga0070660_100000064 Ga0070660_10000006464 217
328 3300005339 Ga0070660_100276101 Ga0070660_1002761012 217
329 3300005339 Ga0070660_100412668 Ga0070660_1004126682 217
330 3300005436 Ga0070713_100368594 Ga0070713_1003685942 217
331 3300005455 Ga0070663_100050356 Ga0070663_1000503564 217
332 3300005455 Ga0070663_100645155 Ga0070663_1006451552 217
333 3300005458 Ga0070681_10024397 Ga0070681_100243972 217
334 3300005458 Ga0070681_10194105 Ga0070681_101941052 217
335 3300005468 Ga0070707_100136600 Ga0070707_1001366002 217
336 3300005530 Ga0070679_100108824 Ga0070679_1001088242 217
337 3300005536 Ga0070697_100298596 Ga0070697_1002985962 217
338 3300005539 Ga0068853_100784584 Ga0068853_1007845841 217
339 3300006871 Ga0075434_100465951 Ga0075434_1004659512 217
340 3300009147 Ga0114129_11134092 Ga0114129_111340922 217
341 3300013104 Ga0157370_10028926 Ga0157370_100289265 217
342 3300014325 Ga0163163_10005537 Ga0163163_1000553710 217
343 3300021361 Ga0213872_10014988 Ga0213872_100149882 217
344 3300025910 Ga0207684_10479254 Ga0207684_104792541 217
345 3300035170 Ga0373943_0084078 Ga0373943_0084078_700_1383 217
346 3300035695 Ga0373927_0025823 Ga0373927_0025823_2934_3626 217
347 3300039447 Ga0436361_0194635 Ga0436361_0194635_744_1424 217
348 3300046459 Ga0495629_0431396 Ga0495629_0431396_42_734 217
349 3300048903 Ga0496100_0117889 Ga0496100_0117889_1142_1825 217
350 3300048904 Ga0496101_0371114 Ga0496101_0371114_294_977 217
351 3300048907 Ga0496104_0003136 Ga0496104_0003136_11842_12525 217
352 3300048908 Ga0496105_0000882 Ga0496105_0000882_14096_14779 217
353 3300048912 Ga0496109_0017543 Ga0496109_0017543_3050_3733 217
354 3300048913 Ga0496110_0004030 Ga0496110_0004030_5756_6439 217
355 3300048914 Ga0496111_0010614 Ga0496111_0010614_4704_5387 217
356 3300048914 Ga0496111_0468431 Ga0496111_0468431_195_875 217
357 3300048915 Ga0496112_0002737 Ga0496112_0002737_13551_14234 217
358 3300048916 Ga0496113_0003871 Ga0496113_0003871_2652_3335 217
359 3300048917 Ga0496114_0245324 Ga0496114_0245324_513_1196 217
360 3300048918 Ga0496115_0001345 Ga0496115_0001345_7753_8436 217
361 3300049581 Ga0501047_0091556 Ga0501047_0091556_1166_1831 217
362 3300049822 Ga0501035_0025766 Ga0501035_0025766_2633_3298 217
363 3300050515 nmdc:mga0a205_62019_c1 nmdc:mga0a205_62019_c1_709_1389 217
364 3300005330 Ga0070690_100040895 Ga0070690_1000408952 218
365 3300005336 Ga0070680_100110382 Ga0070680_1001103822 218
366 3300005340 Ga0070689_100012742 Ga0070689_1000127426 218
367 3300005354 Ga0070675_100310794 Ga0070675_1003107942 218
368 3300005355 Ga0070671_100067244 Ga0070671_1000672441 218
369 3300005364 Ga0070673_100083073 Ga0070673_1000830732 218
370 3300005365 Ga0070688_100045907 Ga0070688_1000459073 218
371 3300005437 Ga0070710_10187201 Ga0070710_101872012 218
372 3300005456 Ga0070678_100049859 Ga0070678_1000498593 218
373 3300005458 Ga0070681_10013407 Ga0070681_100134073 218
374 3300005458 Ga0070681_10046789 Ga0070681_100467893 218
375 3300005458 Ga0070681_10199336 Ga0070681_101993362 218
376 3300005458 Ga0070681_10506439 Ga0070681_105064391 218
377 3300005530 Ga0070679_100165670 Ga0070679_1001656702 218
378 3300005563 Ga0068855_100022850 Ga0068855_1000228503 218
379 3300005563 Ga0068855_100938848 Ga0068855_1009388481 218
380 3300005616 Ga0068852_100042768 Ga0068852_1000427683 218
381 3300005616 Ga0068852_100639984 Ga0068852_1006399842 218
382 3300005617 Ga0068859_100213616 Ga0068859_1002136163 218
383 3300005937 Ga0081455_10002509 Ga0081455_100025094 218
384 3300005937 Ga0081455_10064681 Ga0081455_100646812 218
385 3300005981 Ga0081538_10068599 Ga0081538_100685992 218
386 3300005983 Ga0081540_1014204 Ga0081540_10142042 218
387 3300006028 Ga0070717_10854828 Ga0070717_108548282 218
388 3300006038 Ga0075365_10015277 Ga0075365_100152773 218
389 3300006175 Ga0070712_100001034 Ga0070712_10000103414 218
390 3300006178 Ga0075367_10178454 Ga0075367_101784542 218
391 3300006195 Ga0075366_10003290 Ga0075366_100032906 218
392 3300006195 Ga0075366_10019985 Ga0075366_100199852 218
393 3300006358 Ga0068871_100359928 Ga0068871_1003599282 218
394 3300006844 Ga0075428_100205281 Ga0075428_1002052812 218
395 3300006844 Ga0075428_100311554 Ga0075428_1003115542 218
396 3300006847 Ga0075431_100020447 Ga0075431_1000204471 218
397 3300006880 Ga0075429_100057848 Ga0075429_1000578482 218
398 3300006914 Ga0075436_100065280 Ga0075436_1000652802 218
399 3300006931 Ga0097620_100213618 Ga0097620_1002136183 218
400 3300007076 Ga0075435_100345783 Ga0075435_1003457831 218
401 3300009093 Ga0105240_10597732 Ga0105240_105977322 218
402 3300009094 Ga0111539_10422510 Ga0111539_104225102 218
403 3300009098 Ga0105245_10133351 Ga0105245_101333513 218
404 3300009101 Ga0105247_10039951 Ga0105247_100399512 218
405 3300009101 Ga0105247_10115726 Ga0105247_101157261 218
406 3300009147 Ga0114129_10054562 Ga0114129_100545624 218
407 3300009148 Ga0105243_10138496 Ga0105243_101384962 218
408 3300009176 Ga0105242_10096458 Ga0105242_100964583 218
409 3300009177 Ga0105248_10056676 Ga0105248_100566762 218
410 3300009545 Ga0105237_10047573 Ga0105237_100475732 218
411 3300009551 Ga0105238_10454160 Ga0105238_104541602 218
412 3300009553 Ga0105249_10385060 Ga0105249_103850602 218
413 3300013105 Ga0157369_10847637 Ga0157369_108476371 218
414 3300013297 Ga0157378_10333651 Ga0157378_103336512 218
415 3300013306 Ga0163162_10206538 Ga0163162_102065382 218
416 3300014326 Ga0157380_10062201 Ga0157380_100622011 218
417 3300014968 Ga0157379_10405318 Ga0157379_104053182 218
418 3300014968 Ga0157379_10455885 Ga0157379_104558852 218
419 3300015265 Ga0182005_1064129 Ga0182005_10641291 218
420 3300025297 Ga0209758_1000128 Ga0209758_1000128174 218
421 3300025321 Ga0207656_10102693 Ga0207656_101026932 218
422 3300025900 Ga0207710_10029664 Ga0207710_100296642 218
423 3300025901 Ga0207688_10002303 Ga0207688_100023034 218
424 3300025901 Ga0207688_10157154 Ga0207688_101571542 218
425 3300025903 Ga0207680_10201301 Ga0207680_102013012 218
426 3300025904 Ga0207647_10207689 Ga0207647_102076892 218
427 3300025907 Ga0207645_10022266 Ga0207645_100222662 218
428 3300025908 Ga0207643_10027485 Ga0207643_100274853 218
429 3300025908 Ga0207643_10180488 Ga0207643_101804882 218
430 3300025909 Ga0207705_10310735 Ga0207705_103107352 218
431 3300025912 Ga0207707_10016805 Ga0207707_100168056 218
432 3300025912 Ga0207707_10159254 Ga0207707_101592542 218
433 3300025912 Ga0207707_10605427 Ga0207707_106054272 218
434 3300025915 Ga0207693_10009479 Ga0207693_100094799 218
435 3300025915 Ga0207693_10205671 Ga0207693_102056712 218
436 3300025917 Ga0207660_10029613 Ga0207660_100296132 218
437 3300025920 Ga0207649_10100090 Ga0207649_101000902 218
438 3300025921 Ga0207652_10188151 Ga0207652_101881512 218
439 3300025923 Ga0207681_10021738 Ga0207681_100217382 218
440 3300025927 Ga0207687_10051601 Ga0207687_100516012 218
441 3300025929 Ga0207664_10878560 Ga0207664_108785601 218
442 3300025933 Ga0207706_10298024 Ga0207706_102980242 218
443 3300025934 Ga0207686_10076118 Ga0207686_100761182 218
444 3300025934 Ga0207686_10127490 Ga0207686_101274902 218
445 3300025935 Ga0207709_10252546 Ga0207709_102525461 218
446 3300025936 Ga0207670_10006506 Ga0207670_100065066 218
447 3300025936 Ga0207670_10061467 Ga0207670_100614672 218
448 3300025938 Ga0207704_10249315 Ga0207704_102493152 218
449 3300025939 Ga0207665_10370326 Ga0207665_103703261 218
450 3300025940 Ga0207691_10042109 Ga0207691_100421091 218
451 3300025940 Ga0207691_10429741 Ga0207691_104297412 218
452 3300025941 Ga0207711_10020384 Ga0207711_100203843 218
453 3300025942 Ga0207689_10072495 Ga0207689_100724952 218
454 3300025960 Ga0207651_10109481 Ga0207651_101094812 218
455 3300026035 Ga0207703_10136533 Ga0207703_101365333 218
456 3300026041 Ga0207639_10261723 Ga0207639_102617232 218
457 3300026075 Ga0207708_10043986 Ga0207708_100439862 218
458 3300026116 Ga0207674_10445601 Ga0207674_104456012 218
459 3300026118 Ga0207675_100118534 Ga0207675_1001185342 218
460 3300026121 Ga0207683_10095843 Ga0207683_100958432 218
461 3300026121 Ga0207683_10148744 Ga0207683_101487442 218
462 3300028379 Ga0268266_10942846 Ga0268266_109428462 218
463 3300028381 Ga0268264_10161279 Ga0268264_101612793 218
464 3300031250 Ga0265331_10019075 Ga0265331_100190752 218
465 3300031711 Ga0265314_10058157 Ga0265314_100581572 218
466 3300031712 Ga0265342_10009824 Ga0265342_100098246 218
467 3300031727 Ga0316576_10083949 Ga0316576_100839491 218
468 3300031728 Ga0316578_10038730 Ga0316578_100387302 218
469 3300031911 Ga0307412_10144788 Ga0307412_101447882 218
470 3300032004 Ga0307414_10057088 Ga0307414_100570883 218
471 3300032126 Ga0307415_100252775 Ga0307415_1002527752 218
472 3300034816 Ga0373930_0035672 Ga0373930_0035672_188_871 218
473 3300034819 Ga0373958_0024349 Ga0373958_0024349_41_724 218
474 3300034957 Ga0373938_0090185 Ga0373938_0090185_59_742 218
475 3300035083 Ga0373926_0008334 Ga0373926_0008334_651_1337 218
476 3300035085 Ga0373929_0012346 Ga0373929_0012346_153_836 218
477 3300035088 Ga0373940_0080405 Ga0373940_0080405_95_778 218
478 3300035089 Ga0373944_0002213 Ga0373944_0002213_3290_3976 218
479 3300035111 Ga0373923_0041409 Ga0373923_0041409_1075_1761 218
480 3300035112 Ga0373932_0151554 Ga0373932_0151554_74_757 218
481 3300035115 Ga0373941_0090086 Ga0373941_0090086_158_841 218
482 3300035118 Ga0373954_0127770 Ga0373954_0127770_105_791 218
483 3300035170 Ga0373943_0006907 Ga0373943_0006907_1383_2069 218
484 3300035171 Ga0373946_0003198 Ga0373946_0003198_2570_3256 218
485 3300035172 Ga0373955_0045922 Ga0373955_0045922_761_1447 218
486 3300035172 Ga0373955_0173865 Ga0373955_0173865_276_962 218
487 3300035207 Ga0373942_0052239 Ga0373942_0052239_431_1114 218
488 3300035241 Ga0373961_0028678 Ga0373961_0028678_33_716 218
489 3300035691 Ga0373931_0197657 Ga0373931_0197657_452_1135 218
490 3300035691 Ga0373931_0381779 Ga0373931_0381779_166_849 218
491 3300035691 Ga0373931_0393176 Ga0373931_0393176_130_813 218
492 3300035692 Ga0373935_0297920 Ga0373935_0297920_30_713 218
493 3300035725 Ga0373947_0013366 Ga0373947_0013366_2519_3205 218
494 3300036401 Ga0373937_0020159 Ga0373937_0020159_2831_3517 218
495 3300036647 Ga0316582_0018667 Ga0316582_0018667_1894_2685 218
496 3300036712 Ga0316584_0007550 Ga0316584_0007550_914_1705 218
497 3300037068 Ga0373925_0153430 Ga0373925_0153430_722_1408 218
498 3300037471 Ga0395905_0096596 Ga0395905_0096596_758_1459 218
499 3300037853 Ga0436364_0013094 Ga0436364_0013094_516_1202 218
500 3300037853 Ga0436364_0195157 Ga0436364_0195157_3437_4123 218
501 3300038443 Ga0395901_0485823 Ga0395901_0485823_362_1063 218
502 3300039438 Ga0436360_1007073 Ga0436360_1007073_214_900 218
503 3300042013 Ga0439456_017035 Ga0439456_017035_134_817 218
504 3300044712 Ga0453684_0870126 Ga0453684_0870126_54_737 218
505 3300044901 Ga0466960_0134560 Ga0466960_0134560_325_996 218
506 3300045976 Ga0466967_0032500 Ga0466967_0032500_947_1633 218
507 3300046455 Ga0495603_0022743 Ga0495603_0022743_2225_2911 218
508 3300046455 Ga0495603_0098291 Ga0495603_0098291_157_843 218
509 3300046460 Ga0495638_0064102 Ga0495638_0064102_467_1153 218
510 3300046473 Ga0495582_0127994 Ga0495582_0127994_545_1243 218
511 3300046476 Ga0495662_0041905 Ga0495662_0041905_191_877 218
512 3300046491 Ga0495584_0054269 Ga0495584_0054269_1200_1886 218
513 3300046491 Ga0495584_0182285 Ga0495584_0182285_262_948 218
514 3300046499 Ga0495594_0005510 Ga0495594_0005510_3250_3936 218
515 3300046515 Ga0495620_0122087 Ga0495620_0122087_15_701 218
516 3300046516 Ga0495628_0322965 Ga0495628_0322965_248_934 218
517 3300046516 Ga0495628_0690018 Ga0495628_0690018_17_700 218
518 3300046517 Ga0495630_0264974 Ga0495630_0264974_558_1241 218
519 3300046523 Ga0495644_0097544 Ga0495644_0097544_254_940 218
520 3300046526 Ga0495666_0020658 Ga0495666_0020658_2264_2950 218
521 3300046559 Ga0495667_0354623 Ga0495667_0354623_90_776 218
522 3300046663 Ga0495635_0388504 Ga0495635_0388504_182_865 218
523 3300046681 Ga0495647_0018044 Ga0495647_0018044_1201_1887 218
524 3300046689 Ga0495613_0074116 Ga0495613_0074116_1478_2164 218
525 3300046689 Ga0495613_0157226 Ga0495613_0157226_92_790 218
526 3300046809 Ga0495600_0309258 Ga0495600_0309258_245_928 218
527 3300047321 Ga0495676_0015903 Ga0495676_0015903_3657_4343 218
528 3300047444 Ga0495675_0388210 Ga0495675_0388210_17_700 218
529 3300048903 Ga0496100_0039775 Ga0496100_0039775_1239_1925 218
530 3300048903 Ga0496100_0049795 Ga0496100_0049795_1039_1722 218
531 3300048903 Ga0496100_0373458 Ga0496100_0373458_252_938 218
532 3300048903 Ga0496100_0451373 Ga0496100_0451373_160_846 218
533 3300048904 Ga0496101_0003779 Ga0496101_0003779_3420_4106 218
534 3300048905 Ga0496102_0012833 Ga0496102_0012833_5902_6588 218
535 3300048905 Ga0496102_0143856 Ga0496102_0143856_936_1625 218
536 3300048905 Ga0496102_0200919 Ga0496102_0200919_965_1648 218
537 3300048905 Ga0496102_0593267 Ga0496102_0593267_327_1013 218
538 3300048907 Ga0496104_0002148 Ga0496104_0002148_12506_13195 218
539 3300048907 Ga0496104_0009810 Ga0496104_0009810_152_835 218
540 3300048907 Ga0496104_0026954 Ga0496104_0026954_2783_3469 218
541 3300048907 Ga0496104_0104710 Ga0496104_0104710_515_1201 218
542 3300048907 Ga0496104_0106466 Ga0496104_0106466_179_865 218
543 3300048907 Ga0496104_0232421 Ga0496104_0232421_769_1455 218
544 3300048908 Ga0496105_0013528 Ga0496105_0013528_2911_3597 218
545 3300048908 Ga0496105_0017190 Ga0496105_0017190_4704_5390 218
546 3300048908 Ga0496105_0029423 Ga0496105_0029423_490_1173 218
547 3300048908 Ga0496105_0421979 Ga0496105_0421979_182_868 218
548 3300048909 Ga0496106_0002149 Ga0496106_0002149_250_936 218
549 3300048909 Ga0496106_0095642 Ga0496106_0095642_1050_1733 218
550 3300048909 Ga0496106_0193717 Ga0496106_0193717_738_1424 218
551 3300048910 Ga0496107_0005939 Ga0496107_0005939_6201_6887 218
552 3300048910 Ga0496107_0033374 Ga0496107_0033374_720_1403 218
553 3300048911 Ga0496108_0006835 Ga0496108_0006835_4267_4953 218
554 3300048911 Ga0496108_0011301 Ga0496108_0011301_5853_6536 218
555 3300048911 Ga0496108_0049348 Ga0496108_0049348_138_824 218
556 3300048912 Ga0496109_0005176 Ga0496109_0005176_2252_2938 218
557 3300048912 Ga0496109_0022885 Ga0496109_0022885_3109_3795 218
558 3300048912 Ga0496109_0119498 Ga0496109_0119498_1027_1710 218
559 3300048912 Ga0496109_0162856 Ga0496109_0162856_1115_1804 218
560 3300048913 Ga0496110_0013474 Ga0496110_0013474_2042_2728 218
561 3300048913 Ga0496110_0034708 Ga0496110_0034708_970_1656 218
562 3300048913 Ga0496110_0098102 Ga0496110_0098102_828_1511 218
563 3300048913 Ga0496110_0187090 Ga0496110_0187090_1030_1716 218
564 3300048914 Ga0496111_0017179 Ga0496111_0017179_2821_3507 218
565 3300048914 Ga0496111_0206854 Ga0496111_0206854_727_1413 218
566 3300048914 Ga0496111_0273777 Ga0496111_0273777_247_930 218
567 3300048915 Ga0496112_0008660 Ga0496112_0008660_6714_7400 218
568 3300048915 Ga0496112_0034196 Ga0496112_0034196_689_1375 218
569 3300048915 Ga0496112_0057103 Ga0496112_0057103_2764_3450 218
570 3300048915 Ga0496112_0072266 Ga0496112_0072266_1475_2161 218
571 3300048915 Ga0496112_0093100 Ga0496112_0093100_356_1102 218
572 3300048915 Ga0496112_0098327 Ga0496112_0098327_789_1472 218
573 3300048915 Ga0496112_0157400 Ga0496112_0157400_38_724 218
574 3300048915 Ga0496112_0285303 Ga0496112_0285303_307_990 218
575 3300048915 Ga0496112_0327421 Ga0496112_0327421_662_1345 218
576 3300048916 Ga0496113_0009682 Ga0496113_0009682_4837_5523 218
577 3300048916 Ga0496113_0055224 Ga0496113_0055224_1466_2152 218
578 3300048916 Ga0496113_0406263 Ga0496113_0406263_216_902 218
579 3300048916 Ga0496113_0486196 Ga0496113_0486196_93_776 218
580 3300048917 Ga0496114_0299955 Ga0496114_0299955_461_1144 218
581 3300048918 Ga0496115_0065665 Ga0496115_0065665_896_1582 218
582 3300048918 Ga0496115_0198692 Ga0496115_0198692_779_1465 218
583 3300048918 Ga0496115_0434223 Ga0496115_0434223_308_991 218
584 3300048929 Ga0496126_0517092 Ga0496126_0517092_189_872 218
585 3300049569 Ga0501032_0106862 Ga0501032_0106862_524_1207 218
586 3300049569 Ga0501032_0341181 Ga0501032_0341181_40_741 218
587 3300049570 Ga0501033_0086125 Ga0501033_0086125_100_783 218
588 3300049570 Ga0501033_0110581 Ga0501033_0110581_854_1540 218
589 3300049570 Ga0501033_0258270 Ga0501033_0258270_43_744 218
590 3300049571 Ga0501034_0045159 Ga0501034_0045159_976_1659 218
591 3300049571 Ga0501034_0093965 Ga0501034_0093965_1144_1845 218
592 3300049572 Ga0501036_0067993 Ga0501036_0067993_235_918 218
593 3300049572 Ga0501036_0075584 Ga0501036_0075584_1274_1975 218
594 3300049572 Ga0501036_0648907 Ga0501036_0648907_83_769 218
595 3300049573 Ga0501037_0229598 Ga0501037_0229598_184_933 218
596 3300049573 Ga0501037_0238688 Ga0501037_0238688_493_1194 218
597 3300049574 Ga0501038_0050512 Ga0501038_0050512_1628_2311 218
598 3300049574 Ga0501038_0100002 Ga0501038_0100002_1587_2270 218
599 3300049574 Ga0501038_0566408 Ga0501038_0566408_138_839 218
600 3300049575 Ga0501039_0138114 Ga0501039_0138114_1034_1717 218
601 3300049576 Ga0501040_0027148 Ga0501040_0027148_282_983 218
602 3300049578 Ga0501042_0018714 Ga0501042_0018714_319_1002 218
603 3300049578 Ga0501042_0052098 Ga0501042_0052098_2082_2783 218
604 3300049579 Ga0501043_0085612 Ga0501043_0085612_741_1442 218
605 3300049579 Ga0501043_0223860 Ga0501043_0223860_294_995 218
606 3300049580 Ga0501046_0011538 Ga0501046_0011538_1712_2395 218
607 3300049580 Ga0501046_0296737 Ga0501046_0296737_146_832 218
608 3300049581 Ga0501047_0007528 Ga0501047_0007528_2848_3534 218
609 3300049581 Ga0501047_0133669 Ga0501047_0133669_275_958 218
610 3300049581 Ga0501047_0245573 Ga0501047_0245573_449_1150 218
611 3300049582 Ga0501048_0037378 Ga0501048_0037378_1361_2044 218
612 3300049583 Ga0501067_0000224 Ga0501067_0000224_23563_24231 218
613 3300049583 Ga0501067_0003270 Ga0501067_0003270_7111_7812 218
614 3300049584 Ga0501068_0006315 Ga0501068_0006315_4559_5242 218
615 3300049585 Ga0501069_0034265 Ga0501069_0034265_128_811 218
616 3300049585 Ga0501069_0336743 Ga0501069_0336743_131_799 218
617 3300049586 Ga0501070_0574693 Ga0501070_0574693_158_844 218
618 3300049587 Ga0501071_0024156 Ga0501071_0024156_2137_2820 218
619 3300049587 Ga0501071_0281177 Ga0501071_0281177_108_809 218
620 3300049588 Ga0501072_0379588 Ga0501072_0379588_20_721 218
621 3300049589 Ga0501073_0011271 Ga0501073_0011271_4220_4903 218
622 3300049589 Ga0501073_0111398 Ga0501073_0111398_459_1127 218
623 3300049589 Ga0501073_0161388 Ga0501073_0161388_544_1230 218
624 3300049590 Ga0501074_0104132 Ga0501074_0104132_1093_1776 218
625 3300049593 Ga0501077_0139924 Ga0501077_0139924_102_788 218
626 3300049682 Ga0501252_008839 Ga0501252_008839_457_1128 218
627 3300049741 Ga0501079_0096855 Ga0501079_0096855_767_1468 218
628 3300049742 Ga0501080_0130513 Ga0501080_0130513_1333_2001 218
629 3300049742 Ga0501080_0225582 Ga0501080_0225582_989_1690 218
630 3300049744 Ga0501083_0046768 Ga0501083_0046768_1187_1888 218
631 3300049744 Ga0501083_0173071 Ga0501083_0173071_432_1115 218
632 3300049758 Ga0501241_051067 Ga0501241_051067_36_725 218
633 3300049822 Ga0501035_0027254 Ga0501035_0027254_1732_2415 218
634 3300049822 Ga0501035_0351949 Ga0501035_0351949_169_855 218
635 3300049823 Ga0501044_0000658 Ga0501044_0000658_23075_23758 218
636 3300049823 Ga0501044_0020081 Ga0501044_0020081_3663_4346 218
637 3300049823 Ga0501044_0068185 Ga0501044_0068185_2503_3186 218
638 3300049823 Ga0501044_0217258 Ga0501044_0217258_416_1117 218
639 3300049824 Ga0501045_0056418 Ga0501045_0056418_868_1569 218
640 3300049824 Ga0501045_0093089 Ga0501045_0093089_452_1138 218
641 3300050489 nmdc:mga03683_27069_c1 nmdc:mga03683_27069_c1_16_702 218
642 3300050491 nmdc:mga00v17_385813_c1 nmdc:mga00v17_385813_c1_113_799 218
643 3300050492 nmdc:mga0yw44_30437_c1 nmdc:mga0yw44_30437_c1_2263_2949 218
644 3300050493 nmdc:mga0k408_2287_c1 nmdc:mga0k408_2287_c1_4538_5221 218
645 3300050493 nmdc:mga0k408_95314_c1 nmdc:mga0k408_95314_c1_53_736 218
646 3300050507 nmdc:mga05p37_43907_c1 nmdc:mga05p37_43907_c1_1731_2417 218
647 3300050507 nmdc:mga05p37_751430_c1 nmdc:mga05p37_751430_c1_327_1013 218
648 3300050508 nmdc:mga09592_503163_c1 nmdc:mga09592_503163_c1_127_813 218
649 3300050510 nmdc:mga06r32_213150_c1 nmdc:mga06r32_213150_c1_677_1363 218
650 3300050511 nmdc:mga08y16_636227_c1 nmdc:mga08y16_636227_c1_359_1042 218
651 3300050512 nmdc:mga0n895_125963_c1 nmdc:mga0n895_125963_c1_611_1327 218
652 3300050514 nmdc:mga08x19_59086_c1 nmdc:mga08x19_59086_c1_1000_1686 218
653 3300053077 Ga0495601_0028555 Ga0495601_0028555_945_1631 218
654 3300053077 Ga0495601_0031852 Ga0495601_0031852_1077_1766 218
655 3300053083 Ga0495655_0017666 Ga0495655_0017666_152_838 218
656 3300053084 Ga0495595_0173151 Ga0495595_0173151_218_907 218
657 3300053084 Ga0495595_0285484 Ga0495595_0285484_87_773 218
658 3300053104 Ga0500556_0017319 Ga0500556_0017319_1561_2220 218
659 3300053104 Ga0500556_0117629 Ga0500556_0117629_285_974 218
660 3300053130 Ga0500642_0086461 Ga0500642_0086461_618_1301 218
661 3300053153 Ga0500616_0000805 Ga0500616_0000805_24654_25343 218
662 3300053153 Ga0500616_0231333 Ga0500616_0231333_66_749 218
663 3300054114 Ga0501084_0004384 Ga0501084_0004384_606_1289 218
664 3300054114 Ga0501084_0076860 Ga0501084_0076860_1256_1942 218
665 3300054114 Ga0501084_0094190 Ga0501084_0094190_1804_2472 218
666 3300060353 Ga0501082_0011332 Ga0501082_0011332_5284_5952 218
667 3300060353 Ga0501082_0111262 Ga0501082_0111262_706_1407 218
668 3300060353 Ga0501082_0384604 Ga0501082_0384604_279_962 218
669 3300061734 Ga0530510_0097350 Ga0530510_0097350_655_1341 218
670 iso_pu_bacteria 2894232714 2894240136 218
671 3300001979 JGI24740J21852_10018622 JGI24740J21852_100186222 219
672 3300001990 JGI24737J22298_10033317 JGI24737J22298_100333172 219
673 3300005331 Ga0070670_100287174 Ga0070670_1002871742 219
674 3300005333 Ga0070677_10000155 Ga0070677_1000015520 219
675 3300005335 Ga0070666_10001803 Ga0070666_100018031 219
676 3300005336 Ga0070680_100001660 Ga0070680_1000016606 219
677 3300005336 Ga0070680_100168740 Ga0070680_1001687402 219
678 3300005339 Ga0070660_100047236 Ga0070660_1000472361 219
679 3300005339 Ga0070660_100109866 Ga0070660_1001098662 219
680 3300005343 Ga0070687_100071737 Ga0070687_1000717372 219
681 3300005344 Ga0070661_100004993 Ga0070661_1000049931 219
682 3300005347 Ga0070668_100036683 Ga0070668_1000366832 219
683 3300005353 Ga0070669_100000280 Ga0070669_10000028034 219
684 3300005355 Ga0070671_100000005 Ga0070671_100000005126 219
685 3300005366 Ga0070659_100017634 Ga0070659_1000176344 219
686 3300005457 Ga0070662_100251530 Ga0070662_1002515302 219
687 3300005458 Ga0070681_10272796 Ga0070681_102727962 219
688 3300005535 Ga0070684_100153420 Ga0070684_1001534203 219
689 3300005548 Ga0070665_100000148 Ga0070665_100000148145 219
690 3300005548 Ga0070665_100043313 Ga0070665_1000433134 219
691 3300005548 Ga0070665_100189335 Ga0070665_1001893352 219
692 3300005563 Ga0068855_100016827 Ga0068855_1000168273 219
693 3300005564 Ga0070664_100016307 Ga0070664_1000163076 219
694 3300005578 Ga0068854_100459371 Ga0068854_1004593711 219
695 3300005578 Ga0068854_100504303 Ga0068854_1005043031 219
696 3300005616 Ga0068852_100007430 Ga0068852_1000074307 219
697 3300005616 Ga0068852_100092276 Ga0068852_1000922765 219
698 3300005617 Ga0068859_100022381 Ga0068859_1000223813 219
699 3300005841 Ga0068863_100316090 Ga0068863_1003160902 219
700 3300005842 Ga0068858_100005339 Ga0068858_1000053397 219
701 3300005843 Ga0068860_100134992 Ga0068860_1001349923 219
702 3300005985 Ga0081539_10014301 Ga0081539_100143014 219
703 3300006931 Ga0097620_100022380 Ga0097620_1000223806 219
704 3300009093 Ga0105240_10295843 Ga0105240_102958432 219
705 3300010375 Ga0105239_10034581 Ga0105239_100345817 219
706 3300013100 Ga0157373_10022779 Ga0157373_100227791 219
707 3300013102 Ga0157371_10147730 Ga0157371_101477301 219
708 3300013102 Ga0157371_10269119 Ga0157371_102691192 219
709 3300013104 Ga0157370_10112520 Ga0157370_101125204 219
710 3300013105 Ga0157369_10000043 Ga0157369_10000043134 219
711 3300013105 Ga0157369_10111023 Ga0157369_101110233 219
712 3300013296 Ga0157374_10023802 Ga0157374_100238023 219
713 3300013306 Ga0163162_10036563 Ga0163162_100365636 219
714 3300013308 Ga0157375_11173984 Ga0157375_111739841 219
715 3300025315 Ga0207697_10013327 Ga0207697_100133273 219
716 3300025315 Ga0207697_10055657 Ga0207697_100556572 219
717 3300025893 Ga0207682_10000147 Ga0207682_1000014728 219
718 3300025903 Ga0207680_10024594 Ga0207680_100245944 219
719 3300025904 Ga0207647_10055215 Ga0207647_100552152 219
720 3300025909 Ga0207705_10000033 Ga0207705_10000033201 219
721 3300025909 Ga0207705_10180163 Ga0207705_101801632 219
722 3300025917 Ga0207660_10002059 Ga0207660_100020595 219
723 3300025917 Ga0207660_10245440 Ga0207660_102454402 219
724 3300025919 Ga0207657_10168929 Ga0207657_101689293 219
725 3300025920 Ga0207649_10000444 Ga0207649_1000044423 219
726 3300025923 Ga0207681_10000096 Ga0207681_1000009638 219
727 3300025923 Ga0207681_10323687 Ga0207681_103236872 219
728 3300025924 Ga0207694_10198752 Ga0207694_101987522 219
729 3300025927 Ga0207687_10019713 Ga0207687_100197133 219
730 3300025931 Ga0207644_10000008 Ga0207644_10000008199 219
731 3300025931 Ga0207644_10014179 Ga0207644_100141796 219
732 3300025932 Ga0207690_10011704 Ga0207690_100117042 219
733 3300025933 Ga0207706_10109808 Ga0207706_101098082 219
734 3300025941 Ga0207711_10165981 Ga0207711_101659813 219
735 3300025944 Ga0207661_10174628 Ga0207661_101746283 219
736 3300025944 Ga0207661_10349253 Ga0207661_103492532 219
737 3300025945 Ga0207679_10029237 Ga0207679_100292374 219
738 3300025949 Ga0207667_10007324 Ga0207667_100073247 219
739 3300025949 Ga0207667_10012362 Ga0207667_1001236210 219
740 3300025949 Ga0207667_10022285 Ga0207667_100222853 219
741 3300025949 Ga0207667_10042471 Ga0207667_100424712 219
742 3300025972 Ga0207668_10096978 Ga0207668_100969782 219
743 3300025981 Ga0207640_10215809 Ga0207640_102158092 219
744 3300025986 Ga0207658_10102311 Ga0207658_101023112 219
745 3300026035 Ga0207703_10013788 Ga0207703_100137882 219
746 3300026041 Ga0207639_10616822 Ga0207639_106168222 219
747 3300026067 Ga0207678_10320833 Ga0207678_103208332 219
748 3300026078 Ga0207702_10307501 Ga0207702_103075012 219
749 3300026116 Ga0207674_10030099 Ga0207674_100300994 219
750 3300026116 Ga0207674_10039328 Ga0207674_100393282 219
751 3300026142 Ga0207698_10001849 Ga0207698_1000184910 219
752 3300026142 Ga0207698_10013844 Ga0207698_100138445 219
753 3300028379 Ga0268266_10000626 Ga0268266_100006269 219
754 3300028379 Ga0268266_10108335 Ga0268266_101083352 219
755 3300028379 Ga0268266_10137786 Ga0268266_101377863 219
756 3300031731 Ga0307405_10555396 Ga0307405_105553962 219
757 3300031824 Ga0307413_10220122 Ga0307413_102201222 219
758 3300031911 Ga0307412_10225018 Ga0307412_102250182 219
759 3300031911 Ga0307412_10302574 Ga0307412_103025742 219
760 3300031995 Ga0307409_100079291 Ga0307409_1000792912 219
761 3300032004 Ga0307414_10071542 Ga0307414_100715423 219
762 3300032004 Ga0307414_10229974 Ga0307414_102299742 219
763 3300032005 Ga0307411_10563347 Ga0307411_105633472 219
764 3300037418 Ga0395900_0032943 Ga0395900_0032943_4616_5278 219
765 3300037418 Ga0395900_0034968 Ga0395900_0034968_4316_4978 219
766 3300037418 Ga0395900_0043072 Ga0395900_0043072_1189_1851 219
767 3300037418 Ga0395900_0045893 Ga0395900_0045893_1562_2224 219
768 3300037418 Ga0395900_0170835 Ga0395900_0170835_922_1584 219
769 3300037466 Ga0395898_0044477 Ga0395898_0044477_58_720 219
770 3300037466 Ga0395898_0053895 Ga0395898_0053895_1185_1847 219
771 3300038443 Ga0395901_0000086 Ga0395901_0000086_83914_84576 219
772 3300038443 Ga0395901_0026198 Ga0395901_0026198_888_1550 219
773 3300038443 Ga0395901_0244060 Ga0395901_0244060_321_983 219
774 3300039437 Ga0436365_1896329 Ga0436365_1896329_6376_7035 219
775 3300042005 Ga0439448_0027222 Ga0439448_0027222_500_1162 219
776 3300044684 Ga0466966_0020726 Ga0466966_0020726_2023_2685 219
777 3300044693 Ga0466961_0012256 Ga0466961_0012256_1635_2297 219
778 3300044694 Ga0466963_0034953 Ga0466963_0034953_1347_2009 219
779 3300044694 Ga0466963_0068019 Ga0466963_0068019_1695_2354 219
780 3300044712 Ga0453684_0105894 Ga0453684_0105894_1036_1698 219
781 3300044712 Ga0453684_0494753 Ga0453684_0494753_195_857 219
782 3300044719 Ga0466971_0017973 Ga0466971_0017973_770_1432 219
783 3300044765 Ga0466970_0009668 Ga0466970_0009668_3629_4291 219
784 3300044842 Ga0466957_0055470 Ga0466957_0055470_1221_1880 219
785 3300045049 Ga0466959_0008062 Ga0466959_0008062_2023_2685 219
786 3300045051 Ga0451576_0156267 Ga0451576_0156267_514_1176 219
787 3300045836 Ga0466958_0002196 Ga0466958_0002196_6179_6841 219
788 3300045976 Ga0466967_0438975 Ga0466967_0438975_550_1209 219
789 3300046660 Ga0495625_0200594 Ga0495625_0200594_466_1125 219
790 3300046691 Ga0495670_0001709 Ga0495670_0001709_3396_4055 219
791 3300048904 Ga0496101_0031548 Ga0496101_0031548_1566_2252 219
792 3300048905 Ga0496102_0169470 Ga0496102_0169470_426_1112 219
793 3300048907 Ga0496104_0055314 Ga0496104_0055314_2318_3004 219
794 3300048908 Ga0496105_0043061 Ga0496105_0043061_85_771 219
795 3300048908 Ga0496105_0309730 Ga0496105_0309730_419_1081 219
796 3300048909 Ga0496106_0002837 Ga0496106_0002837_11612_12298 219
797 3300048910 Ga0496107_0011930 Ga0496107_0011930_673_1359 219
798 3300048929 Ga0496126_0001890 Ga0496126_0001890_20228_20893 219
799 3300053139 Ga0500568_0000406 Ga0500568_0000406_22332_22991 219
800 3300053151 Ga0500604_0000583 Ga0500604_0000583_7430_8089 219
801 3300053153 Ga0500616_0000161 Ga0500616_0000161_7265_7924 219
802 3300053739 Ga0500587_000809 Ga0500587_000809_200_859 219
803 3300001976 JGI24752J21851_1000198 JGI24752J21851_10001982 220
804 3300001979 JGI24740J21852_10005460 JGI24740J21852_100054603 220
805 3300001989 JGI24739J22299_10006428 JGI24739J22299_100064283 220
806 3300002067 JGI24735J21928_10005974 JGI24735J21928_100059742 220
807 3300002070 JGI24750J21931_1002769 JGI24750J21931_10027692 220
808 3300002074 JGI24748J21848_1000042 JGI24748J21848_100004244 220
809 3300002076 JGI24749J21850_1020066 JGI24749J21850_10200662 220
810 3300002239 JGI24034J26672_10000035 JGI24034J26672_1000003543 220
811 3300002244 JGI24742J22300_10031650 JGI24742J22300_100316502 220
812 3300005330 Ga0070690_100000009 Ga0070690_10000000995 220
813 3300005335 Ga0070666_10000006 Ga0070666_10000006136 220
814 3300005339 Ga0070660_100307567 Ga0070660_1003075671 220
815 3300005343 Ga0070687_100225626 Ga0070687_1002256261 220
816 3300005347 Ga0070668_100083683 Ga0070668_1000836832 220
817 3300005353 Ga0070669_100000095 Ga0070669_10000009569 220
818 3300005355 Ga0070671_100186306 Ga0070671_1001863061 220
819 3300005365 Ga0070688_100004996 Ga0070688_1000049962 220
820 3300005366 Ga0070659_100132082 Ga0070659_1001320822 220
821 3300005367 Ga0070667_100021629 Ga0070667_1000216294 220
822 3300005466 Ga0070685_10000155 Ga0070685_1000015521 220
823 3300005544 Ga0070686_100000091 Ga0070686_10000009169 220
824 3300005548 Ga0070665_100000019 Ga0070665_100000019248 220
825 3300005564 Ga0070664_100486215 Ga0070664_1004862152 220
826 3300005614 Ga0068856_100490559 Ga0068856_1004905592 220
827 3300005719 Ga0068861_100012358 Ga0068861_1000123587 220
828 3300005834 Ga0068851_10077419 Ga0068851_100774192 220
829 3300005841 Ga0068863_100000118 Ga0068863_10000011894 220
830 3300005841 Ga0068863_100014260 Ga0068863_1000142603 220
831 3300005842 Ga0068858_100000723 Ga0068858_10000072315 220
832 3300005842 Ga0068858_100002727 Ga0068858_1000027272 220
833 3300005843 Ga0068860_100000014 Ga0068860_100000014135 220
834 3300005843 Ga0068860_100001093 Ga0068860_1000010937 220
835 3300005844 Ga0068862_100000014 Ga0068862_100000014169 220
836 3300005844 Ga0068862_100000503 Ga0068862_10000050315 220
837 3300009093 Ga0105240_10678746 Ga0105240_106787462 220
838 3300009101 Ga0105247_10000830 Ga0105247_100008308 220
839 3300009101 Ga0105247_10093791 Ga0105247_100937912 220
840 3300009177 Ga0105248_10028861 Ga0105248_100288613 220
841 3300009545 Ga0105237_10078994 Ga0105237_100789942 220
842 3300009553 Ga0105249_10000002 Ga0105249_10000002228 220
843 3300009553 Ga0105249_10000035 Ga0105249_10000035197 220
844 3300013100 Ga0157373_10105027 Ga0157373_101050272 220
845 3300013104 Ga0157370_10014955 Ga0157370_100149555 220
846 3300013105 Ga0157369_10094209 Ga0157369_100942092 220
847 3300013306 Ga0163162_10014044 Ga0163162_100140448 220
848 3300013306 Ga0163162_10154001 Ga0163162_101540013 220
849 3300014325 Ga0163163_10019657 Ga0163163_100196576 220
850 3300014326 Ga0157380_10004798 Ga0157380_100047983 220
851 3300014968 Ga0157379_10008890 Ga0157379_100088902 220
852 3300017792 Ga0163161_10000102 Ga0163161_1000010281 220
853 3300025315 Ga0207697_10009619 Ga0207697_100096194 220
854 3300025321 Ga0207656_10078538 Ga0207656_100785382 220
855 3300025900 Ga0207710_10022092 Ga0207710_100220922 220
856 3300025900 Ga0207710_10092185 Ga0207710_100921852 220
857 3300025900 Ga0207710_10122998 Ga0207710_101229982 220
858 3300025903 Ga0207680_10000011 Ga0207680_10000011134 220
859 3300025904 Ga0207647_10008450 Ga0207647_100084504 220
860 3300025911 Ga0207654_10000285 Ga0207654_1000028525 220
861 3300025913 Ga0207695_10002074 Ga0207695_1000207425 220
862 3300025914 Ga0207671_10012192 Ga0207671_100121924 220
863 3300025918 Ga0207662_10221508 Ga0207662_102215082 220
864 3300025919 Ga0207657_10091569 Ga0207657_100915692 220
865 3300025920 Ga0207649_10074284 Ga0207649_100742842 220
866 3300025923 Ga0207681_10000112 Ga0207681_1000011215 220
867 3300025924 Ga0207694_10004187 Ga0207694_100041874 220
868 3300025931 Ga0207644_10009210 Ga0207644_100092106 220
869 3300025933 Ga0207706_10123536 Ga0207706_101235362 220
870 3300025941 Ga0207711_10056159 Ga0207711_100561593 220
871 3300025945 Ga0207679_10191126 Ga0207679_101911262 220
872 3300025949 Ga0207667_10074478 Ga0207667_100744783 220
873 3300025961 Ga0207712_10000002 Ga0207712_10000002600 220
874 3300025961 Ga0207712_10000013 Ga0207712_10000013134 220
875 3300025972 Ga0207668_10066392 Ga0207668_100663924 220
876 3300025981 Ga0207640_10063192 Ga0207640_100631922 220
877 3300025986 Ga0207658_10000689 Ga0207658_1000068918 220
878 3300026035 Ga0207703_10001006 Ga0207703_100010061 220
879 3300026035 Ga0207703_10009748 Ga0207703_100097482 220
880 3300026041 Ga0207639_10043651 Ga0207639_100436514 220
881 3300026078 Ga0207702_10007648 Ga0207702_100076484 220
882 3300026088 Ga0207641_10000101 Ga0207641_1000010161 220
883 3300026088 Ga0207641_10003069 Ga0207641_1000306916 220
884 3300026095 Ga0207676_10001834 Ga0207676_100018345 220
885 3300026116 Ga0207674_10231985 Ga0207674_102319852 220
886 3300026116 Ga0207674_10581922 Ga0207674_105819222 220
887 3300026118 Ga0207675_100011489 Ga0207675_1000114897 220
888 3300026142 Ga0207698_10038387 Ga0207698_100383874 220
889 3300028379 Ga0268266_10000025 Ga0268266_10000025253 220
890 3300028380 Ga0268265_10000048 Ga0268265_1000004838 220
891 3300028380 Ga0268265_10000316 Ga0268265_1000031639 220
892 3300028381 Ga0268264_10000037 Ga0268264_10000037134 220
893 3300028381 Ga0268264_10000439 Ga0268264_1000043916 220
894 3300031456 Ga0307513_10494841 Ga0307513_104948412 220
895 3300033180 Ga0307510_10000248 Ga0307510_1000024819 220
896 3300046460 Ga0495638_0001117 Ga0495638_0001117_22041_22703 220
897 3300046520 Ga0495637_0043659 Ga0495637_0043659_975_1649 220
898 3300046522 Ga0495643_0080976 Ga0495643_0080976_305_979 220
899 3300046524 Ga0495648_0075932 Ga0495648_0075932_1084_1761 220
900 3300046660 Ga0495625_0070430 Ga0495625_0070430_1274_1951 220
901 3300046691 Ga0495670_0084260 Ga0495670_0084260_817_1479 220
902 3300047445 Ga0495677_0019390 Ga0495677_0019390_1587_2264 220
903 3300048905 Ga0496102_0017546 Ga0496102_0017546_1123_1785 220
904 3300048906 Ga0496103_0003334 Ga0496103_0003334_883_1545 220
905 3300048907 Ga0496104_0042587 Ga0496104_0042587_777_1439 220
906 3300048908 Ga0496105_0012680 Ga0496105_0012680_4179_4841 220
907 3300048910 Ga0496107_0010755 Ga0496107_0010755_2177_2839 220
908 3300048912 Ga0496109_0128459 Ga0496109_0128459_170_832 220
909 3300048913 Ga0496110_0221215 Ga0496110_0221215_190_852 220
910 3300048914 Ga0496111_0175123 Ga0496111_0175123_298_960 220
911 3300048920 Ga0496117_0037727 Ga0496117_0037727_2839_3501 220
912 3300048921 Ga0496118_0078175 Ga0496118_0078175_1399_2061 220
913 3300048928 Ga0496125_0205690 Ga0496125_0205690_244_906 220
914 3300049513 Ga0501290_000271 Ga0501290_000271_3832_4494 220
915 3300049515 Ga0501292_000003 Ga0501292_000003_3483_4145 220
916 3300049517 Ga0501294_000455 Ga0501294_000455_3302_3964 220
917 3300049523 Ga0501300_000439 Ga0501300_000439_1125_1787 220
918 3300049653 Ga0501206_004121 Ga0501206_004121_980_1642 220
919 3300049662 Ga0501222_000807 Ga0501222_000807_3032_3694 220
920 3300049663 Ga0501223_000796 Ga0501223_000796_6236_6898 220
921 3300049664 Ga0501224_001001 Ga0501224_001001_2536_3198 220
922 3300049665 Ga0501227_001098 Ga0501227_001098_2818_3480 220
923 3300049686 Ga0501257_020712 Ga0501257_020712_579_1241 220
924 3300049688 Ga0501259_000913 Ga0501259_000913_659_1321 220
925 3300049690 Ga0501261_000066 Ga0501261_000066_5542_6204 220
926 3300049705 Ga0501225_0016325 Ga0501225_0016325_687_1349 220
927 3300049775 Ga0501279_000040 Ga0501279_000040_3529_4191 220
928 3300049776 Ga0501280_000144 Ga0501280_000144_7497_8159 220
929 3300049777 Ga0501281_00385 Ga0501281_00385_49_711 220
930 3300049778 Ga0501282_000071 Ga0501282_000071_6210_6872 220
931 3300053091 Ga0500647_0131142 Ga0500647_0131142_372_1046 220
932 3300053133 Ga0500655_000033 Ga0500655_000033_33995_34669 220
933 3300053134 Ga0500658_0002175 Ga0500658_0002175_2789_3451 220
934 3300053148 Ga0500590_013244 Ga0500590_013244_369_1043 220

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00834

Ribul_P_3_epim

Ribulose-phosphate 3 epimerase family

46

241

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fli-assembly1.cif.gz_E the crystal structure of d-ribulose 5-phosphate 3-epimerase from streptococus pyogenes complexed with d-xylitol 5-phosphate 0.9789 5 218
1tqj-assembly1.cif.gz_E crystal structure of d-ribulose 5-phosphate 3-epimerase from synechocystis to 1.6 angstrom resolution 0.9743 4 218
1tqj-assembly1.cif.gz_B crystal structure of d-ribulose 5-phosphate 3-epimerase from synechocystis to 1.6 angstrom resolution 0.974 4 220
1tqj-assembly1.cif.gz_F crystal structure of d-ribulose 5-phosphate 3-epimerase from synechocystis to 1.6 angstrom resolution 0.9711 4 218
3inp-assembly1.cif.gz_A 2.05 angstrom resolution crystal structure of d-ribulose-phosphate 3-epimerase from francisella tularensis. 0.9707 5 218
ID Description Score Start End Superfamily
2fliC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9791 3 218 3.20.20.70
af_P0AG07_1_223_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9725 4 218 3.20.20.70
1tqjD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9698 4 220 3.20.20.70
af_Q58093_1_217_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9695 5 218 3.20.20.70
af_P9WI51_4_223_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9569 3 218 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A7W6EV29-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9929 5 219 GO:0004750
GO:0006098
GO:0019323
GO:0046872
AF-A0A162JL25-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.991 1 218 GO:0004750
GO:0006098
GO:0019323
GO:0046872
AF-A0A844ZET1-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9909 5 220 GO:0004750
GO:0006098
GO:0019323
GO:0046872
AF-A0A1I4C0L9-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9896 3 218 GO:0004750
GO:0006098
GO:0019323
GO:0046872
AF-A0A382V2T8-F1-model_v4 ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9891 3 199 GO:0004750
GO:0005975
GO:0006098

Feature Viewer

pLDDT pTM Quality
95.1 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map