F486122

General Info

Members Datasets Scaffolds Average Seq Length
934 474 1868 159

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_10178028|Ga0105241_101780282
Length 179
Sequence MYLRLRRPGHALLTPEGNDMTIKVGDKIPDSKFRVMTGDGPQWKSTDEVFKGKKVALFAVPGAFTGTCHKMHVPSITQNADAIKAKGVDTIAVTSVNDIFVMDAWKKATAAEKVEFLADGNGEFAKAIDLTFDGSGNGLGTRSKRYAMLVEDGVVKKLNIEEAPGKVEVSGGDALLKQL

Samples

Sample ID Description Type Environment
1 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
4 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
5 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
6 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
7 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
11 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
12 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
13 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
14 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
15 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
16 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
17 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
19 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
20 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
21 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
22 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
23 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
24 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
26 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
27 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
28 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
35 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
36 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
37 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
38 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
41 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
42 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
43 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
44 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
45 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
46 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
47 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
48 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
49 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
50 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
51 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
52 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
53 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
54 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
55 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
56 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
57 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
58 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
59 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
60 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
61 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
62 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
63 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
64 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
65 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
66 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
67 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
68 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
69 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
70 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
71 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
72 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
73 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
74 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
75 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
76 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
77 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
78 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
79 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
80 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
81 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
82 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
83 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
84 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
85 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
86 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
87 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
88 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
89 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
90 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
91 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
92 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
93 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
94 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
95 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
96 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
97 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
98 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
99 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
100 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
101 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
102 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
103 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
104 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
105 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
106 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
107 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
108 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
109 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
110 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
111 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
112 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
113 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
114 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
115 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
116 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
117 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
118 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
119 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
120 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
121 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
122 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
123 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
124 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
125 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
126 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
127 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
128 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
129 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
130 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
131 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
132 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
133 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
134 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
135 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
136 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
137 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
138 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
139 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
140 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
141 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
142 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
143 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
144 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
145 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
146 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
147 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
148 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
149 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
150 3300019192 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
152 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
153 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
154 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
155 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
157 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
158 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
162 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
225 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
226 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
229 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
230 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
231 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
232 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
233 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
234 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
235 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
236 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
237 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
238 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
239 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
240 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
241 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
242 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
243 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
244 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
245 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
246 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
247 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
248 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
249 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
250 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
251 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
252 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
253 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
254 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
255 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
256 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
257 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
258 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
259 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
260 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
261 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
262 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
263 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
264 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
265 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
266 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
267 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
268 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
269 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
270 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
271 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
272 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
273 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
274 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
275 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
276 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
277 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
278 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
279 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
280 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
281 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
282 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
283 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
284 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
285 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
286 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
287 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
288 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
289 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
290 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
291 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
292 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
293 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
294 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
295 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
296 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
297 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
298 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
299 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
300 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
301 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
302 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
303 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
304 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
305 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
306 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
307 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
308 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
309 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
310 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
311 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
312 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
313 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
314 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
315 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
316 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
317 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
318 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
319 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
320 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
321 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
322 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
323 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
324 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
325 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
326 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
327 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
328 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
329 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
330 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
331 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
332 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
333 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
334 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
335 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
336 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
337 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
338 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
339 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
340 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
341 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
342 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
343 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
344 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
345 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
346 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
347 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
348 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
349 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
350 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
351 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
352 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
353 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
354 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
355 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
356 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
357 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
358 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
359 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
360 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
361 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
362 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
363 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
364 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
365 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
366 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
367 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
368 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
369 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
370 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
371 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
372 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
373 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
374 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
375 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
376 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
377 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
378 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
379 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
380 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
381 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
382 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
383 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
384 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
385 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
386 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
387 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
388 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
389 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
390 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
391 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
392 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
393 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
394 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
395 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
396 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
397 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
398 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
399 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
400 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
401 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
402 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
403 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
404 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
405 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
406 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
407 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
408 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
409 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
410 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
411 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
412 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
413 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
414 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
415 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
416 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
417 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
418 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
419 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
420 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
421 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
422 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
423 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
424 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
425 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
426 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
427 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
428 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
429 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
430 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
431 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
432 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
433 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
434 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
435 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
436 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
437 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
438 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
439 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
440 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
441 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
442 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
443 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
444 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
445 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
446 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
447 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
448 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
449 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
450 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
451 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
452 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
453 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
454 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
455 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
456 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
457 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
458 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
459 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
460 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
461 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
462 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
463 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
464 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
465 2643221688 Rhizobium sp. Root482 Isolate Unclassified
466 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
467 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
468 2842694124 Methylopila sp. R-72369 Isolate Unclassified
469 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
470 2909042592 Labrys sp. LIt4 Isolate Nodule
471 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
472 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
473 641522639 Methylobacterium sp. 4-46 Isolate Nodule
474 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.86
Metatranscriptomes 0.96
Isolates 1.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.35
Nodule 0.43
Rhizoplane 8.14
Rhizosphere 78.05
Stem 0
Stem Tuber 0
Unclassified 0.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105241_10178028 3300009174 Bacteria 1762
2 ARcpr5oldR_c010917 3300000041 Bacteria 775
3 ARSoilOldRDRAFT_c010379 3300000044 Bacteria 779
4 CNAas_1006227 3300000532 Bacteria 768
5 JGI24741J21665_1004001 3300001915 Bacteria 3366
6 JGI24747J21853_1006656 3300001978 Bacteria 1097
7 JGI24740J21852_10008136 3300001979 Bacteria 4205
8 JGI24740J21852_10061809 3300001979 Bacteria 1030
9 JGI24739J22299_10007274 3300001989 Bacteria 4159
10 JGI24739J22299_10031222 3300001989 Bacteria 1842
11 JGI24737J22298_10004820 3300001990 Bacteria 4686
12 JGI24737J22298_10008254 3300001990 Bacteria 3493
13 JGI24750J21931_1000402 3300002070 Bacteria 7218
14 JGI24745J21846_1002446 3300002073 Bacteria 1899
15 JGI24748J21848_1012683 3300002074 Bacteria 995
16 JGI24738J21930_10043990 3300002075 Bacteria 908
17 JGI24744J21845_10009105 3300002077 Bacteria 2040
18 JGI24742J22300_10000673 3300002244 Bacteria 5136
19 JGI24751J29686_10020824 3300002459 Bacteria 1359
20 JGI25406J46586_10014070 3300003203 Bacteria 3411
21 JGI25153J46596_10000006 3300003215 Bacteria 447760
22 Ga0006770J48903_1041297 3300003305 Bacteria 632
23 JGI26129J50193_1002667 3300003349 Bacteria 1253
24 Ga0007409J51694_1040205 3300003575 Bacteria 734
25 Ga0055542_1000046 3300003762 Bacteria 201922
26 Ga0055529_1000007 3300003763 Bacteria 403604
27 Ga0055529_1000109 3300003763 Bacteria 121019
28 JGI25405J52794_10005337 3300003911 Bacteria 2316
29 Ga0058859_10066463 3300004798 Bacteria 1120
30 Ga0058861_11603884 3300004800 Bacteria 726
31 Ga0058860_10037437 3300004801 Bacteria 1442
32 Ga0065707_10661364 3300005295 Bacteria 658
33 Ga0070658_10000227 3300005327 Bacteria 50101
34 Ga0070658_10390228 3300005327 Bacteria 1195
35 Ga0070676_10045239 3300005328 Bacteria 2563
36 Ga0070676_10323776 3300005328 Bacteria 1052
37 Ga0070683_100047063 3300005329 Bacteria 3985
38 Ga0070683_100050766 3300005329 Bacteria 3841
39 Ga0070683_100201550 3300005329 Bacteria 1890
40 Ga0070690_100088981 3300005330 Bacteria 2030
41 Ga0070670_100014997 3300005331 Bacteria 6650
42 Ga0070670_100024267 3300005331 Bacteria 5216
43 Ga0070677_10265598 3300005333 Bacteria 858
44 Ga0068869_100402892 3300005334 Bacteria 1126
45 Ga0070666_10098933 3300005335 Bacteria 2009
46 Ga0070666_10193059 3300005335 Bacteria 1431
47 Ga0070680_101690206 3300005336 Bacteria 549
48 Ga0068868_100006136 3300005338 Bacteria 8492
49 Ga0068868_100198504 3300005338 Bacteria 1671
50 Ga0070660_100057050 3300005339 Bacteria 3024
51 Ga0070660_100103350 3300005339 Bacteria 2260
52 Ga0070660_100123272 3300005339 Bacteria 2069
53 Ga0070689_100021560 3300005340 Bacteria 4799
54 Ga0070689_100492516 3300005340 Bacteria 1049
55 Ga0070691_10088053 3300005341 Bacteria 1528
56 Ga0070661_100050710 3300005344 Bacteria 3037
57 Ga0070661_100735807 3300005344 Bacteria 806
58 Ga0070692_10068434 3300005345 Bacteria 1886
59 Ga0070668_100120940 3300005347 Bacteria 2093
60 Ga0070668_100123627 3300005347 Bacteria 2071
61 Ga0070668_100499749 3300005347 Bacteria 1053
62 Ga0070675_100106327 3300005354 Bacteria 2369
63 Ga0070671_100015077 3300005355 Bacteria 6242
64 Ga0070671_100545049 3300005355 Bacteria 1000
65 Ga0070671_100675309 3300005355 Bacteria 895
66 Ga0070674_100011640 3300005356 Bacteria 5361
67 Ga0070673_100018705 3300005364 Bacteria 4957
68 Ga0070673_100019097 3300005364 Bacteria 4917
69 Ga0070673_100062718 3300005364 Bacteria 2954
70 Ga0070673_100084205 3300005364 Bacteria 2585
71 Ga0070673_100277232 3300005364 Bacteria 1469
72 Ga0070688_100001965 3300005365 Bacteria 10333
73 Ga0070659_100127015 3300005366 Bacteria 2069
74 Ga0070659_100787033 3300005366 Bacteria 826
75 Ga0070667_100144332 3300005367 Bacteria 2086
76 Ga0070709_10031572 3300005434 Bacteria 3187
77 Ga0070709_10039765 3300005434 Bacteria 2887
78 Ga0070709_10048746 3300005434 Bacteria 2644
79 Ga0070709_10092168 3300005434 Bacteria 2001
80 Ga0070709_10407584 3300005434 Bacteria 1016
81 Ga0070714_100205727 3300005435 Bacteria 1802
82 Ga0070714_100557405 3300005435 Bacteria 1098
83 Ga0070713_100262776 3300005436 Bacteria 1578
84 Ga0070713_100435030 3300005436 Bacteria 1230
85 Ga0070713_100618351 3300005436 Bacteria 1030
86 Ga0070713_100937132 3300005436 Bacteria 834
87 Ga0070713_100982960 3300005436 Bacteria 814
88 Ga0070713_101161531 3300005436 Bacteria 747
89 Ga0070710_10103497 3300005437 Bacteria 1699
90 Ga0070710_10492334 3300005437 Bacteria 838
91 Ga0070701_10001415 3300005438 Bacteria 8882
92 Ga0070701_10138957 3300005438 Bacteria 1387
93 Ga0070711_100196306 3300005439 Bacteria 1554
94 Ga0070711_100728308 3300005439 Bacteria 837
95 Ga0070700_100016627 3300005441 Bacteria 4194
96 Ga0070694_100292564 3300005444 Bacteria 1245
97 Ga0070694_101197290 3300005444 Bacteria 636
98 Ga0070708_100300427 3300005445 Bacteria 1512
99 Ga0070663_100059934 3300005455 Bacteria 2736
100 Ga0070663_100060575 3300005455 Bacteria 2723
101 Ga0070663_100229052 3300005455 Bacteria 1462
102 Ga0070678_100000076 3300005456 Bacteria 37213
103 Ga0070678_100044515 3300005456 Bacteria 3170
104 Ga0070678_100866806 3300005456 Bacteria 824
105 Ga0068867_100743589 3300005459 Bacteria 869
106 Ga0070685_10003484 3300005466 Bacteria 8005
107 Ga0070685_10018589 3300005466 Bacteria 3740
108 Ga0070707_100591580 3300005468 Bacteria 1072
109 Ga0070679_100736247 3300005530 Bacteria 929
110 Ga0070679_101695232 3300005530 Bacteria 580
111 Ga0070684_100092257 3300005535 Bacteria 2694
112 Ga0070684_100209250 3300005535 Bacteria 1777
113 Ga0070697_100524976 3300005536 Bacteria 1037
114 Ga0068853_100021239 3300005539 Bacteria 5408
115 Ga0068853_100065617 3300005539 Bacteria 3150
116 Ga0070672_100007567 3300005543 Bacteria 7382
117 Ga0070672_100688115 3300005543 Bacteria 895
118 Ga0070686_100013330 3300005544 Bacteria 4702
119 Ga0070686_100095825 3300005544 Bacteria 1994
120 Ga0070686_101365111 3300005544 Bacteria 594
121 Ga0070695_100320207 3300005545 Bacteria 1152
122 Ga0070696_100138508 3300005546 Bacteria 1776
123 Ga0070696_100433591 3300005546 Bacteria 1034
124 Ga0070696_101545394 3300005546 Bacteria 569
125 Ga0070693_100010203 3300005547 Bacteria 4697
126 Ga0070693_100110921 3300005547 Bacteria 1687
127 Ga0070665_100000086 3300005548 Bacteria 178229
128 Ga0070665_100067412 3300005548 Bacteria 3589
129 Ga0070665_100068679 3300005548 Bacteria 3553
130 Ga0070665_100304791 3300005548 Bacteria 1596
131 Ga0070664_100023420 3300005564 Bacteria 5100
132 Ga0070664_100282674 3300005564 Bacteria 1496
133 Ga0068854_100039985 3300005578 Bacteria 3306
134 Ga0068854_100042439 3300005578 Bacteria 3219
135 Ga0068856_100225928 3300005614 Bacteria 1887
136 Ga0070702_100044794 3300005615 Bacteria 2500
137 Ga0070702_100301100 3300005615 Bacteria 1109
138 Ga0070702_101479437 3300005615 Bacteria 558
139 Ga0068852_100217059 3300005616 Bacteria 1817
140 Ga0068859_100051554 3300005617 Bacteria 4136
141 Ga0068864_100076296 3300005618 Bacteria 2928
142 Ga0068864_100089733 3300005618 Bacteria 2708
143 Ga0068866_10020275 3300005718 Bacteria 3044
144 Ga0068851_10134053 3300005834 Bacteria 1341
145 Ga0068870_10006013 3300005840 Bacteria 5332
146 Ga0068863_100006758 3300005841 Bacteria 11246
147 Ga0068863_100040544 3300005841 Bacteria 4427
148 Ga0068863_100120706 3300005841 Bacteria 2499
149 Ga0068858_100019366 3300005842 Bacteria 6364
150 Ga0068858_100045278 3300005842 Bacteria 4077
151 Ga0068860_100034171 3300005843 Bacteria 4876
152 Ga0068860_100219305 3300005843 Bacteria 1847
153 Ga0068862_100137131 3300005844 Bacteria 2169
154 Ga0081455_10000031 3300005937 Bacteria 146486
155 Ga0081455_10006810 3300005937 Bacteria 12183
156 Ga0081455_10007632 3300005937 Bacteria 11363
157 Ga0081455_10009265 3300005937 Bacteria 10140
158 Ga0081455_10218845 3300005937 Bacteria 1413
159 Ga0081455_10872817 3300005937 Bacteria 561
160 Ga0081538_10008070 3300005981 Bacteria 8990
161 Ga0081540_1001289 3300005983 Bacteria 21882
162 Ga0081540_1020606 3300005983 Bacteria 3958
163 Ga0081539_10005395 3300005985 Bacteria 13086
164 Ga0070717_10172395 3300006028 Bacteria 1882
165 Ga0070717_10177708 3300006028 Bacteria 1854
166 Ga0075365_10003192 3300006038 Bacteria 8372
167 Ga0075365_10005288 3300006038 Bacteria 6945
168 Ga0075365_10085364 3300006038 Bacteria 2144
169 Ga0075365_10120212 3300006038 Bacteria 1811
170 Ga0075368_10025328 3300006042 Bacteria 2276
171 Ga0075368_10040074 3300006042 Bacteria 1838
172 Ga0075363_100039414 3300006048 Bacteria 2486
173 Ga0075364_10002133 3300006051 Bacteria 11070
174 Ga0075364_10037536 3300006051 Bacteria 3138
175 Ga0075364_10081168 3300006051 Bacteria 2144
176 Ga0075364_10217663 3300006051 Bacteria 1295
177 Ga0075364_10221008 3300006051 Bacteria 1285
178 Ga0075432_10068835 3300006058 Bacteria 1269
179 Ga0070715_10019098 3300006163 Bacteria 2623
180 Ga0070716_100071926 3300006173 Bacteria 2035
181 Ga0070716_100117673 3300006173 Bacteria 1658
182 Ga0070716_100123052 3300006173 Bacteria 1627
183 Ga0070712_100000791 3300006175 Bacteria 18739
184 Ga0070712_100003188 3300006175 Bacteria 10104
185 Ga0075362_10018797 3300006177 Bacteria 2864
186 Ga0075362_10028993 3300006177 Bacteria 2382
187 Ga0075367_10062216 3300006178 Bacteria 2229
188 Ga0075367_10384387 3300006178 Bacteria 887
189 Ga0075369_10010311 3300006186 Bacteria 3652
190 Ga0075369_10057502 3300006186 Bacteria 1691
191 Ga0075369_10059743 3300006186 Bacteria 1661
192 Ga0075366_10041669 3300006195 Bacteria 2719
193 Ga0097621_100055279 3300006237 Bacteria 3241
194 Ga0068871_100012659 3300006358 Bacteria 6232
195 Ga0068871_100040214 3300006358 Bacteria 3744
196 Ga0068871_100374910 3300006358 Bacteria 1263
197 Ga0075428_100023093 3300006844 Bacteria 6882
198 Ga0075428_100267223 3300006844 Bacteria 1841
199 Ga0075428_101100835 3300006844 Bacteria 839
200 Ga0075430_100000194 3300006846 Bacteria 41024
201 Ga0075430_100004109 3300006846 Bacteria 12280
202 Ga0075431_100251940 3300006847 Bacteria 1794
203 Ga0075431_100285823 3300006847 Bacteria 1670
204 Ga0075431_100914062 3300006847 Bacteria 847
205 Ga0075433_10000273 3300006852 Bacteria 30404
206 Ga0075433_10259454 3300006852 Bacteria 1541
207 Ga0075433_11744912 3300006852 Bacteria 536
208 Ga0075434_100000421 3300006871 Bacteria 31416
209 Ga0075434_100029211 3300006871 Bacteria 5422
210 Ga0075434_100507469 3300006871 Bacteria 1227
211 Ga0075434_100649128 3300006871 Bacteria 1073
212 Ga0075429_100008384 3300006880 Bacteria 8996
213 Ga0075429_100986435 3300006880 Bacteria 737
214 Ga0068865_100086795 3300006881 Bacteria 2259
215 Ga0068865_101150520 3300006881 Bacteria 685
216 Ga0075436_100345558 3300006914 Bacteria 1071
217 Ga0097620_100051553 3300006931 Bacteria 4136
218 Ga0075435_100056781 3300007076 Bacteria 3165
219 Ga0099794_10104145 3300007265 Bacteria 1418
220 Ga0099794_10177246 3300007265 Bacteria 1087
221 Ga0099795_10002266 3300007788 Bacteria 4475
222 Ga0105251_10011778 3300009011 Bacteria 4979
223 Ga0105250_10135776 3300009092 Bacteria 1017
224 Ga0105240_10356021 3300009093 Bacteria 1659
225 Ga0111539_10000229 3300009094 Bacteria 67148
226 Ga0111539_10001379 3300009094 Bacteria 32283
227 Ga0111539_10824815 3300009094 Bacteria 1079
228 Ga0111539_12009851 3300009094 Bacteria 670
229 Ga0105245_10037226 3300009098 Bacteria 4326
230 Ga0105245_10079276 3300009098 Bacteria 2998
231 Ga0114129_10001774 3300009147 Bacteria 29378
232 Ga0114129_10002175 3300009147 Bacteria 26976
233 Ga0114129_10006074 3300009147 Bacteria 17120
234 Ga0114129_10007698 3300009147 Bacteria 15329
235 Ga0105243_10000224 3300009148 Bacteria 65196
236 Ga0105243_10132865 3300009148 Bacteria 2114
237 Ga0105243_10176666 3300009148 Bacteria 1854
238 Ga0105243_11403605 3300009148 Bacteria 719
239 Ga0105241_10020421 3300009174 Bacteria 4893
240 Ga0105241_10505820 3300009174 Bacteria 1078
241 Ga0105242_10161739 3300009176 Bacteria 1960
242 Ga0105242_10733459 3300009176 Bacteria 970
243 Ga0105248_10012785 3300009177 Bacteria 9259
244 Ga0105248_10107968 3300009177 Bacteria 3138
245 Ga0105248_10692325 3300009177 Bacteria 1150
246 Ga0105237_10100274 3300009545 Bacteria 2887
247 Ga0105237_10148761 3300009545 Bacteria 2337
248 Ga0105237_10186189 3300009545 Bacteria 2076
249 Ga0105237_10897334 3300009545 Bacteria 893
250 Ga0105238_10112674 3300009551 Bacteria 2700
251 Ga0105238_10721308 3300009551 Bacteria 1010
252 Ga0105249_10293759 3300009553 Bacteria 1627
253 Ga0105249_11605261 3300009553 Bacteria 723
254 Ga0105249_13126192 3300009553 Bacteria 532
255 Ga0099796_10105966 3300010159 Bacteria 1064
256 Ga0105239_10305677 3300010375 Bacteria 1791
257 Ga0105239_10531814 3300010375 Bacteria 1338
258 Ga0105246_10125959 3300011119 Bacteria 1905
259 Ga0105246_10358069 3300011119 Bacteria 1198
260 Ga0157317_1010086 3300012475 Bacteria 717
261 Ga0157338_1023769 3300012515 Bacteria 734
262 Ga0157373_10130767 3300013100 Bacteria 1766
263 Ga0157371_10000097 3300013102 Bacteria 134150
264 Ga0157374_10029991 3300013296 Bacteria 4934
265 Ga0157374_10718072 3300013296 Bacteria 1013
266 Ga0157378_10038442 3300013297 Bacteria 4241
267 Ga0163162_10148997 3300013306 Bacteria 2457
268 Ga0163162_11970701 3300013306 Bacteria 669
269 Ga0157372_10639287 3300013307 Bacteria 1239
270 Ga0157372_11241792 3300013307 Bacteria 861
271 Ga0157375_11557786 3300013308 Bacteria 781
272 Ga0157375_12762277 3300013308 Bacteria 587
273 Ga0163163_10014233 3300014325 Bacteria 7309
274 Ga0163163_11073786 3300014325 Bacteria 868
275 Ga0157380_10009885 3300014326 Bacteria 6849
276 Ga0157377_10077553 3300014745 Bacteria 1935
277 Ga0157377_10583468 3300014745 Bacteria 795
278 Ga0157376_10123367 3300014969 Bacteria 2300
279 Ga0163161_10052874 3300017792 Bacteria 2944
280 Ga0184603_109846 3300019192 Bacteria 534
281 Ga0206356_11671177 3300020070 Bacteria 1108
282 Ga0213876_10010835 3300021384 Bacteria 4885
283 Ga0213876_10011401 3300021384 Bacteria 4746
284 Ga0213876_10092935 3300021384 Bacteria 1598
285 Ga0213875_10008383 3300021388 Bacteria 5299
286 Ga0224712_10115216 3300022467 Bacteria 1157
287 Ga0209563_100111 3300025230 Bacteria 141123
288 Ga0209646_1006332 3300025246 Bacteria 1994
289 Ga0209026_1015671 3300025250 Bacteria 1240
290 Ga0209677_106271 3300025253 Bacteria 2859
291 Ga0209148_1000026 3300025254 Bacteria 629213
292 Ga0209455_1000005 3300025272 Bacteria 1416756
293 Ga0209758_1000001 3300025297 Bacteria 1981790
294 Ga0209758_1137957 3300025297 Bacteria 636
295 Ga0207656_10021179 3300025321 Bacteria 2594
296 Ga0207692_10038064 3300025898 Bacteria 2357
297 Ga0207642_10114537 3300025899 Bacteria 1379
298 Ga0207710_10005430 3300025900 Bacteria 5490
299 Ga0207710_10050789 3300025900 Bacteria 1861
300 Ga0207688_10000077 3300025901 Bacteria 37350
301 Ga0207688_10106678 3300025901 Bacteria 1623
302 Ga0207688_10640068 3300025901 Bacteria 671
303 Ga0207680_10213819 3300025903 Bacteria 1319
304 Ga0207680_10365608 3300025903 Bacteria 1015
305 Ga0207647_10006537 3300025904 Bacteria 8468
306 Ga0207647_10149441 3300025904 Bacteria 1366
307 Ga0207647_10153308 3300025904 Bacteria 1346
308 Ga0207685_10152462 3300025905 Bacteria 1047
309 Ga0207685_10436222 3300025905 Bacteria 678
310 Ga0207685_10456168 3300025905 Bacteria 666
311 Ga0207645_10007524 3300025907 Bacteria 7685
312 Ga0207643_10001791 3300025908 Bacteria 11957
313 Ga0207705_10000450 3300025909 Bacteria 35404
314 Ga0207654_10004079 3300025911 Bacteria 7359
315 Ga0207654_10343923 3300025911 Bacteria 1025
316 Ga0207707_10364122 3300025912 Bacteria 1245
317 Ga0207695_10015037 3300025913 Bacteria 9132
318 Ga0207695_10029534 3300025913 Bacteria 6053
319 Ga0207695_11521831 3300025913 Bacteria 550
320 Ga0207671_10012661 3300025914 Bacteria 6770
321 Ga0207671_10499191 3300025914 Bacteria 970
322 Ga0207693_10003236 3300025915 Bacteria 13979
323 Ga0207693_10005621 3300025915 Bacteria 10426
324 Ga0207693_10049027 3300025915 Bacteria 3316
325 Ga0207693_10172152 3300025915 Bacteria 1705
326 Ga0207693_11043292 3300025915 Bacteria 623
327 Ga0207663_10122947 3300025916 Bacteria 1780
328 Ga0207663_10499037 3300025916 Bacteria 945
329 Ga0207663_11122550 3300025916 Bacteria 632
330 Ga0207663_11186510 3300025916 Bacteria 614
331 Ga0207660_11334353 3300025917 Bacteria 582
332 Ga0207662_10040674 3300025918 Bacteria 2734
333 Ga0207657_10031958 3300025919 Bacteria 4761
334 Ga0207657_10042332 3300025919 Bacteria 4020
335 Ga0207657_10059602 3300025919 Bacteria 3278
336 Ga0207657_10265897 3300025919 Bacteria 1364
337 Ga0207649_10002255 3300025920 Bacteria 10883
338 Ga0207646_10113582 3300025922 Bacteria 2432
339 Ga0207694_10065778 3300025924 Bacteria 2827
340 Ga0207694_10179649 3300025924 Bacteria 1716
341 Ga0207650_10012602 3300025925 Bacteria 5836
342 Ga0207659_10067487 3300025926 Bacteria 2598
343 Ga0207659_10104307 3300025926 Bacteria 2144
344 Ga0207687_10013627 3300025927 Bacteria 5307
345 Ga0207687_10017793 3300025927 Bacteria 4687
346 Ga0207700_10092443 3300025928 Bacteria 2392
347 Ga0207700_10411181 3300025928 Bacteria 1187
348 Ga0207700_10542782 3300025928 Bacteria 1031
349 Ga0207700_11641347 3300025928 Bacteria 568
350 Ga0207664_10011743 3300025929 Bacteria 6242
351 Ga0207664_10513516 3300025929 Bacteria 1074
352 Ga0207664_11251864 3300025929 Bacteria 661
353 Ga0207644_10055591 3300025931 Bacteria 2853
354 Ga0207644_10624198 3300025931 Bacteria 896
355 Ga0207644_11160769 3300025931 Bacteria 649
356 Ga0207690_10010098 3300025932 Bacteria 5608
357 Ga0207690_10045257 3300025932 Bacteria 2906
358 Ga0207690_10068415 3300025932 Bacteria 2440
359 Ga0207706_10001566 3300025933 Bacteria 22667
360 Ga0207706_10011772 3300025933 Bacteria 7966
361 Ga0207686_10039284 3300025934 Bacteria 2871
362 Ga0207686_10152145 3300025934 Bacteria 1612
363 Ga0207709_10000519 3300025935 Bacteria 33581
364 Ga0207709_10041236 3300025935 Bacteria 2769
365 Ga0207709_10236929 3300025935 Bacteria 1325
366 Ga0207670_10213751 3300025936 Bacteria 1472
367 Ga0207669_10000161 3300025937 Bacteria 32114
368 Ga0207669_10040531 3300025937 Bacteria 2702
369 Ga0207704_10614683 3300025938 Bacteria 891
370 Ga0207665_10231158 3300025939 Bacteria 1359
371 Ga0207691_10002068 3300025940 Bacteria 19576
372 Ga0207691_10050573 3300025940 Bacteria 3804
373 Ga0207691_10778385 3300025940 Bacteria 805
374 Ga0207711_10044686 3300025941 Bacteria 3782
375 Ga0207711_10329039 3300025941 Bacteria 1413
376 Ga0207711_10710146 3300025941 Bacteria 938
377 Ga0207689_10016646 3300025942 Bacteria 6222
378 Ga0207689_10403287 3300025942 Bacteria 1140
379 Ga0207661_10262309 3300025944 Bacteria 1539
380 Ga0207661_10714512 3300025944 Bacteria 922
381 Ga0207679_10166701 3300025945 Bacteria 1809
382 Ga0207679_10175530 3300025945 Bacteria 1768
383 Ga0207667_10000010 3300025949 Bacteria 477432
384 Ga0207651_10178762 3300025960 Bacteria 1681
385 Ga0207651_10371229 3300025960 Bacteria 1210
386 Ga0207651_10588487 3300025960 Bacteria 971
387 Ga0207712_10210268 3300025961 Bacteria 1549
388 Ga0207712_10462903 3300025961 Bacteria 1078
389 Ga0207712_10808581 3300025961 Bacteria 824
390 Ga0207668_10044578 3300025972 Bacteria 3018
391 Ga0207668_10349243 3300025972 Bacteria 1236
392 Ga0207668_11387314 3300025972 Bacteria 633
393 Ga0207640_10013893 3300025981 Bacteria 4622
394 Ga0207640_10076486 3300025981 Bacteria 2272
395 Ga0207658_10266491 3300025986 Bacteria 1462
396 Ga0207677_10013109 3300026023 Bacteria 4792
397 Ga0207703_10091410 3300026035 Bacteria 2560
398 Ga0207639_10060370 3300026041 Bacteria 2925
399 Ga0207639_10225655 3300026041 Bacteria 1620
400 Ga0207678_10001623 3300026067 Bacteria 20664
401 Ga0207678_10021515 3300026067 Bacteria 5656
402 Ga0207678_10835925 3300026067 Bacteria 813
403 Ga0207708_10000155 3300026075 Bacteria 54651
404 Ga0207702_10005521 3300026078 Bacteria 11051
405 Ga0207702_10100222 3300026078 Bacteria 2555
406 Ga0207702_10149284 3300026078 Bacteria 2125
407 Ga0207702_10335211 3300026078 Bacteria 1444
408 Ga0207641_10076371 3300026088 Bacteria 2896
409 Ga0207641_10229845 3300026088 Bacteria 1723
410 Ga0207648_10002624 3300026089 Bacteria 19247
411 Ga0207676_10006530 3300026095 Bacteria 8245
412 Ga0207676_10167625 3300026095 Bacteria 1910
413 Ga0207676_11094049 3300026095 Bacteria 788
414 Ga0207674_10095374 3300026116 Bacteria 2961
415 Ga0207675_100036723 3300026118 Bacteria 4569
416 Ga0207675_100408059 3300026118 Bacteria 1340
417 Ga0207683_10000655 3300026121 Bacteria 31727
418 Ga0207683_10002386 3300026121 Bacteria 16404
419 Ga0207698_10019884 3300026142 Bacteria 4610
420 Ga0209179_1020524 3300027512 Bacteria 1283
421 Ga0209813_10035196 3300027866 Bacteria 1498
422 Ga0209813_10050558 3300027866 Bacteria 1297
423 Ga0207428_10000243 3300027907 Bacteria 74403
424 Ga0207428_10274299 3300027907 Bacteria 1253
425 Ga0207428_10544426 3300027907 Bacteria 840
426 Ga0268266_10000002 3300028379 Bacteria 3059047
427 Ga0268266_10952457 3300028379 Bacteria 830
428 Ga0268265_10697340 3300028380 Bacteria 980
429 Ga0265337_1003979 3300028556 Bacteria 6253
430 Ga0307517_10028536 3300028786 Bacteria 6645
431 Ga0265338_10131866 3300028800 Bacteria 1971
432 Ga0265325_10004230 3300031241 Bacteria 9109
433 Ga0265325_10283302 3300031241 Bacteria 743
434 Ga0265340_10007569 3300031247 Bacteria 5893
435 Ga0307513_10036337 3300031456 Bacteria 5496
436 Ga0307408_100053697 3300031548 Bacteria 2911
437 Ga0265313_10000577 3300031595 Bacteria 38251
438 Ga0316579_10012512 3300031691 Bacteria 3633
439 Ga0316576_10169460 3300031727 Bacteria 1648
440 Ga0316578_10029432 3300031728 Bacteria 3117
441 Ga0307405_10614382 3300031731 Bacteria 889
442 Ga0307412_11113012 3300031911 Bacteria 703
443 Ga0307409_100834114 3300031995 Bacteria 932
444 Ga0307416_100200454 3300032002 Bacteria 1893
445 Ga0307414_10253723 3300032004 Bacteria 1464
446 Ga0307415_100960540 3300032126 Bacteria 792
447 Ga0307510_10218152 3300033180 Bacteria 1422
448 Ga0373959_0002107 3300034820 Bacteria 3175
449 Ga0373938_0219438 3300034957 Bacteria 533
450 Ga0373929_0002588 3300035085 Bacteria 3318
451 Ga0373934_0071952 3300035086 Bacteria 1384
452 Ga0373940_0008848 3300035088 Bacteria 2324
453 Ga0373940_0107108 3300035088 Bacteria 854
454 Ga0373944_0103262 3300035089 Bacteria 965
455 Ga0373949_0002524 3300035090 Bacteria 4662
456 Ga0373951_0230530 3300035091 Unclassified 550
457 Ga0373923_0249273 3300035111 Bacteria 831
458 Ga0373932_0002959 3300035112 Bacteria 4178
459 Ga0373932_0109810 3300035112 Bacteria 908
460 Ga0373936_0419425 3300035113 Bacteria 616
461 Ga0373939_0001760 3300035114 Bacteria 5212
462 Ga0373939_0134207 3300035114 Bacteria 886
463 Ga0373945_0002893 3300035116 Bacteria 5393
464 Ga0373945_0016275 3300035116 Bacteria 2506
465 Ga0373945_0108409 3300035116 Bacteria 1093
466 Ga0373945_0313512 3300035116 Bacteria 674
467 Ga0373953_0019872 3300035117 Bacteria 2504
468 Ga0373954_0013559 3300035118 Bacteria 3634
469 Ga0373954_0167120 3300035118 Bacteria 1077
470 Ga0373956_0008073 3300035119 Bacteria 4257
471 Ga0373957_0055416 3300035120 Bacteria 1524
472 Ga0373960_0024692 3300035121 Bacteria 1628
473 Ga0373960_0125201 3300035121 Bacteria 856
474 Ga0373943_0010841 3300035170 Bacteria 4092
475 Ga0373943_0034408 3300035170 Bacteria 2416
476 Ga0373943_0037165 3300035170 Bacteria 2337
477 Ga0373946_0083319 3300035171 Bacteria 1404
478 Ga0373946_0106293 3300035171 Bacteria 1265
479 Ga0373946_0156961 3300035171 Bacteria 1065
480 Ga0373955_0067263 3300035172 Bacteria 1994
481 Ga0373955_0262806 3300035172 Bacteria 1036
482 Ga0373962_0257097 3300035242 Bacteria 608
483 Ga0316574_0003152 3300035398 Bacteria 8440
484 Ga0373924_0034069 3300035410 Bacteria 2060
485 Ga0373931_0053589 3300035691 Bacteria 2153
486 Ga0373931_0063709 3300035691 Bacteria 1993
487 Ga0373931_0795886 3300035691 Bacteria 630
488 Ga0373935_0028021 3300035692 Bacteria 3481
489 Ga0373935_0043914 3300035692 Bacteria 2815
490 Ga0373935_0179924 3300035692 Bacteria 1451
491 Ga0373935_0709656 3300035692 Bacteria 740
492 Ga0373935_1008721 3300035692 Bacteria 618
493 Ga0373927_0012550 3300035695 Bacteria 5642
494 Ga0373927_0036648 3300035695 Bacteria 3189
495 Ga0373927_0457214 3300035695 Bacteria 843
496 Ga0373927_0625631 3300035695 Bacteria 711
497 Ga0373933_0147484 3300035724 Bacteria 1488
498 Ga0373933_0520623 3300035724 Bacteria 780
499 Ga0373947_0031838 3300035725 Bacteria 3106
500 Ga0373937_0003492 3300036401 Bacteria 13220
501 Ga0373937_0019211 3300036401 Bacteria 6118
502 Ga0373937_0369811 3300036401 Bacteria 1359
503 Ga0373925_0024734 3300037068 Bacteria 4386
504 Ga0395898_1253505 3300037466 Bacteria 672
505 Ga0436364_0234810 3300037853 Bacteria 3824
506 Ga0436364_0399681 3300037853 Bacteria 1288
507 Ga0436364_1142684 3300037853 Bacteria 1682
508 Ga0436364_1239282 3300037853 Bacteria 803
509 Ga0436365_0059329 3300039437 Bacteria 12786
510 Ga0436365_0420699 3300039437 Bacteria 827
511 Ga0436365_0688273 3300039437 Bacteria 848
512 Ga0436365_1240129 3300039437 Bacteria 5706
513 Ga0436365_1813460 3300039437 Bacteria 743
514 Ga0436365_1863036 3300039437 Bacteria 1450
515 Ga0436365_1880013 3300039437 Bacteria 3149
516 Ga0436360_0257014 3300039438 Bacteria 2055
517 Ga0436360_0468502 3300039438 Bacteria 845
518 Ga0436360_1165231 3300039438 Bacteria 1342
519 Ga0436363_0667249 3300039450 Bacteria 838
520 Ga0436363_0912950 3300039450 Bacteria 9571
521 Ga0436363_1034686 3300039450 Bacteria 1089
522 Ga0436363_1185669 3300039450 Bacteria 741
523 Ga0436363_1339204 3300039450 Bacteria 1477
524 Ga0436362_0272649 3300039453 Bacteria 632
525 Ga0436362_0504108 3300039453 Bacteria 2366
526 Ga0436362_0764531 3300039453 Bacteria 779
527 Ga0439466_0163400 3300041411 Bacteria 681
528 Ga0451800_1662737 3300041459 Bacteria 874
529 Ga0451802_1269283 3300041460 Bacteria 732
530 Ga0451807_1178034 3300041486 Bacteria 1791
531 Ga0451807_2205113 3300041486 Bacteria 645
532 Ga0451847_0716738 3300041503 Bacteria 1039
533 Ga0439448_0268964 3300042005 Bacteria 603
534 Ga0453684_0374877 3300044712 Bacteria 1599
535 Ga0453684_1853656 3300044712 Bacteria 612
536 Ga0466968_0226657 3300044735 Bacteria 881
537 Ga0466967_0056965 3300045976 Bacteria 3448
538 Ga0495617_008079 3300046452 Bacteria 3636
539 Ga0495603_0143947 3300046455 Bacteria 1386
540 Ga0495603_0246549 3300046455 Bacteria 1028
541 Ga0495603_0361305 3300046455 Bacteria 833
542 Ga0495603_0537217 3300046455 Bacteria 670
543 Ga0495590_0307898 3300046457 Bacteria 597
544 Ga0495629_0095241 3300046459 Bacteria 2077
545 Ga0495629_0183565 3300046459 Bacteria 1449
546 Ga0495638_0336018 3300046460 Bacteria 802
547 Ga0495641_0245924 3300046461 Bacteria 804
548 Ga0495651_0117195 3300046462 Bacteria 1961
549 Ga0495651_0203022 3300046462 Bacteria 1386
550 Ga0495651_0372208 3300046462 Bacteria 939
551 Ga0495651_0498339 3300046462 Bacteria 780
552 Ga0495653_0814693 3300046463 Bacteria 560
553 Ga0495580_0565922 3300046472 Bacteria 753
554 Ga0495582_0003215 3300046473 Bacteria 9173
555 Ga0495582_0323758 3300046473 Bacteria 887
556 Ga0495605_0067795 3300046474 Bacteria 1692
557 Ga0495639_0124254 3300046475 Bacteria 1232
558 Ga0495662_0021690 3300046476 Bacteria 3103
559 Ga0495662_0126699 3300046476 Bacteria 1254
560 Ga0495664_0109569 3300046477 Bacteria 1666
561 Ga0495584_0056617 3300046491 Bacteria 1973
562 Ga0495584_0067524 3300046491 Bacteria 1797
563 Ga0495584_0126032 3300046491 Bacteria 1298
564 Ga0495584_0318427 3300046491 Bacteria 790
565 Ga0495585_0003684 3300046492 Bacteria 10241
566 Ga0495585_0033792 3300046492 Bacteria 2893
567 Ga0495585_0520881 3300046492 Bacteria 564
568 Ga0495594_0092623 3300046499 Bacteria 1694
569 Ga0495594_0129039 3300046499 Bacteria 1431
570 Ga0495596_0007358 3300046500 Bacteria 4971
571 Ga0495596_0184579 3300046500 Bacteria 811
572 Ga0495607_0313628 3300046501 Bacteria 734
573 Ga0495607_0450241 3300046501 Bacteria 578
574 Ga0495583_0002564 3300046506 Bacteria 15303
575 Ga0495583_0096633 3300046506 Bacteria 1265
576 Ga0495583_0102296 3300046506 Bacteria 1221
577 Ga0495606_0000434 3300046507 Bacteria 69495
578 Ga0495608_0215298 3300046511 Bacteria 1207
579 Ga0495616_0071603 3300046513 Bacteria 1676
580 Ga0495616_0224957 3300046513 Bacteria 815
581 Ga0495618_0069520 3300046514 Bacteria 2239
582 Ga0495618_0137374 3300046514 Bacteria 1564
583 Ga0495620_0058886 3300046515 Bacteria 1607
584 Ga0495620_0167133 3300046515 Bacteria 854
585 Ga0495628_0708252 3300046516 Bacteria 711
586 Ga0495630_0068550 3300046517 Bacteria 2668
587 Ga0495630_0331459 3300046517 Bacteria 1164
588 Ga0495630_0614955 3300046517 Bacteria 833
589 Ga0495631_0015102 3300046518 Bacteria 3710
590 Ga0495632_0302490 3300046519 Bacteria 709
591 Ga0495637_0046443 3300046520 Bacteria 1837
592 Ga0495643_0004044 3300046522 Bacteria 10460
593 Ga0495643_0256628 3300046522 Bacteria 813
594 Ga0495644_0089536 3300046523 Bacteria 1161
595 Ga0495644_0162134 3300046523 Bacteria 857
596 Ga0495648_0000256 3300046524 Bacteria 60519
597 Ga0495648_0197955 3300046524 Bacteria 1008
598 Ga0495666_0324824 3300046526 Bacteria 694
599 Ga0495642_0012268 3300046528 Bacteria 3303
600 Ga0495652_0211248 3300046529 Bacteria 1465
601 Ga0495652_0490897 3300046529 Bacteria 853
602 Ga0495665_0149243 3300046531 Bacteria 1220
603 Ga0495640_0058133 3300046533 Bacteria 2638
604 Ga0495640_0170763 3300046533 Bacteria 1389
605 Ga0495640_0716601 3300046533 Bacteria 599
606 Ga0495587_0061172 3300046536 Bacteria 2207
607 Ga0495598_0007220 3300046537 Bacteria 2539
608 Ga0495598_0058074 3300046537 Bacteria 1186
609 Ga0495609_0040240 3300046538 Bacteria 2104
610 Ga0495609_0219481 3300046538 Bacteria 790
611 Ga0495621_0444031 3300046539 Bacteria 555
612 Ga0495597_0033512 3300046542 Bacteria 2325
613 Ga0495597_0100011 3300046542 Bacteria 1224
614 Ga0495645_0414812 3300046543 Bacteria 856
615 Ga0495622_0007231 3300046557 Bacteria 5154
616 Ga0495622_0042162 3300046557 Bacteria 2122
617 Ga0495622_0059387 3300046557 Bacteria 1771
618 Ga0495622_0413488 3300046557 Bacteria 580
619 Ga0495633_0002904 3300046558 Bacteria 11752
620 Ga0495633_0048113 3300046558 Bacteria 2014
621 Ga0495667_0143547 3300046559 Bacteria 1538
622 Ga0495656_0009903 3300046615 Bacteria 3445
623 Ga0495668_0000163 3300046616 Bacteria 99607
624 Ga0495668_0356889 3300046616 Bacteria 802
625 Ga0495634_0044077 3300046642 Bacteria 3021
626 Ga0495634_0345830 3300046642 Bacteria 891
627 Ga0495634_0585284 3300046642 Bacteria 649
628 Ga0495611_0045853 3300046648 Bacteria 1959
629 Ga0495611_0209504 3300046648 Bacteria 908
630 Ga0495625_0000546 3300046660 Bacteria 55126
631 Ga0495625_0021743 3300046660 Bacteria 4931
632 Ga0495625_0289091 3300046660 Bacteria 1052
633 Ga0495635_0486856 3300046663 Bacteria 813
634 Ga0495635_0914195 3300046663 Bacteria 561
635 Ga0495659_0051822 3300046664 Bacteria 1496
636 Ga0495661_0143407 3300046665 Bacteria 1297
637 Ga0495661_0187508 3300046665 Bacteria 1092
638 Ga0495588_0019191 3300046674 Bacteria 3347
639 Ga0495657_0117056 3300046675 Bacteria 1682
640 Ga0495623_0409535 3300046679 Bacteria 728
641 Ga0495646_0126928 3300046680 Bacteria 1439
642 Ga0495646_0162094 3300046680 Bacteria 1237
643 Ga0495647_0042596 3300046681 Bacteria 1734
644 Ga0495647_0057565 3300046681 Bacteria 1526
645 Ga0495658_0129886 3300046683 Bacteria 1532
646 Ga0495658_0455665 3300046683 Bacteria 817
647 Ga0495669_0000629 3300046684 Bacteria 15335
648 Ga0495613_0105682 3300046689 Bacteria 2032
649 Ga0495613_0213154 3300046689 Bacteria 1358
650 Ga0495613_0414938 3300046689 Bacteria 917
651 Ga0495624_0023574 3300046690 Bacteria 4058
652 Ga0495624_0202441 3300046690 Bacteria 1206
653 Ga0495670_0044549 3300046691 Bacteria 2215
654 Ga0495670_0091158 3300046691 Bacteria 1560
655 Ga0495671_0138292 3300046692 Bacteria 1187
656 Ga0495671_0503813 3300046692 Bacteria 577
657 Ga0495649_0080890 3300046694 Bacteria 1737
658 Ga0495649_0315602 3300046694 Bacteria 794
659 Ga0495589_0056859 3300046794 Bacteria 1925
660 Ga0495600_0000914 3300046809 Bacteria 15826
661 Ga0495600_0102405 3300046809 Bacteria 1866
662 Ga0495660_0030711 3300046810 Bacteria 3026
663 Ga0495660_0507439 3300046810 Bacteria 515
664 Ga0495581_0046865 3300047315 Bacteria 2498
665 Ga0495581_0064842 3300047315 Bacteria 2111
666 Ga0495581_0131892 3300047315 Bacteria 1456
667 Ga0495604_0160981 3300047317 Bacteria 1586
668 Ga0495604_0332054 3300047317 Bacteria 1014
669 Ga0495674_0055199 3300047319 Bacteria 3485
670 Ga0495674_0285562 3300047319 Bacteria 1351
671 Ga0495674_0454826 3300047319 Bacteria 1028
672 Ga0495672_0285350 3300047320 Bacteria 787
673 Ga0495680_0154542 3300047322 Bacteria 1670
674 Ga0495680_0175793 3300047322 Bacteria 1548
675 Ga0495680_0874915 3300047322 Bacteria 582
676 Ga0495683_0014914 3300047323 Bacteria 4047
677 Ga0495683_0325425 3300047323 Bacteria 654
678 Ga0495687_001516 3300047443 Bacteria 21182
679 Ga0495687_001938 3300047443 Bacteria 17742
680 Ga0495675_0136936 3300047444 Bacteria 1520
681 Ga0495675_0850957 3300047444 Bacteria 502
682 Ga0495677_0064928 3300047445 Bacteria 1357
683 Ga0495677_0266736 3300047445 Bacteria 671
684 Ga0495673_0039336 3300047469 Bacteria 2146
685 Ga0495681_0003826 3300047470 Bacteria 10415
686 Ga0495681_0107613 3300047470 Bacteria 1211
687 Ga0495684_0124731 3300047471 Bacteria 1938
688 Ga0495684_0127511 3300047471 Bacteria 1914
689 Ga0495684_0153330 3300047471 Bacteria 1722
690 Ga0495686_0358774 3300047472 Bacteria 791
691 Ga0495602_0227197 3300048088 Bacteria 1405
692 Ga0495614_0080043 3300048089 Bacteria 1415
693 Ga0495614_0316861 3300048089 Bacteria 723
694 Ga0495626_0187719 3300048091 Bacteria 854
695 Ga0495626_0414751 3300048091 Bacteria 519
696 Ga0496100_0110828 3300048903 Bacteria 1906
697 Ga0496101_0036986 3300048904 Bacteria 3460
698 Ga0496101_0054743 3300048904 Bacteria 2880
699 Ga0496101_0436784 3300048904 Bacteria 1032
700 Ga0496102_0002374 3300048905 Bacteria 16067
701 Ga0496102_0016499 3300048905 Bacteria 6455
702 Ga0496102_0018626 3300048905 Bacteria 6105
703 Ga0496102_0080953 3300048905 Bacteria 2993
704 Ga0496102_0410156 3300048905 Bacteria 1273
705 Ga0496102_1312762 3300048905 Bacteria 643
706 Ga0496103_0001305 3300048906 Bacteria 16975
707 Ga0496103_0008814 3300048906 Bacteria 5983
708 Ga0496103_0081573 3300048906 Bacteria 2034
709 Ga0496103_0271461 3300048906 Bacteria 1091
710 Ga0496103_0806570 3300048906 Bacteria 592
711 Ga0496104_0017570 3300048907 Bacteria 6516
712 Ga0496104_0035989 3300048907 Bacteria 4625
713 Ga0496104_0058641 3300048907 Bacteria 3644
714 Ga0496104_0110433 3300048907 Bacteria 2636
715 Ga0496104_0130038 3300048907 Bacteria 2418
716 Ga0496104_0139149 3300048907 Bacteria 2333
717 Ga0496104_0146617 3300048907 Bacteria 2266
718 Ga0496104_0196073 3300048907 Bacteria 1931
719 Ga0496105_0000355 3300048908 Bacteria 30230
720 Ga0496105_0009547 3300048908 Bacteria 7594
721 Ga0496105_0056230 3300048908 Bacteria 3247
722 Ga0496105_0100064 3300048908 Bacteria 2394
723 Ga0496105_0693188 3300048908 Bacteria 782
724 Ga0496106_0006735 3300048909 Bacteria 8509
725 Ga0496106_0032696 3300048909 Bacteria 3879
726 Ga0496106_0068832 3300048909 Bacteria 2700
727 Ga0496106_0320953 3300048909 Bacteria 1243
728 Ga0496106_0661558 3300048909 Bacteria 834
729 Ga0496107_0003073 3300048910 Bacteria 11076
730 Ga0496107_0007790 3300048910 Bacteria 7396
731 Ga0496107_0321875 3300048910 Bacteria 1151
732 Ga0496107_0381715 3300048910 Bacteria 1048
733 Ga0496108_0000619 3300048911 Bacteria 27898
734 Ga0496108_0004947 3300048911 Bacteria 10767
735 Ga0496108_0105362 3300048911 Bacteria 2407
736 Ga0496108_0142768 3300048911 Bacteria 2063
737 Ga0496108_0440214 3300048911 Bacteria 1138
738 Ga0496109_0001296 3300048912 Bacteria 20714
739 Ga0496109_0047907 3300048912 Bacteria 3887
740 Ga0496109_0466404 3300048912 Bacteria 1192
741 Ga0496109_0851787 3300048912 Bacteria 849
742 Ga0496110_0010405 3300048913 Bacteria 7563
743 Ga0496110_0013592 3300048913 Bacteria 6738
744 Ga0496110_0176588 3300048913 Bacteria 1938
745 Ga0496110_0300629 3300048913 Bacteria 1462
746 Ga0496110_1348174 3300048913 Bacteria 623
747 Ga0496111_0000484 3300048914 Bacteria 20435
748 Ga0496111_0003565 3300048914 Bacteria 9638
749 Ga0496111_0014923 3300048914 Bacteria 5319
750 Ga0496111_0022501 3300048914 Bacteria 4414
751 Ga0496111_1241207 3300048914 Bacteria 527
752 Ga0496112_0000727 3300048915 Bacteria 22874
753 Ga0496112_0023695 3300048915 Bacteria 5871
754 Ga0496112_0542405 3300048915 Bacteria 1097
755 Ga0496113_0007581 3300048916 Bacteria 6999
756 Ga0496113_0019225 3300048916 Bacteria 4774
757 Ga0496113_0115177 3300048916 Bacteria 2097
758 Ga0496113_0498730 3300048916 Bacteria 977
759 Ga0496114_0030219 3300048917 Bacteria 4457
760 Ga0496114_0046477 3300048917 Bacteria 3608
761 Ga0496114_0441513 3300048917 Bacteria 1152
762 Ga0496115_0000172 3300048918 Bacteria 59971
763 Ga0496115_0082027 3300048918 Bacteria 2627
764 Ga0496115_0086902 3300048918 Bacteria 2552
765 Ga0496115_0098419 3300048918 Bacteria 2395
766 Ga0496115_0370995 3300048918 Bacteria 1165
767 Ga0496115_0587595 3300048918 Bacteria 886
768 Ga0496117_0000582 3300048920 Bacteria 60157
769 Ga0496117_0528488 3300048920 Bacteria 566
770 Ga0496118_0000392 3300048921 Bacteria 74074
771 Ga0496118_0211134 3300048921 Bacteria 1139
772 Ga0496119_0016624 3300048922 Bacteria 5585
773 Ga0496121_0005396 3300048924 Bacteria 16416
774 Ga0496122_0012049 3300048925 Bacteria 8669
775 Ga0496123_0031365 3300048926 Bacteria 3869
776 Ga0496124_0000606 3300048927 Bacteria 60251
777 Ga0496124_0029126 3300048927 Bacteria 4926
778 Ga0496125_0000666 3300048928 Bacteria 57200
779 Ga0496126_0004606 3300048929 Bacteria 16354
780 Ga0496126_0327510 3300048929 Bacteria 1258
781 Ga0496126_0898861 3300048929 Bacteria 672
782 Ga0495682_0189965 3300049460 Bacteria 729
783 Ga0501032_0171688 3300049569 Bacteria 1422
784 Ga0501036_0723428 3300049572 Bacteria 822
785 Ga0501039_0224366 3300049575 Bacteria 1477
786 Ga0501039_0231328 3300049575 Bacteria 1453
787 Ga0501040_0177157 3300049576 Bacteria 1511
788 Ga0501041_0246890 3300049577 Bacteria 1122
789 Ga0501041_0258672 3300049577 Bacteria 1094
790 Ga0501041_0343469 3300049577 Bacteria 943
791 Ga0501042_0078302 3300049578 Bacteria 2368
792 Ga0501042_0142713 3300049578 Bacteria 1727
793 Ga0501042_0154182 3300049578 Bacteria 1657
794 Ga0501043_0709447 3300049579 Bacteria 734
795 Ga0501047_0215543 3300049581 Bacteria 1777
796 Ga0501047_0960261 3300049581 Bacteria 668
797 Ga0501067_0241596 3300049583 Bacteria 1005
798 Ga0501068_0172943 3300049584 Bacteria 1364
799 Ga0501069_0241471 3300049585 Bacteria 1053
800 Ga0501071_0015440 3300049587 Bacteria 5242
801 Ga0501071_0170400 3300049587 Bacteria 1630
802 Ga0501072_0009908 3300049588 Bacteria 7246
803 Ga0501072_0011471 3300049588 Bacteria 6775
804 Ga0501072_0030553 3300049588 Bacteria 4215
805 Ga0501072_0291642 3300049588 Bacteria 1297
806 Ga0501073_0161378 3300049589 Bacteria 1553
807 Ga0501073_0210549 3300049589 Bacteria 1343
808 Ga0501074_0458263 3300049590 Bacteria 904
809 Ga0501075_0009087 3300049591 Bacteria 6941
810 Ga0501075_0235736 3300049591 Bacteria 1395
811 Ga0501076_0056131 3300049592 Bacteria 3125
812 Ga0501076_0247915 3300049592 Bacteria 1457
813 Ga0501079_0400971 3300049741 Bacteria 1076
814 Ga0501079_0868187 3300049741 Bacteria 710
815 Ga0501080_0050364 3300049742 Bacteria 3876
816 Ga0501080_0374380 3300049742 Bacteria 1284
817 Ga0501080_1297944 3300049742 Bacteria 623
818 Ga0501081_0038098 3300049743 Bacteria 3283
819 Ga0501081_0181897 3300049743 Bacteria 1521
820 Ga0501083_0006679 3300049744 Bacteria 8183
821 Ga0501045_0535480 3300049824 Bacteria 869
822 Ga0501045_0767230 3300049824 Bacteria 710
823 nmdc:mga03683_43909_c1 3300050489 Bacteria 1846
824 nmdc:mga03683_9622_c1 3300050489 Bacteria 3445
825 nmdc:mga03n38_176899_c1 3300050490 Bacteria 1091
826 nmdc:mga03n38_260710_c1 3300050490 Bacteria 919
827 nmdc:mga03n38_275935_c1 3300050490 Bacteria 896
828 nmdc:mga00v17_332953_c1 3300050491 Bacteria 987
829 nmdc:mga00v17_637239_c1 3300050491 Bacteria 686
830 nmdc:mga00v17_64961_c1 3300050491 Bacteria 2250
831 nmdc:mga00v17_696160_c1 3300050491 Bacteria 652
832 nmdc:mga00v17_7396_c1 3300050491 Bacteria 5858
833 nmdc:mga00v17_84108_c1 3300050491 Bacteria 1991
834 nmdc:mga0yw44_1034481_c1 3300050492 Bacteria 556
835 nmdc:mga0yw44_658705_c1 3300050492 Bacteria 711
836 nmdc:mga0yw44_6755_c1 3300050492 Bacteria 5573
837 nmdc:mga0yw44_75621_c1 3300050492 Bacteria 2100
838 nmdc:mga0yw44_80464_c1 3300050492 Bacteria 2041
839 nmdc:mga0yw44_91652_c1 3300050492 Bacteria 1922
840 nmdc:mga0yw44_99555_c1 3300050492 Bacteria 1850
841 nmdc:mga0k408_106946_c1 3300050493 Bacteria 1652
842 nmdc:mga0k408_184513_c1 3300050493 Bacteria 1244
843 nmdc:mga0k408_47207_c1 3300050493 Bacteria 2489
844 nmdc:mga06z11_20453_c1 3300050494 Bacteria 3059
845 nmdc:mga06z11_267691_c1 3300050494 Bacteria 1010
846 nmdc:mga06z11_379175_c1 3300050494 Bacteria 849
847 nmdc:mga06z11_8064_c1 3300050494 Bacteria 4368
848 nmdc:mga04h51_266195_c1 3300050495 Bacteria 691
849 nmdc:mga05p37_22273_c1 3300050507 Bacteria 7683
850 nmdc:mga05p37_22835_c1 3300050507 Bacteria 7587
851 nmdc:mga05p37_250_c1 3300050507 Bacteria 32288
852 nmdc:mga05p37_48218_c2 3300050507 Bacteria 1456
853 nmdc:mga09592_3818_c1 3300050508 Bacteria 12136
854 nmdc:mga09592_434437_c1 3300050508 Bacteria 1133
855 nmdc:mga0qj67_103_c1 3300050509 Bacteria 56674
856 nmdc:mga06r32_1213_c1 3300050510 Bacteria 23225
857 nmdc:mga06r32_1463519_c1 3300050510 Bacteria 624
858 nmdc:mga06r32_242117_c1 3300050510 Bacteria 1791
859 nmdc:mga06r32_334530_c1 3300050510 Bacteria 1499
860 nmdc:mga06r32_580550_c1 3300050510 Bacteria 1093
861 nmdc:mga08y16_147966_c1 3300050511 Bacteria 2441
862 nmdc:mga08y16_3357_c1 3300050511 Bacteria 16585
863 nmdc:mga08y16_498958_c1 3300050511 Bacteria 1237
864 nmdc:mga08y16_574633_c1 3300050511 Bacteria 1139
865 nmdc:mga0n895_1331451_c1 3300050512 Bacteria 688
866 nmdc:mga0n895_148926_c1 3300050512 Bacteria 2370
867 nmdc:mga0n895_198292_c1 3300050512 Bacteria 2039
868 nmdc:mga0n895_356662_c1 3300050512 Bacteria 1481
869 nmdc:mga0n895_431509_c1 3300050512 Bacteria 1331
870 nmdc:mga0n895_447_c1 3300050512 Bacteria 27667
871 nmdc:mga0n895_630147_c1 3300050512 Bacteria 1073
872 nmdc:mga0n895_73780_c1 3300050512 Bacteria 3388
873 nmdc:mga0rr50_22409_c1 3300050513 Bacteria 4335
874 nmdc:mga0rr50_44740_c1 3300050513 Bacteria 3249
875 nmdc:mga0rr50_4596_c1 3300050513 Bacteria 8127
876 nmdc:mga08x19_273487_c1 3300050514 Bacteria 1169
877 nmdc:mga0a205_170201_c1 3300050515 Bacteria 2074
878 nmdc:mga0a205_859_c1 3300050515 Bacteria 24861
879 nmdc:mga0sz30_26670_c1 3300050516 Bacteria 2370
880 nmdc:mga0sz30_285319_c1 3300050516 Bacteria 736
881 nmdc:mga0sz30_42411_c2 3300050516 Bacteria 922
882 nmdc:mga0sz30_82856_c1 3300050516 Bacteria 1389
883 Ga0495601_0010696 3300053077 Bacteria 5473
884 Ga0495601_0097024 3300053077 Bacteria 1901
885 Ga0495612_0111471 3300053078 Bacteria 1171
886 Ga0500610_0000385 3300053079 Bacteria 13390
887 Ga0495655_0040822 3300053083 Bacteria 1183
888 Ga0495595_0029308 3300053084 Bacteria 2462
889 Ga0495595_0356110 3300053084 Bacteria 739
890 Ga0495595_0611464 3300053084 Bacteria 557
891 Ga0495619_0014629 3300053085 Bacteria 4956
892 Ga0495619_0028572 3300053085 Bacteria 3598
893 Ga0495619_0237203 3300053085 Bacteria 1264
894 Ga0500647_0114231 3300053091 Bacteria 1282
895 Ga0500566_0155773 3300053094 Bacteria 1196
896 Ga0500641_0272602 3300053096 Bacteria 704
897 Ga0500595_001337 3300053119 Bacteria 13334
898 Ga0500595_028084 3300053119 Bacteria 1920
899 Ga0500595_042782 3300053119 Bacteria 1447
900 Ga0500642_0000337 3300053130 Bacteria 16075
901 Ga0500642_0104269 3300053130 Bacteria 1321
902 Ga0500652_000019 3300053131 Bacteria 120149
903 Ga0500619_003467 3300053154 Bacteria 3237
904 Ga0500636_0004982 3300053177 Bacteria 7538
905 Ga0500636_0083105 3300053177 Bacteria 1843
906 Ga0500645_000300 3300053730 Bacteria 35408
907 Ga0500645_038507 3300053730 Bacteria 1419
908 Ga0500596_001261 3300053735 Bacteria 5117
909 Ga0501084_0033650 3300054114 Bacteria 4287
910 Ga0501084_0211394 3300054114 Bacteria 1637
911 Ga0501084_0490077 3300054114 Bacteria 1039
912 Ga0501084_0513333 3300054114 Bacteria 1013
913 Ga0501084_0579295 3300054114 Bacteria 948
914 Ga0501084_0901831 3300054114 Bacteria 743
915 Ga0590071_061284 3300059421 Bacteria 920
916 Ga0587071_082597 3300060344 Bacteria 718
917 Ga0501082_0075274 3300060353 Bacteria 2908
918 Ga0501082_0428805 3300060353 Bacteria 1155
919 Ga0501082_0965141 3300060353 Bacteria 745
920 Ga0530510_0013722 3300061734 Bacteria 5703
921 Ga0530510_0148398 3300061734 Bacteria 1730
922 Ga0530510_0168778 3300061734 Bacteria 1620
923 Ga0530510_0696907 3300061734 Bacteria 774
924 2545675444 2545555834 Bacteria 8130841
925 2644493643 2643221688 Bacteria 5260751
926 2738945837 2738541317 Bacteria 5340176
927 2829750875 2829745981 Bacteria 5406054
928 2842698231 2842694124 Bacteria 4063419
929 2861696703 2861691609 Bacteria 5628931
930 2909044974 2909042592 Bacteria 6499737
931 2913310479 2913308742 Bacteria 5350706
932 3003667282 3003665799 Bacteria 7279786
933 641646362 641522639 Bacteria 7737025
934 643604490 643348564 Bacteria 8839022
935 Ga0105241_10178028
936 ARcpr5oldR_c010917
937 ARSoilOldRDRAFT_c010379
938 CNAas_1006227
939 JGI24741J21665_1004001
940 JGI24747J21853_1006656
941 JGI24740J21852_10008136
942 JGI24740J21852_10061809
943 JGI24739J22299_10007274
944 JGI24739J22299_10031222
945 JGI24737J22298_10004820
946 JGI24737J22298_10008254
947 JGI24750J21931_1000402
948 JGI24745J21846_1002446
949 JGI24748J21848_1012683
950 JGI24738J21930_10043990
951 JGI24744J21845_10009105
952 JGI24742J22300_10000673
953 JGI24751J29686_10020824
954 JGI25406J46586_10014070
955 JGI25153J46596_10000006
956 Ga0006770J48903_1041297
957 JGI26129J50193_1002667
958 Ga0007409J51694_1040205
959 Ga0055542_1000046
960 Ga0055529_1000007
961 Ga0055529_1000109
962 JGI25405J52794_10005337
963 Ga0058859_10066463
964 Ga0058861_11603884
965 Ga0058860_10037437
966 Ga0065707_10661364
967 Ga0070658_10000227
968 Ga0070658_10390228
969 Ga0070676_10045239
970 Ga0070676_10323776
971 Ga0070683_100047063
972 Ga0070683_100050766
973 Ga0070683_100201550
974 Ga0070690_100088981
975 Ga0070670_100014997
976 Ga0070670_100024267
977 Ga0070677_10265598
978 Ga0068869_100402892
979 Ga0070666_10098933
980 Ga0070666_10193059
981 Ga0070680_101690206
982 Ga0068868_100006136
983 Ga0068868_100198504
984 Ga0070660_100057050
985 Ga0070660_100103350
986 Ga0070660_100123272
987 Ga0070689_100021560
988 Ga0070689_100492516
989 Ga0070691_10088053
990 Ga0070661_100050710
991 Ga0070661_100735807
992 Ga0070692_10068434
993 Ga0070668_100120940
994 Ga0070668_100123627
995 Ga0070668_100499749
996 Ga0070675_100106327
997 Ga0070671_100015077
998 Ga0070671_100545049
999 Ga0070671_100675309
1000 Ga0070674_100011640
1001 Ga0070673_100018705
1002 Ga0070673_100019097
1003 Ga0070673_100062718
1004 Ga0070673_100084205
1005 Ga0070673_100277232
1006 Ga0070688_100001965
1007 Ga0070659_100127015
1008 Ga0070659_100787033
1009 Ga0070667_100144332
1010 Ga0070709_10031572
1011 Ga0070709_10039765
1012 Ga0070709_10048746
1013 Ga0070709_10092168
1014 Ga0070709_10407584
1015 Ga0070714_100205727
1016 Ga0070714_100557405
1017 Ga0070713_100262776
1018 Ga0070713_100435030
1019 Ga0070713_100618351
1020 Ga0070713_100937132
1021 Ga0070713_100982960
1022 Ga0070713_101161531
1023 Ga0070710_10103497
1024 Ga0070710_10492334
1025 Ga0070701_10001415
1026 Ga0070701_10138957
1027 Ga0070711_100196306
1028 Ga0070711_100728308
1029 Ga0070700_100016627
1030 Ga0070694_100292564
1031 Ga0070694_101197290
1032 Ga0070708_100300427
1033 Ga0070663_100059934
1034 Ga0070663_100060575
1035 Ga0070663_100229052
1036 Ga0070678_100000076
1037 Ga0070678_100044515
1038 Ga0070678_100866806
1039 Ga0068867_100743589
1040 Ga0070685_10003484
1041 Ga0070685_10018589
1042 Ga0070707_100591580
1043 Ga0070679_100736247
1044 Ga0070679_101695232
1045 Ga0070684_100092257
1046 Ga0070684_100209250
1047 Ga0070697_100524976
1048 Ga0068853_100021239
1049 Ga0068853_100065617
1050 Ga0070672_100007567
1051 Ga0070672_100688115
1052 Ga0070686_100013330
1053 Ga0070686_100095825
1054 Ga0070686_101365111
1055 Ga0070695_100320207
1056 Ga0070696_100138508
1057 Ga0070696_100433591
1058 Ga0070696_101545394
1059 Ga0070693_100010203
1060 Ga0070693_100110921
1061 Ga0070665_100000086
1062 Ga0070665_100067412
1063 Ga0070665_100068679
1064 Ga0070665_100304791
1065 Ga0070664_100023420
1066 Ga0070664_100282674
1067 Ga0068854_100039985
1068 Ga0068854_100042439
1069 Ga0068856_100225928
1070 Ga0070702_100044794
1071 Ga0070702_100301100
1072 Ga0070702_101479437
1073 Ga0068852_100217059
1074 Ga0068859_100051554
1075 Ga0068864_100076296
1076 Ga0068864_100089733
1077 Ga0068866_10020275
1078 Ga0068851_10134053
1079 Ga0068870_10006013
1080 Ga0068863_100006758
1081 Ga0068863_100040544
1082 Ga0068863_100120706
1083 Ga0068858_100019366
1084 Ga0068858_100045278
1085 Ga0068860_100034171
1086 Ga0068860_100219305
1087 Ga0068862_100137131
1088 Ga0081455_10000031
1089 Ga0081455_10006810
1090 Ga0081455_10007632
1091 Ga0081455_10009265
1092 Ga0081455_10218845
1093 Ga0081455_10872817
1094 Ga0081538_10008070
1095 Ga0081540_1001289
1096 Ga0081540_1020606
1097 Ga0081539_10005395
1098 Ga0070717_10172395
1099 Ga0070717_10177708
1100 Ga0075365_10003192
1101 Ga0075365_10005288
1102 Ga0075365_10085364
1103 Ga0075365_10120212
1104 Ga0075368_10025328
1105 Ga0075368_10040074
1106 Ga0075363_100039414
1107 Ga0075364_10002133
1108 Ga0075364_10037536
1109 Ga0075364_10081168
1110 Ga0075364_10217663
1111 Ga0075364_10221008
1112 Ga0075432_10068835
1113 Ga0070715_10019098
1114 Ga0070716_100071926
1115 Ga0070716_100117673
1116 Ga0070716_100123052
1117 Ga0070712_100000791
1118 Ga0070712_100003188
1119 Ga0075362_10018797
1120 Ga0075362_10028993
1121 Ga0075367_10062216
1122 Ga0075367_10384387
1123 Ga0075369_10010311
1124 Ga0075369_10057502
1125 Ga0075369_10059743
1126 Ga0075366_10041669
1127 Ga0097621_100055279
1128 Ga0068871_100012659
1129 Ga0068871_100040214
1130 Ga0068871_100374910
1131 Ga0075428_100023093
1132 Ga0075428_100267223
1133 Ga0075428_101100835
1134 Ga0075430_100000194
1135 Ga0075430_100004109
1136 Ga0075431_100251940
1137 Ga0075431_100285823
1138 Ga0075431_100914062
1139 Ga0075433_10000273
1140 Ga0075433_10259454
1141 Ga0075433_11744912
1142 Ga0075434_100000421
1143 Ga0075434_100029211
1144 Ga0075434_100507469
1145 Ga0075434_100649128
1146 Ga0075429_100008384
1147 Ga0075429_100986435
1148 Ga0068865_100086795
1149 Ga0068865_101150520
1150 Ga0075436_100345558
1151 Ga0097620_100051553
1152 Ga0075435_100056781
1153 Ga0099794_10104145
1154 Ga0099794_10177246
1155 Ga0099795_10002266
1156 Ga0105251_10011778
1157 Ga0105250_10135776
1158 Ga0105240_10356021
1159 Ga0111539_10000229
1160 Ga0111539_10001379
1161 Ga0111539_10824815
1162 Ga0111539_12009851
1163 Ga0105245_10037226
1164 Ga0105245_10079276
1165 Ga0114129_10001774
1166 Ga0114129_10002175
1167 Ga0114129_10006074
1168 Ga0114129_10007698
1169 Ga0105243_10000224
1170 Ga0105243_10132865
1171 Ga0105243_10176666
1172 Ga0105243_11403605
1173 Ga0105241_10020421
1174 Ga0105241_10505820
1175 Ga0105242_10161739
1176 Ga0105242_10733459
1177 Ga0105248_10012785
1178 Ga0105248_10107968
1179 Ga0105248_10692325
1180 Ga0105237_10100274
1181 Ga0105237_10148761
1182 Ga0105237_10186189
1183 Ga0105237_10897334
1184 Ga0105238_10112674
1185 Ga0105238_10721308
1186 Ga0105249_10293759
1187 Ga0105249_11605261
1188 Ga0105249_13126192
1189 Ga0099796_10105966
1190 Ga0105239_10305677
1191 Ga0105239_10531814
1192 Ga0105246_10125959
1193 Ga0105246_10358069
1194 Ga0157317_1010086
1195 Ga0157338_1023769
1196 Ga0157373_10130767
1197 Ga0157371_10000097
1198 Ga0157374_10029991
1199 Ga0157374_10718072
1200 Ga0157378_10038442
1201 Ga0163162_10148997
1202 Ga0163162_11970701
1203 Ga0157372_10639287
1204 Ga0157372_11241792
1205 Ga0157375_11557786
1206 Ga0157375_12762277
1207 Ga0163163_10014233
1208 Ga0163163_11073786
1209 Ga0157380_10009885
1210 Ga0157377_10077553
1211 Ga0157377_10583468
1212 Ga0157376_10123367
1213 Ga0163161_10052874
1214 Ga0184603_109846
1215 Ga0206356_11671177
1216 Ga0213876_10010835
1217 Ga0213876_10011401
1218 Ga0213876_10092935
1219 Ga0213875_10008383
1220 Ga0224712_10115216
1221 Ga0209563_100111
1222 Ga0209646_1006332
1223 Ga0209026_1015671
1224 Ga0209677_106271
1225 Ga0209148_1000026
1226 Ga0209455_1000005
1227 Ga0209758_1000001
1228 Ga0209758_1137957
1229 Ga0207656_10021179
1230 Ga0207692_10038064
1231 Ga0207642_10114537
1232 Ga0207710_10005430
1233 Ga0207710_10050789
1234 Ga0207688_10000077
1235 Ga0207688_10106678
1236 Ga0207688_10640068
1237 Ga0207680_10213819
1238 Ga0207680_10365608
1239 Ga0207647_10006537
1240 Ga0207647_10149441
1241 Ga0207647_10153308
1242 Ga0207685_10152462
1243 Ga0207685_10436222
1244 Ga0207685_10456168
1245 Ga0207645_10007524
1246 Ga0207643_10001791
1247 Ga0207705_10000450
1248 Ga0207654_10004079
1249 Ga0207654_10343923
1250 Ga0207707_10364122
1251 Ga0207695_10015037
1252 Ga0207695_10029534
1253 Ga0207695_11521831
1254 Ga0207671_10012661
1255 Ga0207671_10499191
1256 Ga0207693_10003236
1257 Ga0207693_10005621
1258 Ga0207693_10049027
1259 Ga0207693_10172152
1260 Ga0207693_11043292
1261 Ga0207663_10122947
1262 Ga0207663_10499037
1263 Ga0207663_11122550
1264 Ga0207663_11186510
1265 Ga0207660_11334353
1266 Ga0207662_10040674
1267 Ga0207657_10031958
1268 Ga0207657_10042332
1269 Ga0207657_10059602
1270 Ga0207657_10265897
1271 Ga0207649_10002255
1272 Ga0207646_10113582
1273 Ga0207694_10065778
1274 Ga0207694_10179649
1275 Ga0207650_10012602
1276 Ga0207659_10067487
1277 Ga0207659_10104307
1278 Ga0207687_10013627
1279 Ga0207687_10017793
1280 Ga0207700_10092443
1281 Ga0207700_10411181
1282 Ga0207700_10542782
1283 Ga0207700_11641347
1284 Ga0207664_10011743
1285 Ga0207664_10513516
1286 Ga0207664_11251864
1287 Ga0207644_10055591
1288 Ga0207644_10624198
1289 Ga0207644_11160769
1290 Ga0207690_10010098
1291 Ga0207690_10045257
1292 Ga0207690_10068415
1293 Ga0207706_10001566
1294 Ga0207706_10011772
1295 Ga0207686_10039284
1296 Ga0207686_10152145
1297 Ga0207709_10000519
1298 Ga0207709_10041236
1299 Ga0207709_10236929
1300 Ga0207670_10213751
1301 Ga0207669_10000161
1302 Ga0207669_10040531
1303 Ga0207704_10614683
1304 Ga0207665_10231158
1305 Ga0207691_10002068
1306 Ga0207691_10050573
1307 Ga0207691_10778385
1308 Ga0207711_10044686
1309 Ga0207711_10329039
1310 Ga0207711_10710146
1311 Ga0207689_10016646
1312 Ga0207689_10403287
1313 Ga0207661_10262309
1314 Ga0207661_10714512
1315 Ga0207679_10166701
1316 Ga0207679_10175530
1317 Ga0207667_10000010
1318 Ga0207651_10178762
1319 Ga0207651_10371229
1320 Ga0207651_10588487
1321 Ga0207712_10210268
1322 Ga0207712_10462903
1323 Ga0207712_10808581
1324 Ga0207668_10044578
1325 Ga0207668_10349243
1326 Ga0207668_11387314
1327 Ga0207640_10013893
1328 Ga0207640_10076486
1329 Ga0207658_10266491
1330 Ga0207677_10013109
1331 Ga0207703_10091410
1332 Ga0207639_10060370
1333 Ga0207639_10225655
1334 Ga0207678_10001623
1335 Ga0207678_10021515
1336 Ga0207678_10835925
1337 Ga0207708_10000155
1338 Ga0207702_10005521
1339 Ga0207702_10100222
1340 Ga0207702_10149284
1341 Ga0207702_10335211
1342 Ga0207641_10076371
1343 Ga0207641_10229845
1344 Ga0207648_10002624
1345 Ga0207676_10006530
1346 Ga0207676_10167625
1347 Ga0207676_11094049
1348 Ga0207674_10095374
1349 Ga0207675_100036723
1350 Ga0207675_100408059
1351 Ga0207683_10000655
1352 Ga0207683_10002386
1353 Ga0207698_10019884
1354 Ga0209179_1020524
1355 Ga0209813_10035196
1356 Ga0209813_10050558
1357 Ga0207428_10000243
1358 Ga0207428_10274299
1359 Ga0207428_10544426
1360 Ga0268266_10000002
1361 Ga0268266_10952457
1362 Ga0268265_10697340
1363 Ga0265337_1003979
1364 Ga0307517_10028536
1365 Ga0265338_10131866
1366 Ga0265325_10004230
1367 Ga0265325_10283302
1368 Ga0265340_10007569
1369 Ga0307513_10036337
1370 Ga0307408_100053697
1371 Ga0265313_10000577
1372 Ga0316579_10012512
1373 Ga0316576_10169460
1374 Ga0316578_10029432
1375 Ga0307405_10614382
1376 Ga0307412_11113012
1377 Ga0307409_100834114
1378 Ga0307416_100200454
1379 Ga0307414_10253723
1380 Ga0307415_100960540
1381 Ga0307510_10218152
1382 Ga0373959_0002107
1383 Ga0373938_0219438
1384 Ga0373929_0002588
1385 Ga0373934_0071952
1386 Ga0373940_0008848
1387 Ga0373940_0107108
1388 Ga0373944_0103262
1389 Ga0373949_0002524
1390 Ga0373951_0230530
1391 Ga0373923_0249273
1392 Ga0373932_0002959
1393 Ga0373932_0109810
1394 Ga0373936_0419425
1395 Ga0373939_0001760
1396 Ga0373939_0134207
1397 Ga0373945_0002893
1398 Ga0373945_0016275
1399 Ga0373945_0108409
1400 Ga0373945_0313512
1401 Ga0373953_0019872
1402 Ga0373954_0013559
1403 Ga0373954_0167120
1404 Ga0373956_0008073
1405 Ga0373957_0055416
1406 Ga0373960_0024692
1407 Ga0373960_0125201
1408 Ga0373943_0010841
1409 Ga0373943_0034408
1410 Ga0373943_0037165
1411 Ga0373946_0083319
1412 Ga0373946_0106293
1413 Ga0373946_0156961
1414 Ga0373955_0067263
1415 Ga0373955_0262806
1416 Ga0373962_0257097
1417 Ga0316574_0003152
1418 Ga0373924_0034069
1419 Ga0373931_0053589
1420 Ga0373931_0063709
1421 Ga0373931_0795886
1422 Ga0373935_0028021
1423 Ga0373935_0043914
1424 Ga0373935_0179924
1425 Ga0373935_0709656
1426 Ga0373935_1008721
1427 Ga0373927_0012550
1428 Ga0373927_0036648
1429 Ga0373927_0457214
1430 Ga0373927_0625631
1431 Ga0373933_0147484
1432 Ga0373933_0520623
1433 Ga0373947_0031838
1434 Ga0373937_0003492
1435 Ga0373937_0019211
1436 Ga0373937_0369811
1437 Ga0373925_0024734
1438 Ga0395898_1253505
1439 Ga0436364_0234810
1440 Ga0436364_0399681
1441 Ga0436364_1142684
1442 Ga0436364_1239282
1443 Ga0436365_0059329
1444 Ga0436365_0420699
1445 Ga0436365_0688273
1446 Ga0436365_1240129
1447 Ga0436365_1813460
1448 Ga0436365_1863036
1449 Ga0436365_1880013
1450 Ga0436360_0257014
1451 Ga0436360_0468502
1452 Ga0436360_1165231
1453 Ga0436363_0667249
1454 Ga0436363_0912950
1455 Ga0436363_1034686
1456 Ga0436363_1185669
1457 Ga0436363_1339204
1458 Ga0436362_0272649
1459 Ga0436362_0504108
1460 Ga0436362_0764531
1461 Ga0439466_0163400
1462 Ga0451800_1662737
1463 Ga0451802_1269283
1464 Ga0451807_1178034
1465 Ga0451807_2205113
1466 Ga0451847_0716738
1467 Ga0439448_0268964
1468 Ga0453684_0374877
1469 Ga0453684_1853656
1470 Ga0466968_0226657
1471 Ga0466967_0056965
1472 Ga0495617_008079
1473 Ga0495603_0143947
1474 Ga0495603_0246549
1475 Ga0495603_0361305
1476 Ga0495603_0537217
1477 Ga0495590_0307898
1478 Ga0495629_0095241
1479 Ga0495629_0183565
1480 Ga0495638_0336018
1481 Ga0495641_0245924
1482 Ga0495651_0117195
1483 Ga0495651_0203022
1484 Ga0495651_0372208
1485 Ga0495651_0498339
1486 Ga0495653_0814693
1487 Ga0495580_0565922
1488 Ga0495582_0003215
1489 Ga0495582_0323758
1490 Ga0495605_0067795
1491 Ga0495639_0124254
1492 Ga0495662_0021690
1493 Ga0495662_0126699
1494 Ga0495664_0109569
1495 Ga0495584_0056617
1496 Ga0495584_0067524
1497 Ga0495584_0126032
1498 Ga0495584_0318427
1499 Ga0495585_0003684
1500 Ga0495585_0033792
1501 Ga0495585_0520881
1502 Ga0495594_0092623
1503 Ga0495594_0129039
1504 Ga0495596_0007358
1505 Ga0495596_0184579
1506 Ga0495607_0313628
1507 Ga0495607_0450241
1508 Ga0495583_0002564
1509 Ga0495583_0096633
1510 Ga0495583_0102296
1511 Ga0495606_0000434
1512 Ga0495608_0215298
1513 Ga0495616_0071603
1514 Ga0495616_0224957
1515 Ga0495618_0069520
1516 Ga0495618_0137374
1517 Ga0495620_0058886
1518 Ga0495620_0167133
1519 Ga0495628_0708252
1520 Ga0495630_0068550
1521 Ga0495630_0331459
1522 Ga0495630_0614955
1523 Ga0495631_0015102
1524 Ga0495632_0302490
1525 Ga0495637_0046443
1526 Ga0495643_0004044
1527 Ga0495643_0256628
1528 Ga0495644_0089536
1529 Ga0495644_0162134
1530 Ga0495648_0000256
1531 Ga0495648_0197955
1532 Ga0495666_0324824
1533 Ga0495642_0012268
1534 Ga0495652_0211248
1535 Ga0495652_0490897
1536 Ga0495665_0149243
1537 Ga0495640_0058133
1538 Ga0495640_0170763
1539 Ga0495640_0716601
1540 Ga0495587_0061172
1541 Ga0495598_0007220
1542 Ga0495598_0058074
1543 Ga0495609_0040240
1544 Ga0495609_0219481
1545 Ga0495621_0444031
1546 Ga0495597_0033512
1547 Ga0495597_0100011
1548 Ga0495645_0414812
1549 Ga0495622_0007231
1550 Ga0495622_0042162
1551 Ga0495622_0059387
1552 Ga0495622_0413488
1553 Ga0495633_0002904
1554 Ga0495633_0048113
1555 Ga0495667_0143547
1556 Ga0495656_0009903
1557 Ga0495668_0000163
1558 Ga0495668_0356889
1559 Ga0495634_0044077
1560 Ga0495634_0345830
1561 Ga0495634_0585284
1562 Ga0495611_0045853
1563 Ga0495611_0209504
1564 Ga0495625_0000546
1565 Ga0495625_0021743
1566 Ga0495625_0289091
1567 Ga0495635_0486856
1568 Ga0495635_0914195
1569 Ga0495659_0051822
1570 Ga0495661_0143407
1571 Ga0495661_0187508
1572 Ga0495588_0019191
1573 Ga0495657_0117056
1574 Ga0495623_0409535
1575 Ga0495646_0126928
1576 Ga0495646_0162094
1577 Ga0495647_0042596
1578 Ga0495647_0057565
1579 Ga0495658_0129886
1580 Ga0495658_0455665
1581 Ga0495669_0000629
1582 Ga0495613_0105682
1583 Ga0495613_0213154
1584 Ga0495613_0414938
1585 Ga0495624_0023574
1586 Ga0495624_0202441
1587 Ga0495670_0044549
1588 Ga0495670_0091158
1589 Ga0495671_0138292
1590 Ga0495671_0503813
1591 Ga0495649_0080890
1592 Ga0495649_0315602
1593 Ga0495589_0056859
1594 Ga0495600_0000914
1595 Ga0495600_0102405
1596 Ga0495660_0030711
1597 Ga0495660_0507439
1598 Ga0495581_0046865
1599 Ga0495581_0064842
1600 Ga0495581_0131892
1601 Ga0495604_0160981
1602 Ga0495604_0332054
1603 Ga0495674_0055199
1604 Ga0495674_0285562
1605 Ga0495674_0454826
1606 Ga0495672_0285350
1607 Ga0495680_0154542
1608 Ga0495680_0175793
1609 Ga0495680_0874915
1610 Ga0495683_0014914
1611 Ga0495683_0325425
1612 Ga0495687_001516
1613 Ga0495687_001938
1614 Ga0495675_0136936
1615 Ga0495675_0850957
1616 Ga0495677_0064928
1617 Ga0495677_0266736
1618 Ga0495673_0039336
1619 Ga0495681_0003826
1620 Ga0495681_0107613
1621 Ga0495684_0124731
1622 Ga0495684_0127511
1623 Ga0495684_0153330
1624 Ga0495686_0358774
1625 Ga0495602_0227197
1626 Ga0495614_0080043
1627 Ga0495614_0316861
1628 Ga0495626_0187719
1629 Ga0495626_0414751
1630 Ga0496100_0110828
1631 Ga0496101_0036986
1632 Ga0496101_0054743
1633 Ga0496101_0436784
1634 Ga0496102_0002374
1635 Ga0496102_0016499
1636 Ga0496102_0018626
1637 Ga0496102_0080953
1638 Ga0496102_0410156
1639 Ga0496102_1312762
1640 Ga0496103_0001305
1641 Ga0496103_0008814
1642 Ga0496103_0081573
1643 Ga0496103_0271461
1644 Ga0496103_0806570
1645 Ga0496104_0017570
1646 Ga0496104_0035989
1647 Ga0496104_0058641
1648 Ga0496104_0110433
1649 Ga0496104_0130038
1650 Ga0496104_0139149
1651 Ga0496104_0146617
1652 Ga0496104_0196073
1653 Ga0496105_0000355
1654 Ga0496105_0009547
1655 Ga0496105_0056230
1656 Ga0496105_0100064
1657 Ga0496105_0693188
1658 Ga0496106_0006735
1659 Ga0496106_0032696
1660 Ga0496106_0068832
1661 Ga0496106_0320953
1662 Ga0496106_0661558
1663 Ga0496107_0003073
1664 Ga0496107_0007790
1665 Ga0496107_0321875
1666 Ga0496107_0381715
1667 Ga0496108_0000619
1668 Ga0496108_0004947
1669 Ga0496108_0105362
1670 Ga0496108_0142768
1671 Ga0496108_0440214
1672 Ga0496109_0001296
1673 Ga0496109_0047907
1674 Ga0496109_0466404
1675 Ga0496109_0851787
1676 Ga0496110_0010405
1677 Ga0496110_0013592
1678 Ga0496110_0176588
1679 Ga0496110_0300629
1680 Ga0496110_1348174
1681 Ga0496111_0000484
1682 Ga0496111_0003565
1683 Ga0496111_0014923
1684 Ga0496111_0022501
1685 Ga0496111_1241207
1686 Ga0496112_0000727
1687 Ga0496112_0023695
1688 Ga0496112_0542405
1689 Ga0496113_0007581
1690 Ga0496113_0019225
1691 Ga0496113_0115177
1692 Ga0496113_0498730
1693 Ga0496114_0030219
1694 Ga0496114_0046477
1695 Ga0496114_0441513
1696 Ga0496115_0000172
1697 Ga0496115_0082027
1698 Ga0496115_0086902
1699 Ga0496115_0098419
1700 Ga0496115_0370995
1701 Ga0496115_0587595
1702 Ga0496117_0000582
1703 Ga0496117_0528488
1704 Ga0496118_0000392
1705 Ga0496118_0211134
1706 Ga0496119_0016624
1707 Ga0496121_0005396
1708 Ga0496122_0012049
1709 Ga0496123_0031365
1710 Ga0496124_0000606
1711 Ga0496124_0029126
1712 Ga0496125_0000666
1713 Ga0496126_0004606
1714 Ga0496126_0327510
1715 Ga0496126_0898861
1716 Ga0495682_0189965
1717 Ga0501032_0171688
1718 Ga0501036_0723428
1719 Ga0501039_0224366
1720 Ga0501039_0231328
1721 Ga0501040_0177157
1722 Ga0501041_0246890
1723 Ga0501041_0258672
1724 Ga0501041_0343469
1725 Ga0501042_0078302
1726 Ga0501042_0142713
1727 Ga0501042_0154182
1728 Ga0501043_0709447
1729 Ga0501047_0215543
1730 Ga0501047_0960261
1731 Ga0501067_0241596
1732 Ga0501068_0172943
1733 Ga0501069_0241471
1734 Ga0501071_0015440
1735 Ga0501071_0170400
1736 Ga0501072_0009908
1737 Ga0501072_0011471
1738 Ga0501072_0030553
1739 Ga0501072_0291642
1740 Ga0501073_0161378
1741 Ga0501073_0210549
1742 Ga0501074_0458263
1743 Ga0501075_0009087
1744 Ga0501075_0235736
1745 Ga0501076_0056131
1746 Ga0501076_0247915
1747 Ga0501079_0400971
1748 Ga0501079_0868187
1749 Ga0501080_0050364
1750 Ga0501080_0374380
1751 Ga0501080_1297944
1752 Ga0501081_0038098
1753 Ga0501081_0181897
1754 Ga0501083_0006679
1755 Ga0501045_0535480
1756 Ga0501045_0767230
1757 nmdc:mga03683_43909_c1
1758 nmdc:mga03683_9622_c1
1759 nmdc:mga03n38_176899_c1
1760 nmdc:mga03n38_260710_c1
1761 nmdc:mga03n38_275935_c1
1762 nmdc:mga00v17_332953_c1
1763 nmdc:mga00v17_637239_c1
1764 nmdc:mga00v17_64961_c1
1765 nmdc:mga00v17_696160_c1
1766 nmdc:mga00v17_7396_c1
1767 nmdc:mga00v17_84108_c1
1768 nmdc:mga0yw44_1034481_c1
1769 nmdc:mga0yw44_658705_c1
1770 nmdc:mga0yw44_6755_c1
1771 nmdc:mga0yw44_75621_c1
1772 nmdc:mga0yw44_80464_c1
1773 nmdc:mga0yw44_91652_c1
1774 nmdc:mga0yw44_99555_c1
1775 nmdc:mga0k408_106946_c1
1776 nmdc:mga0k408_184513_c1
1777 nmdc:mga0k408_47207_c1
1778 nmdc:mga06z11_20453_c1
1779 nmdc:mga06z11_267691_c1
1780 nmdc:mga06z11_379175_c1
1781 nmdc:mga06z11_8064_c1
1782 nmdc:mga04h51_266195_c1
1783 nmdc:mga05p37_22273_c1
1784 nmdc:mga05p37_22835_c1
1785 nmdc:mga05p37_250_c1
1786 nmdc:mga05p37_48218_c2
1787 nmdc:mga09592_3818_c1
1788 nmdc:mga09592_434437_c1
1789 nmdc:mga0qj67_103_c1
1790 nmdc:mga06r32_1213_c1
1791 nmdc:mga06r32_1463519_c1
1792 nmdc:mga06r32_242117_c1
1793 nmdc:mga06r32_334530_c1
1794 nmdc:mga06r32_580550_c1
1795 nmdc:mga08y16_147966_c1
1796 nmdc:mga08y16_3357_c1
1797 nmdc:mga08y16_498958_c1
1798 nmdc:mga08y16_574633_c1
1799 nmdc:mga0n895_1331451_c1
1800 nmdc:mga0n895_148926_c1
1801 nmdc:mga0n895_198292_c1
1802 nmdc:mga0n895_356662_c1
1803 nmdc:mga0n895_431509_c1
1804 nmdc:mga0n895_447_c1
1805 nmdc:mga0n895_630147_c1
1806 nmdc:mga0n895_73780_c1
1807 nmdc:mga0rr50_22409_c1
1808 nmdc:mga0rr50_44740_c1
1809 nmdc:mga0rr50_4596_c1
1810 nmdc:mga08x19_273487_c1
1811 nmdc:mga0a205_170201_c1
1812 nmdc:mga0a205_859_c1
1813 nmdc:mga0sz30_26670_c1
1814 nmdc:mga0sz30_285319_c1
1815 nmdc:mga0sz30_42411_c2
1816 nmdc:mga0sz30_82856_c1
1817 Ga0495601_0010696
1818 Ga0495601_0097024
1819 Ga0495612_0111471
1820 Ga0500610_0000385
1821 Ga0495655_0040822
1822 Ga0495595_0029308
1823 Ga0495595_0356110
1824 Ga0495595_0611464
1825 Ga0495619_0014629
1826 Ga0495619_0028572
1827 Ga0495619_0237203
1828 Ga0500647_0114231
1829 Ga0500566_0155773
1830 Ga0500641_0272602
1831 Ga0500595_001337
1832 Ga0500595_028084
1833 Ga0500595_042782
1834 Ga0500642_0000337
1835 Ga0500642_0104269
1836 Ga0500652_000019
1837 Ga0500619_003467
1838 Ga0500636_0004982
1839 Ga0500636_0083105
1840 Ga0500645_000300
1841 Ga0500645_038507
1842 Ga0500596_001261
1843 Ga0501084_0033650
1844 Ga0501084_0211394
1845 Ga0501084_0490077
1846 Ga0501084_0513333
1847 Ga0501084_0579295
1848 Ga0501084_0901831
1849 Ga0590071_061284
1850 Ga0587071_082597
1851 Ga0501082_0075274
1852 Ga0501082_0428805
1853 Ga0501082_0965141
1854 Ga0530510_0013722
1855 Ga0530510_0148398
1856 Ga0530510_0168778
1857 Ga0530510_0696907
1858 2545675444
1859 2644493643
1860 2738945837
1861 2829750875
1862 2842698231
1863 2861696703
1864 2909044974
1865 2913310479
1866 3003667282
1867 641646362
1868 643604490

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08534

Redoxin

Redoxin

23

176

0.86

PF00578

AhpC-TSA

AhpC/TSA family

24

158

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3uma-assembly3.cif.gz_C crystal structure of a hypothetical peroxiredoxin protein frm sinorhizobium meliloti 0.9825 1 161
3uma-assembly3.cif.gz_C crystal structure of a hypothetical peroxiredoxin protein frm sinorhizobium meliloti 0.9765 1 161
5k2j-assembly4.cif.gz_H crystal structure of reduced prx3 in complex with h2o2 from vibrio vulnificus 0.975 3 160
5k2j-assembly3.cif.gz_F crystal structure of reduced prx3 in complex with h2o2 from vibrio vulnificus 0.9744 3 160
4f82-assembly1.cif.gz_B x-ray crystal structure of a putative thioredoxin reductase from burkholderia cenocepacia 0.9682 1 161
ID Description Score Start End Superfamily
4f82B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9682 1 161 3.40.30.10
3umaA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9677 1 161 3.40.30.10
4f82B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9623 1 161 3.40.30.10
af_Q54N76_3_172_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9545 1 161 3.40.30.10
af_A0A0R4J5B9_27_197_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9534 1 161 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A6N7GRI7-F1-model_v4 Glutathione-dependent peroxiredoxin (EC 1.11.1.27) 0.999 1 161 GO:0005737
GO:0008379
GO:0034599
GO:0042744
GO:0045454
AF-A0A7Y9TEC9-F1-model_v4 deleted 0.9967 1 161
AF-A0A539CSW6-F1-model_v4 Glutathione-dependent peroxiredoxin (EC 1.11.1.27) 0.996 1 161 GO:0005737
GO:0008379
GO:0034599
GO:0042744
GO:0045454
AF-Q8YFR4-F1-model_v4 Glutathione-dependent peroxiredoxin (EC 1.11.1.27) 0.9955 1 161 GO:0005737
GO:0008379
GO:0034599
GO:0042744
GO:0045454
AF-D8R7Y2-F1-model_v4 Glutaredoxin-dependent peroxiredoxin (EC 1.11.1.25) 0.9955 23 161 GO:0005737
GO:0005739
GO:0008379
GO:0034599
GO:0042744
GO:0045454

Map