F486118
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 934 | 368 | 1868 | 150 |
Family's Representative Sequence
| Representative Sequence | 3300005577|Ga0068857_101862921|Ga0068857_1018629211 |
| Length | 156 |
| Sequence | MTLTALGNLIDVTYLWIKAGHVIFVIFWIAGLFMLPRFYVYHQEAAPGSAEERRWIDRERRLQNIIITPAMVIVWIFGLTLAWQIGLFNGTPGLGWLHLKLLLVVALSGYHGWMVGYGKKLARGVRPTSGRALRIMNEIPGVATAAIVILVIVKPF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 2 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 3 | 3300001432 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 4 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 5 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 6 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 7 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 8 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 9 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 10 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 11 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 12 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 13 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 14 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 15 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 16 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 17 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 18 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 19 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 20 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 21 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 24 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 35 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 39 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 59 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 63 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 69 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 71 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 72 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 73 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 74 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 75 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 76 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 77 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 78 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 79 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 80 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 81 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 82 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 83 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 84 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 86 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 87 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 88 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 122 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 123 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 124 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 130 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 194 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 195 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 196 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 197 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 198 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 199 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 200 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 201 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 202 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 203 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 204 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 205 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 206 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 207 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 208 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 209 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 210 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 211 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 212 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 213 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 214 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 215 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 216 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 217 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 218 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 219 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 220 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 221 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 222 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 223 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 224 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 225 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 226 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 227 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 228 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 229 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 230 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 231 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 232 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 233 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 234 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 235 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 236 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 237 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 238 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 239 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 240 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 241 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 242 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 268 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 269 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 271 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 272 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 273 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 274 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 275 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 276 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 277 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 278 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 279 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 280 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 281 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 282 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 285 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 286 | 3300049516 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought | Metagenome | Rhizosphere |
| 287 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 288 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 289 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 290 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 303 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 304 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 305 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 306 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 307 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 308 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 309 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 310 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 311 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 312 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 313 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 314 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 315 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 316 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 317 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 318 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 319 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 320 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 321 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 324 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 325 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 326 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 327 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 328 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 332 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 333 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 334 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 335 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 336 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 337 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 338 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 339 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 340 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 341 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 342 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 343 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 344 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 345 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 346 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 347 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 348 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 349 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 350 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 351 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 352 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 353 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 354 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 355 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 356 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 357 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 358 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 359 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 360 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 361 | 2643221560 | Sphingopyxis sp. Root1497 | Isolate | Unclassified |
| 362 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 363 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 364 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 365 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 366 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 367 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 368 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.82 |
| Metatranscriptomes | 0.11 |
| Isolates | 1.07 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.35 |
| Nodule | 0 |
| Rhizoplane | 1.61 |
| Rhizosphere | 81.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068857_101862921 | 3300005577 | Bacteria | 589 |
| 2 | SwRhRL3b_contig_2422426 | 2162886006 | Bacteria | 2609 |
| 3 | JGI24034J14986_101753 | 3300001432 | Bacteria | 1198 |
| 4 | JGI24736J21556_1000006 | 3300001904 | Bacteria | 45118 |
| 5 | JGI24736J21556_1001522 | 3300001904 | Bacteria | 4223 |
| 6 | JGI24736J21556_1001945 | 3300001904 | Bacteria | 3673 |
| 7 | JGI24741J21665_1004748 | 3300001915 | Bacteria | 2951 |
| 8 | JGI24741J21665_1030719 | 3300001915 | Bacteria | 805 |
| 9 | JGI24752J21851_1000120 | 3300001976 | Bacteria | 10691 |
| 10 | JGI24752J21851_1000257 | 3300001976 | Bacteria | 7367 |
| 11 | JGI24740J21852_10005378 | 3300001979 | Bacteria | 5424 |
| 12 | JGI24740J21852_10014536 | 3300001979 | Bacteria | 2898 |
| 13 | JGI24740J21852_10112498 | 3300001979 | Bacteria | 686 |
| 14 | JGI24739J22299_10000250 | 3300001989 | Bacteria | 18085 |
| 15 | JGI24739J22299_10008181 | 3300001989 | Bacteria | 3903 |
| 16 | JGI24739J22299_10023790 | 3300001989 | Bacteria | 2163 |
| 17 | JGI24737J22298_10003302 | 3300001990 | Bacteria | 5713 |
| 18 | JGI24737J22298_10007938 | 3300001990 | Bacteria | 3570 |
| 19 | JGI24737J22298_10026562 | 3300001990 | Bacteria | 1828 |
| 20 | JGI24737J22298_10033868 | 3300001990 | Bacteria | 1586 |
| 21 | JGI24737J22298_10042149 | 3300001990 | Bacteria | 1399 |
| 22 | JGI24737J22298_10148436 | 3300001990 | Bacteria | 692 |
| 23 | JGI24735J21928_10000409 | 3300002067 | Bacteria | 15021 |
| 24 | JGI24735J21928_10001827 | 3300002067 | Bacteria | 7472 |
| 25 | JGI24735J21928_10002688 | 3300002067 | Bacteria | 6143 |
| 26 | JGI24735J21928_10014476 | 3300002067 | Bacteria | 2469 |
| 27 | JGI24735J21928_10015885 | 3300002067 | Bacteria | 2343 |
| 28 | JGI24735J21928_10043127 | 3300002067 | Bacteria | 1313 |
| 29 | JGI24735J21928_10116855 | 3300002067 | Bacteria | 767 |
| 30 | JGI24750J21931_1000757 | 3300002070 | Bacteria | 4559 |
| 31 | JGI24748J21848_1000060 | 3300002074 | Bacteria | 43952 |
| 32 | JGI24738J21930_10000103 | 3300002075 | Bacteria | 19478 |
| 33 | JGI24738J21930_10006549 | 3300002075 | Bacteria | 2726 |
| 34 | JGI24738J21930_10006840 | 3300002075 | Bacteria | 2649 |
| 35 | JGI24738J21930_10007018 | 3300002075 | Bacteria | 2617 |
| 36 | JGI24749J21850_1003743 | 3300002076 | Bacteria | 2129 |
| 37 | JGI24744J21845_10000743 | 3300002077 | Bacteria | 6054 |
| 38 | JGI24034J26672_10000010 | 3300002239 | Bacteria | 150746 |
| 39 | JGI24034J26672_10028949 | 3300002239 | Bacteria | 895 |
| 40 | JGI24742J22300_10000451 | 3300002244 | Bacteria | 6066 |
| 41 | JGI24751J29686_10000572 | 3300002459 | Bacteria | 9962 |
| 42 | JGI25165J46597_1000210 | 3300003214 | Bacteria | 83572 |
| 43 | rootH2_10139160 | 3300003320 | Bacteria | 1353 |
| 44 | Ga0055542_1006667 | 3300003762 | Bacteria | 2439 |
| 45 | Ga0055529_1038245 | 3300003763 | Bacteria | 583 |
| 46 | Ga0055536_1002684 | 3300003781 | Bacteria | 9870 |
| 47 | Ga0055530_10005156 | 3300003791 | Bacteria | 6368 |
| 48 | Ga0055531_10000492 | 3300003794 | Bacteria | 36203 |
| 49 | Ga0055531_10007782 | 3300003794 | Bacteria | 5775 |
| 50 | Ga0055531_10044062 | 3300003794 | Bacteria | 1255 |
| 51 | Ga0065704_10071035 | 3300005289 | Bacteria | 13600 |
| 52 | Ga0065704_10167171 | 3300005289 | Bacteria | 1315 |
| 53 | Ga0065707_10081714 | 3300005295 | Bacteria | 75872 |
| 54 | Ga0065707_10093677 | 3300005295 | Bacteria | 3593 |
| 55 | Ga0065707_10115350 | 3300005295 | Bacteria | 2269 |
| 56 | Ga0070658_10000003 | 3300005327 | Bacteria | 465963 |
| 57 | Ga0070658_10000195 | 3300005327 | Bacteria | 53384 |
| 58 | Ga0070658_10009638 | 3300005327 | Bacteria | 7751 |
| 59 | Ga0070658_10033154 | 3300005327 | Bacteria | 4154 |
| 60 | Ga0070658_10070441 | 3300005327 | Bacteria | 2863 |
| 61 | Ga0070658_10282640 | 3300005327 | Bacteria | 1412 |
| 62 | Ga0070658_10453898 | 3300005327 | Bacteria | 1104 |
| 63 | Ga0070676_10030994 | 3300005328 | Bacteria | 3053 |
| 64 | Ga0070676_10298341 | 3300005328 | Bacteria | 1091 |
| 65 | Ga0070683_100026685 | 3300005329 | Bacteria | 5205 |
| 66 | Ga0070683_100254936 | 3300005329 | Bacteria | 1669 |
| 67 | Ga0070683_101690283 | 3300005329 | Bacteria | 609 |
| 68 | Ga0070690_100000034 | 3300005330 | Bacteria | 62831 |
| 69 | Ga0070690_100206531 | 3300005330 | Bacteria | 1369 |
| 70 | Ga0070670_100000027 | 3300005331 | Bacteria | 186072 |
| 71 | Ga0070670_100000158 | 3300005331 | Bacteria | 62049 |
| 72 | Ga0070670_100213548 | 3300005331 | Bacteria | 1678 |
| 73 | Ga0070670_100402678 | 3300005331 | Bacteria | 1208 |
| 74 | Ga0070670_100521698 | 3300005331 | Bacteria | 1058 |
| 75 | Ga0070677_10000160 | 3300005333 | Bacteria | 22947 |
| 76 | Ga0070677_10491982 | 3300005333 | Bacteria | 663 |
| 77 | Ga0068869_100000341 | 3300005334 | Bacteria | 24968 |
| 78 | Ga0070666_10000009 | 3300005335 | Bacteria | 279209 |
| 79 | Ga0070666_10050089 | 3300005335 | Bacteria | 2809 |
| 80 | Ga0070666_10069928 | 3300005335 | Bacteria | 2387 |
| 81 | Ga0070666_10075446 | 3300005335 | Bacteria | 2299 |
| 82 | Ga0070680_100000263 | 3300005336 | Bacteria | 34685 |
| 83 | Ga0070680_100006749 | 3300005336 | Bacteria | 8745 |
| 84 | Ga0070682_100332044 | 3300005337 | Bacteria | 1127 |
| 85 | Ga0070682_100339376 | 3300005337 | Bacteria | 1116 |
| 86 | Ga0070682_100842004 | 3300005337 | Bacteria | 749 |
| 87 | Ga0068868_100000924 | 3300005338 | Bacteria | 20001 |
| 88 | Ga0068868_100001637 | 3300005338 | Bacteria | 15285 |
| 89 | Ga0070660_100000747 | 3300005339 | Bacteria | 21579 |
| 90 | Ga0070660_100001100 | 3300005339 | Bacteria | 18179 |
| 91 | Ga0070660_100006069 | 3300005339 | Bacteria | 8352 |
| 92 | Ga0070660_100059620 | 3300005339 | Bacteria | 2960 |
| 93 | Ga0070660_100098762 | 3300005339 | Bacteria | 2311 |
| 94 | Ga0070660_100126505 | 3300005339 | Bacteria | 2042 |
| 95 | Ga0070660_100449911 | 3300005339 | Bacteria | 1068 |
| 96 | Ga0070660_100673376 | 3300005339 | Bacteria | 867 |
| 97 | Ga0070689_100004591 | 3300005340 | Bacteria | 9351 |
| 98 | Ga0070689_100886039 | 3300005340 | Bacteria | 789 |
| 99 | Ga0070661_100000261 | 3300005344 | Bacteria | 43151 |
| 100 | Ga0070661_100011548 | 3300005344 | Bacteria | 6154 |
| 101 | Ga0070661_100089186 | 3300005344 | Bacteria | 2283 |
| 102 | Ga0070661_100151031 | 3300005344 | Bacteria | 1756 |
| 103 | Ga0070661_100208059 | 3300005344 | Bacteria | 1497 |
| 104 | Ga0070661_100907319 | 3300005344 | Bacteria | 727 |
| 105 | Ga0070692_10023630 | 3300005345 | Bacteria | 3013 |
| 106 | Ga0070668_100000001 | 3300005347 | Bacteria | 275905 |
| 107 | Ga0070668_100000007 | 3300005347 | Bacteria | 150621 |
| 108 | Ga0070668_100000948 | 3300005347 | Bacteria | 20236 |
| 109 | Ga0070668_100048065 | 3300005347 | Bacteria | 3281 |
| 110 | Ga0070668_100069713 | 3300005347 | Bacteria | 2736 |
| 111 | Ga0070668_100109191 | 3300005347 | Bacteria | 2201 |
| 112 | Ga0070669_100000017 | 3300005353 | Bacteria | 195995 |
| 113 | Ga0070669_100000031 | 3300005353 | Bacteria | 154042 |
| 114 | Ga0070669_100014088 | 3300005353 | Bacteria | 5687 |
| 115 | Ga0070669_100073935 | 3300005353 | Bacteria | 2526 |
| 116 | Ga0070669_100094212 | 3300005353 | Bacteria | 2250 |
| 117 | Ga0070669_100101995 | 3300005353 | Bacteria | 2166 |
| 118 | Ga0070669_100349423 | 3300005353 | Bacteria | 1200 |
| 119 | Ga0070675_100062595 | 3300005354 | Bacteria | 3074 |
| 120 | Ga0070675_100084517 | 3300005354 | Bacteria | 2651 |
| 121 | Ga0070675_100760274 | 3300005354 | Bacteria | 884 |
| 122 | Ga0070675_101745308 | 3300005354 | Bacteria | 574 |
| 123 | Ga0070671_100000106 | 3300005355 | Bacteria | 53385 |
| 124 | Ga0070671_100011633 | 3300005355 | Bacteria | 7077 |
| 125 | Ga0070671_100018600 | 3300005355 | Bacteria | 5645 |
| 126 | Ga0070671_100268673 | 3300005355 | Bacteria | 1450 |
| 127 | Ga0070671_100315401 | 3300005355 | Bacteria | 1332 |
| 128 | Ga0070674_100015971 | 3300005356 | Bacteria | 4700 |
| 129 | Ga0070674_100058373 | 3300005356 | Bacteria | 2682 |
| 130 | Ga0070674_100189956 | 3300005356 | Bacteria | 1579 |
| 131 | Ga0070674_100676134 | 3300005356 | Bacteria | 880 |
| 132 | Ga0070673_100000014 | 3300005364 | Bacteria | 135250 |
| 133 | Ga0070688_100000672 | 3300005365 | Bacteria | 17030 |
| 134 | Ga0070659_100000005 | 3300005366 | Bacteria | 259902 |
| 135 | Ga0070659_100056410 | 3300005366 | Bacteria | 3097 |
| 136 | Ga0070659_100057609 | 3300005366 | Bacteria | 3064 |
| 137 | Ga0070659_100068374 | 3300005366 | Bacteria | 2817 |
| 138 | Ga0070659_100081669 | 3300005366 | Bacteria | 2582 |
| 139 | Ga0070659_100099989 | 3300005366 | Bacteria | 2333 |
| 140 | Ga0070659_100124151 | 3300005366 | Bacteria | 2094 |
| 141 | Ga0070659_100127854 | 3300005366 | Bacteria | 2062 |
| 142 | Ga0070659_100140258 | 3300005366 | Bacteria | 1968 |
| 143 | Ga0070659_100414578 | 3300005366 | Bacteria | 1138 |
| 144 | Ga0070659_101125164 | 3300005366 | Bacteria | 693 |
| 145 | Ga0070667_100000006 | 3300005367 | Bacteria | 336732 |
| 146 | Ga0070667_100000280 | 3300005367 | Bacteria | 58186 |
| 147 | Ga0070667_100003426 | 3300005367 | Bacteria | 13510 |
| 148 | Ga0070667_100068184 | 3300005367 | Bacteria | 3027 |
| 149 | Ga0070667_100222493 | 3300005367 | Bacteria | 1680 |
| 150 | Ga0070705_100403339 | 3300005440 | Bacteria | 1013 |
| 151 | Ga0070700_101277646 | 3300005441 | Bacteria | 616 |
| 152 | Ga0070663_100017610 | 3300005455 | Bacteria | 4666 |
| 153 | Ga0070678_100263987 | 3300005456 | Bacteria | 1449 |
| 154 | Ga0070662_100066937 | 3300005457 | Bacteria | 2637 |
| 155 | Ga0070662_100141752 | 3300005457 | Bacteria | 1863 |
| 156 | Ga0070662_100195104 | 3300005457 | Bacteria | 1603 |
| 157 | Ga0070662_100536004 | 3300005457 | Bacteria | 979 |
| 158 | Ga0070662_100748473 | 3300005457 | Bacteria | 829 |
| 159 | Ga0070681_10066238 | 3300005458 | Bacteria | 3581 |
| 160 | Ga0070681_10320152 | 3300005458 | Bacteria | 1460 |
| 161 | Ga0068867_100000002 | 3300005459 | Bacteria | 247206 |
| 162 | Ga0068867_100985454 | 3300005459 | Bacteria | 763 |
| 163 | Ga0070685_10000274 | 3300005466 | Bacteria | 33246 |
| 164 | Ga0070685_10392747 | 3300005466 | Bacteria | 959 |
| 165 | Ga0070679_100000001 | 3300005530 | Bacteria | 764811 |
| 166 | Ga0070679_100195829 | 3300005530 | Bacteria | 1988 |
| 167 | Ga0070684_100394457 | 3300005535 | Bacteria | 1276 |
| 168 | Ga0070684_100435085 | 3300005535 | Bacteria | 1211 |
| 169 | Ga0068853_100000627 | 3300005539 | Bacteria | 24278 |
| 170 | Ga0068853_100002208 | 3300005539 | Bacteria | 14538 |
| 171 | Ga0068853_100023038 | 3300005539 | Bacteria | 5209 |
| 172 | Ga0068853_100119846 | 3300005539 | Bacteria | 2346 |
| 173 | Ga0068853_100181923 | 3300005539 | Bacteria | 1906 |
| 174 | Ga0068853_100237775 | 3300005539 | Bacteria | 1668 |
| 175 | Ga0068853_100348363 | 3300005539 | Bacteria | 1377 |
| 176 | Ga0068853_100487087 | 3300005539 | Bacteria | 1163 |
| 177 | Ga0068853_100995778 | 3300005539 | Bacteria | 807 |
| 178 | Ga0068853_101098252 | 3300005539 | Bacteria | 767 |
| 179 | Ga0070672_100054196 | 3300005543 | Bacteria | 3138 |
| 180 | Ga0070672_100440178 | 3300005543 | Bacteria | 1121 |
| 181 | Ga0070672_100464064 | 3300005543 | Bacteria | 1092 |
| 182 | Ga0070686_100000018 | 3300005544 | Bacteria | 140685 |
| 183 | Ga0070686_100001116 | 3300005544 | Bacteria | 15433 |
| 184 | Ga0070696_100364102 | 3300005546 | Bacteria | 1123 |
| 185 | Ga0070693_100245863 | 3300005547 | Bacteria | 1184 |
| 186 | Ga0070693_100260755 | 3300005547 | Bacteria | 1153 |
| 187 | Ga0070665_100000071 | 3300005548 | Bacteria | 200675 |
| 188 | Ga0070665_100000168 | 3300005548 | Bacteria | 119133 |
| 189 | Ga0070665_100004425 | 3300005548 | Bacteria | 14760 |
| 190 | Ga0070665_100017637 | 3300005548 | Bacteria | 7169 |
| 191 | Ga0070665_100061225 | 3300005548 | Bacteria | 3772 |
| 192 | Ga0070665_100277670 | 3300005548 | Bacteria | 1677 |
| 193 | Ga0068855_100000504 | 3300005563 | Bacteria | 48297 |
| 194 | Ga0068855_100084549 | 3300005563 | Bacteria | 3673 |
| 195 | Ga0068855_100139003 | 3300005563 | Bacteria | 2770 |
| 196 | Ga0068855_100591049 | 3300005563 | Bacteria | 1198 |
| 197 | Ga0070664_100102832 | 3300005564 | Bacteria | 2486 |
| 198 | Ga0070664_100418140 | 3300005564 | Bacteria | 1227 |
| 199 | Ga0068857_100006021 | 3300005577 | Bacteria | 10357 |
| 200 | Ga0068857_100043993 | 3300005577 | Bacteria | 3960 |
| 201 | Ga0068857_100089233 | 3300005577 | Bacteria | 2758 |
| 202 | Ga0068857_100830828 | 3300005577 | Bacteria | 883 |
| 203 | Ga0068857_101268560 | 3300005577 | Bacteria | 714 |
| 204 | Ga0068854_100000118 | 3300005578 | Bacteria | 54862 |
| 205 | Ga0068854_100019674 | 3300005578 | Bacteria | 4554 |
| 206 | Ga0068854_100025207 | 3300005578 | Bacteria | 4080 |
| 207 | Ga0068854_100100831 | 3300005578 | Bacteria | 2164 |
| 208 | Ga0068854_100116937 | 3300005578 | Bacteria | 2019 |
| 209 | Ga0068854_100657766 | 3300005578 | Bacteria | 900 |
| 210 | Ga0068854_101149409 | 3300005578 | Bacteria | 694 |
| 211 | Ga0068856_100064952 | 3300005614 | Bacteria | 3606 |
| 212 | Ga0068856_100172821 | 3300005614 | Bacteria | 2173 |
| 213 | Ga0068852_100000052 | 3300005616 | Bacteria | 80329 |
| 214 | Ga0068852_100259483 | 3300005616 | Bacteria | 1668 |
| 215 | Ga0068852_100264492 | 3300005616 | Bacteria | 1653 |
| 216 | Ga0068852_100779036 | 3300005616 | Bacteria | 970 |
| 217 | Ga0068859_100004549 | 3300005617 | Bacteria | 14141 |
| 218 | Ga0068859_100006032 | 3300005617 | Bacteria | 12307 |
| 219 | Ga0068859_100018002 | 3300005617 | Bacteria | 7099 |
| 220 | Ga0068859_100031019 | 3300005617 | Bacteria | 5365 |
| 221 | Ga0068859_100033839 | 3300005617 | Bacteria | 5131 |
| 222 | Ga0068859_100250946 | 3300005617 | Bacteria | 1860 |
| 223 | Ga0068859_100339624 | 3300005617 | Bacteria | 1596 |
| 224 | Ga0068864_100000083 | 3300005618 | Bacteria | 100972 |
| 225 | Ga0068864_100000123 | 3300005618 | Bacteria | 75407 |
| 226 | Ga0068864_100000306 | 3300005618 | Bacteria | 43501 |
| 227 | Ga0068864_100007374 | 3300005618 | Bacteria | 9051 |
| 228 | Ga0068864_101384401 | 3300005618 | Bacteria | 705 |
| 229 | Ga0068861_100158334 | 3300005719 | Bacteria | 1865 |
| 230 | Ga0068861_101131871 | 3300005719 | Bacteria | 754 |
| 231 | Ga0068851_10039174 | 3300005834 | Bacteria | 2380 |
| 232 | Ga0068851_10076909 | 3300005834 | Bacteria | 1736 |
| 233 | Ga0068851_10160742 | 3300005834 | Bacteria | 1234 |
| 234 | Ga0068863_100000025 | 3300005841 | Bacteria | 186072 |
| 235 | Ga0068863_100000027 | 3300005841 | Bacteria | 181884 |
| 236 | Ga0068863_100000197 | 3300005841 | Bacteria | 64182 |
| 237 | Ga0068863_100008301 | 3300005841 | Bacteria | 10148 |
| 238 | Ga0068863_100012079 | 3300005841 | Bacteria | 8343 |
| 239 | Ga0068863_100049502 | 3300005841 | Bacteria | 3985 |
| 240 | Ga0068863_100106037 | 3300005841 | Bacteria | 2674 |
| 241 | Ga0068858_100000348 | 3300005842 | Bacteria | 48656 |
| 242 | Ga0068858_100003670 | 3300005842 | Bacteria | 15204 |
| 243 | Ga0068858_100022546 | 3300005842 | Bacteria | 5875 |
| 244 | Ga0068860_100000013 | 3300005843 | Bacteria | 323055 |
| 245 | Ga0068860_100000022 | 3300005843 | Bacteria | 279209 |
| 246 | Ga0068860_100000074 | 3300005843 | Bacteria | 173022 |
| 247 | Ga0068860_100392165 | 3300005843 | Bacteria | 1372 |
| 248 | Ga0068860_100535346 | 3300005843 | Bacteria | 1172 |
| 249 | Ga0068862_100000027 | 3300005844 | Bacteria | 186072 |
| 250 | Ga0068862_100000043 | 3300005844 | Bacteria | 164356 |
| 251 | Ga0068862_100000070 | 3300005844 | Bacteria | 122289 |
| 252 | Ga0068862_100000898 | 3300005844 | Bacteria | 28838 |
| 253 | Ga0068862_100016373 | 3300005844 | Bacteria | 6170 |
| 254 | Ga0068862_100804363 | 3300005844 | Bacteria | 918 |
| 255 | Ga0081455_10000244 | 3300005937 | Bacteria | 70746 |
| 256 | Ga0081539_10015526 | 3300005985 | Bacteria | 5526 |
| 257 | Ga0075364_10717429 | 3300006051 | Bacteria | 682 |
| 258 | Ga0097621_100025235 | 3300006237 | Bacteria | 4648 |
| 259 | Ga0075370_10015764 | 3300006353 | Bacteria | 4054 |
| 260 | Ga0068871_100002746 | 3300006358 | Bacteria | 12022 |
| 261 | Ga0068871_100533435 | 3300006358 | Bacteria | 1061 |
| 262 | Ga0075430_100034331 | 3300006846 | Bacteria | 4305 |
| 263 | Ga0075434_100048864 | 3300006871 | Bacteria | 4199 |
| 264 | Ga0068865_100000016 | 3300006881 | Bacteria | 121076 |
| 265 | Ga0068865_101600368 | 3300006881 | Bacteria | 585 |
| 266 | Ga0097620_100004549 | 3300006931 | Bacteria | 14141 |
| 267 | Ga0097620_100006032 | 3300006931 | Bacteria | 12307 |
| 268 | Ga0097620_100018002 | 3300006931 | Bacteria | 7099 |
| 269 | Ga0097620_100031019 | 3300006931 | Bacteria | 5365 |
| 270 | Ga0097620_100033839 | 3300006931 | Bacteria | 5131 |
| 271 | Ga0097620_100250946 | 3300006931 | Bacteria | 1860 |
| 272 | Ga0097620_100339628 | 3300006931 | Bacteria | 1596 |
| 273 | Ga0105251_10000138 | 3300009011 | Bacteria | 74430 |
| 274 | Ga0105250_10063060 | 3300009092 | Bacteria | 1492 |
| 275 | Ga0105240_10001036 | 3300009093 | Bacteria | 49427 |
| 276 | Ga0111539_10383759 | 3300009094 | Bacteria | 1636 |
| 277 | Ga0105245_10021968 | 3300009098 | Bacteria | 5600 |
| 278 | Ga0105245_10104464 | 3300009098 | Bacteria | 2626 |
| 279 | Ga0105245_10534306 | 3300009098 | Bacteria | 1193 |
| 280 | Ga0105245_11293622 | 3300009098 | Bacteria | 778 |
| 281 | Ga0105247_10009207 | 3300009101 | Bacteria | 6006 |
| 282 | Ga0105243_10001456 | 3300009148 | Bacteria | 20796 |
| 283 | Ga0105243_10126622 | 3300009148 | Bacteria | 2162 |
| 284 | Ga0105243_10411211 | 3300009148 | Bacteria | 1259 |
| 285 | Ga0105243_10521771 | 3300009148 | Bacteria | 1130 |
| 286 | Ga0105241_10546126 | 3300009174 | Bacteria | 1040 |
| 287 | Ga0105242_10003829 | 3300009176 | Bacteria | 11697 |
| 288 | Ga0105248_10000026 | 3300009177 | Bacteria | 257155 |
| 289 | Ga0105248_10000081 | 3300009177 | Bacteria | 111105 |
| 290 | Ga0105248_10068211 | 3300009177 | Bacteria | 3994 |
| 291 | Ga0105248_10091937 | 3300009177 | Bacteria | 3417 |
| 292 | Ga0105248_10622231 | 3300009177 | Bacteria | 1218 |
| 293 | Ga0105237_10151824 | 3300009545 | Bacteria | 2313 |
| 294 | Ga0105237_10404375 | 3300009545 | Bacteria | 1370 |
| 295 | Ga0105238_10140784 | 3300009551 | Bacteria | 2389 |
| 296 | Ga0105238_10172795 | 3300009551 | Bacteria | 2137 |
| 297 | Ga0105238_10617498 | 3300009551 | Bacteria | 1093 |
| 298 | Ga0105238_10685760 | 3300009551 | Bacteria | 1036 |
| 299 | Ga0105249_10000014 | 3300009553 | Bacteria | 283274 |
| 300 | Ga0105249_10000123 | 3300009553 | Bacteria | 104747 |
| 301 | Ga0105249_10001466 | 3300009553 | Bacteria | 20693 |
| 302 | Ga0105249_10057690 | 3300009553 | Bacteria | 3557 |
| 303 | Ga0105239_10000319 | 3300010375 | Bacteria | 70995 |
| 304 | Ga0105239_10195399 | 3300010375 | Bacteria | 2266 |
| 305 | Ga0105239_10502441 | 3300010375 | Bacteria | 1378 |
| 306 | Ga0105239_11161715 | 3300010375 | Bacteria | 889 |
| 307 | Ga0105246_10836880 | 3300011119 | Bacteria | 820 |
| 308 | Ga0157373_10009096 | 3300013100 | Bacteria | 7348 |
| 309 | Ga0157373_10028341 | 3300013100 | Bacteria | 4040 |
| 310 | Ga0157373_10127024 | 3300013100 | Bacteria | 1793 |
| 311 | Ga0157373_10445874 | 3300013100 | Bacteria | 931 |
| 312 | Ga0157373_10827167 | 3300013100 | Bacteria | 684 |
| 313 | Ga0157371_10001651 | 3300013102 | Bacteria | 22752 |
| 314 | Ga0157371_10161144 | 3300013102 | Bacteria | 1602 |
| 315 | Ga0157371_10212204 | 3300013102 | Bacteria | 1389 |
| 316 | Ga0157371_10528046 | 3300013102 | Bacteria | 873 |
| 317 | Ga0157371_11012259 | 3300013102 | Bacteria | 634 |
| 318 | Ga0157370_10000417 | 3300013104 | Bacteria | 53666 |
| 319 | Ga0157370_10022018 | 3300013104 | Bacteria | 6346 |
| 320 | Ga0157370_10096838 | 3300013104 | Bacteria | 2768 |
| 321 | Ga0157370_10997253 | 3300013104 | Bacteria | 758 |
| 322 | Ga0157369_10000384 | 3300013105 | Bacteria | 58625 |
| 323 | Ga0157369_10030750 | 3300013105 | Bacteria | 5920 |
| 324 | Ga0157369_10042629 | 3300013105 | Bacteria | 4950 |
| 325 | Ga0157369_10203994 | 3300013105 | Bacteria | 2074 |
| 326 | Ga0157369_10367292 | 3300013105 | Bacteria | 1494 |
| 327 | Ga0157374_10007716 | 3300013296 | Bacteria | 9187 |
| 328 | Ga0157374_10119952 | 3300013296 | Bacteria | 2537 |
| 329 | Ga0157378_10007952 | 3300013297 | Bacteria | 9255 |
| 330 | Ga0157378_10025212 | 3300013297 | Bacteria | 5238 |
| 331 | Ga0163162_10009714 | 3300013306 | Bacteria | 9363 |
| 332 | Ga0163162_10079146 | 3300013306 | Bacteria | 3353 |
| 333 | Ga0163162_10110468 | 3300013306 | Bacteria | 2846 |
| 334 | Ga0163162_10150169 | 3300013306 | Bacteria | 2447 |
| 335 | Ga0157372_10004422 | 3300013307 | Bacteria | 14988 |
| 336 | Ga0157372_10097177 | 3300013307 | Bacteria | 3358 |
| 337 | Ga0157372_10167927 | 3300013307 | Bacteria | 2538 |
| 338 | Ga0157372_10177467 | 3300013307 | Bacteria | 2466 |
| 339 | Ga0157372_10355520 | 3300013307 | Bacteria | 1707 |
| 340 | Ga0157372_10419041 | 3300013307 | Bacteria | 1560 |
| 341 | Ga0157372_10478161 | 3300013307 | Bacteria | 1452 |
| 342 | Ga0157372_10768549 | 3300013307 | Bacteria | 1120 |
| 343 | Ga0157372_10947841 | 3300013307 | Bacteria | 998 |
| 344 | Ga0157375_10000725 | 3300013308 | Bacteria | 29001 |
| 345 | Ga0157375_10865565 | 3300013308 | Bacteria | 1049 |
| 346 | Ga0157375_12698621 | 3300013308 | Bacteria | 594 |
| 347 | Ga0163163_10101740 | 3300014325 | Bacteria | 2896 |
| 348 | Ga0163163_11711528 | 3300014325 | Bacteria | 689 |
| 349 | Ga0157380_10000040 | 3300014326 | Bacteria | 76401 |
| 350 | Ga0157380_10000292 | 3300014326 | Bacteria | 30110 |
| 351 | Ga0157380_10002861 | 3300014326 | Bacteria | 11717 |
| 352 | Ga0157380_10352859 | 3300014326 | Bacteria | 1377 |
| 353 | Ga0157380_10837417 | 3300014326 | Bacteria | 940 |
| 354 | Ga0157377_10478049 | 3300014745 | Bacteria | 866 |
| 355 | Ga0157379_10004472 | 3300014968 | Bacteria | 11991 |
| 356 | Ga0157376_10000337 | 3300014969 | Bacteria | 31344 |
| 357 | Ga0163161_10000057 | 3300017792 | Bacteria | 114339 |
| 358 | Ga0163161_10168898 | 3300017792 | Bacteria | 1671 |
| 359 | Ga0163161_10337956 | 3300017792 | Bacteria | 1194 |
| 360 | Ga0163161_10386995 | 3300017792 | Bacteria | 1119 |
| 361 | Ga0163161_10747395 | 3300017792 | Bacteria | 818 |
| 362 | Ga0206355_1374227 | 3300020076 | Bacteria | 559 |
| 363 | Ga0213873_10000216 | 3300021358 | Bacteria | 10215 |
| 364 | Ga0213876_10000056 | 3300021384 | Bacteria | 135017 |
| 365 | Ga0213876_10000258 | 3300021384 | Bacteria | 49441 |
| 366 | Ga0213876_10016445 | 3300021384 | Bacteria | 3910 |
| 367 | Ga0207672_1000246 | 3300025223 | Bacteria | 7493 |
| 368 | Ga0209147_100362 | 3300025229 | Bacteria | 32252 |
| 369 | Ga0207427_101677 | 3300025231 | Bacteria | 7383 |
| 370 | Ga0209437_119786 | 3300025233 | Bacteria | 839 |
| 371 | Ga0209148_1000146 | 3300025254 | Bacteria | 160734 |
| 372 | Ga0209148_1001719 | 3300025254 | Bacteria | 9636 |
| 373 | Ga0209759_1017119 | 3300025256 | Bacteria | 1797 |
| 374 | Ga0209233_1000003 | 3300025261 | Bacteria | 1607366 |
| 375 | Ga0209455_1000655 | 3300025272 | Bacteria | 21163 |
| 376 | Ga0209455_1018202 | 3300025272 | Bacteria | 1451 |
| 377 | Ga0209455_1038581 | 3300025272 | Bacteria | 743 |
| 378 | Ga0209675_1000638 | 3300025291 | Bacteria | 24903 |
| 379 | Ga0209676_1000897 | 3300025292 | Bacteria | 37715 |
| 380 | Ga0209676_1001537 | 3300025292 | Bacteria | 20872 |
| 381 | Ga0209025_1005555 | 3300025294 | Bacteria | 10219 |
| 382 | Ga0209025_1086778 | 3300025294 | Bacteria | 1039 |
| 383 | Ga0209050_1000113 | 3300025298 | Bacteria | 209222 |
| 384 | Ga0209050_1009081 | 3300025298 | Bacteria | 5162 |
| 385 | Ga0209050_1030261 | 3300025298 | Bacteria | 1712 |
| 386 | Ga0209050_1033589 | 3300025298 | Bacteria | 1552 |
| 387 | Ga0209257_1000083 | 3300025304 | Bacteria | 296207 |
| 388 | Ga0209257_1000330 | 3300025304 | Bacteria | 99167 |
| 389 | Ga0209257_1001563 | 3300025304 | Bacteria | 26461 |
| 390 | Ga0207713_1002556 | 3300025735 | Bacteria | 13146 |
| 391 | Ga0207682_10000258 | 3300025893 | Bacteria | 23899 |
| 392 | Ga0207682_10323645 | 3300025893 | Bacteria | 724 |
| 393 | Ga0207710_10050211 | 3300025900 | Bacteria | 1871 |
| 394 | Ga0207688_10348111 | 3300025901 | Bacteria | 913 |
| 395 | Ga0207680_10000007 | 3300025903 | Bacteria | 623574 |
| 396 | Ga0207680_10018006 | 3300025903 | Bacteria | 3744 |
| 397 | Ga0207680_10266318 | 3300025903 | Bacteria | 1187 |
| 398 | Ga0207680_11175260 | 3300025903 | Bacteria | 547 |
| 399 | Ga0207647_10000242 | 3300025904 | Bacteria | 44571 |
| 400 | Ga0207647_10000782 | 3300025904 | Bacteria | 24751 |
| 401 | Ga0207647_10013772 | 3300025904 | Bacteria | 5600 |
| 402 | Ga0207647_10016757 | 3300025904 | Bacteria | 4993 |
| 403 | Ga0207647_10410760 | 3300025904 | Bacteria | 762 |
| 404 | Ga0207645_10002404 | 3300025907 | Bacteria | 14733 |
| 405 | Ga0207705_10000005 | 3300025909 | Bacteria | 673478 |
| 406 | Ga0207705_10000025 | 3300025909 | Bacteria | 259826 |
| 407 | Ga0207705_10000347 | 3300025909 | Bacteria | 41820 |
| 408 | Ga0207705_10026471 | 3300025909 | Bacteria | 4136 |
| 409 | Ga0207705_10038533 | 3300025909 | Bacteria | 3422 |
| 410 | Ga0207705_10145228 | 3300025909 | Bacteria | 1774 |
| 411 | Ga0207705_10426592 | 3300025909 | Bacteria | 1027 |
| 412 | Ga0207684_10537421 | 3300025910 | Bacteria | 1000 |
| 413 | Ga0207654_10010042 | 3300025911 | Bacteria | 4815 |
| 414 | Ga0207707_10051479 | 3300025912 | Bacteria | 3586 |
| 415 | Ga0207707_10120012 | 3300025912 | Bacteria | 2298 |
| 416 | Ga0207695_10000867 | 3300025913 | Bacteria | 55339 |
| 417 | Ga0207695_10009308 | 3300025913 | Bacteria | 12158 |
| 418 | Ga0207695_10043468 | 3300025913 | Bacteria | 4788 |
| 419 | Ga0207671_10000590 | 3300025914 | Bacteria | 48498 |
| 420 | Ga0207671_10000924 | 3300025914 | Bacteria | 36861 |
| 421 | Ga0207671_10037763 | 3300025914 | Bacteria | 3580 |
| 422 | Ga0207671_10166203 | 3300025914 | Bacteria | 1711 |
| 423 | Ga0207660_10000246 | 3300025917 | Bacteria | 35132 |
| 424 | Ga0207660_10020186 | 3300025917 | Bacteria | 4469 |
| 425 | Ga0207657_10000156 | 3300025919 | Bacteria | 69892 |
| 426 | Ga0207657_10001846 | 3300025919 | Bacteria | 22883 |
| 427 | Ga0207657_10005712 | 3300025919 | Bacteria | 12985 |
| 428 | Ga0207657_10011954 | 3300025919 | Bacteria | 8590 |
| 429 | Ga0207657_10013682 | 3300025919 | Bacteria | 7947 |
| 430 | Ga0207657_10020640 | 3300025919 | Bacteria | 6220 |
| 431 | Ga0207657_10117093 | 3300025919 | Bacteria | 2195 |
| 432 | Ga0207657_10139641 | 3300025919 | Bacteria | 1980 |
| 433 | Ga0207657_10181263 | 3300025919 | Bacteria | 1702 |
| 434 | Ga0207657_10436658 | 3300025919 | Bacteria | 1028 |
| 435 | Ga0207657_10746740 | 3300025919 | Bacteria | 758 |
| 436 | Ga0207649_10000016 | 3300025920 | Bacteria | 243843 |
| 437 | Ga0207649_10013083 | 3300025920 | Bacteria | 4627 |
| 438 | Ga0207649_10337182 | 3300025920 | Bacteria | 1112 |
| 439 | Ga0207652_10000002 | 3300025921 | Bacteria | 878035 |
| 440 | Ga0207652_10017465 | 3300025921 | Bacteria | 5872 |
| 441 | Ga0207681_10000014 | 3300025923 | Bacteria | 353422 |
| 442 | Ga0207681_10000074 | 3300025923 | Bacteria | 89861 |
| 443 | Ga0207681_10023683 | 3300025923 | Bacteria | 3931 |
| 444 | Ga0207681_10103594 | 3300025923 | Bacteria | 2057 |
| 445 | Ga0207681_10145492 | 3300025923 | Bacteria | 1770 |
| 446 | Ga0207681_10347686 | 3300025923 | Bacteria | 1186 |
| 447 | Ga0207681_10441526 | 3300025923 | Bacteria | 1057 |
| 448 | Ga0207694_10008201 | 3300025924 | Bacteria | 7897 |
| 449 | Ga0207694_10075168 | 3300025924 | Bacteria | 2644 |
| 450 | Ga0207694_10296290 | 3300025924 | Bacteria | 1331 |
| 451 | Ga0207694_10562580 | 3300025924 | Bacteria | 957 |
| 452 | Ga0207694_11092372 | 3300025924 | Bacteria | 675 |
| 453 | Ga0207650_10000015 | 3300025925 | Bacteria | 369173 |
| 454 | Ga0207650_10000056 | 3300025925 | Bacteria | 157972 |
| 455 | Ga0207650_10003426 | 3300025925 | Bacteria | 10905 |
| 456 | Ga0207650_10160867 | 3300025925 | Bacteria | 1779 |
| 457 | Ga0207659_10651440 | 3300025926 | Bacteria | 900 |
| 458 | Ga0207687_10011808 | 3300025927 | Bacteria | 5714 |
| 459 | Ga0207687_10070619 | 3300025927 | Bacteria | 2493 |
| 460 | Ga0207687_10278213 | 3300025927 | Bacteria | 1340 |
| 461 | Ga0207644_10000047 | 3300025931 | Bacteria | 103158 |
| 462 | Ga0207644_10000111 | 3300025931 | Bacteria | 60737 |
| 463 | Ga0207644_10002467 | 3300025931 | Bacteria | 11927 |
| 464 | Ga0207644_10741036 | 3300025931 | Bacteria | 820 |
| 465 | Ga0207644_11201786 | 3300025931 | Bacteria | 637 |
| 466 | Ga0207690_10000020 | 3300025932 | Bacteria | 218439 |
| 467 | Ga0207690_10031407 | 3300025932 | Bacteria | 3397 |
| 468 | Ga0207690_10059130 | 3300025932 | Bacteria | 2596 |
| 469 | Ga0207690_10084447 | 3300025932 | Bacteria | 2226 |
| 470 | Ga0207690_10096235 | 3300025932 | Bacteria | 2105 |
| 471 | Ga0207690_10119385 | 3300025932 | Bacteria | 1913 |
| 472 | Ga0207690_10399159 | 3300025932 | Bacteria | 1096 |
| 473 | Ga0207690_10437120 | 3300025932 | Bacteria | 1049 |
| 474 | Ga0207690_10454282 | 3300025932 | Bacteria | 1030 |
| 475 | Ga0207690_10760354 | 3300025932 | Bacteria | 799 |
| 476 | Ga0207706_10001346 | 3300025933 | Bacteria | 24541 |
| 477 | Ga0207706_10004328 | 3300025933 | Bacteria | 13327 |
| 478 | Ga0207706_10015196 | 3300025933 | Bacteria | 6967 |
| 479 | Ga0207706_10032684 | 3300025933 | Bacteria | 4631 |
| 480 | Ga0207706_10083325 | 3300025933 | Bacteria | 2811 |
| 481 | Ga0207706_10091254 | 3300025933 | Bacteria | 2678 |
| 482 | Ga0207706_10596292 | 3300025933 | Bacteria | 949 |
| 483 | Ga0207706_10599679 | 3300025933 | Bacteria | 946 |
| 484 | Ga0207686_10001193 | 3300025934 | Bacteria | 15064 |
| 485 | Ga0207709_10000221 | 3300025935 | Bacteria | 72262 |
| 486 | Ga0207709_10281612 | 3300025935 | Bacteria | 1228 |
| 487 | Ga0207709_10959604 | 3300025935 | Bacteria | 697 |
| 488 | Ga0207670_10027546 | 3300025936 | Bacteria | 3594 |
| 489 | Ga0207669_10008141 | 3300025937 | Bacteria | 4906 |
| 490 | Ga0207669_10085925 | 3300025937 | Bacteria | 2032 |
| 491 | Ga0207669_10710928 | 3300025937 | Bacteria | 827 |
| 492 | Ga0207704_10000072 | 3300025938 | Bacteria | 63809 |
| 493 | Ga0207691_10142268 | 3300025940 | Bacteria | 2113 |
| 494 | Ga0207711_10000004 | 3300025941 | Bacteria | 870636 |
| 495 | Ga0207711_10013963 | 3300025941 | Bacteria | 6671 |
| 496 | Ga0207711_10053396 | 3300025941 | Bacteria | 3466 |
| 497 | Ga0207711_10057488 | 3300025941 | Bacteria | 3344 |
| 498 | Ga0207711_10067888 | 3300025941 | Bacteria | 3087 |
| 499 | Ga0207711_10123105 | 3300025941 | Bacteria | 2317 |
| 500 | Ga0207711_10359215 | 3300025941 | Bacteria | 1349 |
| 501 | Ga0207689_10000890 | 3300025942 | Bacteria | 28729 |
| 502 | Ga0207661_10400388 | 3300025944 | Bacteria | 1245 |
| 503 | Ga0207679_10066538 | 3300025945 | Bacteria | 2700 |
| 504 | Ga0207679_10129587 | 3300025945 | Bacteria | 2022 |
| 505 | Ga0207679_10498612 | 3300025945 | Bacteria | 1086 |
| 506 | Ga0207667_10000017 | 3300025949 | Bacteria | 390654 |
| 507 | Ga0207667_10003236 | 3300025949 | Bacteria | 20091 |
| 508 | Ga0207667_10021208 | 3300025949 | Bacteria | 7202 |
| 509 | Ga0207667_10244242 | 3300025949 | Bacteria | 1837 |
| 510 | Ga0207667_10478919 | 3300025949 | Bacteria | 1264 |
| 511 | Ga0207667_10924637 | 3300025949 | Bacteria | 863 |
| 512 | Ga0207667_11246891 | 3300025949 | Bacteria | 721 |
| 513 | Ga0207651_10000004 | 3300025960 | Bacteria | 290191 |
| 514 | Ga0207712_10000004 | 3300025961 | Bacteria | 614655 |
| 515 | Ga0207712_10000102 | 3300025961 | Bacteria | 96444 |
| 516 | Ga0207712_10008274 | 3300025961 | Bacteria | 6575 |
| 517 | Ga0207712_10087744 | 3300025961 | Bacteria | 2282 |
| 518 | Ga0207668_10000009 | 3300025972 | Bacteria | 188071 |
| 519 | Ga0207668_10000054 | 3300025972 | Bacteria | 95426 |
| 520 | Ga0207668_10005300 | 3300025972 | Bacteria | 7588 |
| 521 | Ga0207668_10021349 | 3300025972 | Bacteria | 4129 |
| 522 | Ga0207668_10021560 | 3300025972 | Bacteria | 4110 |
| 523 | Ga0207668_10027744 | 3300025972 | Bacteria | 3692 |
| 524 | Ga0207668_10100904 | 3300025972 | Bacteria | 2144 |
| 525 | Ga0207640_10000085 | 3300025981 | Bacteria | 73838 |
| 526 | Ga0207640_10015751 | 3300025981 | Bacteria | 4383 |
| 527 | Ga0207640_10053827 | 3300025981 | Bacteria | 2629 |
| 528 | Ga0207640_10082315 | 3300025981 | Bacteria | 2204 |
| 529 | Ga0207640_10173723 | 3300025981 | Bacteria | 1608 |
| 530 | Ga0207640_10192452 | 3300025981 | Bacteria | 1538 |
| 531 | Ga0207640_10210347 | 3300025981 | Bacteria | 1481 |
| 532 | Ga0207640_10507350 | 3300025981 | Bacteria | 1006 |
| 533 | Ga0207658_10000010 | 3300025986 | Bacteria | 240224 |
| 534 | Ga0207658_10000132 | 3300025986 | Bacteria | 80078 |
| 535 | Ga0207658_10000712 | 3300025986 | Bacteria | 28818 |
| 536 | Ga0207658_10001234 | 3300025986 | Bacteria | 20208 |
| 537 | Ga0207658_10001639 | 3300025986 | Bacteria | 17148 |
| 538 | Ga0207658_10024447 | 3300025986 | Bacteria | 4228 |
| 539 | Ga0207677_10000100 | 3300026023 | Bacteria | 70908 |
| 540 | Ga0207677_10000138 | 3300026023 | Bacteria | 59552 |
| 541 | Ga0207677_10382431 | 3300026023 | Bacteria | 1188 |
| 542 | Ga0207703_10000368 | 3300026035 | Bacteria | 48197 |
| 543 | Ga0207703_10012667 | 3300026035 | Bacteria | 6576 |
| 544 | Ga0207703_10015133 | 3300026035 | Bacteria | 6021 |
| 545 | Ga0207639_10013979 | 3300026041 | Bacteria | 5633 |
| 546 | Ga0207639_10016817 | 3300026041 | Bacteria | 5181 |
| 547 | Ga0207639_10035941 | 3300026041 | Bacteria | 3668 |
| 548 | Ga0207639_10044463 | 3300026041 | Bacteria | 3340 |
| 549 | Ga0207639_10160050 | 3300026041 | Bacteria | 1896 |
| 550 | Ga0207639_10204315 | 3300026041 | Bacteria | 1696 |
| 551 | Ga0207639_10244109 | 3300026041 | Bacteria | 1563 |
| 552 | Ga0207639_10251551 | 3300026041 | Bacteria | 1541 |
| 553 | Ga0207639_10650446 | 3300026041 | Bacteria | 975 |
| 554 | Ga0207678_10030575 | 3300026067 | Bacteria | 4700 |
| 555 | Ga0207678_10118443 | 3300026067 | Bacteria | 2260 |
| 556 | Ga0207702_10000443 | 3300026078 | Bacteria | 47033 |
| 557 | Ga0207702_10013135 | 3300026078 | Bacteria | 6886 |
| 558 | Ga0207702_10044822 | 3300026078 | Bacteria | 3718 |
| 559 | Ga0207702_10148746 | 3300026078 | Bacteria | 2128 |
| 560 | Ga0207702_11720788 | 3300026078 | Bacteria | 620 |
| 561 | Ga0207641_10000018 | 3300026088 | Bacteria | 298209 |
| 562 | Ga0207641_10000045 | 3300026088 | Bacteria | 181882 |
| 563 | Ga0207641_10000192 | 3300026088 | Bacteria | 83746 |
| 564 | Ga0207641_10000584 | 3300026088 | Bacteria | 40125 |
| 565 | Ga0207641_10001281 | 3300026088 | Bacteria | 25019 |
| 566 | Ga0207641_10009028 | 3300026088 | Bacteria | 8235 |
| 567 | Ga0207641_10082369 | 3300026088 | Bacteria | 2795 |
| 568 | Ga0207648_10000003 | 3300026089 | Bacteria | 289983 |
| 569 | Ga0207648_10853354 | 3300026089 | Bacteria | 849 |
| 570 | Ga0207676_10000021 | 3300026095 | Bacteria | 296572 |
| 571 | Ga0207676_10000027 | 3300026095 | Bacteria | 245868 |
| 572 | Ga0207676_10001450 | 3300026095 | Bacteria | 17632 |
| 573 | Ga0207676_10013305 | 3300026095 | Bacteria | 5910 |
| 574 | Ga0207676_10357430 | 3300026095 | Bacteria | 1353 |
| 575 | Ga0207674_10003093 | 3300026116 | Bacteria | 20563 |
| 576 | Ga0207674_10048663 | 3300026116 | Bacteria | 4339 |
| 577 | Ga0207674_10076358 | 3300026116 | Bacteria | 3358 |
| 578 | Ga0207674_10127701 | 3300026116 | Bacteria | 2507 |
| 579 | Ga0207674_10133967 | 3300026116 | Bacteria | 2440 |
| 580 | Ga0207674_11529635 | 3300026116 | Bacteria | 636 |
| 581 | Ga0207675_100001487 | 3300026118 | Bacteria | 23519 |
| 582 | Ga0207675_100013637 | 3300026118 | Bacteria | 7586 |
| 583 | Ga0207675_100059901 | 3300026118 | Bacteria | 3553 |
| 584 | Ga0207675_100586291 | 3300026118 | Bacteria | 1117 |
| 585 | Ga0207683_10302343 | 3300026121 | Bacteria | 1464 |
| 586 | Ga0207698_10009489 | 3300026142 | Bacteria | 6208 |
| 587 | Ga0207698_10140206 | 3300026142 | Bacteria | 2081 |
| 588 | Ga0207698_10217814 | 3300026142 | Bacteria | 1723 |
| 589 | Ga0207698_10224926 | 3300026142 | Bacteria | 1699 |
| 590 | Ga0207698_10317840 | 3300026142 | Bacteria | 1457 |
| 591 | Ga0207698_10337915 | 3300026142 | Bacteria | 1417 |
| 592 | Ga0268266_10000040 | 3300028379 | Bacteria | 323843 |
| 593 | Ga0268266_10000130 | 3300028379 | Bacteria | 147912 |
| 594 | Ga0268266_10003755 | 3300028379 | Bacteria | 14909 |
| 595 | Ga0268266_10024096 | 3300028379 | Bacteria | 5179 |
| 596 | Ga0268266_10083513 | 3300028379 | Bacteria | 2788 |
| 597 | Ga0268266_10600952 | 3300028379 | Bacteria | 1057 |
| 598 | Ga0268266_10755783 | 3300028379 | Bacteria | 938 |
| 599 | Ga0268265_10000013 | 3300028380 | Bacteria | 341536 |
| 600 | Ga0268265_10000042 | 3300028380 | Bacteria | 186086 |
| 601 | Ga0268265_10001721 | 3300028380 | Bacteria | 17706 |
| 602 | Ga0268265_10006438 | 3300028380 | Bacteria | 7959 |
| 603 | Ga0268265_10099889 | 3300028380 | Bacteria | 2340 |
| 604 | Ga0268265_10511741 | 3300028380 | Bacteria | 1133 |
| 605 | Ga0268264_10000003 | 3300028381 | Bacteria | 1141976 |
| 606 | Ga0268264_10000039 | 3300028381 | Bacteria | 376641 |
| 607 | Ga0268264_10000070 | 3300028381 | Bacteria | 268524 |
| 608 | Ga0268264_10002547 | 3300028381 | Bacteria | 15981 |
| 609 | Ga0268264_10068107 | 3300028381 | Bacteria | 3007 |
| 610 | Ga0268264_10393042 | 3300028381 | Bacteria | 1331 |
| 611 | Ga0307517_10220624 | 3300028786 | Bacteria | 1153 |
| 612 | Ga0316182_1095902 | 3300030745 | Bacteria | 835 |
| 613 | Ga0307513_10020089 | 3300031456 | Bacteria | 7931 |
| 614 | Ga0307408_100006528 | 3300031548 | Bacteria | 7731 |
| 615 | Ga0307408_100075236 | 3300031548 | Bacteria | 2508 |
| 616 | Ga0307408_100218229 | 3300031548 | Bacteria | 1555 |
| 617 | Ga0307408_100255270 | 3300031548 | Bacteria | 1448 |
| 618 | Ga0307408_101840168 | 3300031548 | Bacteria | 579 |
| 619 | Ga0307405_10066497 | 3300031731 | Bacteria | 2298 |
| 620 | Ga0307405_10102373 | 3300031731 | Bacteria | 1923 |
| 621 | Ga0307405_10167202 | 3300031731 | Bacteria | 1564 |
| 622 | Ga0307405_10181052 | 3300031731 | Bacteria | 1513 |
| 623 | Ga0307413_10099374 | 3300031824 | Bacteria | 1918 |
| 624 | Ga0307413_10273005 | 3300031824 | Bacteria | 1267 |
| 625 | Ga0307413_10426849 | 3300031824 | Bacteria | 1046 |
| 626 | Ga0307413_11020683 | 3300031824 | Bacteria | 710 |
| 627 | Ga0307413_11305232 | 3300031824 | Bacteria | 635 |
| 628 | Ga0307410_10598928 | 3300031852 | Bacteria | 919 |
| 629 | Ga0307406_10020598 | 3300031901 | Bacteria | 3887 |
| 630 | Ga0307406_10092043 | 3300031901 | Bacteria | 2044 |
| 631 | Ga0307406_10651770 | 3300031901 | Bacteria | 874 |
| 632 | Ga0307406_10879046 | 3300031901 | Bacteria | 762 |
| 633 | Ga0307406_11338638 | 3300031901 | Bacteria | 626 |
| 634 | Ga0307407_10173668 | 3300031903 | Bacteria | 1422 |
| 635 | Ga0307412_10010608 | 3300031911 | Bacteria | 5311 |
| 636 | Ga0307412_10012357 | 3300031911 | Bacteria | 4974 |
| 637 | Ga0307412_10126765 | 3300031911 | Bacteria | 1847 |
| 638 | Ga0307412_10139656 | 3300031911 | Bacteria | 1772 |
| 639 | Ga0307412_10199507 | 3300031911 | Bacteria | 1518 |
| 640 | Ga0307412_10994026 | 3300031911 | Bacteria | 741 |
| 641 | Ga0307416_100027021 | 3300032002 | Bacteria | 4241 |
| 642 | Ga0307416_100060199 | 3300032002 | Bacteria | 3091 |
| 643 | Ga0307416_100548752 | 3300032002 | Bacteria | 1229 |
| 644 | Ga0307416_100729157 | 3300032002 | Bacteria | 1082 |
| 645 | Ga0307416_100935931 | 3300032002 | Bacteria | 968 |
| 646 | Ga0307414_10000212 | 3300032004 | Bacteria | 38895 |
| 647 | Ga0307414_10000996 | 3300032004 | Bacteria | 14475 |
| 648 | Ga0307414_10090510 | 3300032004 | Bacteria | 2271 |
| 649 | Ga0307414_10093316 | 3300032004 | Bacteria | 2243 |
| 650 | Ga0307414_10417134 | 3300032004 | Bacteria | 1170 |
| 651 | Ga0307414_10494162 | 3300032004 | Bacteria | 1081 |
| 652 | Ga0307414_10739152 | 3300032004 | Bacteria | 893 |
| 653 | Ga0307414_11019436 | 3300032004 | Bacteria | 762 |
| 654 | Ga0307411_11559256 | 3300032005 | Bacteria | 608 |
| 655 | Ga0307411_11742017 | 3300032005 | Bacteria | 577 |
| 656 | Ga0307411_11818745 | 3300032005 | Bacteria | 566 |
| 657 | Ga0307415_100036264 | 3300032126 | Bacteria | 3230 |
| 658 | Ga0307415_100677474 | 3300032126 | Bacteria | 928 |
| 659 | Ga0307510_10000369 | 3300033180 | Bacteria | 42647 |
| 660 | Ga0373947_0079029 | 3300035725 | Bacteria | 2032 |
| 661 | Ga0395899_0001300 | 3300037312 | Bacteria | 21555 |
| 662 | Ga0395900_0232042 | 3300037418 | Bacteria | 1855 |
| 663 | Ga0395898_0377024 | 3300037466 | Bacteria | 1353 |
| 664 | Ga0436364_0075610 | 3300037853 | Bacteria | 591 |
| 665 | Ga0436364_1343161 | 3300037853 | Bacteria | 583 |
| 666 | Ga0395901_0290202 | 3300038443 | Bacteria | 1698 |
| 667 | Ga0436365_0048055 | 3300039437 | Bacteria | 15749 |
| 668 | Ga0436365_0083543 | 3300039437 | Bacteria | 85224 |
| 669 | Ga0436365_0456925 | 3300039437 | Bacteria | 13529 |
| 670 | Ga0436365_1439593 | 3300039437 | Bacteria | 4806 |
| 671 | Ga0436365_1774152 | 3300039437 | Bacteria | 1223 |
| 672 | Ga0436363_0743961 | 3300039450 | Bacteria | 2012 |
| 673 | Ga0436363_0798933 | 3300039450 | Bacteria | 1760 |
| 674 | Ga0436363_0939697 | 3300039450 | Bacteria | 655 |
| 675 | Ga0436362_1001952 | 3300039453 | Bacteria | 11094 |
| 676 | Ga0451797_0120132 | 3300041453 | Bacteria | 744 |
| 677 | Ga0451806_761036 | 3300041462 | Bacteria | 673 |
| 678 | Ga0451804_0783827 | 3300041463 | Bacteria | 696 |
| 679 | Ga0451807_1486108 | 3300041486 | Bacteria | 899 |
| 680 | Ga0451807_2002233 | 3300041486 | Bacteria | 2783 |
| 681 | Ga0451841_1227102 | 3300041498 | Bacteria | 1079 |
| 682 | Ga0451853_1319342 | 3300041512 | Bacteria | 846 |
| 683 | Ga0439445_0027398 | 3300042004 | Bacteria | 1463 |
| 684 | Ga0439445_0043410 | 3300042004 | Bacteria | 1200 |
| 685 | Ga0439448_0019958 | 3300042005 | Bacteria | 2069 |
| 686 | Ga0439448_0060516 | 3300042005 | Bacteria | 1251 |
| 687 | Ga0439448_0061235 | 3300042005 | Bacteria | 1244 |
| 688 | Ga0439448_0082899 | 3300042005 | Bacteria | 1078 |
| 689 | Ga0439455_0000612 | 3300042012 | Bacteria | 5192 |
| 690 | Ga0439455_0001654 | 3300042012 | Bacteria | 3826 |
| 691 | Ga0439455_0124719 | 3300042012 | Bacteria | 723 |
| 692 | Ga0439458_0000527 | 3300042157 | Bacteria | 9835 |
| 693 | Ga0439458_0011172 | 3300042157 | Bacteria | 2005 |
| 694 | Ga0439458_0192860 | 3300042157 | Bacteria | 555 |
| 695 | Ga0466972_0011191 | 3300044658 | Bacteria | 4502 |
| 696 | Ga0466973_0101414 | 3300044659 | Bacteria | 2440 |
| 697 | Ga0453683_1047893 | 3300044673 | Bacteria | 542 |
| 698 | Ga0466965_0019350 | 3300044683 | Bacteria | 3269 |
| 699 | Ga0466966_0427435 | 3300044684 | Bacteria | 796 |
| 700 | Ga0466961_0012485 | 3300044693 | Bacteria | 5436 |
| 701 | Ga0466963_0012587 | 3300044694 | Bacteria | 5183 |
| 702 | Ga0466963_0267624 | 3300044694 | Bacteria | 1201 |
| 703 | Ga0466964_0110996 | 3300044706 | Bacteria | 1223 |
| 704 | Ga0466964_0118701 | 3300044706 | Bacteria | 1189 |
| 705 | Ga0466971_0007472 | 3300044719 | Bacteria | 4760 |
| 706 | Ga0466968_0019851 | 3300044735 | Bacteria | 2709 |
| 707 | Ga0466968_0470227 | 3300044735 | Bacteria | 623 |
| 708 | Ga0466970_0108323 | 3300044765 | Bacteria | 1516 |
| 709 | Ga0466957_0034771 | 3300044842 | Bacteria | 3022 |
| 710 | Ga0466957_0091550 | 3300044842 | Bacteria | 1906 |
| 711 | Ga0466957_0561448 | 3300044842 | Bacteria | 796 |
| 712 | Ga0466960_0005656 | 3300044901 | Bacteria | 4961 |
| 713 | Ga0466959_0004827 | 3300045049 | Bacteria | 9108 |
| 714 | Ga0466958_0001565 | 3300045836 | Bacteria | 10970 |
| 715 | Ga0466958_0056408 | 3300045836 | Bacteria | 2386 |
| 716 | Ga0495627_000171 | 3300046453 | Bacteria | 74013 |
| 717 | Ga0495590_0164449 | 3300046457 | Bacteria | 807 |
| 718 | Ga0495590_0269459 | 3300046457 | Bacteria | 636 |
| 719 | Ga0495638_0051739 | 3300046460 | Bacteria | 2561 |
| 720 | Ga0495638_0329675 | 3300046460 | Bacteria | 813 |
| 721 | Ga0495583_0000279 | 3300046506 | Bacteria | 82827 |
| 722 | Ga0495583_0354987 | 3300046506 | Bacteria | 578 |
| 723 | Ga0495606_0000406 | 3300046507 | Bacteria | 72668 |
| 724 | Ga0495606_0162464 | 3300046507 | Bacteria | 1302 |
| 725 | Ga0495610_0041245 | 3300046512 | Bacteria | 2319 |
| 726 | Ga0495616_0000010 | 3300046513 | Bacteria | 224378 |
| 727 | Ga0495632_0110424 | 3300046519 | Bacteria | 1291 |
| 728 | Ga0495637_0018933 | 3300046520 | Bacteria | 3189 |
| 729 | Ga0495648_0002867 | 3300046524 | Bacteria | 15532 |
| 730 | Ga0495663_0011679 | 3300046525 | Bacteria | 2444 |
| 731 | Ga0495654_0002383 | 3300046530 | Bacteria | 12125 |
| 732 | Ga0495654_0030697 | 3300046530 | Bacteria | 2733 |
| 733 | Ga0495654_0039355 | 3300046530 | Bacteria | 2361 |
| 734 | Ga0495609_0172990 | 3300046538 | Bacteria | 911 |
| 735 | Ga0495668_0000234 | 3300046616 | Bacteria | 79147 |
| 736 | Ga0495668_0001218 | 3300046616 | Bacteria | 26031 |
| 737 | Ga0495668_0007104 | 3300046616 | Bacteria | 7210 |
| 738 | Ga0495668_0067003 | 3300046616 | Bacteria | 1975 |
| 739 | Ga0495668_0160015 | 3300046616 | Bacteria | 1233 |
| 740 | Ga0495668_0202652 | 3300046616 | Bacteria | 1086 |
| 741 | Ga0495625_0000195 | 3300046660 | Bacteria | 96493 |
| 742 | Ga0495625_0018549 | 3300046660 | Bacteria | 5426 |
| 743 | Ga0495661_0023660 | 3300046665 | Bacteria | 3984 |
| 744 | Ga0495670_0009371 | 3300046691 | Bacteria | 4814 |
| 745 | Ga0495649_0067684 | 3300046694 | Bacteria | 1916 |
| 746 | Ga0495649_0163856 | 3300046694 | Bacteria | 1165 |
| 747 | Ga0495649_0284526 | 3300046694 | Bacteria | 844 |
| 748 | Ga0495660_0154389 | 3300046810 | Bacteria | 1131 |
| 749 | Ga0495683_0096616 | 3300047323 | Bacteria | 1425 |
| 750 | Ga0495687_028628 | 3300047443 | Bacteria | 2589 |
| 751 | Ga0495687_125741 | 3300047443 | Bacteria | 917 |
| 752 | Ga0495677_0003219 | 3300047445 | Bacteria | 6369 |
| 753 | Ga0495673_0028621 | 3300047469 | Bacteria | 2638 |
| 754 | Ga0495686_0000100 | 3300047472 | Bacteria | 180492 |
| 755 | Ga0495686_0000139 | 3300047472 | Bacteria | 145796 |
| 756 | Ga0495686_0001947 | 3300047472 | Bacteria | 20548 |
| 757 | Ga0495686_0014062 | 3300047472 | Bacteria | 5525 |
| 758 | Ga0495686_0053634 | 3300047472 | Bacteria | 2526 |
| 759 | Ga0496101_0034863 | 3300048904 | Bacteria | 3557 |
| 760 | Ga0496101_0105806 | 3300048904 | Bacteria | 2112 |
| 761 | Ga0496102_0008072 | 3300048905 | Bacteria | 9006 |
| 762 | Ga0496102_0173143 | 3300048905 | Bacteria | 2032 |
| 763 | Ga0496102_0255328 | 3300048905 | Bacteria | 1653 |
| 764 | Ga0496103_0000082 | 3300048906 | Bacteria | 109451 |
| 765 | Ga0496103_0049570 | 3300048906 | Bacteria | 2596 |
| 766 | Ga0496103_0532423 | 3300048906 | Bacteria | 751 |
| 767 | Ga0496108_0001496 | 3300048911 | Bacteria | 18486 |
| 768 | Ga0496111_0269140 | 3300048914 | Bacteria | 1264 |
| 769 | Ga0496116_0004459 | 3300048919 | Bacteria | 13338 |
| 770 | Ga0496116_0026258 | 3300048919 | Bacteria | 4264 |
| 771 | Ga0496116_0041148 | 3300048919 | Bacteria | 3174 |
| 772 | Ga0496117_0000037 | 3300048920 | Bacteria | 324960 |
| 773 | Ga0496117_0004510 | 3300048920 | Bacteria | 15302 |
| 774 | Ga0496117_0026236 | 3300048920 | Bacteria | 4563 |
| 775 | Ga0496117_0032449 | 3300048920 | Bacteria | 3967 |
| 776 | Ga0496117_0041953 | 3300048920 | Bacteria | 3344 |
| 777 | Ga0496117_0043105 | 3300048920 | Bacteria | 3285 |
| 778 | Ga0496117_0237764 | 3300048920 | Bacteria | 1002 |
| 779 | Ga0496118_0000034 | 3300048921 | Bacteria | 322764 |
| 780 | Ga0496118_0000262 | 3300048921 | Bacteria | 92154 |
| 781 | Ga0496118_0003482 | 3300048921 | Bacteria | 19739 |
| 782 | Ga0496118_0004003 | 3300048921 | Bacteria | 17936 |
| 783 | Ga0496118_0108162 | 3300048921 | Bacteria | 1854 |
| 784 | Ga0496118_0191540 | 3300048921 | Bacteria | 1222 |
| 785 | Ga0496118_0470386 | 3300048921 | Bacteria | 633 |
| 786 | Ga0496119_0010120 | 3300048922 | Bacteria | 7964 |
| 787 | Ga0496120_0016240 | 3300048923 | Bacteria | 4872 |
| 788 | Ga0496120_0058995 | 3300048923 | Bacteria | 2152 |
| 789 | Ga0496120_0069740 | 3300048923 | Bacteria | 1935 |
| 790 | Ga0496121_0002347 | 3300048924 | Bacteria | 29197 |
| 791 | Ga0496121_0002562 | 3300048924 | Bacteria | 27530 |
| 792 | Ga0496121_0002899 | 3300048924 | Bacteria | 25178 |
| 793 | Ga0496121_0110264 | 3300048924 | Bacteria | 2100 |
| 794 | Ga0496121_0410273 | 3300048924 | Bacteria | 884 |
| 795 | Ga0496122_0009342 | 3300048925 | Bacteria | 10354 |
| 796 | Ga0496122_0059696 | 3300048925 | Bacteria | 2814 |
| 797 | Ga0496123_0079353 | 3300048926 | Bacteria | 2006 |
| 798 | Ga0496123_0088070 | 3300048926 | Bacteria | 1855 |
| 799 | Ga0496124_0000033 | 3300048927 | Bacteria | 330586 |
| 800 | Ga0496124_0010643 | 3300048927 | Bacteria | 9284 |
| 801 | Ga0496124_0067807 | 3300048927 | Bacteria | 2967 |
| 802 | Ga0496124_0162171 | 3300048927 | Bacteria | 1741 |
| 803 | Ga0496124_0173155 | 3300048927 | Bacteria | 1669 |
| 804 | Ga0496124_0202854 | 3300048927 | Bacteria | 1506 |
| 805 | Ga0496124_0210799 | 3300048927 | Bacteria | 1470 |
| 806 | Ga0496124_0497253 | 3300048927 | Bacteria | 819 |
| 807 | Ga0496125_0015502 | 3300048928 | Bacteria | 7365 |
| 808 | Ga0496125_0019769 | 3300048928 | Bacteria | 6338 |
| 809 | Ga0496125_0059711 | 3300048928 | Bacteria | 3070 |
| 810 | Ga0496125_0230554 | 3300048928 | Bacteria | 1185 |
| 811 | Ga0496126_0007959 | 3300048929 | Bacteria | 11517 |
| 812 | Ga0496126_0021909 | 3300048929 | Bacteria | 6232 |
| 813 | Ga0496126_0105133 | 3300048929 | Bacteria | 2466 |
| 814 | Ga0496126_0204859 | 3300048929 | Bacteria | 1664 |
| 815 | Ga0496126_0294927 | 3300048929 | Bacteria | 1340 |
| 816 | Ga0496126_0864100 | 3300048929 | Bacteria | 689 |
| 817 | Ga0496126_0931328 | 3300048929 | Bacteria | 657 |
| 818 | Ga0495678_027559 | 3300049459 | Bacteria | 2410 |
| 819 | Ga0495678_261011 | 3300049459 | Bacteria | 512 |
| 820 | Ga0495682_0002704 | 3300049460 | Bacteria | 8233 |
| 821 | Ga0501290_000432 | 3300049513 | Bacteria | 6576 |
| 822 | Ga0501290_015806 | 3300049513 | Bacteria | 1001 |
| 823 | Ga0501292_000013 | 3300049515 | Bacteria | 65866 |
| 824 | Ga0501293_000368 | 3300049516 | Bacteria | 3383 |
| 825 | Ga0501294_000631 | 3300049517 | Bacteria | 3981 |
| 826 | Ga0501297_040199 | 3300049520 | Bacteria | 656 |
| 827 | Ga0501300_003918 | 3300049523 | Bacteria | 2216 |
| 828 | Ga0501300_009154 | 3300049523 | Bacteria | 1446 |
| 829 | Ga0501032_0336191 | 3300049569 | Bacteria | 973 |
| 830 | Ga0501033_0088852 | 3300049570 | Bacteria | 2260 |
| 831 | Ga0501033_0095064 | 3300049570 | Bacteria | 2178 |
| 832 | Ga0501034_0028784 | 3300049571 | Bacteria | 5652 |
| 833 | Ga0501034_0210177 | 3300049571 | Bacteria | 1901 |
| 834 | Ga0501034_0529036 | 3300049571 | Bacteria | 1090 |
| 835 | Ga0501034_0551994 | 3300049571 | Bacteria | 1061 |
| 836 | Ga0501034_1356930 | 3300049571 | Bacteria | 587 |
| 837 | Ga0501036_0205337 | 3300049572 | Bacteria | 1656 |
| 838 | Ga0501038_0005908 | 3300049574 | Bacteria | 11312 |
| 839 | Ga0501038_0041175 | 3300049574 | Bacteria | 4029 |
| 840 | Ga0501039_0034162 | 3300049575 | Bacteria | 3924 |
| 841 | Ga0501043_0203801 | 3300049579 | Bacteria | 1534 |
| 842 | Ga0501046_0372083 | 3300049580 | Bacteria | 1035 |
| 843 | Ga0501047_0166362 | 3300049581 | Bacteria | 2075 |
| 844 | Ga0501069_0030904 | 3300049585 | Bacteria | 2943 |
| 845 | Ga0501070_0433749 | 3300049586 | Bacteria | 1060 |
| 846 | Ga0501074_0575622 | 3300049590 | Bacteria | 797 |
| 847 | Ga0501202_127207 | 3300049652 | Bacteria | 646 |
| 848 | Ga0501206_011120 | 3300049653 | Bacteria | 1212 |
| 849 | Ga0501222_001056 | 3300049662 | Bacteria | 3900 |
| 850 | Ga0501223_001010 | 3300049663 | Bacteria | 6648 |
| 851 | Ga0501223_004285 | 3300049663 | Bacteria | 3064 |
| 852 | Ga0501224_000924 | 3300049664 | Bacteria | 3782 |
| 853 | Ga0501227_012163 | 3300049665 | Bacteria | 1881 |
| 854 | Ga0501235_022685 | 3300049669 | Bacteria | 1396 |
| 855 | Ga0501242_018225 | 3300049674 | Bacteria | 891 |
| 856 | Ga0501257_000010 | 3300049686 | Bacteria | 53242 |
| 857 | Ga0501261_000517 | 3300049690 | Bacteria | 4944 |
| 858 | Ga0501221_004963 | 3300049704 | Bacteria | 2215 |
| 859 | Ga0501225_0005076 | 3300049705 | Bacteria | 3881 |
| 860 | Ga0501245_004530 | 3300049708 | Bacteria | 1909 |
| 861 | Ga0501262_000736 | 3300049759 | Bacteria | 3777 |
| 862 | Ga0501279_000004 | 3300049775 | Bacteria | 175612 |
| 863 | Ga0501279_012016 | 3300049775 | Bacteria | 1176 |
| 864 | Ga0501280_000314 | 3300049776 | Bacteria | 12170 |
| 865 | Ga0501280_000948 | 3300049776 | Bacteria | 6063 |
| 866 | Ga0501281_00738 | 3300049777 | Bacteria | 2822 |
| 867 | Ga0501282_000150 | 3300049778 | Bacteria | 8371 |
| 868 | Ga0501283_000662 | 3300049779 | Bacteria | 4545 |
| 869 | Ga0501035_0028457 | 3300049822 | Bacteria | 5099 |
| 870 | Ga0501035_0231685 | 3300049822 | Bacteria | 1574 |
| 871 | Ga0501044_0064035 | 3300049823 | Bacteria | 3754 |
| 872 | Ga0501226_018712 | 3300049853 | Bacteria | 763 |
| 873 | Ga0501284_08585 | 3300050005 | Bacteria | 611 |
| 874 | nmdc:mga03683_282096_c1 | 3300050489 | Bacteria | 776 |
| 875 | nmdc:mga00v17_803513_c1 | 3300050491 | Bacteria | 599 |
| 876 | nmdc:mga0k408_178363_c1 | 3300050493 | Bacteria | 1267 |
| 877 | nmdc:mga0qj67_33293_c1 | 3300050509 | Bacteria | 4021 |
| 878 | nmdc:mga08y16_1106861_c1 | 3300050511 | Bacteria | 767 |
| 879 | nmdc:mga0n895_98404_c1 | 3300050512 | Bacteria | 2932 |
| 880 | nmdc:mga0sz30_188011_c1 | 3300050516 | Bacteria | 917 |
| 881 | Ga0500643_000096 | 3300053087 | Bacteria | 92125 |
| 882 | Ga0500643_000403 | 3300053087 | Bacteria | 33015 |
| 883 | Ga0500643_000578 | 3300053087 | Bacteria | 25456 |
| 884 | Ga0500643_094126 | 3300053087 | Bacteria | 815 |
| 885 | Ga0500646_0031807 | 3300053090 | Bacteria | 1453 |
| 886 | Ga0500651_0120206 | 3300053093 | Bacteria | 1595 |
| 887 | Ga0500566_0059231 | 3300053094 | Bacteria | 2172 |
| 888 | Ga0500641_0054985 | 3300053096 | Bacteria | 1647 |
| 889 | Ga0500555_000414 | 3300053103 | Bacteria | 17859 |
| 890 | Ga0500592_004271 | 3300053116 | Bacteria | 2280 |
| 891 | Ga0500592_014513 | 3300053116 | Bacteria | 1262 |
| 892 | Ga0500608_087387 | 3300053122 | Bacteria | 1463 |
| 893 | Ga0500614_012615 | 3300053123 | Bacteria | 1848 |
| 894 | Ga0500642_0005281 | 3300053130 | Bacteria | 4153 |
| 895 | Ga0500655_004770 | 3300053133 | Bacteria | 2439 |
| 896 | Ga0500655_010892 | 3300053133 | Bacteria | 1644 |
| 897 | Ga0500658_0023395 | 3300053134 | Bacteria | 2358 |
| 898 | Ga0500658_0091852 | 3300053134 | Bacteria | 1314 |
| 899 | Ga0500559_0022687 | 3300053136 | Bacteria | 2662 |
| 900 | Ga0500559_0062973 | 3300053136 | Bacteria | 1657 |
| 901 | Ga0500559_0170573 | 3300053136 | Bacteria | 1023 |
| 902 | Ga0500568_0001218 | 3300053139 | Bacteria | 17161 |
| 903 | Ga0500568_0016647 | 3300053139 | Bacteria | 3261 |
| 904 | Ga0500573_0236415 | 3300053140 | Bacteria | 950 |
| 905 | Ga0500577_0104613 | 3300053142 | Bacteria | 1161 |
| 906 | Ga0500590_016080 | 3300053148 | Bacteria | 3865 |
| 907 | Ga0500604_0000175 | 3300053151 | Bacteria | 18367 |
| 908 | Ga0500604_0013262 | 3300053151 | Bacteria | 2231 |
| 909 | Ga0500604_0054346 | 3300053151 | Bacteria | 1243 |
| 910 | Ga0500604_0066562 | 3300053151 | Bacteria | 1141 |
| 911 | Ga0500616_0000161 | 3300053153 | Bacteria | 111424 |
| 912 | Ga0500616_0018108 | 3300053153 | Bacteria | 3985 |
| 913 | Ga0500622_0004156 | 3300053156 | Bacteria | 9264 |
| 914 | Ga0500627_0000070 | 3300053158 | Bacteria | 41863 |
| 915 | Ga0500627_0000152 | 3300053158 | Bacteria | 20430 |
| 916 | Ga0500627_0001848 | 3300053158 | Bacteria | 6050 |
| 917 | Ga0500627_0043382 | 3300053158 | Bacteria | 1939 |
| 918 | Ga0500627_0414685 | 3300053158 | Bacteria | 572 |
| 919 | Ga0500639_193698 | 3300053163 | Bacteria | 882 |
| 920 | Ga0500636_0039360 | 3300053177 | Bacteria | 2796 |
| 921 | Ga0500570_001639 | 3300053724 | Bacteria | 10510 |
| 922 | Ga0500645_009786 | 3300053730 | Bacteria | 3207 |
| 923 | Ga0500587_016465 | 3300053739 | Bacteria | 944 |
| 924 | Ga0466962_0049928 | 3300061719 | Bacteria | 2000 |
| 925 | 2585261813 | 2582581305 | Bacteria | 4895574 |
| 926 | 2643726796 | 2643221541 | Bacteria | 5498788 |
| 927 | 2643819222 | 2643221560 | Bacteria | 4801179 |
| 928 | 2643835085 | 2643221563 | Bacteria | 4726935 |
| 929 | 2644040302 | 2643221605 | Bacteria | 4772303 |
| 930 | 2644046163 | 2643221606 | Bacteria | 5588032 |
| 931 | 2644056012 | 2643221608 | Bacteria | 4724829 |
| 932 | 2644393026 | 2643221671 | Bacteria | 5496681 |
| 933 | 2852655899 | 2852653556 | Bacteria | 4050083 |
| 934 | 2852683047 | 2852680915 | Bacteria | 4100189 |
| 935 | Ga0068857_101862921 | |||
| 936 | SwRhRL3b_contig_2422426 | |||
| 937 | JGI24034J14986_101753 | |||
| 938 | JGI24736J21556_1000006 | |||
| 939 | JGI24736J21556_1001522 | |||
| 940 | JGI24736J21556_1001945 | |||
| 941 | JGI24741J21665_1004748 | |||
| 942 | JGI24741J21665_1030719 | |||
| 943 | JGI24752J21851_1000120 | |||
| 944 | JGI24752J21851_1000257 | |||
| 945 | JGI24740J21852_10005378 | |||
| 946 | JGI24740J21852_10014536 | |||
| 947 | JGI24740J21852_10112498 | |||
| 948 | JGI24739J22299_10000250 | |||
| 949 | JGI24739J22299_10008181 | |||
| 950 | JGI24739J22299_10023790 | |||
| 951 | JGI24737J22298_10003302 | |||
| 952 | JGI24737J22298_10007938 | |||
| 953 | JGI24737J22298_10026562 | |||
| 954 | JGI24737J22298_10033868 | |||
| 955 | JGI24737J22298_10042149 | |||
| 956 | JGI24737J22298_10148436 | |||
| 957 | JGI24735J21928_10000409 | |||
| 958 | JGI24735J21928_10001827 | |||
| 959 | JGI24735J21928_10002688 | |||
| 960 | JGI24735J21928_10014476 | |||
| 961 | JGI24735J21928_10015885 | |||
| 962 | JGI24735J21928_10043127 | |||
| 963 | JGI24735J21928_10116855 | |||
| 964 | JGI24750J21931_1000757 | |||
| 965 | JGI24748J21848_1000060 | |||
| 966 | JGI24738J21930_10000103 | |||
| 967 | JGI24738J21930_10006549 | |||
| 968 | JGI24738J21930_10006840 | |||
| 969 | JGI24738J21930_10007018 | |||
| 970 | JGI24749J21850_1003743 | |||
| 971 | JGI24744J21845_10000743 | |||
| 972 | JGI24034J26672_10000010 | |||
| 973 | JGI24034J26672_10028949 | |||
| 974 | JGI24742J22300_10000451 | |||
| 975 | JGI24751J29686_10000572 | |||
| 976 | JGI25165J46597_1000210 | |||
| 977 | rootH2_10139160 | |||
| 978 | Ga0055542_1006667 | |||
| 979 | Ga0055529_1038245 | |||
| 980 | Ga0055536_1002684 | |||
| 981 | Ga0055530_10005156 | |||
| 982 | Ga0055531_10000492 | |||
| 983 | Ga0055531_10007782 | |||
| 984 | Ga0055531_10044062 | |||
| 985 | Ga0065704_10071035 | |||
| 986 | Ga0065704_10167171 | |||
| 987 | Ga0065707_10081714 | |||
| 988 | Ga0065707_10093677 | |||
| 989 | Ga0065707_10115350 | |||
| 990 | Ga0070658_10000003 | |||
| 991 | Ga0070658_10000195 | |||
| 992 | Ga0070658_10009638 | |||
| 993 | Ga0070658_10033154 | |||
| 994 | Ga0070658_10070441 | |||
| 995 | Ga0070658_10282640 | |||
| 996 | Ga0070658_10453898 | |||
| 997 | Ga0070676_10030994 | |||
| 998 | Ga0070676_10298341 | |||
| 999 | Ga0070683_100026685 | |||
| 1000 | Ga0070683_100254936 | |||
| 1001 | Ga0070683_101690283 | |||
| 1002 | Ga0070690_100000034 | |||
| 1003 | Ga0070690_100206531 | |||
| 1004 | Ga0070670_100000027 | |||
| 1005 | Ga0070670_100000158 | |||
| 1006 | Ga0070670_100213548 | |||
| 1007 | Ga0070670_100402678 | |||
| 1008 | Ga0070670_100521698 | |||
| 1009 | Ga0070677_10000160 | |||
| 1010 | Ga0070677_10491982 | |||
| 1011 | Ga0068869_100000341 | |||
| 1012 | Ga0070666_10000009 | |||
| 1013 | Ga0070666_10050089 | |||
| 1014 | Ga0070666_10069928 | |||
| 1015 | Ga0070666_10075446 | |||
| 1016 | Ga0070680_100000263 | |||
| 1017 | Ga0070680_100006749 | |||
| 1018 | Ga0070682_100332044 | |||
| 1019 | Ga0070682_100339376 | |||
| 1020 | Ga0070682_100842004 | |||
| 1021 | Ga0068868_100000924 | |||
| 1022 | Ga0068868_100001637 | |||
| 1023 | Ga0070660_100000747 | |||
| 1024 | Ga0070660_100001100 | |||
| 1025 | Ga0070660_100006069 | |||
| 1026 | Ga0070660_100059620 | |||
| 1027 | Ga0070660_100098762 | |||
| 1028 | Ga0070660_100126505 | |||
| 1029 | Ga0070660_100449911 | |||
| 1030 | Ga0070660_100673376 | |||
| 1031 | Ga0070689_100004591 | |||
| 1032 | Ga0070689_100886039 | |||
| 1033 | Ga0070661_100000261 | |||
| 1034 | Ga0070661_100011548 | |||
| 1035 | Ga0070661_100089186 | |||
| 1036 | Ga0070661_100151031 | |||
| 1037 | Ga0070661_100208059 | |||
| 1038 | Ga0070661_100907319 | |||
| 1039 | Ga0070692_10023630 | |||
| 1040 | Ga0070668_100000001 | |||
| 1041 | Ga0070668_100000007 | |||
| 1042 | Ga0070668_100000948 | |||
| 1043 | Ga0070668_100048065 | |||
| 1044 | Ga0070668_100069713 | |||
| 1045 | Ga0070668_100109191 | |||
| 1046 | Ga0070669_100000017 | |||
| 1047 | Ga0070669_100000031 | |||
| 1048 | Ga0070669_100014088 | |||
| 1049 | Ga0070669_100073935 | |||
| 1050 | Ga0070669_100094212 | |||
| 1051 | Ga0070669_100101995 | |||
| 1052 | Ga0070669_100349423 | |||
| 1053 | Ga0070675_100062595 | |||
| 1054 | Ga0070675_100084517 | |||
| 1055 | Ga0070675_100760274 | |||
| 1056 | Ga0070675_101745308 | |||
| 1057 | Ga0070671_100000106 | |||
| 1058 | Ga0070671_100011633 | |||
| 1059 | Ga0070671_100018600 | |||
| 1060 | Ga0070671_100268673 | |||
| 1061 | Ga0070671_100315401 | |||
| 1062 | Ga0070674_100015971 | |||
| 1063 | Ga0070674_100058373 | |||
| 1064 | Ga0070674_100189956 | |||
| 1065 | Ga0070674_100676134 | |||
| 1066 | Ga0070673_100000014 | |||
| 1067 | Ga0070688_100000672 | |||
| 1068 | Ga0070659_100000005 | |||
| 1069 | Ga0070659_100056410 | |||
| 1070 | Ga0070659_100057609 | |||
| 1071 | Ga0070659_100068374 | |||
| 1072 | Ga0070659_100081669 | |||
| 1073 | Ga0070659_100099989 | |||
| 1074 | Ga0070659_100124151 | |||
| 1075 | Ga0070659_100127854 | |||
| 1076 | Ga0070659_100140258 | |||
| 1077 | Ga0070659_100414578 | |||
| 1078 | Ga0070659_101125164 | |||
| 1079 | Ga0070667_100000006 | |||
| 1080 | Ga0070667_100000280 | |||
| 1081 | Ga0070667_100003426 | |||
| 1082 | Ga0070667_100068184 | |||
| 1083 | Ga0070667_100222493 | |||
| 1084 | Ga0070705_100403339 | |||
| 1085 | Ga0070700_101277646 | |||
| 1086 | Ga0070663_100017610 | |||
| 1087 | Ga0070678_100263987 | |||
| 1088 | Ga0070662_100066937 | |||
| 1089 | Ga0070662_100141752 | |||
| 1090 | Ga0070662_100195104 | |||
| 1091 | Ga0070662_100536004 | |||
| 1092 | Ga0070662_100748473 | |||
| 1093 | Ga0070681_10066238 | |||
| 1094 | Ga0070681_10320152 | |||
| 1095 | Ga0068867_100000002 | |||
| 1096 | Ga0068867_100985454 | |||
| 1097 | Ga0070685_10000274 | |||
| 1098 | Ga0070685_10392747 | |||
| 1099 | Ga0070679_100000001 | |||
| 1100 | Ga0070679_100195829 | |||
| 1101 | Ga0070684_100394457 | |||
| 1102 | Ga0070684_100435085 | |||
| 1103 | Ga0068853_100000627 | |||
| 1104 | Ga0068853_100002208 | |||
| 1105 | Ga0068853_100023038 | |||
| 1106 | Ga0068853_100119846 | |||
| 1107 | Ga0068853_100181923 | |||
| 1108 | Ga0068853_100237775 | |||
| 1109 | Ga0068853_100348363 | |||
| 1110 | Ga0068853_100487087 | |||
| 1111 | Ga0068853_100995778 | |||
| 1112 | Ga0068853_101098252 | |||
| 1113 | Ga0070672_100054196 | |||
| 1114 | Ga0070672_100440178 | |||
| 1115 | Ga0070672_100464064 | |||
| 1116 | Ga0070686_100000018 | |||
| 1117 | Ga0070686_100001116 | |||
| 1118 | Ga0070696_100364102 | |||
| 1119 | Ga0070693_100245863 | |||
| 1120 | Ga0070693_100260755 | |||
| 1121 | Ga0070665_100000071 | |||
| 1122 | Ga0070665_100000168 | |||
| 1123 | Ga0070665_100004425 | |||
| 1124 | Ga0070665_100017637 | |||
| 1125 | Ga0070665_100061225 | |||
| 1126 | Ga0070665_100277670 | |||
| 1127 | Ga0068855_100000504 | |||
| 1128 | Ga0068855_100084549 | |||
| 1129 | Ga0068855_100139003 | |||
| 1130 | Ga0068855_100591049 | |||
| 1131 | Ga0070664_100102832 | |||
| 1132 | Ga0070664_100418140 | |||
| 1133 | Ga0068857_100006021 | |||
| 1134 | Ga0068857_100043993 | |||
| 1135 | Ga0068857_100089233 | |||
| 1136 | Ga0068857_100830828 | |||
| 1137 | Ga0068857_101268560 | |||
| 1138 | Ga0068854_100000118 | |||
| 1139 | Ga0068854_100019674 | |||
| 1140 | Ga0068854_100025207 | |||
| 1141 | Ga0068854_100100831 | |||
| 1142 | Ga0068854_100116937 | |||
| 1143 | Ga0068854_100657766 | |||
| 1144 | Ga0068854_101149409 | |||
| 1145 | Ga0068856_100064952 | |||
| 1146 | Ga0068856_100172821 | |||
| 1147 | Ga0068852_100000052 | |||
| 1148 | Ga0068852_100259483 | |||
| 1149 | Ga0068852_100264492 | |||
| 1150 | Ga0068852_100779036 | |||
| 1151 | Ga0068859_100004549 | |||
| 1152 | Ga0068859_100006032 | |||
| 1153 | Ga0068859_100018002 | |||
| 1154 | Ga0068859_100031019 | |||
| 1155 | Ga0068859_100033839 | |||
| 1156 | Ga0068859_100250946 | |||
| 1157 | Ga0068859_100339624 | |||
| 1158 | Ga0068864_100000083 | |||
| 1159 | Ga0068864_100000123 | |||
| 1160 | Ga0068864_100000306 | |||
| 1161 | Ga0068864_100007374 | |||
| 1162 | Ga0068864_101384401 | |||
| 1163 | Ga0068861_100158334 | |||
| 1164 | Ga0068861_101131871 | |||
| 1165 | Ga0068851_10039174 | |||
| 1166 | Ga0068851_10076909 | |||
| 1167 | Ga0068851_10160742 | |||
| 1168 | Ga0068863_100000025 | |||
| 1169 | Ga0068863_100000027 | |||
| 1170 | Ga0068863_100000197 | |||
| 1171 | Ga0068863_100008301 | |||
| 1172 | Ga0068863_100012079 | |||
| 1173 | Ga0068863_100049502 | |||
| 1174 | Ga0068863_100106037 | |||
| 1175 | Ga0068858_100000348 | |||
| 1176 | Ga0068858_100003670 | |||
| 1177 | Ga0068858_100022546 | |||
| 1178 | Ga0068860_100000013 | |||
| 1179 | Ga0068860_100000022 | |||
| 1180 | Ga0068860_100000074 | |||
| 1181 | Ga0068860_100392165 | |||
| 1182 | Ga0068860_100535346 | |||
| 1183 | Ga0068862_100000027 | |||
| 1184 | Ga0068862_100000043 | |||
| 1185 | Ga0068862_100000070 | |||
| 1186 | Ga0068862_100000898 | |||
| 1187 | Ga0068862_100016373 | |||
| 1188 | Ga0068862_100804363 | |||
| 1189 | Ga0081455_10000244 | |||
| 1190 | Ga0081539_10015526 | |||
| 1191 | Ga0075364_10717429 | |||
| 1192 | Ga0097621_100025235 | |||
| 1193 | Ga0075370_10015764 | |||
| 1194 | Ga0068871_100002746 | |||
| 1195 | Ga0068871_100533435 | |||
| 1196 | Ga0075430_100034331 | |||
| 1197 | Ga0075434_100048864 | |||
| 1198 | Ga0068865_100000016 | |||
| 1199 | Ga0068865_101600368 | |||
| 1200 | Ga0097620_100004549 | |||
| 1201 | Ga0097620_100006032 | |||
| 1202 | Ga0097620_100018002 | |||
| 1203 | Ga0097620_100031019 | |||
| 1204 | Ga0097620_100033839 | |||
| 1205 | Ga0097620_100250946 | |||
| 1206 | Ga0097620_100339628 | |||
| 1207 | Ga0105251_10000138 | |||
| 1208 | Ga0105250_10063060 | |||
| 1209 | Ga0105240_10001036 | |||
| 1210 | Ga0111539_10383759 | |||
| 1211 | Ga0105245_10021968 | |||
| 1212 | Ga0105245_10104464 | |||
| 1213 | Ga0105245_10534306 | |||
| 1214 | Ga0105245_11293622 | |||
| 1215 | Ga0105247_10009207 | |||
| 1216 | Ga0105243_10001456 | |||
| 1217 | Ga0105243_10126622 | |||
| 1218 | Ga0105243_10411211 | |||
| 1219 | Ga0105243_10521771 | |||
| 1220 | Ga0105241_10546126 | |||
| 1221 | Ga0105242_10003829 | |||
| 1222 | Ga0105248_10000026 | |||
| 1223 | Ga0105248_10000081 | |||
| 1224 | Ga0105248_10068211 | |||
| 1225 | Ga0105248_10091937 | |||
| 1226 | Ga0105248_10622231 | |||
| 1227 | Ga0105237_10151824 | |||
| 1228 | Ga0105237_10404375 | |||
| 1229 | Ga0105238_10140784 | |||
| 1230 | Ga0105238_10172795 | |||
| 1231 | Ga0105238_10617498 | |||
| 1232 | Ga0105238_10685760 | |||
| 1233 | Ga0105249_10000014 | |||
| 1234 | Ga0105249_10000123 | |||
| 1235 | Ga0105249_10001466 | |||
| 1236 | Ga0105249_10057690 | |||
| 1237 | Ga0105239_10000319 | |||
| 1238 | Ga0105239_10195399 | |||
| 1239 | Ga0105239_10502441 | |||
| 1240 | Ga0105239_11161715 | |||
| 1241 | Ga0105246_10836880 | |||
| 1242 | Ga0157373_10009096 | |||
| 1243 | Ga0157373_10028341 | |||
| 1244 | Ga0157373_10127024 | |||
| 1245 | Ga0157373_10445874 | |||
| 1246 | Ga0157373_10827167 | |||
| 1247 | Ga0157371_10001651 | |||
| 1248 | Ga0157371_10161144 | |||
| 1249 | Ga0157371_10212204 | |||
| 1250 | Ga0157371_10528046 | |||
| 1251 | Ga0157371_11012259 | |||
| 1252 | Ga0157370_10000417 | |||
| 1253 | Ga0157370_10022018 | |||
| 1254 | Ga0157370_10096838 | |||
| 1255 | Ga0157370_10997253 | |||
| 1256 | Ga0157369_10000384 | |||
| 1257 | Ga0157369_10030750 | |||
| 1258 | Ga0157369_10042629 | |||
| 1259 | Ga0157369_10203994 | |||
| 1260 | Ga0157369_10367292 | |||
| 1261 | Ga0157374_10007716 | |||
| 1262 | Ga0157374_10119952 | |||
| 1263 | Ga0157378_10007952 | |||
| 1264 | Ga0157378_10025212 | |||
| 1265 | Ga0163162_10009714 | |||
| 1266 | Ga0163162_10079146 | |||
| 1267 | Ga0163162_10110468 | |||
| 1268 | Ga0163162_10150169 | |||
| 1269 | Ga0157372_10004422 | |||
| 1270 | Ga0157372_10097177 | |||
| 1271 | Ga0157372_10167927 | |||
| 1272 | Ga0157372_10177467 | |||
| 1273 | Ga0157372_10355520 | |||
| 1274 | Ga0157372_10419041 | |||
| 1275 | Ga0157372_10478161 | |||
| 1276 | Ga0157372_10768549 | |||
| 1277 | Ga0157372_10947841 | |||
| 1278 | Ga0157375_10000725 | |||
| 1279 | Ga0157375_10865565 | |||
| 1280 | Ga0157375_12698621 | |||
| 1281 | Ga0163163_10101740 | |||
| 1282 | Ga0163163_11711528 | |||
| 1283 | Ga0157380_10000040 | |||
| 1284 | Ga0157380_10000292 | |||
| 1285 | Ga0157380_10002861 | |||
| 1286 | Ga0157380_10352859 | |||
| 1287 | Ga0157380_10837417 | |||
| 1288 | Ga0157377_10478049 | |||
| 1289 | Ga0157379_10004472 | |||
| 1290 | Ga0157376_10000337 | |||
| 1291 | Ga0163161_10000057 | |||
| 1292 | Ga0163161_10168898 | |||
| 1293 | Ga0163161_10337956 | |||
| 1294 | Ga0163161_10386995 | |||
| 1295 | Ga0163161_10747395 | |||
| 1296 | Ga0206355_1374227 | |||
| 1297 | Ga0213873_10000216 | |||
| 1298 | Ga0213876_10000056 | |||
| 1299 | Ga0213876_10000258 | |||
| 1300 | Ga0213876_10016445 | |||
| 1301 | Ga0207672_1000246 | |||
| 1302 | Ga0209147_100362 | |||
| 1303 | Ga0207427_101677 | |||
| 1304 | Ga0209437_119786 | |||
| 1305 | Ga0209148_1000146 | |||
| 1306 | Ga0209148_1001719 | |||
| 1307 | Ga0209759_1017119 | |||
| 1308 | Ga0209233_1000003 | |||
| 1309 | Ga0209455_1000655 | |||
| 1310 | Ga0209455_1018202 | |||
| 1311 | Ga0209455_1038581 | |||
| 1312 | Ga0209675_1000638 | |||
| 1313 | Ga0209676_1000897 | |||
| 1314 | Ga0209676_1001537 | |||
| 1315 | Ga0209025_1005555 | |||
| 1316 | Ga0209025_1086778 | |||
| 1317 | Ga0209050_1000113 | |||
| 1318 | Ga0209050_1009081 | |||
| 1319 | Ga0209050_1030261 | |||
| 1320 | Ga0209050_1033589 | |||
| 1321 | Ga0209257_1000083 | |||
| 1322 | Ga0209257_1000330 | |||
| 1323 | Ga0209257_1001563 | |||
| 1324 | Ga0207713_1002556 | |||
| 1325 | Ga0207682_10000258 | |||
| 1326 | Ga0207682_10323645 | |||
| 1327 | Ga0207710_10050211 | |||
| 1328 | Ga0207688_10348111 | |||
| 1329 | Ga0207680_10000007 | |||
| 1330 | Ga0207680_10018006 | |||
| 1331 | Ga0207680_10266318 | |||
| 1332 | Ga0207680_11175260 | |||
| 1333 | Ga0207647_10000242 | |||
| 1334 | Ga0207647_10000782 | |||
| 1335 | Ga0207647_10013772 | |||
| 1336 | Ga0207647_10016757 | |||
| 1337 | Ga0207647_10410760 | |||
| 1338 | Ga0207645_10002404 | |||
| 1339 | Ga0207705_10000005 | |||
| 1340 | Ga0207705_10000025 | |||
| 1341 | Ga0207705_10000347 | |||
| 1342 | Ga0207705_10026471 | |||
| 1343 | Ga0207705_10038533 | |||
| 1344 | Ga0207705_10145228 | |||
| 1345 | Ga0207705_10426592 | |||
| 1346 | Ga0207684_10537421 | |||
| 1347 | Ga0207654_10010042 | |||
| 1348 | Ga0207707_10051479 | |||
| 1349 | Ga0207707_10120012 | |||
| 1350 | Ga0207695_10000867 | |||
| 1351 | Ga0207695_10009308 | |||
| 1352 | Ga0207695_10043468 | |||
| 1353 | Ga0207671_10000590 | |||
| 1354 | Ga0207671_10000924 | |||
| 1355 | Ga0207671_10037763 | |||
| 1356 | Ga0207671_10166203 | |||
| 1357 | Ga0207660_10000246 | |||
| 1358 | Ga0207660_10020186 | |||
| 1359 | Ga0207657_10000156 | |||
| 1360 | Ga0207657_10001846 | |||
| 1361 | Ga0207657_10005712 | |||
| 1362 | Ga0207657_10011954 | |||
| 1363 | Ga0207657_10013682 | |||
| 1364 | Ga0207657_10020640 | |||
| 1365 | Ga0207657_10117093 | |||
| 1366 | Ga0207657_10139641 | |||
| 1367 | Ga0207657_10181263 | |||
| 1368 | Ga0207657_10436658 | |||
| 1369 | Ga0207657_10746740 | |||
| 1370 | Ga0207649_10000016 | |||
| 1371 | Ga0207649_10013083 | |||
| 1372 | Ga0207649_10337182 | |||
| 1373 | Ga0207652_10000002 | |||
| 1374 | Ga0207652_10017465 | |||
| 1375 | Ga0207681_10000014 | |||
| 1376 | Ga0207681_10000074 | |||
| 1377 | Ga0207681_10023683 | |||
| 1378 | Ga0207681_10103594 | |||
| 1379 | Ga0207681_10145492 | |||
| 1380 | Ga0207681_10347686 | |||
| 1381 | Ga0207681_10441526 | |||
| 1382 | Ga0207694_10008201 | |||
| 1383 | Ga0207694_10075168 | |||
| 1384 | Ga0207694_10296290 | |||
| 1385 | Ga0207694_10562580 | |||
| 1386 | Ga0207694_11092372 | |||
| 1387 | Ga0207650_10000015 | |||
| 1388 | Ga0207650_10000056 | |||
| 1389 | Ga0207650_10003426 | |||
| 1390 | Ga0207650_10160867 | |||
| 1391 | Ga0207659_10651440 | |||
| 1392 | Ga0207687_10011808 | |||
| 1393 | Ga0207687_10070619 | |||
| 1394 | Ga0207687_10278213 | |||
| 1395 | Ga0207644_10000047 | |||
| 1396 | Ga0207644_10000111 | |||
| 1397 | Ga0207644_10002467 | |||
| 1398 | Ga0207644_10741036 | |||
| 1399 | Ga0207644_11201786 | |||
| 1400 | Ga0207690_10000020 | |||
| 1401 | Ga0207690_10031407 | |||
| 1402 | Ga0207690_10059130 | |||
| 1403 | Ga0207690_10084447 | |||
| 1404 | Ga0207690_10096235 | |||
| 1405 | Ga0207690_10119385 | |||
| 1406 | Ga0207690_10399159 | |||
| 1407 | Ga0207690_10437120 | |||
| 1408 | Ga0207690_10454282 | |||
| 1409 | Ga0207690_10760354 | |||
| 1410 | Ga0207706_10001346 | |||
| 1411 | Ga0207706_10004328 | |||
| 1412 | Ga0207706_10015196 | |||
| 1413 | Ga0207706_10032684 | |||
| 1414 | Ga0207706_10083325 | |||
| 1415 | Ga0207706_10091254 | |||
| 1416 | Ga0207706_10596292 | |||
| 1417 | Ga0207706_10599679 | |||
| 1418 | Ga0207686_10001193 | |||
| 1419 | Ga0207709_10000221 | |||
| 1420 | Ga0207709_10281612 | |||
| 1421 | Ga0207709_10959604 | |||
| 1422 | Ga0207670_10027546 | |||
| 1423 | Ga0207669_10008141 | |||
| 1424 | Ga0207669_10085925 | |||
| 1425 | Ga0207669_10710928 | |||
| 1426 | Ga0207704_10000072 | |||
| 1427 | Ga0207691_10142268 | |||
| 1428 | Ga0207711_10000004 | |||
| 1429 | Ga0207711_10013963 | |||
| 1430 | Ga0207711_10053396 | |||
| 1431 | Ga0207711_10057488 | |||
| 1432 | Ga0207711_10067888 | |||
| 1433 | Ga0207711_10123105 | |||
| 1434 | Ga0207711_10359215 | |||
| 1435 | Ga0207689_10000890 | |||
| 1436 | Ga0207661_10400388 | |||
| 1437 | Ga0207679_10066538 | |||
| 1438 | Ga0207679_10129587 | |||
| 1439 | Ga0207679_10498612 | |||
| 1440 | Ga0207667_10000017 | |||
| 1441 | Ga0207667_10003236 | |||
| 1442 | Ga0207667_10021208 | |||
| 1443 | Ga0207667_10244242 | |||
| 1444 | Ga0207667_10478919 | |||
| 1445 | Ga0207667_10924637 | |||
| 1446 | Ga0207667_11246891 | |||
| 1447 | Ga0207651_10000004 | |||
| 1448 | Ga0207712_10000004 | |||
| 1449 | Ga0207712_10000102 | |||
| 1450 | Ga0207712_10008274 | |||
| 1451 | Ga0207712_10087744 | |||
| 1452 | Ga0207668_10000009 | |||
| 1453 | Ga0207668_10000054 | |||
| 1454 | Ga0207668_10005300 | |||
| 1455 | Ga0207668_10021349 | |||
| 1456 | Ga0207668_10021560 | |||
| 1457 | Ga0207668_10027744 | |||
| 1458 | Ga0207668_10100904 | |||
| 1459 | Ga0207640_10000085 | |||
| 1460 | Ga0207640_10015751 | |||
| 1461 | Ga0207640_10053827 | |||
| 1462 | Ga0207640_10082315 | |||
| 1463 | Ga0207640_10173723 | |||
| 1464 | Ga0207640_10192452 | |||
| 1465 | Ga0207640_10210347 | |||
| 1466 | Ga0207640_10507350 | |||
| 1467 | Ga0207658_10000010 | |||
| 1468 | Ga0207658_10000132 | |||
| 1469 | Ga0207658_10000712 | |||
| 1470 | Ga0207658_10001234 | |||
| 1471 | Ga0207658_10001639 | |||
| 1472 | Ga0207658_10024447 | |||
| 1473 | Ga0207677_10000100 | |||
| 1474 | Ga0207677_10000138 | |||
| 1475 | Ga0207677_10382431 | |||
| 1476 | Ga0207703_10000368 | |||
| 1477 | Ga0207703_10012667 | |||
| 1478 | Ga0207703_10015133 | |||
| 1479 | Ga0207639_10013979 | |||
| 1480 | Ga0207639_10016817 | |||
| 1481 | Ga0207639_10035941 | |||
| 1482 | Ga0207639_10044463 | |||
| 1483 | Ga0207639_10160050 | |||
| 1484 | Ga0207639_10204315 | |||
| 1485 | Ga0207639_10244109 | |||
| 1486 | Ga0207639_10251551 | |||
| 1487 | Ga0207639_10650446 | |||
| 1488 | Ga0207678_10030575 | |||
| 1489 | Ga0207678_10118443 | |||
| 1490 | Ga0207702_10000443 | |||
| 1491 | Ga0207702_10013135 | |||
| 1492 | Ga0207702_10044822 | |||
| 1493 | Ga0207702_10148746 | |||
| 1494 | Ga0207702_11720788 | |||
| 1495 | Ga0207641_10000018 | |||
| 1496 | Ga0207641_10000045 | |||
| 1497 | Ga0207641_10000192 | |||
| 1498 | Ga0207641_10000584 | |||
| 1499 | Ga0207641_10001281 | |||
| 1500 | Ga0207641_10009028 | |||
| 1501 | Ga0207641_10082369 | |||
| 1502 | Ga0207648_10000003 | |||
| 1503 | Ga0207648_10853354 | |||
| 1504 | Ga0207676_10000021 | |||
| 1505 | Ga0207676_10000027 | |||
| 1506 | Ga0207676_10001450 | |||
| 1507 | Ga0207676_10013305 | |||
| 1508 | Ga0207676_10357430 | |||
| 1509 | Ga0207674_10003093 | |||
| 1510 | Ga0207674_10048663 | |||
| 1511 | Ga0207674_10076358 | |||
| 1512 | Ga0207674_10127701 | |||
| 1513 | Ga0207674_10133967 | |||
| 1514 | Ga0207674_11529635 | |||
| 1515 | Ga0207675_100001487 | |||
| 1516 | Ga0207675_100013637 | |||
| 1517 | Ga0207675_100059901 | |||
| 1518 | Ga0207675_100586291 | |||
| 1519 | Ga0207683_10302343 | |||
| 1520 | Ga0207698_10009489 | |||
| 1521 | Ga0207698_10140206 | |||
| 1522 | Ga0207698_10217814 | |||
| 1523 | Ga0207698_10224926 | |||
| 1524 | Ga0207698_10317840 | |||
| 1525 | Ga0207698_10337915 | |||
| 1526 | Ga0268266_10000040 | |||
| 1527 | Ga0268266_10000130 | |||
| 1528 | Ga0268266_10003755 | |||
| 1529 | Ga0268266_10024096 | |||
| 1530 | Ga0268266_10083513 | |||
| 1531 | Ga0268266_10600952 | |||
| 1532 | Ga0268266_10755783 | |||
| 1533 | Ga0268265_10000013 | |||
| 1534 | Ga0268265_10000042 | |||
| 1535 | Ga0268265_10001721 | |||
| 1536 | Ga0268265_10006438 | |||
| 1537 | Ga0268265_10099889 | |||
| 1538 | Ga0268265_10511741 | |||
| 1539 | Ga0268264_10000003 | |||
| 1540 | Ga0268264_10000039 | |||
| 1541 | Ga0268264_10000070 | |||
| 1542 | Ga0268264_10002547 | |||
| 1543 | Ga0268264_10068107 | |||
| 1544 | Ga0268264_10393042 | |||
| 1545 | Ga0307517_10220624 | |||
| 1546 | Ga0316182_1095902 | |||
| 1547 | Ga0307513_10020089 | |||
| 1548 | Ga0307408_100006528 | |||
| 1549 | Ga0307408_100075236 | |||
| 1550 | Ga0307408_100218229 | |||
| 1551 | Ga0307408_100255270 | |||
| 1552 | Ga0307408_101840168 | |||
| 1553 | Ga0307405_10066497 | |||
| 1554 | Ga0307405_10102373 | |||
| 1555 | Ga0307405_10167202 | |||
| 1556 | Ga0307405_10181052 | |||
| 1557 | Ga0307413_10099374 | |||
| 1558 | Ga0307413_10273005 | |||
| 1559 | Ga0307413_10426849 | |||
| 1560 | Ga0307413_11020683 | |||
| 1561 | Ga0307413_11305232 | |||
| 1562 | Ga0307410_10598928 | |||
| 1563 | Ga0307406_10020598 | |||
| 1564 | Ga0307406_10092043 | |||
| 1565 | Ga0307406_10651770 | |||
| 1566 | Ga0307406_10879046 | |||
| 1567 | Ga0307406_11338638 | |||
| 1568 | Ga0307407_10173668 | |||
| 1569 | Ga0307412_10010608 | |||
| 1570 | Ga0307412_10012357 | |||
| 1571 | Ga0307412_10126765 | |||
| 1572 | Ga0307412_10139656 | |||
| 1573 | Ga0307412_10199507 | |||
| 1574 | Ga0307412_10994026 | |||
| 1575 | Ga0307416_100027021 | |||
| 1576 | Ga0307416_100060199 | |||
| 1577 | Ga0307416_100548752 | |||
| 1578 | Ga0307416_100729157 | |||
| 1579 | Ga0307416_100935931 | |||
| 1580 | Ga0307414_10000212 | |||
| 1581 | Ga0307414_10000996 | |||
| 1582 | Ga0307414_10090510 | |||
| 1583 | Ga0307414_10093316 | |||
| 1584 | Ga0307414_10417134 | |||
| 1585 | Ga0307414_10494162 | |||
| 1586 | Ga0307414_10739152 | |||
| 1587 | Ga0307414_11019436 | |||
| 1588 | Ga0307411_11559256 | |||
| 1589 | Ga0307411_11742017 | |||
| 1590 | Ga0307411_11818745 | |||
| 1591 | Ga0307415_100036264 | |||
| 1592 | Ga0307415_100677474 | |||
| 1593 | Ga0307510_10000369 | |||
| 1594 | Ga0373947_0079029 | |||
| 1595 | Ga0395899_0001300 | |||
| 1596 | Ga0395900_0232042 | |||
| 1597 | Ga0395898_0377024 | |||
| 1598 | Ga0436364_0075610 | |||
| 1599 | Ga0436364_1343161 | |||
| 1600 | Ga0395901_0290202 | |||
| 1601 | Ga0436365_0048055 | |||
| 1602 | Ga0436365_0083543 | |||
| 1603 | Ga0436365_0456925 | |||
| 1604 | Ga0436365_1439593 | |||
| 1605 | Ga0436365_1774152 | |||
| 1606 | Ga0436363_0743961 | |||
| 1607 | Ga0436363_0798933 | |||
| 1608 | Ga0436363_0939697 | |||
| 1609 | Ga0436362_1001952 | |||
| 1610 | Ga0451797_0120132 | |||
| 1611 | Ga0451806_761036 | |||
| 1612 | Ga0451804_0783827 | |||
| 1613 | Ga0451807_1486108 | |||
| 1614 | Ga0451807_2002233 | |||
| 1615 | Ga0451841_1227102 | |||
| 1616 | Ga0451853_1319342 | |||
| 1617 | Ga0439445_0027398 | |||
| 1618 | Ga0439445_0043410 | |||
| 1619 | Ga0439448_0019958 | |||
| 1620 | Ga0439448_0060516 | |||
| 1621 | Ga0439448_0061235 | |||
| 1622 | Ga0439448_0082899 | |||
| 1623 | Ga0439455_0000612 | |||
| 1624 | Ga0439455_0001654 | |||
| 1625 | Ga0439455_0124719 | |||
| 1626 | Ga0439458_0000527 | |||
| 1627 | Ga0439458_0011172 | |||
| 1628 | Ga0439458_0192860 | |||
| 1629 | Ga0466972_0011191 | |||
| 1630 | Ga0466973_0101414 | |||
| 1631 | Ga0453683_1047893 | |||
| 1632 | Ga0466965_0019350 | |||
| 1633 | Ga0466966_0427435 | |||
| 1634 | Ga0466961_0012485 | |||
| 1635 | Ga0466963_0012587 | |||
| 1636 | Ga0466963_0267624 | |||
| 1637 | Ga0466964_0110996 | |||
| 1638 | Ga0466964_0118701 | |||
| 1639 | Ga0466971_0007472 | |||
| 1640 | Ga0466968_0019851 | |||
| 1641 | Ga0466968_0470227 | |||
| 1642 | Ga0466970_0108323 | |||
| 1643 | Ga0466957_0034771 | |||
| 1644 | Ga0466957_0091550 | |||
| 1645 | Ga0466957_0561448 | |||
| 1646 | Ga0466960_0005656 | |||
| 1647 | Ga0466959_0004827 | |||
| 1648 | Ga0466958_0001565 | |||
| 1649 | Ga0466958_0056408 | |||
| 1650 | Ga0495627_000171 | |||
| 1651 | Ga0495590_0164449 | |||
| 1652 | Ga0495590_0269459 | |||
| 1653 | Ga0495638_0051739 | |||
| 1654 | Ga0495638_0329675 | |||
| 1655 | Ga0495583_0000279 | |||
| 1656 | Ga0495583_0354987 | |||
| 1657 | Ga0495606_0000406 | |||
| 1658 | Ga0495606_0162464 | |||
| 1659 | Ga0495610_0041245 | |||
| 1660 | Ga0495616_0000010 | |||
| 1661 | Ga0495632_0110424 | |||
| 1662 | Ga0495637_0018933 | |||
| 1663 | Ga0495648_0002867 | |||
| 1664 | Ga0495663_0011679 | |||
| 1665 | Ga0495654_0002383 | |||
| 1666 | Ga0495654_0030697 | |||
| 1667 | Ga0495654_0039355 | |||
| 1668 | Ga0495609_0172990 | |||
| 1669 | Ga0495668_0000234 | |||
| 1670 | Ga0495668_0001218 | |||
| 1671 | Ga0495668_0007104 | |||
| 1672 | Ga0495668_0067003 | |||
| 1673 | Ga0495668_0160015 | |||
| 1674 | Ga0495668_0202652 | |||
| 1675 | Ga0495625_0000195 | |||
| 1676 | Ga0495625_0018549 | |||
| 1677 | Ga0495661_0023660 | |||
| 1678 | Ga0495670_0009371 | |||
| 1679 | Ga0495649_0067684 | |||
| 1680 | Ga0495649_0163856 | |||
| 1681 | Ga0495649_0284526 | |||
| 1682 | Ga0495660_0154389 | |||
| 1683 | Ga0495683_0096616 | |||
| 1684 | Ga0495687_028628 | |||
| 1685 | Ga0495687_125741 | |||
| 1686 | Ga0495677_0003219 | |||
| 1687 | Ga0495673_0028621 | |||
| 1688 | Ga0495686_0000100 | |||
| 1689 | Ga0495686_0000139 | |||
| 1690 | Ga0495686_0001947 | |||
| 1691 | Ga0495686_0014062 | |||
| 1692 | Ga0495686_0053634 | |||
| 1693 | Ga0496101_0034863 | |||
| 1694 | Ga0496101_0105806 | |||
| 1695 | Ga0496102_0008072 | |||
| 1696 | Ga0496102_0173143 | |||
| 1697 | Ga0496102_0255328 | |||
| 1698 | Ga0496103_0000082 | |||
| 1699 | Ga0496103_0049570 | |||
| 1700 | Ga0496103_0532423 | |||
| 1701 | Ga0496108_0001496 | |||
| 1702 | Ga0496111_0269140 | |||
| 1703 | Ga0496116_0004459 | |||
| 1704 | Ga0496116_0026258 | |||
| 1705 | Ga0496116_0041148 | |||
| 1706 | Ga0496117_0000037 | |||
| 1707 | Ga0496117_0004510 | |||
| 1708 | Ga0496117_0026236 | |||
| 1709 | Ga0496117_0032449 | |||
| 1710 | Ga0496117_0041953 | |||
| 1711 | Ga0496117_0043105 | |||
| 1712 | Ga0496117_0237764 | |||
| 1713 | Ga0496118_0000034 | |||
| 1714 | Ga0496118_0000262 | |||
| 1715 | Ga0496118_0003482 | |||
| 1716 | Ga0496118_0004003 | |||
| 1717 | Ga0496118_0108162 | |||
| 1718 | Ga0496118_0191540 | |||
| 1719 | Ga0496118_0470386 | |||
| 1720 | Ga0496119_0010120 | |||
| 1721 | Ga0496120_0016240 | |||
| 1722 | Ga0496120_0058995 | |||
| 1723 | Ga0496120_0069740 | |||
| 1724 | Ga0496121_0002347 | |||
| 1725 | Ga0496121_0002562 | |||
| 1726 | Ga0496121_0002899 | |||
| 1727 | Ga0496121_0110264 | |||
| 1728 | Ga0496121_0410273 | |||
| 1729 | Ga0496122_0009342 | |||
| 1730 | Ga0496122_0059696 | |||
| 1731 | Ga0496123_0079353 | |||
| 1732 | Ga0496123_0088070 | |||
| 1733 | Ga0496124_0000033 | |||
| 1734 | Ga0496124_0010643 | |||
| 1735 | Ga0496124_0067807 | |||
| 1736 | Ga0496124_0162171 | |||
| 1737 | Ga0496124_0173155 | |||
| 1738 | Ga0496124_0202854 | |||
| 1739 | Ga0496124_0210799 | |||
| 1740 | Ga0496124_0497253 | |||
| 1741 | Ga0496125_0015502 | |||
| 1742 | Ga0496125_0019769 | |||
| 1743 | Ga0496125_0059711 | |||
| 1744 | Ga0496125_0230554 | |||
| 1745 | Ga0496126_0007959 | |||
| 1746 | Ga0496126_0021909 | |||
| 1747 | Ga0496126_0105133 | |||
| 1748 | Ga0496126_0204859 | |||
| 1749 | Ga0496126_0294927 | |||
| 1750 | Ga0496126_0864100 | |||
| 1751 | Ga0496126_0931328 | |||
| 1752 | Ga0495678_027559 | |||
| 1753 | Ga0495678_261011 | |||
| 1754 | Ga0495682_0002704 | |||
| 1755 | Ga0501290_000432 | |||
| 1756 | Ga0501290_015806 | |||
| 1757 | Ga0501292_000013 | |||
| 1758 | Ga0501293_000368 | |||
| 1759 | Ga0501294_000631 | |||
| 1760 | Ga0501297_040199 | |||
| 1761 | Ga0501300_003918 | |||
| 1762 | Ga0501300_009154 | |||
| 1763 | Ga0501032_0336191 | |||
| 1764 | Ga0501033_0088852 | |||
| 1765 | Ga0501033_0095064 | |||
| 1766 | Ga0501034_0028784 | |||
| 1767 | Ga0501034_0210177 | |||
| 1768 | Ga0501034_0529036 | |||
| 1769 | Ga0501034_0551994 | |||
| 1770 | Ga0501034_1356930 | |||
| 1771 | Ga0501036_0205337 | |||
| 1772 | Ga0501038_0005908 | |||
| 1773 | Ga0501038_0041175 | |||
| 1774 | Ga0501039_0034162 | |||
| 1775 | Ga0501043_0203801 | |||
| 1776 | Ga0501046_0372083 | |||
| 1777 | Ga0501047_0166362 | |||
| 1778 | Ga0501069_0030904 | |||
| 1779 | Ga0501070_0433749 | |||
| 1780 | Ga0501074_0575622 | |||
| 1781 | Ga0501202_127207 | |||
| 1782 | Ga0501206_011120 | |||
| 1783 | Ga0501222_001056 | |||
| 1784 | Ga0501223_001010 | |||
| 1785 | Ga0501223_004285 | |||
| 1786 | Ga0501224_000924 | |||
| 1787 | Ga0501227_012163 | |||
| 1788 | Ga0501235_022685 | |||
| 1789 | Ga0501242_018225 | |||
| 1790 | Ga0501257_000010 | |||
| 1791 | Ga0501261_000517 | |||
| 1792 | Ga0501221_004963 | |||
| 1793 | Ga0501225_0005076 | |||
| 1794 | Ga0501245_004530 | |||
| 1795 | Ga0501262_000736 | |||
| 1796 | Ga0501279_000004 | |||
| 1797 | Ga0501279_012016 | |||
| 1798 | Ga0501280_000314 | |||
| 1799 | Ga0501280_000948 | |||
| 1800 | Ga0501281_00738 | |||
| 1801 | Ga0501282_000150 | |||
| 1802 | Ga0501283_000662 | |||
| 1803 | Ga0501035_0028457 | |||
| 1804 | Ga0501035_0231685 | |||
| 1805 | Ga0501044_0064035 | |||
| 1806 | Ga0501226_018712 | |||
| 1807 | Ga0501284_08585 | |||
| 1808 | nmdc:mga03683_282096_c1 | |||
| 1809 | nmdc:mga00v17_803513_c1 | |||
| 1810 | nmdc:mga0k408_178363_c1 | |||
| 1811 | nmdc:mga0qj67_33293_c1 | |||
| 1812 | nmdc:mga08y16_1106861_c1 | |||
| 1813 | nmdc:mga0n895_98404_c1 | |||
| 1814 | nmdc:mga0sz30_188011_c1 | |||
| 1815 | Ga0500643_000096 | |||
| 1816 | Ga0500643_000403 | |||
| 1817 | Ga0500643_000578 | |||
| 1818 | Ga0500643_094126 | |||
| 1819 | Ga0500646_0031807 | |||
| 1820 | Ga0500651_0120206 | |||
| 1821 | Ga0500566_0059231 | |||
| 1822 | Ga0500641_0054985 | |||
| 1823 | Ga0500555_000414 | |||
| 1824 | Ga0500592_004271 | |||
| 1825 | Ga0500592_014513 | |||
| 1826 | Ga0500608_087387 | |||
| 1827 | Ga0500614_012615 | |||
| 1828 | Ga0500642_0005281 | |||
| 1829 | Ga0500655_004770 | |||
| 1830 | Ga0500655_010892 | |||
| 1831 | Ga0500658_0023395 | |||
| 1832 | Ga0500658_0091852 | |||
| 1833 | Ga0500559_0022687 | |||
| 1834 | Ga0500559_0062973 | |||
| 1835 | Ga0500559_0170573 | |||
| 1836 | Ga0500568_0001218 | |||
| 1837 | Ga0500568_0016647 | |||
| 1838 | Ga0500573_0236415 | |||
| 1839 | Ga0500577_0104613 | |||
| 1840 | Ga0500590_016080 | |||
| 1841 | Ga0500604_0000175 | |||
| 1842 | Ga0500604_0013262 | |||
| 1843 | Ga0500604_0054346 | |||
| 1844 | Ga0500604_0066562 | |||
| 1845 | Ga0500616_0000161 | |||
| 1846 | Ga0500616_0018108 | |||
| 1847 | Ga0500622_0004156 | |||
| 1848 | Ga0500627_0000070 | |||
| 1849 | Ga0500627_0000152 | |||
| 1850 | Ga0500627_0001848 | |||
| 1851 | Ga0500627_0043382 | |||
| 1852 | Ga0500627_0414685 | |||
| 1853 | Ga0500639_193698 | |||
| 1854 | Ga0500636_0039360 | |||
| 1855 | Ga0500570_001639 | |||
| 1856 | Ga0500645_009786 | |||
| 1857 | Ga0500587_016465 | |||
| 1858 | Ga0466962_0049928 | |||
| 1859 | 2585261813 | |||
| 1860 | 2643726796 | |||
| 1861 | 2643819222 | |||
| 1862 | 2643835085 | |||
| 1863 | 2644040302 | |||
| 1864 | 2644046163 | |||
| 1865 | 2644056012 | |||
| 1866 | 2644393026 | |||
| 1867 | 2852655899 | |||
| 1868 | 2852683047 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6x8n-assembly2.cif.gz_B | crystal structure of h49a able mutant | 0.5904 | 12 | 136 |
| 6egc-assembly1.cif.gz_A | single-chain version of 2l4hc2_23 (pdb 5j0k) | 0.5646 | 7 | 137 |
| 6x8n-assembly2.cif.gz_B | crystal structure of h49a able mutant | 0.5408 | 12 | 136 |
| 6jx6-assembly1.cif.gz_A | tetrameric form of smac | 0.5166 | 7 | 143 |
| 6xv8-assembly2.cif.gz_B | crystal structure of megabody mb-nb207-c7hopq_g10 | 0.4742 | 4 | 131 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A4I1S8_112_254_3.30.40.10 | Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) | 0.713 | 7 | 85 | 3.30.40.10 |
| af_Q7JYY8_1_96_1.20.5.110 | Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; | 0.6276 | 9 | 101 | 1.20.5.110 |
| af_Q7JZW7_1_97_1.20.5.110 | Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; | 0.6083 | 7 | 108 | 1.20.5.110 |
| af_Q8NF91_8320_8646_1.20.58.60 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.5907 | 5 | 115 | 1.20.58.60 |
| af_Q7JZW7_1_97_1.20.5.110 | Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; | 0.5858 | 7 | 108 | 1.20.5.110 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E2W7J6-F1-model_v4 | Protoporphyrinogen IX oxidase | 0.9652 | 7 | 79 |
GO:0005886
GO:0006782 GO:0016491 GO:0046872 |
| AF-A0A1Y2J9X3-F1-model_v4 | Protoporphyrinogen IX oxidase | 0.9632 | 7 | 113 |
GO:0005886
GO:0006782 GO:0016491 GO:0046872 |
| AF-A0A659YHV8-F1-model_v4 | deleted | 0.9617 | 6 | 105 |
|
| AF-A0A528NWT4-F1-model_v4 | deleted | 0.9506 | 6 | 79 |
|
| AF-A0A7X6B8V8-F1-model_v4 | Protoporphyrinogen IX oxidase (PPO) (EC 1.3.99.-) | 0.9503 | 10 | 146 |
GO:0005886
GO:0006782 GO:0046872 GO:0070818 |