F486052

General Info

Members Datasets Scaffolds Average Seq Length
931 357 931 158

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0000581|Ga0501034_0000581_9882_10472
Length 196
Sequence MKPPDMQDIARLVTALQDITSIIIGHNGATSTQAGGSDKMLDLKILVGTQTGVAQLVAQEIELRLDGDDVRVTTALMEDVDLSVFDDDAVFLVCTSTYGQGDVPDSAKAFYEDIVRKRPDLSAVRYGLIGLGDKGTHGATFCFAAKKFDKILGELGARRIGEPLFNDSNTHLPEDEAAEWVEGWIVLCREKVGQAG

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
86 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
87 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
179 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
183 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
184 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
185 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
186 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
187 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
188 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
189 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
190 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
191 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
192 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
193 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
194 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
196 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
197 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
198 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
199 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
200 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
201 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
202 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
203 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
204 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
205 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
206 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
207 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
208 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
209 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
210 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
211 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
212 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
213 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
214 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
215 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
216 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
217 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
218 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
219 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
220 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
221 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
222 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
223 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
224 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
225 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
226 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
227 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
228 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
229 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
230 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
231 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
232 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
233 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
234 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
235 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
236 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
237 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
238 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
239 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
240 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
241 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
242 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
243 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
244 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
245 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
246 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
247 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
248 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
249 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
250 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
251 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
252 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
253 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
254 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
255 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
256 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
257 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
258 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
259 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
260 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
261 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
262 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
263 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
264 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
265 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
266 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
267 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
268 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
269 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
270 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
271 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
272 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
273 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
274 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
275 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
276 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
277 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
278 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
279 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
280 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
281 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
282 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
283 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
284 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
285 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
286 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
287 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
288 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
289 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
290 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
291 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
292 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
293 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
294 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
295 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
296 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
297 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
298 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
299 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
300 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
301 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
302 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
303 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
319 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
320 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
321 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
322 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
323 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
324 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
325 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
326 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
327 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
328 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
329 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
330 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
331 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
332 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
333 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
334 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
335 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
336 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
337 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
340 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
341 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
342 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
343 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
344 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
345 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
346 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
347 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
348 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
349 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
350 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
351 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
352 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
353 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
354 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
355 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
356 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
357 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0.21
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.21
Nodule 0
Rhizoplane 0
Rhizosphere 99.68
Stem 0
Stem Tuber 0
Unclassified 0.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10041276 3300005289 Unclassified 988
2 Ga0065707_10009454 3300005295 Bacteria 2622
3 Ga0065707_10330711 3300005295 Unclassified 950
4 Ga0070683_100096140 3300005329 Bacteria 2786
5 Ga0070683_100394875 3300005329 Bacteria 1319
6 Ga0070690_100000758 3300005330 Bacteria 16523
7 Ga0070690_100000906 3300005330 Bacteria 15097
8 Ga0070690_100170184 3300005330 Bacteria 1499
9 Ga0070690_100179335 3300005330 Bacteria 1463
10 Ga0070670_100765812 3300005331 Bacteria 870
11 Ga0070670_101020046 3300005331 Bacteria 753
12 Ga0070677_10159944 3300005333 Bacteria 1056
13 Ga0068869_100001703 3300005334 Bacteria 13138
14 Ga0068869_100001795 3300005334 Bacteria 12871
15 Ga0068869_100006074 3300005334 Bacteria 7635
16 Ga0068869_100025130 3300005334 Bacteria 4133
17 Ga0068869_100305007 3300005334 Unclassified 1287
18 Ga0070666_10183799 3300005335 Bacteria 1467
19 Ga0070680_100024647 3300005336 Bacteria 4808
20 Ga0070680_100195119 3300005336 Unclassified 1707
21 Ga0070680_100329957 3300005336 Bacteria 1296
22 Ga0070680_101036712 3300005336 Bacteria 709
23 Ga0070682_100004264 3300005337 Bacteria 7931
24 Ga0068868_100000169 3300005338 Bacteria 42949
25 Ga0068868_100117065 3300005338 Bacteria 2171
26 Ga0068868_100164551 3300005338 Bacteria 1834
27 Ga0068868_100181578 3300005338 Bacteria 1746
28 Ga0068868_100613804 3300005338 Bacteria 965
29 Ga0070660_100272244 3300005339 Bacteria 1384
30 Ga0070689_100005385 3300005340 Bacteria 8729
31 Ga0070689_100077140 3300005340 Bacteria 2611
32 Ga0070689_100092168 3300005340 Bacteria 2390
33 Ga0070689_100163455 3300005340 Bacteria 1801
34 Ga0070689_100513304 3300005340 Bacteria 1028
35 Ga0070689_100680869 3300005340 Unclassified 897
36 Ga0070691_10002837 3300005341 Bacteria 7750
37 Ga0070691_10020766 3300005341 Bacteria 3035
38 Ga0070691_10246292 3300005341 Unclassified 957
39 Ga0070691_10800460 3300005341 Unclassified 574
40 Ga0070687_100000112 3300005343 Bacteria 27473
41 Ga0070687_100139265 3300005343 Bacteria 1411
42 Ga0070687_100150179 3300005343 Bacteria 1367
43 Ga0070687_100176990 3300005343 Bacteria 1274
44 Ga0070687_100446006 3300005343 Bacteria 860
45 Ga0070661_100072196 3300005344 Bacteria 2540
46 Ga0070692_10000260 3300005345 Bacteria 14689
47 Ga0070692_10008357 3300005345 Bacteria 4615
48 Ga0070692_10232897 3300005345 Bacteria 1094
49 Ga0070692_10288351 3300005345 Bacteria 998
50 Ga0070692_10340507 3300005345 Bacteria 929
51 Ga0070668_100011505 3300005347 Bacteria 6589
52 Ga0070669_100013917 3300005353 Bacteria 5721
53 Ga0070675_100125120 3300005354 Bacteria 2187
54 Ga0070674_100026595 3300005356 Bacteria 3782
55 Ga0070674_100387381 3300005356 Bacteria 1139
56 Ga0070674_100832461 3300005356 Unclassified 799
57 Ga0070673_100420163 3300005364 Bacteria 1199
58 Ga0070673_100699443 3300005364 Bacteria 931
59 Ga0070673_100708229 3300005364 Bacteria 925
60 Ga0070673_101725593 3300005364 Unclassified 593
61 Ga0070688_100572513 3300005365 Unclassified 861
62 Ga0070667_100209649 3300005367 Bacteria 1731
63 Ga0070709_10312919 3300005434 Bacteria 1150
64 Ga0070709_11314962 3300005434 Unclassified 583
65 Ga0070714_100156934 3300005435 Bacteria 2055
66 Ga0070713_100065706 3300005436 Bacteria 3049
67 Ga0070701_10003531 3300005438 Bacteria 6202
68 Ga0070701_10096270 3300005438 Bacteria 1631
69 Ga0070701_10201137 3300005438 Bacteria 1178
70 Ga0070711_100347503 3300005439 Unclassified 1192
71 Ga0070705_100011432 3300005440 Bacteria 4478
72 Ga0070705_100027713 3300005440 Bacteria 3095
73 Ga0070705_100067286 3300005440 Bacteria 2152
74 Ga0070705_100212536 3300005440 Bacteria 1334
75 Ga0070705_100320451 3300005440 Bacteria 1119
76 Ga0070705_100336229 3300005440 Bacteria 1096
77 Ga0070705_100530481 3300005440 Unclassified 899
78 Ga0070700_100011261 3300005441 Bacteria 4951
79 Ga0070700_100988667 3300005441 Bacteria 691
80 Ga0070700_101102733 3300005441 Bacteria 658
81 Ga0070694_100005764 3300005444 Bacteria 7513
82 Ga0070694_100012756 3300005444 Bacteria 5234
83 Ga0070694_100022323 3300005444 Bacteria 4055
84 Ga0070694_100033291 3300005444 Bacteria 3390
85 Ga0070694_100052880 3300005444 Bacteria 2747
86 Ga0070694_100056900 3300005444 Bacteria 2657
87 Ga0070694_100187862 3300005444 Bacteria 1532
88 Ga0070694_100241896 3300005444 Bacteria 1362
89 Ga0070694_100262057 3300005444 Bacteria 1311
90 Ga0070694_100275286 3300005444 Bacteria 1281
91 Ga0070694_100389461 3300005444 Bacteria 1089
92 Ga0070694_101139573 3300005444 Unclassified 652
93 Ga0070708_100064500 3300005445 Bacteria 3282
94 Ga0070678_100107548 3300005456 Bacteria 2175
95 Ga0070662_100096492 3300005457 Bacteria 2230
96 Ga0070681_10000198 3300005458 Bacteria 47037
97 Ga0070681_10001458 3300005458 Bacteria 20859
98 Ga0070681_10087279 3300005458 Bacteria 3073
99 Ga0070681_10277060 3300005458 Bacteria 1588
100 Ga0070681_10398303 3300005458 Bacteria 1288
101 Ga0070681_10588537 3300005458 Bacteria 1027
102 Ga0068867_100001181 3300005459 Bacteria 17901
103 Ga0068867_100009709 3300005459 Bacteria 6787
104 Ga0068867_100011272 3300005459 Bacteria 6305
105 Ga0068867_100033240 3300005459 Bacteria 3733
106 Ga0068867_100136196 3300005459 Bacteria 1914
107 Ga0070685_10290062 3300005466 Unclassified 1099
108 Ga0070685_10638662 3300005466 Unclassified 770
109 Ga0070685_10790286 3300005466 Unclassified 699
110 Ga0070706_100448434 3300005467 Bacteria 1201
111 Ga0070707_100450843 3300005468 Bacteria 1247
112 Ga0070698_100048113 3300005471 Bacteria 4357
113 Ga0070698_100125334 3300005471 Bacteria 2526
114 Ga0070698_100912975 3300005471 Bacteria 824
115 Ga0070699_100026976 3300005518 Bacteria 4954
116 Ga0070699_100887389 3300005518 Bacteria 817
117 Ga0070679_100021105 3300005530 Bacteria 6356
118 Ga0070679_100047847 3300005530 Bacteria 4261
119 Ga0070684_100012632 3300005535 Bacteria 6772
120 Ga0070697_100064994 3300005536 Bacteria 2980
121 Ga0070697_100296274 3300005536 Bacteria 1390
122 Ga0068853_100036438 3300005539 Bacteria 4183
123 Ga0068853_100076380 3300005539 Bacteria 2925
124 Ga0068853_101279183 3300005539 Bacteria 709
125 Ga0070686_100000683 3300005544 Bacteria 19702
126 Ga0070686_100005999 3300005544 Bacteria 6742
127 Ga0070686_100486760 3300005544 Bacteria 955
128 Ga0070695_100017760 3300005545 Bacteria 4316
129 Ga0070695_100021991 3300005545 Bacteria 3909
130 Ga0070695_100060766 3300005545 Bacteria 2449
131 Ga0070695_100097671 3300005545 Bacteria 1972
132 Ga0070695_100151682 3300005545 Unclassified 1618
133 Ga0070695_100662906 3300005545 Bacteria 825
134 Ga0070695_100678394 3300005545 Bacteria 816
135 Ga0070696_100003044 3300005546 Bacteria 11138
136 Ga0070696_100007503 3300005546 Bacteria 7296
137 Ga0070696_100071908 3300005546 Bacteria 2435
138 Ga0070696_100083140 3300005546 Bacteria 2270
139 Ga0070696_100181329 3300005546 Unclassified 1562
140 Ga0070696_100355522 3300005546 Bacteria 1135
141 Ga0070696_100410052 3300005546 Unclassified 1062
142 Ga0070696_100565417 3300005546 Unclassified 913
143 Ga0070696_101154530 3300005546 Unclassified 653
144 Ga0070693_100030068 3300005547 Bacteria 2967
145 Ga0070693_100115573 3300005547 Unclassified 1657
146 Ga0070693_100144158 3300005547 Bacteria 1502
147 Ga0070693_100279272 3300005547 Bacteria 1118
148 Ga0070693_100465503 3300005547 Bacteria 890
149 Ga0070665_101396693 3300005548 Bacteria 709
150 Ga0070704_100001415 3300005549 Bacteria 12797
151 Ga0070704_100003271 3300005549 Bacteria 9259
152 Ga0070704_100008163 3300005549 Bacteria 6263
153 Ga0070704_100152996 3300005549 Unclassified 1816
154 Ga0070704_100243771 3300005549 Bacteria 1472
155 Ga0070704_100477051 3300005549 Bacteria 1079
156 Ga0070704_100536038 3300005549 Bacteria 1021
157 Ga0070704_100616783 3300005549 Bacteria 955
158 Ga0070704_100660249 3300005549 Bacteria 924
159 Ga0068855_100053051 3300005563 Bacteria 4771
160 Ga0068855_100213198 3300005563 Bacteria 2169
161 Ga0070664_100420499 3300005564 Bacteria 1224
162 Ga0068857_100007353 3300005577 Bacteria 9482
163 Ga0068857_100056140 3300005577 Bacteria 3495
164 Ga0068857_100619314 3300005577 Bacteria 1024
165 Ga0068854_100003215 3300005578 Bacteria 10192
166 Ga0068856_100096496 3300005614 Bacteria 2945
167 Ga0068856_100126582 3300005614 Bacteria 2558
168 Ga0068856_100178994 3300005614 Bacteria 2133
169 Ga0068856_100548521 3300005614 Bacteria 1177
170 Ga0070702_100003136 3300005615 Bacteria 7325
171 Ga0070702_100014801 3300005615 Bacteria 3967
172 Ga0070702_100223864 3300005615 Bacteria 1260
173 Ga0070702_100277120 3300005615 Bacteria 1150
174 Ga0068852_100134170 3300005616 Bacteria 2284
175 Ga0068859_100040783 3300005617 Bacteria 4662
176 Ga0068859_100073919 3300005617 Bacteria 3447
177 Ga0068859_100076303 3300005617 Bacteria 3392
178 Ga0068859_100814856 3300005617 Unclassified 1021
179 Ga0068864_100030981 3300005618 Bacteria 4536
180 Ga0068864_100082692 3300005618 Bacteria 2818
181 Ga0068864_100303727 3300005618 Bacteria 1495
182 Ga0068866_10002432 3300005718 Bacteria 7684
183 Ga0068866_10007632 3300005718 Bacteria 4534
184 Ga0068866_10055570 3300005718 Unclassified 2034
185 Ga0068861_100001299 3300005719 Bacteria 15627
186 Ga0068861_100013261 3300005719 Bacteria 5767
187 Ga0068861_100364699 3300005719 Bacteria 1271
188 Ga0068861_100375975 3300005719 Bacteria 1254
189 Ga0068861_100949665 3300005719 Unclassified 818
190 Ga0068861_100966944 3300005719 Unclassified 811
191 Ga0068870_10019003 3300005840 Bacteria 3327
192 Ga0068863_100247449 3300005841 Bacteria 1721
193 Ga0068858_100011781 3300005842 Bacteria 8249
194 Ga0068858_100035118 3300005842 Bacteria 4650
195 Ga0068858_100136730 3300005842 Bacteria 2299
196 Ga0068858_100379235 3300005842 Bacteria 1357
197 Ga0068858_101080720 3300005842 Bacteria 787
198 Ga0068860_100040479 3300005843 Bacteria 4453
199 Ga0068860_100049251 3300005843 Bacteria 4013
200 Ga0068860_100165741 3300005843 Bacteria 2133
201 Ga0068860_100183967 3300005843 Bacteria 2020
202 Ga0068860_100347596 3300005843 Bacteria 1459
203 Ga0068862_100002444 3300005844 Bacteria 16490
204 Ga0068862_100005336 3300005844 Bacteria 10766
205 Ga0068862_100041133 3300005844 Bacteria 3932
206 Ga0068862_100071645 3300005844 Bacteria 2992
207 Ga0068862_100250993 3300005844 Bacteria 1612
208 Ga0068862_100283152 3300005844 Bacteria 1520
209 Ga0068862_101175879 3300005844 Bacteria 765
210 Ga0068862_101186450 3300005844 Bacteria 761
211 Ga0081539_10000842 3300005985 Bacteria 58746
212 Ga0070717_10749087 3300006028 Bacteria 888
213 Ga0070716_100004507 3300006173 Bacteria 6668
214 Ga0075366_10219168 3300006195 Unclassified 1159
215 Ga0097621_100008740 3300006237 Bacteria 7317
216 Ga0097621_100056029 3300006237 Bacteria 3220
217 Ga0097621_100218593 3300006237 Bacteria 1659
218 Ga0097621_101175211 3300006237 Unclassified 722
219 Ga0097621_101255051 3300006237 Unclassified 699
220 Ga0068871_100008932 3300006358 Bacteria 7231
221 Ga0068871_100014795 3300006358 Bacteria 5826
222 Ga0068871_100017615 3300006358 Bacteria 5410
223 Ga0075428_100008533 3300006844 Bacteria 11367
224 Ga0075428_100017325 3300006844 Bacteria 7961
225 Ga0075428_100027994 3300006844 Bacteria 6235
226 Ga0075428_100099471 3300006844 Bacteria 3171
227 Ga0075428_100175066 3300006844 Bacteria 2324
228 Ga0075430_100003868 3300006846 Bacteria 12611
229 Ga0075430_100022846 3300006846 Bacteria 5319
230 Ga0075430_100025385 3300006846 Bacteria 5041
231 Ga0075430_100272277 3300006846 Unclassified 1401
232 Ga0075430_100798627 3300006846 Bacteria 778
233 Ga0075431_100012828 3300006847 Bacteria 8459
234 Ga0075431_100227291 3300006847 Bacteria 1902
235 Ga0075431_100295201 3300006847 Bacteria 1638
236 Ga0075433_10001178 3300006852 Bacteria 18995
237 Ga0075434_100000073 3300006871 Bacteria 52987
238 Ga0075434_100001217 3300006871 Bacteria 21379
239 Ga0075434_100036600 3300006871 Bacteria 4855
240 Ga0075434_100638907 3300006871 Bacteria 1083
241 Ga0075434_101294397 3300006871 Unclassified 740
242 Ga0075434_101492886 3300006871 Bacteria 685
243 Ga0075429_100000832 3300006880 Bacteria 24219
244 Ga0075429_100005024 3300006880 Bacteria 11389
245 Ga0075429_100173918 3300006880 Bacteria 1886
246 Ga0075429_100178209 3300006880 Bacteria 1862
247 Ga0075429_101226563 3300006880 Unclassified 654
248 Ga0068865_100002425 3300006881 Bacteria 11015
249 Ga0068865_100002861 3300006881 Bacteria 10282
250 Ga0068865_100008105 3300006881 Bacteria 6483
251 Ga0068865_101028399 3300006881 Unclassified 722
252 Ga0068865_101889057 3300006881 Bacteria 541
253 Ga0075436_100000205 3300006914 Bacteria 36621
254 Ga0075436_100003082 3300006914 Bacteria 11419
255 Ga0075436_100013578 3300006914 Bacteria 5578
256 Ga0075436_100090711 3300006914 Bacteria 2125
257 Ga0075436_100300374 3300006914 Unclassified 1151
258 Ga0075436_100375168 3300006914 Unclassified 1028
259 Ga0097620_100040783 3300006931 Bacteria 4662
260 Ga0097620_100073916 3300006931 Bacteria 3447
261 Ga0097620_100076300 3300006931 Bacteria 3392
262 Ga0097620_100814887 3300006931 Unclassified 1021
263 Ga0075435_100000549 3300007076 Bacteria 23038
264 Ga0075435_100031439 3300007076 Bacteria 4182
265 Ga0075435_100081861 3300007076 Bacteria 2652
266 Ga0075435_100160136 3300007076 Unclassified 1895
267 Ga0075435_100630813 3300007076 Bacteria 930
268 Ga0099794_10018805 3300007265 Bacteria 3102
269 Ga0099794_10026051 3300007265 Bacteria 2700
270 Ga0099794_10097540 3300007265 Bacteria 1464
271 Ga0099794_10165686 3300007265 Bacteria 1125
272 Ga0099794_10249705 3300007265 Bacteria 915
273 Ga0099794_10291906 3300007265 Unclassified 844
274 Ga0099794_10544055 3300007265 Bacteria 613
275 Ga0099795_10330843 3300007788 Bacteria 677
276 Ga0099795_10636159 3300007788 Unclassified 510
277 Ga0105250_10055044 3300009092 Unclassified 1596
278 Ga0105240_10584684 3300009093 Bacteria 1231
279 Ga0111539_10023101 3300009094 Bacteria 7638
280 Ga0111539_10046142 3300009094 Bacteria 5214
281 Ga0111539_10047339 3300009094 Bacteria 5139
282 Ga0111539_10047790 3300009094 Bacteria 5113
283 Ga0111539_10087485 3300009094 Bacteria 3660
284 Ga0111539_10554603 3300009094 Bacteria 1338
285 Ga0111539_10592557 3300009094 Bacteria 1291
286 Ga0105245_10000259 3300009098 Bacteria 50388
287 Ga0105245_10002540 3300009098 Bacteria 16450
288 Ga0105245_10020740 3300009098 Bacteria 5761
289 Ga0105245_10060315 3300009098 Bacteria 3416
290 Ga0105247_10111952 3300009101 Bacteria 1758
291 Ga0114129_10002896 3300009147 Bacteria 24008
292 Ga0114129_10184031 3300009147 Bacteria 2841
293 Ga0114129_10332533 3300009147 Bacteria 2017
294 Ga0114129_10384053 3300009147 Bacteria 1854
295 Ga0114129_10729544 3300009147 Bacteria 1270
296 Ga0114129_12479601 3300009147 Unclassified 620
297 Ga0114129_12650695 3300009147 Unclassified 598
298 Ga0105243_10015069 3300009148 Bacteria 5851
299 Ga0105243_10015877 3300009148 Bacteria 5695
300 Ga0105243_10109524 3300009148 Bacteria 2307
301 Ga0105243_10218457 3300009148 Bacteria 1683
302 Ga0105243_10248657 3300009148 Bacteria 1586
303 Ga0105243_10274551 3300009148 Bacteria 1515
304 Ga0105242_10013543 3300009176 Bacteria 6308
305 Ga0105242_10017789 3300009176 Bacteria 5546
306 Ga0105242_10040775 3300009176 Bacteria 3741
307 Ga0105242_10303439 3300009176 Unclassified 1458
308 Ga0105242_10429485 3300009176 Bacteria 1240
309 Ga0105248_10008114 3300009177 Bacteria 11527
310 Ga0105248_10264831 3300009177 Unclassified 1935
311 Ga0105248_10569339 3300009177 Bacteria 1278
312 Ga0105237_10017011 3300009545 Bacteria 7548
313 Ga0105238_11454569 3300009551 Unclassified 713
314 Ga0105249_10008790 3300009553 Bacteria 8815
315 Ga0105249_10045036 3300009553 Bacteria 4012
316 Ga0105249_10065108 3300009553 Bacteria 3352
317 Ga0105239_10086505 3300010375 Bacteria 3455
318 Ga0105239_10299239 3300010375 Bacteria 1812
319 Ga0105246_10182074 3300011119 Unclassified 1619
320 Ga0157335_1019794 3300012492 Bacteria 630
321 Ga0157369_10364019 3300013105 Bacteria 1501
322 Ga0157369_10693125 3300013105 Bacteria 1049
323 Ga0157374_10019265 3300013296 Bacteria 6037
324 Ga0157374_12134839 3300013296 Unclassified 587
325 Ga0157378_10011016 3300013297 Bacteria 7913
326 Ga0157378_10016132 3300013297 Bacteria 6541
327 Ga0163162_10223351 3300013306 Bacteria 2013
328 Ga0163162_10497852 3300013306 Unclassified 1349
329 Ga0163162_10645161 3300013306 Bacteria 1183
330 Ga0163162_11086676 3300013306 Unclassified 906
331 Ga0157372_10634216 3300013307 Bacteria 1245
332 Ga0157372_11226250 3300013307 Bacteria 866
333 Ga0157375_10018987 3300013308 Bacteria 6241
334 Ga0157375_10358208 3300013308 Bacteria 1625
335 Ga0157375_12059655 3300013308 Bacteria 679
336 Ga0163163_10228692 3300014325 Bacteria 1909
337 Ga0157380_10007220 3300014326 Bacteria 7876
338 Ga0157380_10013330 3300014326 Bacteria 5991
339 Ga0157380_10076719 3300014326 Bacteria 2721
340 Ga0157380_10527773 3300014326 Unclassified 1153
341 Ga0157380_11289430 3300014326 Bacteria 777
342 Ga0157377_10151669 3300014745 Bacteria 1433
343 Ga0157377_10333343 3300014745 Bacteria 1012
344 Ga0157379_10064557 3300014968 Bacteria 3272
345 Ga0157379_10089627 3300014968 Unclassified 2759
346 Ga0157379_10305578 3300014968 Bacteria 1450
347 Ga0157379_11282928 3300014968 Unclassified 707
348 Ga0157376_10004961 3300014969 Bacteria 9280
349 Ga0157376_10057987 3300014969 Bacteria 3242
350 Ga0157376_10178381 3300014969 Bacteria 1940
351 Ga0163161_10420652 3300017792 Bacteria 1075
352 Ga0163161_11074484 3300017792 Bacteria 690
353 Ga0206356_10307192 3300020070 Bacteria 746
354 Ga0207653_10086539 3300025885 Bacteria 1092
355 Ga0207682_10413005 3300025893 Bacteria 638
356 Ga0207692_10323593 3300025898 Bacteria 944
357 Ga0207642_10002932 3300025899 Bacteria 5339
358 Ga0207642_10513112 3300025899 Bacteria 735
359 Ga0207688_10154686 3300025901 Bacteria 1357
360 Ga0207680_10184209 3300025903 Bacteria 1414
361 Ga0207699_10188451 3300025906 Bacteria 1391
362 Ga0207645_10049368 3300025907 Bacteria 2687
363 Ga0207643_10013945 3300025908 Bacteria 4360
364 Ga0207643_10147708 3300025908 Bacteria 1407
365 Ga0207684_10552861 3300025910 Bacteria 985
366 Ga0207707_10110099 3300025912 Bacteria 2407
367 Ga0207695_10569337 3300025913 Bacteria 1014
368 Ga0207671_10015443 3300025914 Bacteria 5977
369 Ga0207663_10463019 3300025916 Unclassified 979
370 Ga0207660_10023363 3300025917 Bacteria 4175
371 Ga0207660_10062248 3300025917 Bacteria 2688
372 Ga0207660_10106839 3300025917 Bacteria 2099
373 Ga0207660_10425681 3300025917 Unclassified 1071
374 Ga0207660_10956936 3300025917 Unclassified 699
375 Ga0207662_10000106 3300025918 Bacteria 40137
376 Ga0207662_10060345 3300025918 Bacteria 2274
377 Ga0207662_10151910 3300025918 Bacteria 1473
378 Ga0207662_10183190 3300025918 Bacteria 1348
379 Ga0207662_11171181 3300025918 Unclassified 546
380 Ga0207657_10312236 3300025919 Bacteria 1244
381 Ga0207652_10009867 3300025921 Bacteria 7683
382 Ga0207652_10100884 3300025921 Bacteria 2548
383 Ga0207646_10677968 3300025922 Bacteria 922
384 Ga0207646_11103108 3300025922 Unclassified 698
385 Ga0207681_10005713 3300025923 Bacteria 7633
386 Ga0207650_10615567 3300025925 Bacteria 914
387 Ga0207659_10073547 3300025926 Bacteria 2502
388 Ga0207687_10012762 3300025927 Bacteria 5489
389 Ga0207687_10030722 3300025927 Bacteria 3624
390 Ga0207687_10593501 3300025927 Bacteria 933
391 Ga0207686_10003108 3300025934 Bacteria 8937
392 Ga0207686_10007420 3300025934 Bacteria 5902
393 Ga0207686_10049528 3300025934 Bacteria 2608
394 Ga0207686_10256560 3300025934 Bacteria 1280
395 Ga0207709_10001408 3300025935 Bacteria 16830
396 Ga0207709_10020832 3300025935 Bacteria 3704
397 Ga0207709_10039097 3300025935 Bacteria 2831
398 Ga0207709_10161383 3300025935 Bacteria 1563
399 Ga0207670_10034330 3300025936 Bacteria 3277
400 Ga0207670_10051331 3300025936 Bacteria 2768
401 Ga0207670_10071657 3300025936 Unclassified 2397
402 Ga0207670_10110229 3300025936 Bacteria 1982
403 Ga0207670_10151278 3300025936 Bacteria 1722
404 Ga0207670_10299993 3300025936 Bacteria 1258
405 Ga0207670_10326630 3300025936 Bacteria 1208
406 Ga0207669_10029230 3300025937 Bacteria 3045
407 Ga0207669_10373198 3300025937 Unclassified 1109
408 Ga0207669_10793512 3300025937 Unclassified 785
409 Ga0207704_10009742 3300025938 Bacteria 4652
410 Ga0207704_10068056 3300025938 Bacteria 2243
411 Ga0207704_10127713 3300025938 Bacteria 1754
412 Ga0207704_10169081 3300025938 Bacteria 1565
413 Ga0207704_11338728 3300025938 Unclassified 613
414 Ga0207665_10007173 3300025939 Bacteria 7374
415 Ga0207665_10186263 3300025939 Unclassified 1506
416 Ga0207665_10873472 3300025939 Unclassified 713
417 Ga0207691_10057731 3300025940 Bacteria 3531
418 Ga0207711_10264947 3300025941 Bacteria 1580
419 Ga0207711_10526631 3300025941 Unclassified 1102
420 Ga0207689_10000376 3300025942 Bacteria 41990
421 Ga0207689_10000558 3300025942 Bacteria 35566
422 Ga0207689_10003070 3300025942 Bacteria 15386
423 Ga0207689_10026651 3300025942 Bacteria 4841
424 Ga0207689_10620262 3300025942 Bacteria 910
425 Ga0207661_10524678 3300025944 Bacteria 1083
426 Ga0207667_10070136 3300025949 Bacteria 3648
427 Ga0207667_10212080 3300025949 Bacteria 1985
428 Ga0207651_10214407 3300025960 Bacteria 1552
429 Ga0207651_10250357 3300025960 Bacteria 1449
430 Ga0207651_10279266 3300025960 Bacteria 1379
431 Ga0207651_10550239 3300025960 Bacteria 1003
432 Ga0207651_10836294 3300025960 Bacteria 817
433 Ga0207712_10007303 3300025961 Bacteria 6971
434 Ga0207712_10212602 3300025961 Bacteria 1541
435 Ga0207668_10008880 3300025972 Bacteria 6011
436 Ga0207668_10580070 3300025972 Unclassified 975
437 Ga0207640_10006997 3300025981 Bacteria 6207
438 Ga0207658_10262765 3300025986 Bacteria 1472
439 Ga0207677_10003904 3300026023 Bacteria 7941
440 Ga0207677_10090834 3300026023 Bacteria 2220
441 Ga0207677_10399794 3300026023 Bacteria 1165
442 Ga0207677_10667672 3300026023 Bacteria 919
443 Ga0207677_10903151 3300026023 Unclassified 796
444 Ga0207703_10003689 3300026035 Bacteria 12755
445 Ga0207703_10193101 3300026035 Bacteria 1805
446 Ga0207703_10345043 3300026035 Bacteria 1369
447 Ga0207703_10402959 3300026035 Bacteria 1270
448 Ga0207703_11038591 3300026035 Bacteria 787
449 Ga0207639_10060156 3300026041 Bacteria 2930
450 Ga0207639_10167638 3300026041 Bacteria 1857
451 Ga0207708_10000362 3300026075 Bacteria 35576
452 Ga0207708_10007750 3300026075 Bacteria 7952
453 Ga0207708_10139805 3300026075 Unclassified 1898
454 Ga0207708_10310191 3300026075 Bacteria 1285
455 Ga0207708_10322349 3300026075 Bacteria 1261
456 Ga0207708_10464336 3300026075 Bacteria 1056
457 Ga0207708_10806333 3300026075 Archaea 808
458 Ga0207702_10098663 3300026078 Bacteria 2573
459 Ga0207702_10228910 3300026078 Bacteria 1736
460 Ga0207702_10508597 3300026078 Bacteria 1175
461 Ga0207641_10726389 3300026088 Bacteria 979
462 Ga0207648_10000159 3300026089 Bacteria 69221
463 Ga0207648_10008533 3300026089 Bacteria 9916
464 Ga0207648_10032928 3300026089 Bacteria 4573
465 Ga0207648_10057472 3300026089 Bacteria 3394
466 Ga0207648_10119846 3300026089 Bacteria 2313
467 Ga0207676_10024443 3300026095 Bacteria 4470
468 Ga0207676_10330655 3300026095 Bacteria 1402
469 Ga0207676_10627899 3300026095 Bacteria 1034
470 Ga0207674_10028098 3300026116 Bacteria 5941
471 Ga0207674_10138825 3300026116 Bacteria 2391
472 Ga0207674_10972161 3300026116 Bacteria 818
473 Ga0207675_100000068 3300026118 Bacteria 78105
474 Ga0207675_100004506 3300026118 Bacteria 13456
475 Ga0207675_100048496 3300026118 Bacteria 3964
476 Ga0207675_100083503 3300026118 Bacteria 2996
477 Ga0207675_100344164 3300026118 Bacteria 1460
478 Ga0207675_100438531 3300026118 Bacteria 1293
479 Ga0207675_101076762 3300026118 Unclassified 823
480 Ga0207675_101805859 3300026118 Bacteria 630
481 Ga0207683_10036881 3300026121 Bacteria 4257
482 Ga0207683_10151638 3300026121 Bacteria 2092
483 Ga0207683_10564800 3300026121 Unclassified 1052
484 Ga0207698_10105200 3300026142 Bacteria 2351
485 Ga0207698_11545225 3300026142 Bacteria 679
486 Ga0209969_1020779 3300027360 Bacteria 978
487 Ga0209967_1000884 3300027364 Bacteria 3844
488 Ga0209981_1000310 3300027378 Bacteria 6258
489 Ga0209981_1032075 3300027378 Unclassified 772
490 Ga0209996_1018334 3300027395 Bacteria 971
491 Ga0210000_1000624 3300027462 Bacteria 4851
492 Ga0209995_1003506 3300027471 Bacteria 2498
493 Ga0209995_1009839 3300027471 Bacteria 1549
494 Ga0209995_1053600 3300027471 Bacteria 685
495 Ga0209999_1002308 3300027543 Bacteria 3358
496 Ga0209999_1036195 3300027543 Bacteria 921
497 Ga0209983_1014604 3300027665 Bacteria 1618
498 Ga0209588_1000881 3300027671 Bacteria 7625
499 Ga0209588_1018434 3300027671 Bacteria 2173
500 Ga0209588_1125882 3300027671 Bacteria 818
501 Ga0209971_1057758 3300027682 Bacteria 939
502 Ga0209966_1015486 3300027695 Bacteria 1432
503 Ga0209974_10009659 3300027876 Unclassified 3272
504 Ga0209974_10220301 3300027876 Bacteria 706
505 Ga0207428_10012800 3300027907 Bacteria 7359
506 Ga0207428_10071945 3300027907 Bacteria 2715
507 Ga0207428_10072217 3300027907 Bacteria 2709
508 Ga0207428_10075323 3300027907 Bacteria 2645
509 Ga0207428_10088601 3300027907 Bacteria 2406
510 Ga0268266_10492219 3300028379 Bacteria 1170
511 Ga0268265_10021501 3300028380 Bacteria 4521
512 Ga0268265_10025442 3300028380 Bacteria 4201
513 Ga0268265_10029590 3300028380 Bacteria 3933
514 Ga0268265_10107368 3300028380 Bacteria 2270
515 Ga0268265_10257151 3300028380 Bacteria 1550
516 Ga0268265_10581844 3300028380 Bacteria 1067
517 Ga0268265_10815230 3300028380 Bacteria 911
518 Ga0268265_11150833 3300028380 Bacteria 772
519 Ga0268264_10032986 3300028381 Bacteria 4250
520 Ga0268264_10077192 3300028381 Bacteria 2836
521 Ga0268264_10279564 3300028381 Bacteria 1563
522 Ga0268264_10332921 3300028381 Bacteria 1439
523 Ga0268264_10539530 3300028381 Bacteria 1143
524 Ga0265327_10044317 3300031251 Bacteria 2373
525 Ga0307513_10481528 3300031456 Bacteria 961
526 Ga0307408_100091441 3300031548 Bacteria 2298
527 Ga0307408_100176698 3300031548 Bacteria 1709
528 Ga0307408_100196788 3300031548 Unclassified 1628
529 Ga0307408_101490570 3300031548 Bacteria 639
530 Ga0307408_101528249 3300031548 Bacteria 632
531 Ga0316575_10009403 3300031665 Bacteria 3580
532 Ga0316579_10053730 3300031691 Bacteria 1887
533 Ga0265342_10161351 3300031712 Bacteria 1239
534 Ga0316578_10018325 3300031728 Bacteria 3834
535 Ga0307412_10123067 3300031911 Unclassified 1871
536 Ga0307412_10276573 3300031911 Bacteria 1316
537 Ga0307412_10472482 3300031911 Bacteria 1038
538 Ga0307416_100066483 3300032002 Bacteria 2968
539 Ga0307416_100785157 3300032002 Bacteria 1047
540 Ga0307416_102946849 3300032002 Bacteria 569
541 Ga0307416_103419543 3300032002 Unclassified 531
542 Ga0307414_11950188 3300032004 Bacteria 548
543 Ga0307411_10381773 3300032005 Bacteria 1159
544 Ga0307411_10435842 3300032005 Bacteria 1092
545 Ga0316583_10033290 3300032133 Bacteria 1831
546 Ga0316593_10019918 3300032168 Bacteria 2078
547 Ga0373948_0068906 3300034817 Bacteria 790
548 Ga0373958_0015294 3300034819 Unclassified 1353
549 Ga0373958_0035460 3300034819 Bacteria 999
550 Ga0373959_0007907 3300034820 Bacteria 1796
551 Ga0373938_0027274 3300034957 Bacteria 1201
552 Ga0373926_0001421 3300035083 Bacteria 7277
553 Ga0373929_0037517 3300035085 Bacteria 1063
554 Ga0373934_0000927 3300035086 Bacteria 10606
555 Ga0373940_0000658 3300035088 Bacteria 5523
556 Ga0373944_0008050 3300035089 Bacteria 2841
557 Ga0373952_0006719 3300035092 Bacteria 2135
558 Ga0373952_0073225 3300035092 Bacteria 861
559 Ga0373923_0001061 3300035111 Bacteria 7527
560 Ga0373932_0002462 3300035112 Bacteria 4676
561 Ga0373936_0029074 3300035113 Bacteria 2174
562 Ga0373936_0058554 3300035113 Bacteria 1569
563 Ga0373936_0120651 3300035113 Bacteria 1120
564 Ga0373939_0015512 3300035114 Bacteria 1995
565 Ga0373939_0031855 3300035114 Unclassified 1528
566 Ga0373939_0101195 3300035114 Bacteria 989
567 Ga0373939_0386107 3300035114 Bacteria 577
568 Ga0373941_0004938 3300035115 Bacteria 3107
569 Ga0373941_0014498 3300035115 Unclassified 2107
570 Ga0373941_0267156 3300035115 Bacteria 673
571 Ga0373945_0000803 3300035116 Bacteria 9198
572 Ga0373953_0002557 3300035117 Bacteria 5499
573 Ga0373953_0007213 3300035117 Bacteria 3711
574 Ga0373953_0386110 3300035117 Bacteria 615
575 Ga0373954_0000025 3300035118 Bacteria 57365
576 Ga0373954_0002423 3300035118 Bacteria 7813
577 Ga0373954_0005281 3300035118 Bacteria 5580
578 Ga0373954_0297813 3300035118 Bacteria 795
579 Ga0373956_0001667 3300035119 Bacteria 9139
580 Ga0373956_0001841 3300035119 Bacteria 8746
581 Ga0373956_0180535 3300035119 Bacteria 998
582 Ga0373957_0042858 3300035120 Bacteria 1708
583 Ga0373957_0070108 3300035120 Bacteria 1369
584 Ga0373960_0045252 3300035121 Bacteria 1288
585 Ga0373960_0136965 3300035121 Unclassified 826
586 Ga0373943_0061504 3300035170 Bacteria 1877
587 Ga0373946_0028087 3300035171 Bacteria 2229
588 Ga0373955_0068382 3300035172 Bacteria 1979
589 Ga0373942_0002629 3300035207 Bacteria 4316
590 Ga0373942_0057096 3300035207 Unclassified 1109
591 Ga0373942_0220501 3300035207 Unclassified 635
592 Ga0373961_0017229 3300035241 Bacteria 1871
593 Ga0373961_0019706 3300035241 Unclassified 1775
594 Ga0373961_0243589 3300035241 Unclassified 648
595 Ga0373962_0002511 3300035242 Bacteria 4357
596 Ga0373962_0052671 3300035242 Bacteria 1176
597 Ga0316574_0014869 3300035398 Bacteria 4506
598 Ga0373924_0006450 3300035410 Bacteria 4204
599 Ga0373924_0017690 3300035410 Bacteria 2737
600 Ga0373924_0485178 3300035410 Bacteria 555
601 Ga0373931_0001493 3300035691 Bacteria 10064
602 Ga0373931_0006170 3300035691 Bacteria 5588
603 Ga0373931_0020035 3300035691 Bacteria 3344
604 Ga0373931_0021061 3300035691 Bacteria 3268
605 Ga0373931_0098259 3300035691 Bacteria 1643
606 Ga0373931_0308281 3300035691 Bacteria 980
607 Ga0373935_0003613 3300035692 Bacteria 9014
608 Ga0373935_0021405 3300035692 Bacteria 3958
609 Ga0373927_0004507 3300035695 Bacteria 9742
610 Ga0373927_0010306 3300035695 Bacteria 6242
611 Ga0373933_0006322 3300035724 Bacteria 6448
612 Ga0373933_0006503 3300035724 Bacteria 6363
613 Ga0373933_0081204 3300035724 Bacteria 1989
614 Ga0373933_0091707 3300035724 Bacteria 1875
615 Ga0373933_0492714 3300035724 Bacteria 803
616 Ga0373947_0019034 3300035725 Bacteria 3956
617 Ga0373937_0000296 3300036401 Bacteria 47231
618 Ga0373937_0001026 3300036401 Bacteria 23613
619 Ga0373937_0011656 3300036401 Bacteria 7715
620 Ga0373937_0070854 3300036401 Bacteria 3215
621 Ga0373937_0193158 3300036401 Bacteria 1913
622 Ga0373937_0200648 3300036401 Bacteria 1875
623 Ga0373937_0245262 3300036401 Bacteria 1688
624 Ga0316582_0025338 3300036647 Bacteria 3560
625 Ga0316584_0512087 3300036712 Unclassified 842
626 Ga0373925_0003111 3300037068 Bacteria 13025
627 Ga0373925_0112428 3300037068 Bacteria 2105
628 Ga0373925_0161900 3300037068 Bacteria 1763
629 Ga0436360_1341558 3300039438 Bacteria 1483
630 Ga0439439_0054435 3300041406 Bacteria 1054
631 Ga0439453_0011225 3300041408 Bacteria 1491
632 Ga0439461_0010851 3300041410 Bacteria 1680
633 Ga0439441_016169 3300042001 Bacteria 1328
634 Ga0439451_015271 3300042009 Unclassified 1548
635 Ga0439456_030254 3300042013 Unclassified 1158
636 Ga0439446_0040964 3300042156 Bacteria 1364
637 Ga0439446_0249041 3300042156 Bacteria 612
638 Ga0439434_0000699 3300042435 Bacteria 9669
639 Ga0439434_0044132 3300042435 Bacteria 1373
640 Ga0439435_0008199 3300042436 Bacteria 2418
641 Ga0439435_0022553 3300042436 Bacteria 1644
642 Ga0439435_0055943 3300042436 Unclassified 1139
643 Ga0439444_0000648 3300042437 Bacteria 4035
644 Ga0439444_0007155 3300042437 Bacteria 1706
645 Ga0439460_0025039 3300042461 Unclassified 1658
646 Ga0450916_029269 3300042530 Unclassified 795
647 Ga0451577_0121570 3300042876 Bacteria 2339
648 Ga0451577_0948371 3300042876 Bacteria 774
649 Ga0439440_0145382 3300042993 Bacteria 676
650 Ga0466965_0054544 3300044683 Bacteria 1988
651 Ga0466963_0454290 3300044694 Bacteria 904
652 Ga0466963_0513667 3300044694 Bacteria 846
653 Ga0451576_0005020 3300045051 Bacteria 16812
654 Ga0451576_0163334 3300045051 Bacteria 2324
655 Ga0451576_0191105 3300045051 Bacteria 2138
656 Ga0451576_0195488 3300045051 Bacteria 2112
657 Ga0451576_1312027 3300045051 Bacteria 754
658 Ga0451576_1344618 3300045051 Bacteria 744
659 Ga0451576_1460238 3300045051 Unclassified 711
660 Ga0451576_1516540 3300045051 Unclassified 696
661 Ga0466958_0882636 3300045836 Unclassified 583
662 Ga0466967_0061026 3300045976 Bacteria 3344
663 Ga0466967_1012436 3300045976 Bacteria 827
664 Ga0495592_0029053 3300046454 Bacteria 4185
665 Ga0495592_0048947 3300046454 Bacteria 3142
666 Ga0495592_0186893 3300046454 Bacteria 1407
667 Ga0495603_0002444 3300046455 Bacteria 10930
668 Ga0495603_0316054 3300046455 Unclassified 897
669 Ga0495629_0066799 3300046459 Bacteria 2510
670 Ga0495629_0202804 3300046459 Bacteria 1371
671 Ga0495641_0005144 3300046461 Bacteria 8951
672 Ga0495651_0001528 3300046462 Bacteria 17892
673 Ga0495651_0004190 3300046462 Bacteria 11042
674 Ga0495653_0009088 3300046463 Bacteria 8126
675 Ga0495653_0135641 3300046463 Bacteria 1736
676 Ga0495653_0441880 3300046463 Bacteria 820
677 Ga0495653_0743647 3300046463 Bacteria 593
678 Ga0495580_0017020 3300046472 Bacteria 5446
679 Ga0495580_0018844 3300046472 Bacteria 5134
680 Ga0495582_0006969 3300046473 Bacteria 6285
681 Ga0495639_0002185 3300046475 Bacteria 8617
682 Ga0495639_0057626 3300046475 Bacteria 1775
683 Ga0495662_0018325 3300046476 Bacteria 3388
684 Ga0495662_0079289 3300046476 Bacteria 1596
685 Ga0495664_0081074 3300046477 Bacteria 1945
686 Ga0495608_0003114 3300046511 Bacteria 11849
687 Ga0495608_0045756 3300046511 Bacteria 2914
688 Ga0495608_0134577 3300046511 Bacteria 1580
689 Ga0495618_0022879 3300046514 Bacteria 3861
690 Ga0495618_0052136 3300046514 Bacteria 2585
691 Ga0495628_0041512 3300046516 Bacteria 3672
692 Ga0495630_0000851 3300046517 Bacteria 21474
693 Ga0495630_0044464 3300046517 Bacteria 3319
694 Ga0495630_0450554 3300046517 Bacteria 986
695 Ga0495644_0199661 3300046523 Bacteria 771
696 Ga0495666_0045537 3300046526 Bacteria 2116
697 Ga0495666_0089060 3300046526 Bacteria 1457
698 Ga0495642_0062641 3300046528 Unclassified 1545
699 Ga0495652_0045337 3300046529 Bacteria 3781
700 Ga0495640_0028067 3300046533 Bacteria 4054
701 Ga0495640_0032932 3300046533 Bacteria 3687
702 Ga0495586_0002520 3300046535 Bacteria 9923
703 Ga0495586_0016097 3300046535 Bacteria 3978
704 Ga0495586_0118185 3300046535 Bacteria 1479
705 Ga0495586_0236938 3300046535 Bacteria 1039
706 Ga0495587_0003382 3300046536 Bacteria 10640
707 Ga0495587_0006598 3300046536 Bacteria 7555
708 Ga0495598_0254984 3300046537 Bacteria 651
709 Ga0495621_0051617 3300046539 Bacteria 1472
710 Ga0495621_0123686 3300046539 Bacteria 1002
711 Ga0495645_0037686 3300046543 Bacteria 3526
712 Ga0495622_0067906 3300046557 Unclassified 1647
713 Ga0495667_0047217 3300046559 Bacteria 2845
714 Ga0495667_0079452 3300046559 Bacteria 2132
715 Ga0495667_0228698 3300046559 Bacteria 1186
716 Ga0495667_0240601 3300046559 Bacteria 1153
717 Ga0495667_0373285 3300046559 Bacteria 900
718 Ga0495656_0046959 3300046615 Bacteria 1829
719 Ga0495634_0051715 3300046642 Bacteria 2756
720 Ga0495634_0161296 3300046642 Bacteria 1413
721 Ga0495635_0046410 3300046663 Bacteria 2997
722 Ga0495635_0310646 3300046663 Bacteria 1056
723 Ga0495657_0007456 3300046675 Bacteria 8452
724 Ga0495657_0065254 3300046675 Bacteria 2395
725 Ga0495657_0161532 3300046675 Bacteria 1386
726 Ga0495657_0645830 3300046675 Bacteria 610
727 Ga0495599_0007268 3300046678 Bacteria 6707
728 Ga0495599_0170148 3300046678 Bacteria 1345
729 Ga0495646_0532621 3300046680 Unclassified 601
730 Ga0495647_0000090 3300046681 Bacteria 22381
731 Ga0495647_0075647 3300046681 Bacteria 1356
732 Ga0495647_0086052 3300046681 Bacteria 1281
733 Ga0495658_0007437 3300046683 Bacteria 5420
734 Ga0495658_0119842 3300046683 Bacteria 1590
735 Ga0495658_0178340 3300046683 Bacteria 1317
736 Ga0495658_0936676 3300046683 Bacteria 553
737 Ga0495613_0412102 3300046689 Bacteria 920
738 Ga0495624_0056008 3300046690 Bacteria 2482
739 Ga0495624_0197977 3300046690 Bacteria 1221
740 Ga0495600_0020078 3300046809 Bacteria 4273
741 Ga0495600_0020363 3300046809 Bacteria 4243
742 Ga0495581_0073293 3300047315 Bacteria 1981
743 Ga0495581_0074892 3300047315 Unclassified 1959
744 Ga0495581_0667494 3300047315 Bacteria 600
745 Ga0495581_0829037 3300047315 Unclassified 530
746 Ga0495604_0012460 3300047317 Bacteria 6763
747 Ga0495604_0023283 3300047317 Bacteria 4940
748 Ga0495604_0093029 3300047317 Bacteria 2232
749 Ga0495604_0454785 3300047317 Bacteria 836
750 Ga0495674_0005814 3300047319 Bacteria 11827
751 Ga0495674_0611190 3300047319 Bacteria 863
752 Ga0495672_0372644 3300047320 Bacteria 658
753 Ga0495676_0016777 3300047321 Bacteria 6487
754 Ga0495680_0001252 3300047322 Bacteria 27832
755 Ga0495680_0075253 3300047322 Bacteria 2562
756 Ga0495680_0082697 3300047322 Bacteria 2422
757 Ga0495680_0177271 3300047322 Bacteria 1540
758 Ga0495680_0624314 3300047322 Bacteria 719
759 Ga0495675_0007174 3300047444 Bacteria 6863
760 Ga0495675_0071825 3300047444 Bacteria 2184
761 Ga0495677_0074775 3300047445 Unclassified 1265
762 Ga0495684_0016574 3300047471 Bacteria 5676
763 Ga0495684_0193600 3300047471 Bacteria 1502
764 Ga0495684_0481307 3300047471 Bacteria 857
765 Ga0501292_044861 3300049515 Bacteria 771
766 Ga0501292_063105 3300049515 Bacteria 676
767 Ga0501298_022598 3300049521 Unclassified 1186
768 Ga0501299_144231 3300049522 Bacteria 595
769 Ga0501031_0011710 3300049568 Bacteria 5720
770 Ga0501031_0846665 3300049568 Unclassified 586
771 Ga0501031_0952817 3300049568 Unclassified 549
772 Ga0501032_0015532 3300049569 Bacteria 5370
773 Ga0501032_0177298 3300049569 Bacteria 1396
774 Ga0501033_0006483 3300049570 Bacteria 9157
775 Ga0501033_0335109 3300049570 Bacteria 1061
776 Ga0501033_0539639 3300049570 Bacteria 804
777 Ga0501034_0000581 3300049571 Bacteria 57797
778 Ga0501034_0050375 3300049571 Bacteria 4200
779 Ga0501036_0001252 3300049572 Bacteria 19463
780 Ga0501036_0056260 3300049572 Bacteria 3333
781 Ga0501036_0059286 3300049572 Bacteria 3244
782 Ga0501036_0216282 3300049572 Bacteria 1610
783 Ga0501037_0042207 3300049573 Bacteria 3353
784 Ga0501038_0001280 3300049574 Bacteria 22839
785 Ga0501038_0128702 3300049574 Bacteria 2081
786 Ga0501038_1192944 3300049574 Unclassified 553
787 Ga0501039_0011180 3300049575 Bacteria 6839
788 Ga0501039_0152376 3300049575 Bacteria 1816
789 Ga0501039_0600088 3300049575 Bacteria 863
790 Ga0501040_0000052 3300049576 Bacteria 54195
791 Ga0501040_0078654 3300049576 Bacteria 2282
792 Ga0501041_0004912 3300049577 Bacteria 7767
793 Ga0501041_0090832 3300049577 Bacteria 1885
794 Ga0501041_0110569 3300049577 Bacteria 1705
795 Ga0501041_0129865 3300049577 Bacteria 1569
796 Ga0501042_0013259 3300049578 Bacteria 5610
797 Ga0501042_0074219 3300049578 Bacteria 2434
798 Ga0501042_0115127 3300049578 Bacteria 1936
799 Ga0501043_0015925 3300049579 Bacteria 5893
800 Ga0501046_0000271 3300049580 Bacteria 52841
801 Ga0501046_1072446 3300049580 Bacteria 557
802 Ga0501047_0376999 3300049581 Bacteria 1253
803 Ga0501048_0001409 3300049582 Bacteria 18204
804 Ga0501048_0022699 3300049582 Bacteria 4587
805 Ga0501048_0349719 3300049582 Bacteria 1054
806 Ga0501048_0677235 3300049582 Bacteria 741
807 Ga0501067_0445794 3300049583 Unclassified 723
808 Ga0501068_0001232 3300049584 Bacteria 13570
809 Ga0501068_0030228 3300049584 Bacteria 3212
810 Ga0501068_0297858 3300049584 Bacteria 1032
811 Ga0501069_0276048 3300049585 Unclassified 983
812 Ga0501070_0100907 3300049586 Bacteria 2387
813 Ga0501071_0033617 3300049587 Bacteria 3643
814 Ga0501071_0307458 3300049587 Bacteria 1202
815 Ga0501071_0876686 3300049587 Bacteria 692
816 Ga0501072_0003349 3300049588 Bacteria 12056
817 Ga0501072_0108153 3300049588 Bacteria 2212
818 Ga0501072_1148486 3300049588 Bacteria 604
819 Ga0501073_0005893 3300049589 Bacteria 9144
820 Ga0501073_0304378 3300049589 Bacteria 1100
821 Ga0501074_0074479 3300049590 Bacteria 2438
822 Ga0501074_0185266 3300049590 Bacteria 1484
823 Ga0501075_0000751 3300049591 Bacteria 20223
824 Ga0501075_0001243 3300049591 Bacteria 16533
825 Ga0501075_0083266 3300049591 Bacteria 2423
826 Ga0501075_0254676 3300049591 Bacteria 1338
827 Ga0501075_0270924 3300049591 Bacteria 1294
828 Ga0501076_0000290 3300049592 Bacteria 31327
829 Ga0501076_0006671 3300049592 Bacteria 8374
830 Ga0501076_0526727 3300049592 Bacteria 974
831 Ga0501077_0008144 3300049593 Bacteria 6479
832 Ga0501077_0024729 3300049593 Bacteria 3813
833 Ga0501198_021510 3300049649 Unclassified 1029
834 Ga0501233_017091 3300049668 Bacteria 1512
835 Ga0501079_0000061 3300049741 Bacteria 48925
836 Ga0501079_0097776 3300049741 Bacteria 2275
837 Ga0501079_0204890 3300049741 Bacteria 1541
838 Ga0501079_0207768 3300049741 Bacteria 1529
839 Ga0501080_0000712 3300049742 Bacteria 26727
840 Ga0501080_0022971 3300049742 Bacteria 5783
841 Ga0501080_0096381 3300049742 Bacteria 2746
842 Ga0501080_0101151 3300049742 Bacteria 2674
843 Ga0501080_0587171 3300049742 Bacteria 990
844 Ga0501081_0000110 3300049743 Bacteria 34989
845 Ga0501081_0056555 3300049743 Bacteria 2711
846 Ga0501081_0082284 3300049743 Bacteria 2255
847 Ga0501083_0060813 3300049744 Bacteria 2523
848 Ga0501083_0100203 3300049744 Bacteria 1910
849 Ga0501083_0108208 3300049744 Bacteria 1829
850 Ga0501083_0130681 3300049744 Bacteria 1646
851 Ga0501279_019506 3300049775 Unclassified 960
852 Ga0501283_070470 3300049779 Unclassified 643
853 Ga0501035_0073483 3300049822 Bacteria 3025
854 Ga0501044_0072036 3300049823 Bacteria 3514
855 Ga0501045_0002891 3300049824 Bacteria 11734
856 Ga0501045_1104412 3300049824 Bacteria 580
857 nmdc:mga05p37_21952_c1 3300050507 Bacteria 7734
858 nmdc:mga05p37_471014_c1 3300050507 Bacteria 1449
859 nmdc:mga05p37_485301_c1 3300050507 Bacteria 1422
860 nmdc:mga05p37_78_c1 3300050507 Bacteria 85760
861 nmdc:mga09592_10611_c1 3300050508 Bacteria 7502
862 nmdc:mga09592_119266_c1 3300050508 Bacteria 2265
863 nmdc:mga09592_248719_c1 3300050508 Bacteria 1541
864 nmdc:mga09592_264_c1 3300050508 Bacteria 38183
865 nmdc:mga09592_414027_c1 3300050508 Bacteria 1165
866 nmdc:mga0qj67_201156_c1 3300050509 Unclassified 1619
867 nmdc:mga0qj67_222839_c1 3300050509 Bacteria 1531
868 nmdc:mga0qj67_237804_c1 3300050509 Bacteria 1478
869 nmdc:mga0qj67_52391_c1 3300050509 Bacteria 3230
870 nmdc:mga0qj67_915119_c1 3300050509 Bacteria 691
871 nmdc:mga06r32_1282979_c1 3300050510 Bacteria 677
872 nmdc:mga06r32_5387_c2 3300050510 Bacteria 8395
873 nmdc:mga06r32_87082_c1 3300050510 Bacteria 3047
874 nmdc:mga08y16_1062068_c1 3300050511 Bacteria 787
875 nmdc:mga08y16_107926_c1 3300050511 Bacteria 2898
876 nmdc:mga08y16_112219_c1 3300050511 Bacteria 2838
877 nmdc:mga08y16_138251_c1 3300050511 Bacteria 2533
878 nmdc:mga08y16_14672_c1 3300050511 Bacteria 8239
879 nmdc:mga08y16_15715_c1 3300050511 Bacteria 7962
880 nmdc:mga08y16_59668_c1 3300050511 Bacteria 3984
881 nmdc:mga08y16_731718_c1 3300050511 Unclassified 987
882 nmdc:mga0n895_12822_c1 3300050512 Bacteria 7531
883 nmdc:mga0n895_19782_c1 3300050512 Bacteria 6264
884 nmdc:mga0n895_26682_c1 3300050512 Bacteria 5476
885 nmdc:mga0n895_582_c1 3300050512 Bacteria 25135
886 nmdc:mga0n895_668203_c1 3300050512 Bacteria 1036
887 nmdc:mga0n895_909447_c1 3300050512 Unclassified 865
888 nmdc:mga0rr50_14639_c1 3300050513 Bacteria 5151
889 nmdc:mga0rr50_2806_c1 3300050513 Bacteria 9895
890 nmdc:mga0rr50_3216_c1 3300050513 Bacteria 9354
891 nmdc:mga0rr50_665660_c1 3300050513 Bacteria 888
892 nmdc:mga0rr50_836509_c1 3300050513 Bacteria 785
893 nmdc:mga08x19_103339_c1 3300050514 Bacteria 1893
894 nmdc:mga08x19_1308_c1 3300050514 Bacteria 15470
895 nmdc:mga08x19_167747_c1 3300050514 Bacteria 1494
896 nmdc:mga08x19_18933_c1 3300050514 Bacteria 4221
897 nmdc:mga08x19_219248_c1 3300050514 Bacteria 1307
898 nmdc:mga08x19_512384_c1 3300050514 Unclassified 847
899 nmdc:mga08x19_5960_c1 3300050514 Bacteria 7209
900 nmdc:mga08x19_695052_c1 3300050514 Bacteria 722
901 nmdc:mga08x19_70207_c1 3300050514 Bacteria 2282
902 nmdc:mga08x19_750869_c1 3300050514 Bacteria 693
903 nmdc:mga0a205_11407_c1 3300050515 Bacteria 8179
904 nmdc:mga0a205_1704_c1 3300050515 Bacteria 18985
905 nmdc:mga0a205_313976_c1 3300050515 Bacteria 1439
906 nmdc:mga0a205_344883_c1 3300050515 Bacteria 1357
907 nmdc:mga0a205_710166_c1 3300050515 Unclassified 855
908 Ga0495612_0069482 3300053078 Bacteria 1467
909 Ga0495595_0632316 3300053084 Bacteria 548
910 Ga0495619_0004389 3300053085 Bacteria 8995
911 Ga0500566_0344287 3300053094 Bacteria 685
912 Ga0501084_0001172 3300054114 Bacteria 20445
913 Ga0501084_0068968 3300054114 Bacteria 2960
914 Ga0501084_0069282 3300054114 Bacteria 2953
915 Ga0501084_0277148 3300054114 Bacteria 1416
916 Ga0501084_0362490 3300054114 Bacteria 1225
917 Ga0501084_0679131 3300054114 Bacteria 869
918 Ga0501084_1457848 3300054114 Unclassified 573
919 Ga0590075_162224 3300059424 Unclassified 590
920 Ga0590077_071846 3300059426 Bacteria 791
921 Ga0501082_0004197 3300060353 Bacteria 12591
922 Ga0501082_0026853 3300060353 Bacteria 4961
923 Ga0501082_0096614 3300060353 Bacteria 2554
924 Ga0501082_0120467 3300060353 Bacteria 2274
925 Ga0501082_0367260 3300060353 Bacteria 1255
926 Ga0501082_0717060 3300060353 Bacteria 875
927 Ga0530510_0000048 3300061734 Bacteria 56268
928 Ga0530510_0000186 3300061734 Bacteria 37940
929 Ga0530510_0191812 3300061734 Bacteria 1517
930 Ga0530510_0627618 3300061734 Unclassified 818
931 Ga0530510_0869249 3300061734 Bacteria 689

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049581 Ga0501047_0376999 Ga0501047_0376999_816_1241 139
2 3300049742 Ga0501080_0587171 Ga0501080_0587171_22_459 143
3 3300005345 Ga0070692_10340507 Ga0070692_103405072 145
4 3300005615 Ga0070702_100277120 Ga0070702_1002771201 145
5 3300031548 Ga0307408_100091441 Ga0307408_1000914412 145
6 3300032002 Ga0307416_100066483 Ga0307416_1000664833 145
7 3300032168 Ga0316593_10019918 Ga0316593_100199182 145
8 3300035117 Ga0373953_0386110 Ga0373953_0386110_80_523 145
9 3300042001 Ga0439441_016169 Ga0439441_016169_861_1304 145
10 3300046454 Ga0495592_0186893 Ga0495592_0186893_936_1379 145
11 3300046459 Ga0495629_0202804 Ga0495629_0202804_83_526 145
12 3300046517 Ga0495630_0044464 Ga0495630_0044464_41_484 145
13 3300046533 Ga0495640_0032932 Ga0495640_0032932_1352_1795 145
14 3300046675 Ga0495657_0645830 Ga0495657_0645830_74_517 145
15 3300046680 Ga0495646_0532621 Ga0495646_0532621_41_484 145
16 3300046683 Ga0495658_0178340 Ga0495658_0178340_10_453 145
17 3300046690 Ga0495624_0056008 Ga0495624_0056008_1479_1922 145
18 3300047315 Ga0495581_0829037 Ga0495581_0829037_17_460 145
19 3300047317 Ga0495604_0093029 Ga0495604_0093029_706_1149 145
20 3300050514 nmdc:mga08x19_219248_c1 nmdc:mga08x19_219248_c1_12_455 145
21 3300046539 Ga0495621_0051617 Ga0495621_0051617_981_1442 146
22 3300046559 Ga0495667_0240601 Ga0495667_0240601_13_456 146
23 3300049582 Ga0501048_0349719 Ga0501048_0349719_14_457 146
24 3300054114 Ga0501084_0679131 Ga0501084_0679131_408_851 146
25 3300007076 Ga0075435_100031439 Ga0075435_1000314394 148
26 3300031251 Ga0265327_10044317 Ga0265327_100443172 148
27 3300031712 Ga0265342_10161351 Ga0265342_101613512 148
28 3300050512 nmdc:mga0n895_909447_c1 nmdc:mga0n895_909447_c1_54_500 148
29 3300050513 nmdc:mga0rr50_14639_c1 nmdc:mga0rr50_14639_c1_1965_2411 148
30 3300005844 Ga0068862_101175879 Ga0068862_1011758792 149
31 3300028380 Ga0268265_10815230 Ga0268265_108152302 149
32 3300005336 Ga0070680_101036712 Ga0070680_1010367121 150
33 3300005341 Ga0070691_10800460 Ga0070691_108004601 150
34 3300005436 Ga0070713_100065706 Ga0070713_1000657063 150
35 3300005444 Ga0070694_100262057 Ga0070694_1002620572 150
36 3300005545 Ga0070695_100151682 Ga0070695_1001516822 150
37 3300005546 Ga0070696_100181329 Ga0070696_1001813292 150
38 3300005549 Ga0070704_100616783 Ga0070704_1006167832 150
39 3300005549 Ga0070704_100660249 Ga0070704_1006602492 150
40 3300006028 Ga0070717_10749087 Ga0070717_107490871 150
41 3300007788 Ga0099795_10636159 Ga0099795_106361591 150
42 3300026075 Ga0207708_10464336 Ga0207708_104643362 150
43 3300035118 Ga0373954_0000025 Ga0373954_0000025_5426_5914 150
44 3300035691 Ga0373931_0098259 Ga0373931_0098259_420_887 150
45 3300035724 Ga0373933_0081204 Ga0373933_0081204_178_666 150
46 3300036401 Ga0373937_0000296 Ga0373937_0000296_36449_36937 150
47 3300045051 Ga0451576_0163334 Ga0451576_0163334_1534_2001 150
48 3300046528 Ga0495642_0062641 Ga0495642_0062641_776_1255 150
49 3300046537 Ga0495598_0254984 Ga0495598_0254984_67_531 150
50 3300046559 Ga0495667_0228698 Ga0495667_0228698_335_823 150
51 3300047317 Ga0495604_0454785 Ga0495604_0454785_246_734 150
52 3300049568 Ga0501031_0846665 Ga0501031_0846665_42_506 150
53 3300050514 nmdc:mga08x19_70207_c1 nmdc:mga08x19_70207_c1_139_606 150
54 3300006195 Ga0075366_10219168 Ga0075366_102191682 152
55 3300025939 Ga0207665_10873472 Ga0207665_108734722 152
56 3300026118 Ga0207675_101805859 Ga0207675_1018058592 152
57 3300034819 Ga0373958_0035460 Ga0373958_0035460_49_507 152
58 3300037068 Ga0373925_0161900 Ga0373925_0161900_45_509 152
59 3300042530 Ga0450916_029269 Ga0450916_029269_21_485 152
60 3300044694 Ga0466963_0454290 Ga0466963_0454290_23_499 152
61 3300044694 Ga0466963_0513667 Ga0466963_0513667_169_669 152
62 3300045051 Ga0451576_1460238 Ga0451576_1460238_43_519 152
63 3300045836 Ga0466958_0882636 Ga0466958_0882636_60_536 152
64 3300045976 Ga0466967_1012436 Ga0466967_1012436_91_591 152
65 3300046523 Ga0495644_0199661 Ga0495644_0199661_212_685 152
66 3300049569 Ga0501032_0177298 Ga0501032_0177298_399_887 152
67 3300049571 Ga0501034_0000581 Ga0501034_0000581_9882_10472 152
68 3300049571 Ga0501034_0050375 Ga0501034_0050375_2913_3386 152
69 3300049580 Ga0501046_1072446 Ga0501046_1072446_67_531 152
70 3300049583 Ga0501067_0445794 Ga0501067_0445794_62_550 152
71 3300049584 Ga0501068_0001232 Ga0501068_0001232_7201_7689 152
72 3300049586 Ga0501070_0100907 Ga0501070_0100907_950_1438 152
73 3300049589 Ga0501073_0005893 Ga0501073_0005893_5237_5725 152
74 3300049589 Ga0501073_0304378 Ga0501073_0304378_53_517 152
75 3300049590 Ga0501074_0074479 Ga0501074_0074479_906_1376 152
76 3300049742 Ga0501080_0000712 Ga0501080_0000712_19318_19806 152
77 3300049744 Ga0501083_0060813 Ga0501083_0060813_875_1363 152
78 3300060353 Ga0501082_0367260 Ga0501082_0367260_17_484 152
79 3300005330 Ga0070690_100000906 Ga0070690_1000009067 153
80 3300005334 Ga0068869_100006074 Ga0068869_1000060745 153
81 3300005338 Ga0068868_100117065 Ga0068868_1001170652 153
82 3300005340 Ga0070689_100005385 Ga0070689_1000053859 153
83 3300005341 Ga0070691_10002837 Ga0070691_100028373 153
84 3300005438 Ga0070701_10096270 Ga0070701_100962701 153
85 3300005440 Ga0070705_100067286 Ga0070705_1000672862 153
86 3300005444 Ga0070694_100022323 Ga0070694_1000223233 153
87 3300005456 Ga0070678_100107548 Ga0070678_1001075483 153
88 3300005458 Ga0070681_10398303 Ga0070681_103983032 153
89 3300005459 Ga0068867_100009709 Ga0068867_1000097092 153
90 3300005536 Ga0070697_100296274 Ga0070697_1002962741 153
91 3300005544 Ga0070686_100000683 Ga0070686_1000006837 153
92 3300005545 Ga0070695_100017760 Ga0070695_1000177604 153
93 3300005546 Ga0070696_100355522 Ga0070696_1003555222 153
94 3300005547 Ga0070693_100115573 Ga0070693_1001155732 153
95 3300005548 Ga0070665_101396693 Ga0070665_1013966932 153
96 3300005549 Ga0070704_100152996 Ga0070704_1001529963 153
97 3300005614 Ga0068856_100548521 Ga0068856_1005485212 153
98 3300005615 Ga0070702_100003136 Ga0070702_1000031362 153
99 3300005718 Ga0068866_10002432 Ga0068866_100024322 153
100 3300005719 Ga0068861_100375975 Ga0068861_1003759751 153
101 3300005842 Ga0068858_100011781 Ga0068858_1000117811 153
102 3300005843 Ga0068860_100040479 Ga0068860_1000404793 153
103 3300005844 Ga0068862_100005336 Ga0068862_1000053366 153
104 3300006237 Ga0097621_100056029 Ga0097621_1000560293 153
105 3300006358 Ga0068871_100008932 Ga0068871_1000089323 153
106 3300006846 Ga0075430_100025385 Ga0075430_1000253855 153
107 3300006881 Ga0068865_100002425 Ga0068865_1000024255 153
108 3300007076 Ga0075435_100160136 Ga0075435_1001601362 153
109 3300009092 Ga0105250_10055044 Ga0105250_100550442 153
110 3300009098 Ga0105245_10002540 Ga0105245_100025408 153
111 3300009098 Ga0105245_10060315 Ga0105245_100603153 153
112 3300009148 Ga0105243_10015877 Ga0105243_100158772 153
113 3300009176 Ga0105242_10017789 Ga0105242_100177894 153
114 3300009177 Ga0105248_10264831 Ga0105248_102648313 153
115 3300009551 Ga0105238_11454569 Ga0105238_114545691 153
116 3300009553 Ga0105249_10045036 Ga0105249_100450363 153
117 3300013297 Ga0157378_10016132 Ga0157378_100161326 153
118 3300013306 Ga0163162_10645161 Ga0163162_106451611 153
119 3300013308 Ga0157375_10018987 Ga0157375_100189874 153
120 3300014326 Ga0157380_10007220 Ga0157380_100072204 153
121 3300014968 Ga0157379_10089627 Ga0157379_100896273 153
122 3300025917 Ga0207660_10106839 Ga0207660_101068393 153
123 3300025927 Ga0207687_10012762 Ga0207687_100127623 153
124 3300025927 Ga0207687_10593501 Ga0207687_105935011 153
125 3300025934 Ga0207686_10003108 Ga0207686_100031082 153
126 3300025935 Ga0207709_10020832 Ga0207709_100208322 153
127 3300025936 Ga0207670_10034330 Ga0207670_100343303 153
128 3300025937 Ga0207669_10373198 Ga0207669_103731981 153
129 3300025938 Ga0207704_10068056 Ga0207704_100680561 153
130 3300025942 Ga0207689_10000558 Ga0207689_100005583 153
131 3300025942 Ga0207689_10620262 Ga0207689_106202622 153
132 3300026023 Ga0207677_10903151 Ga0207677_109031512 153
133 3300026075 Ga0207708_10000362 Ga0207708_1000036218 153
134 3300026089 Ga0207648_10000159 Ga0207648_100001598 153
135 3300026118 Ga0207675_100000068 Ga0207675_10000006815 153
136 3300026121 Ga0207683_10036881 Ga0207683_100368815 153
137 3300028380 Ga0268265_10021501 Ga0268265_100215013 153
138 3300028381 Ga0268264_10077192 Ga0268264_100771923 153
139 3300035398 Ga0316574_0014869 Ga0316574_0014869_3827_4303 153
140 3300045976 Ga0466967_0061026 Ga0466967_0061026_2386_2862 153
141 3300049585 Ga0501069_0276048 Ga0501069_0276048_492_968 153
142 3300050512 nmdc:mga0n895_26682_c1 nmdc:mga0n895_26682_c1_3979_4455 153
143 3300050515 nmdc:mga0a205_11407_c1 nmdc:mga0a205_11407_c1_6328_6804 153
144 3300005295 Ga0065707_10009454 Ga0065707_100094543 154
145 3300005329 Ga0070683_100096140 Ga0070683_1000961403 154
146 3300005329 Ga0070683_100394875 Ga0070683_1003948751 154
147 3300005330 Ga0070690_100170184 Ga0070690_1001701842 154
148 3300005331 Ga0070670_101020046 Ga0070670_1010200461 154
149 3300005333 Ga0070677_10159944 Ga0070677_101599442 154
150 3300005334 Ga0068869_100025130 Ga0068869_1000251302 154
151 3300005334 Ga0068869_100305007 Ga0068869_1003050072 154
152 3300005336 Ga0070680_100195119 Ga0070680_1001951192 154
153 3300005336 Ga0070680_100329957 Ga0070680_1003299572 154
154 3300005338 Ga0068868_100164551 Ga0068868_1001645513 154
155 3300005338 Ga0068868_100613804 Ga0068868_1006138041 154
156 3300005340 Ga0070689_100092168 Ga0070689_1000921682 154
157 3300005340 Ga0070689_100680869 Ga0070689_1006808691 154
158 3300005341 Ga0070691_10246292 Ga0070691_102462922 154
159 3300005343 Ga0070687_100139265 Ga0070687_1001392652 154
160 3300005343 Ga0070687_100150179 Ga0070687_1001501792 154
161 3300005343 Ga0070687_100176990 Ga0070687_1001769902 154
162 3300005343 Ga0070687_100446006 Ga0070687_1004460062 154
163 3300005345 Ga0070692_10008357 Ga0070692_100083573 154
164 3300005345 Ga0070692_10288351 Ga0070692_102883512 154
165 3300005347 Ga0070668_100011505 Ga0070668_1000115053 154
166 3300005353 Ga0070669_100013917 Ga0070669_1000139173 154
167 3300005354 Ga0070675_100125120 Ga0070675_1001251203 154
168 3300005356 Ga0070674_100026595 Ga0070674_1000265952 154
169 3300005364 Ga0070673_100420163 Ga0070673_1004201632 154
170 3300005364 Ga0070673_100708229 Ga0070673_1007082292 154
171 3300005434 Ga0070709_10312919 Ga0070709_103129192 154
172 3300005434 Ga0070709_11314962 Ga0070709_113149621 154
173 3300005435 Ga0070714_100156934 Ga0070714_1001569342 154
174 3300005438 Ga0070701_10201137 Ga0070701_102011372 154
175 3300005439 Ga0070711_100347503 Ga0070711_1003475032 154
176 3300005440 Ga0070705_100027713 Ga0070705_1000277132 154
177 3300005440 Ga0070705_100212536 Ga0070705_1002125362 154
178 3300005440 Ga0070705_100336229 Ga0070705_1003362291 154
179 3300005440 Ga0070705_100530481 Ga0070705_1005304812 154
180 3300005441 Ga0070700_100011261 Ga0070700_1000112613 154
181 3300005441 Ga0070700_100988667 Ga0070700_1009886671 154
182 3300005441 Ga0070700_101102733 Ga0070700_1011027331 154
183 3300005444 Ga0070694_100005764 Ga0070694_1000057646 154
184 3300005444 Ga0070694_100012756 Ga0070694_1000127563 154
185 3300005444 Ga0070694_100033291 Ga0070694_1000332913 154
186 3300005444 Ga0070694_100052880 Ga0070694_1000528802 154
187 3300005444 Ga0070694_100056900 Ga0070694_1000569001 154
188 3300005444 Ga0070694_100241896 Ga0070694_1002418962 154
189 3300005444 Ga0070694_100275286 Ga0070694_1002752862 154
190 3300005444 Ga0070694_100389461 Ga0070694_1003894611 154
191 3300005458 Ga0070681_10000198 Ga0070681_1000019858 154
192 3300005458 Ga0070681_10277060 Ga0070681_102770602 154
193 3300005458 Ga0070681_10588537 Ga0070681_105885372 154
194 3300005459 Ga0068867_100011272 Ga0068867_1000112725 154
195 3300005459 Ga0068867_100136196 Ga0068867_1001361962 154
196 3300005466 Ga0070685_10290062 Ga0070685_102900622 154
197 3300005467 Ga0070706_100448434 Ga0070706_1004484342 154
198 3300005468 Ga0070707_100450843 Ga0070707_1004508432 154
199 3300005471 Ga0070698_100048113 Ga0070698_1000481132 154
200 3300005471 Ga0070698_100125334 Ga0070698_1001253342 154
201 3300005518 Ga0070699_100026976 Ga0070699_1000269762 154
202 3300005518 Ga0070699_100887389 Ga0070699_1008873891 154
203 3300005530 Ga0070679_100047847 Ga0070679_1000478473 154
204 3300005535 Ga0070684_100012632 Ga0070684_1000126324 154
205 3300005536 Ga0070697_100064994 Ga0070697_1000649942 154
206 3300005539 Ga0068853_101279183 Ga0068853_1012791831 154
207 3300005545 Ga0070695_100021991 Ga0070695_1000219912 154
208 3300005545 Ga0070695_100097671 Ga0070695_1000976712 154
209 3300005545 Ga0070695_100662906 Ga0070695_1006629062 154
210 3300005545 Ga0070695_100678394 Ga0070695_1006783941 154
211 3300005546 Ga0070696_100007503 Ga0070696_1000075031 154
212 3300005546 Ga0070696_100071908 Ga0070696_1000719081 154
213 3300005546 Ga0070696_100565417 Ga0070696_1005654172 154
214 3300005546 Ga0070696_101154530 Ga0070696_1011545301 154
215 3300005547 Ga0070693_100279272 Ga0070693_1002792722 154
216 3300005547 Ga0070693_100465503 Ga0070693_1004655032 154
217 3300005549 Ga0070704_100001415 Ga0070704_10000141515 154
218 3300005549 Ga0070704_100003271 Ga0070704_1000032714 154
219 3300005549 Ga0070704_100477051 Ga0070704_1004770512 154
220 3300005549 Ga0070704_100536038 Ga0070704_1005360382 154
221 3300005564 Ga0070664_100420499 Ga0070664_1004204991 154
222 3300005577 Ga0068857_100619314 Ga0068857_1006193141 154
223 3300005617 Ga0068859_100814856 Ga0068859_1008148562 154
224 3300005618 Ga0068864_100303727 Ga0068864_1003037272 154
225 3300005719 Ga0068861_100013261 Ga0068861_1000132615 154
226 3300005719 Ga0068861_100364699 Ga0068861_1003646992 154
227 3300005719 Ga0068861_100949665 Ga0068861_1009496651 154
228 3300005719 Ga0068861_100966944 Ga0068861_1009669441 154
229 3300005844 Ga0068862_100041133 Ga0068862_1000411333 154
230 3300005844 Ga0068862_100071645 Ga0068862_1000716453 154
231 3300005844 Ga0068862_100250993 Ga0068862_1002509933 154
232 3300005844 Ga0068862_100283152 Ga0068862_1002831522 154
233 3300005985 Ga0081539_10000842 Ga0081539_1000084273 154
234 3300006173 Ga0070716_100004507 Ga0070716_1000045072 154
235 3300006237 Ga0097621_101175211 Ga0097621_1011752111 154
236 3300006844 Ga0075428_100017325 Ga0075428_1000173256 154
237 3300006844 Ga0075428_100099471 Ga0075428_1000994711 154
238 3300006844 Ga0075428_100175066 Ga0075428_1001750663 154
239 3300006846 Ga0075430_100003868 Ga0075430_10000386811 154
240 3300006846 Ga0075430_100022846 Ga0075430_1000228465 154
241 3300006846 Ga0075430_100272277 Ga0075430_1002722773 154
242 3300006847 Ga0075431_100012828 Ga0075431_1000128283 154
243 3300006847 Ga0075431_100295201 Ga0075431_1002952013 154
244 3300006871 Ga0075434_100000073 Ga0075434_10000007310 154
245 3300006871 Ga0075434_100036600 Ga0075434_1000366004 154
246 3300006871 Ga0075434_100638907 Ga0075434_1006389072 154
247 3300006871 Ga0075434_101294397 Ga0075434_1012943971 154
248 3300006871 Ga0075434_101492886 Ga0075434_1014928862 154
249 3300006880 Ga0075429_100000832 Ga0075429_10000083228 154
250 3300006880 Ga0075429_100173918 Ga0075429_1001739182 154
251 3300006880 Ga0075429_100178209 Ga0075429_1001782092 154
252 3300006880 Ga0075429_101226563 Ga0075429_1012265631 154
253 3300006881 Ga0068865_100008105 Ga0068865_1000081053 154
254 3300006881 Ga0068865_101889057 Ga0068865_1018890571 154
255 3300006914 Ga0075436_100000205 Ga0075436_10000020536 154
256 3300006914 Ga0075436_100013578 Ga0075436_1000135783 154
257 3300006914 Ga0075436_100090711 Ga0075436_1000907112 154
258 3300006914 Ga0075436_100300374 Ga0075436_1003003742 154
259 3300006931 Ga0097620_100814887 Ga0097620_1008148872 154
260 3300007076 Ga0075435_100081861 Ga0075435_1000818612 154
261 3300007265 Ga0099794_10026051 Ga0099794_100260513 154
262 3300007265 Ga0099794_10097540 Ga0099794_100975402 154
263 3300007265 Ga0099794_10165686 Ga0099794_101656862 154
264 3300007265 Ga0099794_10249705 Ga0099794_102497052 154
265 3300007265 Ga0099794_10291906 Ga0099794_102919061 154
266 3300007265 Ga0099794_10544055 Ga0099794_105440551 154
267 3300007788 Ga0099795_10330843 Ga0099795_103308431 154
268 3300009094 Ga0111539_10046142 Ga0111539_100461424 154
269 3300009094 Ga0111539_10047339 Ga0111539_100473393 154
270 3300009094 Ga0111539_10047790 Ga0111539_100477902 154
271 3300009094 Ga0111539_10087485 Ga0111539_100874854 154
272 3300009094 Ga0111539_10554603 Ga0111539_105546032 154
273 3300009147 Ga0114129_10002896 Ga0114129_1000289622 154
274 3300009147 Ga0114129_10184031 Ga0114129_101840312 154
275 3300009147 Ga0114129_10332533 Ga0114129_103325333 154
276 3300009147 Ga0114129_10729544 Ga0114129_107295442 154
277 3300009147 Ga0114129_12479601 Ga0114129_124796011 154
278 3300009147 Ga0114129_12650695 Ga0114129_126506951 154
279 3300009148 Ga0105243_10109524 Ga0105243_101095242 154
280 3300009148 Ga0105243_10218457 Ga0105243_102184572 154
281 3300009176 Ga0105242_10429485 Ga0105242_104294852 154
282 3300009553 Ga0105249_10008790 Ga0105249_100087904 154
283 3300013105 Ga0157369_10693125 Ga0157369_106931252 154
284 3300013307 Ga0157372_10634216 Ga0157372_106342161 154
285 3300013308 Ga0157375_12059655 Ga0157375_120596551 154
286 3300014326 Ga0157380_10013330 Ga0157380_100133302 154
287 3300014745 Ga0157377_10151669 Ga0157377_101516692 154
288 3300014745 Ga0157377_10333343 Ga0157377_103333432 154
289 3300014968 Ga0157379_11282928 Ga0157379_112829282 154
290 3300014969 Ga0157376_10178381 Ga0157376_101783812 154
291 3300017792 Ga0163161_10420652 Ga0163161_104206522 154
292 3300020070 Ga0206356_10307192 Ga0206356_103071921 154
293 3300025885 Ga0207653_10086539 Ga0207653_100865392 154
294 3300025893 Ga0207682_10413005 Ga0207682_104130051 154
295 3300025898 Ga0207692_10323593 Ga0207692_103235932 154
296 3300025906 Ga0207699_10188451 Ga0207699_101884511 154
297 3300025907 Ga0207645_10049368 Ga0207645_100493682 154
298 3300025908 Ga0207643_10013945 Ga0207643_100139453 154
299 3300025908 Ga0207643_10147708 Ga0207643_101477081 154
300 3300025910 Ga0207684_10552861 Ga0207684_105528611 154
301 3300025912 Ga0207707_10110099 Ga0207707_101100993 154
302 3300025916 Ga0207663_10463019 Ga0207663_104630191 154
303 3300025917 Ga0207660_10062248 Ga0207660_100622482 154
304 3300025917 Ga0207660_10425681 Ga0207660_104256811 154
305 3300025917 Ga0207660_10956936 Ga0207660_109569361 154
306 3300025918 Ga0207662_10060345 Ga0207662_100603451 154
307 3300025918 Ga0207662_10151910 Ga0207662_101519102 154
308 3300025918 Ga0207662_10183190 Ga0207662_101831902 154
309 3300025918 Ga0207662_11171181 Ga0207662_111711811 154
310 3300025921 Ga0207652_10100884 Ga0207652_101008843 154
311 3300025922 Ga0207646_10677968 Ga0207646_106779682 154
312 3300025923 Ga0207681_10005713 Ga0207681_100057136 154
313 3300025926 Ga0207659_10073547 Ga0207659_100735472 154
314 3300025934 Ga0207686_10256560 Ga0207686_102565602 154
315 3300025935 Ga0207709_10039097 Ga0207709_100390972 154
316 3300025936 Ga0207670_10071657 Ga0207670_100716572 154
317 3300025936 Ga0207670_10110229 Ga0207670_101102293 154
318 3300025936 Ga0207670_10151278 Ga0207670_101512782 154
319 3300025936 Ga0207670_10326630 Ga0207670_103266302 154
320 3300025937 Ga0207669_10029230 Ga0207669_100292303 154
321 3300025937 Ga0207669_10793512 Ga0207669_107935122 154
322 3300025938 Ga0207704_10127713 Ga0207704_101277133 154
323 3300025939 Ga0207665_10007173 Ga0207665_100071732 154
324 3300025939 Ga0207665_10186263 Ga0207665_101862632 154
325 3300025940 Ga0207691_10057731 Ga0207691_100577312 154
326 3300025942 Ga0207689_10026651 Ga0207689_100266513 154
327 3300025944 Ga0207661_10524678 Ga0207661_105246782 154
328 3300025960 Ga0207651_10214407 Ga0207651_102144072 154
329 3300025960 Ga0207651_10250357 Ga0207651_102503572 154
330 3300025960 Ga0207651_10836294 Ga0207651_108362942 154
331 3300025961 Ga0207712_10007303 Ga0207712_100073033 154
332 3300025972 Ga0207668_10008880 Ga0207668_100088806 154
333 3300026023 Ga0207677_10399794 Ga0207677_103997942 154
334 3300026075 Ga0207708_10007750 Ga0207708_100077503 154
335 3300026075 Ga0207708_10139805 Ga0207708_101398052 154
336 3300026075 Ga0207708_10310191 Ga0207708_103101912 154
337 3300026075 Ga0207708_10806333 Ga0207708_108063331 154
338 3300026089 Ga0207648_10008533 Ga0207648_100085334 154
339 3300026089 Ga0207648_10119846 Ga0207648_101198462 154
340 3300026095 Ga0207676_10330655 Ga0207676_103306552 154
341 3300026116 Ga0207674_10138825 Ga0207674_101388253 154
342 3300026118 Ga0207675_100004506 Ga0207675_1000045067 154
343 3300026118 Ga0207675_100344164 Ga0207675_1003441642 154
344 3300026118 Ga0207675_100438531 Ga0207675_1004385312 154
345 3300026118 Ga0207675_101076762 Ga0207675_1010767621 154
346 3300027360 Ga0209969_1020779 Ga0209969_10207792 154
347 3300027364 Ga0209967_1000884 Ga0209967_10008843 154
348 3300027378 Ga0209981_1000310 Ga0209981_10003102 154
349 3300027378 Ga0209981_1032075 Ga0209981_10320752 154
350 3300027395 Ga0209996_1018334 Ga0209996_10183341 154
351 3300027462 Ga0210000_1000624 Ga0210000_10006242 154
352 3300027471 Ga0209995_1003506 Ga0209995_10035061 154
353 3300027471 Ga0209995_1009839 Ga0209995_10098392 154
354 3300027471 Ga0209995_1053600 Ga0209995_10536001 154
355 3300027543 Ga0209999_1002308 Ga0209999_10023081 154
356 3300027543 Ga0209999_1036195 Ga0209999_10361952 154
357 3300027665 Ga0209983_1014604 Ga0209983_10146042 154
358 3300027671 Ga0209588_1000881 Ga0209588_10008815 154
359 3300027671 Ga0209588_1018434 Ga0209588_10184342 154
360 3300027671 Ga0209588_1125882 Ga0209588_11258821 154
361 3300027682 Ga0209971_1057758 Ga0209971_10577581 154
362 3300027695 Ga0209966_1015486 Ga0209966_10154863 154
363 3300027876 Ga0209974_10009659 Ga0209974_100096593 154
364 3300027876 Ga0209974_10220301 Ga0209974_102203012 154
365 3300027907 Ga0207428_10071945 Ga0207428_100719451 154
366 3300027907 Ga0207428_10072217 Ga0207428_100722172 154
367 3300027907 Ga0207428_10075323 Ga0207428_100753233 154
368 3300028380 Ga0268265_10025442 Ga0268265_100254423 154
369 3300028380 Ga0268265_10107368 Ga0268265_101073681 154
370 3300028380 Ga0268265_10257151 Ga0268265_102571513 154
371 3300028380 Ga0268265_10581844 Ga0268265_105818442 154
372 3300028381 Ga0268264_10539530 Ga0268264_105395302 154
373 3300031548 Ga0307408_100176698 Ga0307408_1001766982 154
374 3300031548 Ga0307408_100196788 Ga0307408_1001967882 154
375 3300031548 Ga0307408_101490570 Ga0307408_1014905701 154
376 3300031665 Ga0316575_10009403 Ga0316575_100094034 154
377 3300031691 Ga0316579_10053730 Ga0316579_100537301 154
378 3300031728 Ga0316578_10018325 Ga0316578_100183255 154
379 3300031911 Ga0307412_10123067 Ga0307412_101230672 154
380 3300031911 Ga0307412_10276573 Ga0307412_102765732 154
381 3300031911 Ga0307412_10472482 Ga0307412_104724822 154
382 3300032002 Ga0307416_100785157 Ga0307416_1007851572 154
383 3300032002 Ga0307416_102946849 Ga0307416_1029468491 154
384 3300032002 Ga0307416_103419543 Ga0307416_1034195431 154
385 3300032004 Ga0307414_11950188 Ga0307414_119501881 154
386 3300032005 Ga0307411_10381773 Ga0307411_103817732 154
387 3300032005 Ga0307411_10435842 Ga0307411_104358422 154
388 3300032133 Ga0316583_10033290 Ga0316583_100332902 154
389 3300034820 Ga0373959_0007907 Ga0373959_0007907_1146_1610 154
390 3300035085 Ga0373929_0037517 Ga0373929_0037517_39_509 154
391 3300035086 Ga0373934_0000927 Ga0373934_0000927_7185_7661 154
392 3300035092 Ga0373952_0073225 Ga0373952_0073225_104_574 154
393 3300035111 Ga0373923_0001061 Ga0373923_0001061_6718_7194 154
394 3300035113 Ga0373936_0058554 Ga0373936_0058554_934_1410 154
395 3300035114 Ga0373939_0031855 Ga0373939_0031855_883_1353 154
396 3300035114 Ga0373939_0101195 Ga0373939_0101195_203_673 154
397 3300035115 Ga0373941_0004938 Ga0373941_0004938_1872_2342 154
398 3300035115 Ga0373941_0267156 Ga0373941_0267156_182_652 154
399 3300035117 Ga0373953_0002557 Ga0373953_0002557_1730_2206 154
400 3300035118 Ga0373954_0002423 Ga0373954_0002423_6626_7102 154
401 3300035118 Ga0373954_0005281 Ga0373954_0005281_3660_4136 154
402 3300035119 Ga0373956_0001667 Ga0373956_0001667_4457_4933 154
403 3300035119 Ga0373956_0001841 Ga0373956_0001841_1971_2447 154
404 3300035120 Ga0373957_0042858 Ga0373957_0042858_1131_1607 154
405 3300035120 Ga0373957_0070108 Ga0373957_0070108_755_1231 154
406 3300035121 Ga0373960_0045252 Ga0373960_0045252_464_934 154
407 3300035121 Ga0373960_0136965 Ga0373960_0136965_72_542 154
408 3300035207 Ga0373942_0002629 Ga0373942_0002629_2201_2680 154
409 3300035207 Ga0373942_0220501 Ga0373942_0220501_41_511 154
410 3300035241 Ga0373961_0017229 Ga0373961_0017229_702_1172 154
411 3300035241 Ga0373961_0243589 Ga0373961_0243589_80_550 154
412 3300035242 Ga0373962_0052671 Ga0373962_0052671_143_613 154
413 3300035410 Ga0373924_0006450 Ga0373924_0006450_3174_3650 154
414 3300035410 Ga0373924_0485178 Ga0373924_0485178_59_535 154
415 3300035691 Ga0373931_0006170 Ga0373931_0006170_2380_2850 154
416 3300035691 Ga0373931_0020035 Ga0373931_0020035_346_816 154
417 3300035691 Ga0373931_0308281 Ga0373931_0308281_447_923 154
418 3300035692 Ga0373935_0003613 Ga0373935_0003613_1913_2389 154
419 3300035695 Ga0373927_0010306 Ga0373927_0010306_508_984 154
420 3300035724 Ga0373933_0006322 Ga0373933_0006322_4783_5259 154
421 3300035724 Ga0373933_0091707 Ga0373933_0091707_1107_1583 154
422 3300035724 Ga0373933_0492714 Ga0373933_0492714_57_542 154
423 3300036401 Ga0373937_0001026 Ga0373937_0001026_18354_18830 154
424 3300036401 Ga0373937_0070854 Ga0373937_0070854_2470_2946 154
425 3300036401 Ga0373937_0193158 Ga0373937_0193158_1076_1546 154
426 3300036401 Ga0373937_0200648 Ga0373937_0200648_313_783 154
427 3300036401 Ga0373937_0245262 Ga0373937_0245262_465_941 154
428 3300036647 Ga0316582_0025338 Ga0316582_0025338_1007_1483 154
429 3300036712 Ga0316584_0512087 Ga0316584_0512087_294_770 154
430 3300037068 Ga0373925_0003111 Ga0373925_0003111_1970_2446 154
431 3300039438 Ga0436360_1341558 Ga0436360_1341558_717_1193 154
432 3300041406 Ga0439439_0054435 Ga0439439_0054435_32_502 154
433 3300041408 Ga0439453_0011225 Ga0439453_0011225_1015_1479 154
434 3300041410 Ga0439461_0010851 Ga0439461_0010851_1077_1547 154
435 3300042009 Ga0439451_015271 Ga0439451_015271_602_1066 154
436 3300042013 Ga0439456_030254 Ga0439456_030254_14_478 154
437 3300042156 Ga0439446_0040964 Ga0439446_0040964_458_928 154
438 3300042156 Ga0439446_0249041 Ga0439446_0249041_116_580 154
439 3300042435 Ga0439434_0000699 Ga0439434_0000699_2777_3247 154
440 3300042435 Ga0439434_0044132 Ga0439434_0044132_898_1362 154
441 3300042436 Ga0439435_0008199 Ga0439435_0008199_581_1045 154
442 3300042436 Ga0439435_0022553 Ga0439435_0022553_974_1444 154
443 3300042436 Ga0439435_0055943 Ga0439435_0055943_244_708 154
444 3300042437 Ga0439444_0007155 Ga0439444_0007155_1079_1543 154
445 3300042461 Ga0439460_0025039 Ga0439460_0025039_1074_1538 154
446 3300042876 Ga0451577_0948371 Ga0451577_0948371_78_566 154
447 3300042993 Ga0439440_0145382 Ga0439440_0145382_49_519 154
448 3300044683 Ga0466965_0054544 Ga0466965_0054544_317_787 154
449 3300045051 Ga0451576_1312027 Ga0451576_1312027_198_674 154
450 3300046454 Ga0495592_0029053 Ga0495592_0029053_2812_3288 154
451 3300046454 Ga0495592_0048947 Ga0495592_0048947_1946_2422 154
452 3300046455 Ga0495603_0316054 Ga0495603_0316054_356_832 154
453 3300046459 Ga0495629_0066799 Ga0495629_0066799_1970_2446 154
454 3300046461 Ga0495641_0005144 Ga0495641_0005144_8210_8686 154
455 3300046462 Ga0495651_0001528 Ga0495651_0001528_9995_10471 154
456 3300046462 Ga0495651_0004190 Ga0495651_0004190_3603_4079 154
457 3300046463 Ga0495653_0009088 Ga0495653_0009088_5700_6176 154
458 3300046463 Ga0495653_0135641 Ga0495653_0135641_658_1134 154
459 3300046463 Ga0495653_0743647 Ga0495653_0743647_44_520 154
460 3300046472 Ga0495580_0018844 Ga0495580_0018844_2688_3164 154
461 3300046475 Ga0495639_0002185 Ga0495639_0002185_3603_4079 154
462 3300046476 Ga0495662_0018325 Ga0495662_0018325_2609_3085 154
463 3300046476 Ga0495662_0079289 Ga0495662_0079289_65_541 154
464 3300046477 Ga0495664_0081074 Ga0495664_0081074_1328_1804 154
465 3300046511 Ga0495608_0003114 Ga0495608_0003114_10350_10826 154
466 3300046511 Ga0495608_0045756 Ga0495608_0045756_1163_1639 154
467 3300046514 Ga0495618_0022879 Ga0495618_0022879_1654_2130 154
468 3300046514 Ga0495618_0052136 Ga0495618_0052136_1971_2447 154
469 3300046516 Ga0495628_0041512 Ga0495628_0041512_2887_3363 154
470 3300046517 Ga0495630_0000851 Ga0495630_0000851_1146_1622 154
471 3300046517 Ga0495630_0450554 Ga0495630_0450554_165_641 154
472 3300046526 Ga0495666_0045537 Ga0495666_0045537_991_1467 154
473 3300046526 Ga0495666_0089060 Ga0495666_0089060_39_560 154
474 3300046529 Ga0495652_0045337 Ga0495652_0045337_1375_1851 154
475 3300046533 Ga0495640_0028067 Ga0495640_0028067_2858_3334 154
476 3300046535 Ga0495586_0002520 Ga0495586_0002520_4783_5259 154
477 3300046535 Ga0495586_0118185 Ga0495586_0118185_239_760 154
478 3300046535 Ga0495586_0236938 Ga0495586_0236938_267_743 154
479 3300046536 Ga0495587_0003382 Ga0495587_0003382_8642_9118 154
480 3300046536 Ga0495587_0006598 Ga0495587_0006598_6031_6507 154
481 3300046543 Ga0495645_0037686 Ga0495645_0037686_1108_1584 154
482 3300046559 Ga0495667_0047217 Ga0495667_0047217_1953_2429 154
483 3300046559 Ga0495667_0079452 Ga0495667_0079452_1107_1583 154
484 3300046559 Ga0495667_0373285 Ga0495667_0373285_278_754 154
485 3300046642 Ga0495634_0051715 Ga0495634_0051715_818_1294 154
486 3300046642 Ga0495634_0161296 Ga0495634_0161296_267_743 154
487 3300046663 Ga0495635_0046410 Ga0495635_0046410_475_951 154
488 3300046675 Ga0495657_0007456 Ga0495657_0007456_6250_6726 154
489 3300046675 Ga0495657_0065254 Ga0495657_0065254_141_617 154
490 3300046675 Ga0495657_0161532 Ga0495657_0161532_141_617 154
491 3300046678 Ga0495599_0007268 Ga0495599_0007268_3894_4370 154
492 3300046678 Ga0495599_0170148 Ga0495599_0170148_785_1255 154
493 3300046681 Ga0495647_0075647 Ga0495647_0075647_540_1016 154
494 3300046681 Ga0495647_0086052 Ga0495647_0086052_574_1050 154
495 3300046683 Ga0495658_0119842 Ga0495658_0119842_1003_1479 154
496 3300046683 Ga0495658_0936676 Ga0495658_0936676_21_497 154
497 3300046689 Ga0495613_0412102 Ga0495613_0412102_380_856 154
498 3300046690 Ga0495624_0197977 Ga0495624_0197977_486_962 154
499 3300046809 Ga0495600_0020078 Ga0495600_0020078_279_755 154
500 3300046809 Ga0495600_0020363 Ga0495600_0020363_1148_1624 154
501 3300047315 Ga0495581_0074892 Ga0495581_0074892_517_1038 154
502 3300047315 Ga0495581_0667494 Ga0495581_0667494_45_521 154
503 3300047317 Ga0495604_0012460 Ga0495604_0012460_1501_1977 154
504 3300047317 Ga0495604_0023283 Ga0495604_0023283_1510_1986 154
505 3300047319 Ga0495674_0005814 Ga0495674_0005814_7148_7624 154
506 3300047322 Ga0495680_0001252 Ga0495680_0001252_25836_26312 154
507 3300047322 Ga0495680_0082697 Ga0495680_0082697_1276_1752 154
508 3300047322 Ga0495680_0177271 Ga0495680_0177271_1044_1520 154
509 3300047444 Ga0495675_0007174 Ga0495675_0007174_213_689 154
510 3300047444 Ga0495675_0071825 Ga0495675_0071825_1063_1539 154
511 3300047471 Ga0495684_0016574 Ga0495684_0016574_4904_5380 154
512 3300047471 Ga0495684_0193600 Ga0495684_0193600_78_554 154
513 3300047471 Ga0495684_0481307 Ga0495684_0481307_250_726 154
514 3300049515 Ga0501292_044861 Ga0501292_044861_47_535 154
515 3300049515 Ga0501292_063105 Ga0501292_063105_64_576 154
516 3300049521 Ga0501298_022598 Ga0501298_022598_43_507 154
517 3300049522 Ga0501299_144231 Ga0501299_144231_71_535 154
518 3300049568 Ga0501031_0011710 Ga0501031_0011710_2765_3241 154
519 3300049569 Ga0501032_0015532 Ga0501032_0015532_2955_3431 154
520 3300049570 Ga0501033_0006483 Ga0501033_0006483_6628_7104 154
521 3300049570 Ga0501033_0335109 Ga0501033_0335109_107_571 154
522 3300049572 Ga0501036_0001252 Ga0501036_0001252_1984_2460 154
523 3300049572 Ga0501036_0059286 Ga0501036_0059286_1176_1640 154
524 3300049572 Ga0501036_0216282 Ga0501036_0216282_1105_1569 154
525 3300049573 Ga0501037_0042207 Ga0501037_0042207_2861_3337 154
526 3300049574 Ga0501038_0001280 Ga0501038_0001280_9176_9652 154
527 3300049574 Ga0501038_0128702 Ga0501038_0128702_1097_1561 154
528 3300049574 Ga0501038_1192944 Ga0501038_1192944_54_536 154
529 3300049575 Ga0501039_0011180 Ga0501039_0011180_882_1358 154
530 3300049575 Ga0501039_0152376 Ga0501039_0152376_720_1202 154
531 3300049576 Ga0501040_0000052 Ga0501040_0000052_49398_49874 154
532 3300049576 Ga0501040_0078654 Ga0501040_0078654_688_1152 154
533 3300049577 Ga0501041_0004912 Ga0501041_0004912_5080_5556 154
534 3300049577 Ga0501041_0090832 Ga0501041_0090832_1081_1545 154
535 3300049577 Ga0501041_0110569 Ga0501041_0110569_355_828 154
536 3300049577 Ga0501041_0129865 Ga0501041_0129865_1088_1552 154
537 3300049578 Ga0501042_0013259 Ga0501042_0013259_4317_4793 154
538 3300049578 Ga0501042_0074219 Ga0501042_0074219_953_1417 154
539 3300049578 Ga0501042_0115127 Ga0501042_0115127_115_579 154
540 3300049579 Ga0501043_0015925 Ga0501043_0015925_4317_4793 154
541 3300049580 Ga0501046_0000271 Ga0501046_0000271_3142_3618 154
542 3300049582 Ga0501048_0001409 Ga0501048_0001409_14070_14546 154
543 3300049582 Ga0501048_0022699 Ga0501048_0022699_18_482 154
544 3300049582 Ga0501048_0677235 Ga0501048_0677235_118_582 154
545 3300049584 Ga0501068_0030228 Ga0501068_0030228_1653_2129 154
546 3300049584 Ga0501068_0297858 Ga0501068_0297858_360_833 154
547 3300049587 Ga0501071_0033617 Ga0501071_0033617_158_634 154
548 3300049587 Ga0501071_0307458 Ga0501071_0307458_24_488 154
549 3300049587 Ga0501071_0876686 Ga0501071_0876686_85_549 154
550 3300049588 Ga0501072_0003349 Ga0501072_0003349_4015_4491 154
551 3300049588 Ga0501072_0108153 Ga0501072_0108153_785_1249 154
552 3300049588 Ga0501072_1148486 Ga0501072_1148486_24_494 154
553 3300049590 Ga0501074_0185266 Ga0501074_0185266_257_733 154
554 3300049591 Ga0501075_0000751 Ga0501075_0000751_16505_16981 154
555 3300049591 Ga0501075_0001243 Ga0501075_0001243_2663_3127 154
556 3300049591 Ga0501075_0083266 Ga0501075_0083266_1260_1733 154
557 3300049591 Ga0501075_0270924 Ga0501075_0270924_49_513 154
558 3300049592 Ga0501076_0000290 Ga0501076_0000290_1132_1596 154
559 3300049592 Ga0501076_0006671 Ga0501076_0006671_6760_7236 154
560 3300049592 Ga0501076_0526727 Ga0501076_0526727_38_520 154
561 3300049593 Ga0501077_0008144 Ga0501077_0008144_2850_3326 154
562 3300049593 Ga0501077_0024729 Ga0501077_0024729_2283_2747 154
563 3300049649 Ga0501198_021510 Ga0501198_021510_499_1011 154
564 3300049668 Ga0501233_017091 Ga0501233_017091_17_529 154
565 3300049741 Ga0501079_0000061 Ga0501079_0000061_44296_44772 154
566 3300049741 Ga0501079_0204890 Ga0501079_0204890_530_1012 154
567 3300049741 Ga0501079_0207768 Ga0501079_0207768_853_1317 154
568 3300049742 Ga0501080_0022971 Ga0501080_0022971_4157_4633 154
569 3300049742 Ga0501080_0096381 Ga0501080_0096381_2226_2699 154
570 3300049743 Ga0501081_0000110 Ga0501081_0000110_4626_5102 154
571 3300049743 Ga0501081_0056555 Ga0501081_0056555_1131_1595 154
572 3300049743 Ga0501081_0082284 Ga0501081_0082284_1159_1641 154
573 3300049744 Ga0501083_0100203 Ga0501083_0100203_255_731 154
574 3300049744 Ga0501083_0108208 Ga0501083_0108208_1166_1630 154
575 3300049744 Ga0501083_0130681 Ga0501083_0130681_816_1298 154
576 3300049775 Ga0501279_019506 Ga0501279_019506_371_859 154
577 3300049779 Ga0501283_070470 Ga0501283_070470_54_518 154
578 3300049822 Ga0501035_0073483 Ga0501035_0073483_722_1198 154
579 3300049823 Ga0501044_0072036 Ga0501044_0072036_2437_2913 154
580 3300049824 Ga0501045_0002891 Ga0501045_0002891_5761_6237 154
581 3300049824 Ga0501045_1104412 Ga0501045_1104412_53_517 154
582 3300050507 nmdc:mga05p37_471014_c1 nmdc:mga05p37_471014_c1_863_1333 154
583 3300050507 nmdc:mga05p37_78_c1 nmdc:mga05p37_78_c1_38611_39096 154
584 3300050508 nmdc:mga09592_119266_c1 nmdc:mga09592_119266_c1_815_1291 154
585 3300050508 nmdc:mga09592_264_c1 nmdc:mga09592_264_c1_22714_23199 154
586 3300050508 nmdc:mga09592_414027_c1 nmdc:mga09592_414027_c1_642_1106 154
587 3300050509 nmdc:mga0qj67_201156_c1 nmdc:mga0qj67_201156_c1_510_974 154
588 3300050509 nmdc:mga0qj67_222839_c1 nmdc:mga0qj67_222839_c1_1001_1465 154
589 3300050509 nmdc:mga0qj67_237804_c1 nmdc:mga0qj67_237804_c1_71_535 154
590 3300050509 nmdc:mga0qj67_915119_c1 nmdc:mga0qj67_915119_c1_178_642 154
591 3300050510 nmdc:mga06r32_1282979_c1 nmdc:mga06r32_1282979_c1_155_619 154
592 3300050510 nmdc:mga06r32_5387_c2 nmdc:mga06r32_5387_c2_1825_2310 154
593 3300050510 nmdc:mga06r32_87082_c1 nmdc:mga06r32_87082_c1_2349_2813 154
594 3300050511 nmdc:mga08y16_1062068_c1 nmdc:mga08y16_1062068_c1_135_620 154
595 3300050511 nmdc:mga08y16_107926_c1 nmdc:mga08y16_107926_c1_1461_1937 154
596 3300050511 nmdc:mga08y16_112219_c1 nmdc:mga08y16_112219_c1_1097_1561 154
597 3300050511 nmdc:mga08y16_14672_c1 nmdc:mga08y16_14672_c1_1428_1892 154
598 3300050511 nmdc:mga08y16_59668_c1 nmdc:mga08y16_59668_c1_946_1410 154
599 3300050511 nmdc:mga08y16_731718_c1 nmdc:mga08y16_731718_c1_159_623 154
600 3300050512 nmdc:mga0n895_19782_c1 nmdc:mga0n895_19782_c1_3032_3508 154
601 3300050512 nmdc:mga0n895_582_c1 nmdc:mga0n895_582_c1_15844_16314 154
602 3300050512 nmdc:mga0n895_668203_c1 nmdc:mga0n895_668203_c1_422_916 154
603 3300050513 nmdc:mga0rr50_2806_c1 nmdc:mga0rr50_2806_c1_6772_7242 154
604 3300050513 nmdc:mga0rr50_836509_c1 nmdc:mga0rr50_836509_c1_16_492 154
605 3300050514 nmdc:mga08x19_103339_c1 nmdc:mga08x19_103339_c1_1373_1849 154
606 3300050514 nmdc:mga08x19_1308_c1 nmdc:mga08x19_1308_c1_12944_13414 154
607 3300050514 nmdc:mga08x19_167747_c1 nmdc:mga08x19_167747_c1_38_532 154
608 3300050514 nmdc:mga08x19_18933_c1 nmdc:mga08x19_18933_c1_1713_2183 154
609 3300050514 nmdc:mga08x19_512384_c1 nmdc:mga08x19_512384_c1_239_709 154
610 3300050514 nmdc:mga08x19_695052_c1 nmdc:mga08x19_695052_c1_194_664 154
611 3300050515 nmdc:mga0a205_313976_c1 nmdc:mga0a205_313976_c1_728_1204 154
612 3300050515 nmdc:mga0a205_344883_c1 nmdc:mga0a205_344883_c1_729_1205 154
613 3300053078 Ga0495612_0069482 Ga0495612_0069482_55_531 154
614 3300053085 Ga0495619_0004389 Ga0495619_0004389_1107_1583 154
615 3300053094 Ga0500566_0344287 Ga0500566_0344287_107_583 154
616 3300054114 Ga0501084_0001172 Ga0501084_0001172_3558_4034 154
617 3300054114 Ga0501084_0069282 Ga0501084_0069282_1520_1984 154
618 3300054114 Ga0501084_0277148 Ga0501084_0277148_812_1294 154
619 3300054114 Ga0501084_0362490 Ga0501084_0362490_309_797 154
620 3300054114 Ga0501084_1457848 Ga0501084_1457848_75_539 154
621 3300059424 Ga0590075_162224 Ga0590075_162224_67_531 154
622 3300059426 Ga0590077_071846 Ga0590077_071846_247_717 154
623 3300060353 Ga0501082_0004197 Ga0501082_0004197_3333_3809 154
624 3300060353 Ga0501082_0096614 Ga0501082_0096614_1453_1935 154
625 3300060353 Ga0501082_0120467 Ga0501082_0120467_883_1347 154
626 3300061734 Ga0530510_0000048 Ga0530510_0000048_12496_12960 154
627 3300061734 Ga0530510_0000186 Ga0530510_0000186_34222_34698 154
628 3300061734 Ga0530510_0191812 Ga0530510_0191812_1000_1473 154
629 3300061734 Ga0530510_0869249 Ga0530510_0869249_42_524 154
630 3300005289 Ga0065704_10041276 Ga0065704_100412761 155
631 3300005295 Ga0065707_10330711 Ga0065707_103307111 155
632 3300005330 Ga0070690_100000758 Ga0070690_1000007584 155
633 3300005330 Ga0070690_100179335 Ga0070690_1001793352 155
634 3300005331 Ga0070670_100765812 Ga0070670_1007658122 155
635 3300005334 Ga0068869_100001703 Ga0068869_1000017039 155
636 3300005334 Ga0068869_100001795 Ga0068869_1000017951 155
637 3300005335 Ga0070666_10183799 Ga0070666_101837992 155
638 3300005336 Ga0070680_100024647 Ga0070680_1000246473 155
639 3300005337 Ga0070682_100004264 Ga0070682_1000042643 155
640 3300005338 Ga0068868_100000169 Ga0068868_1000001694 155
641 3300005338 Ga0068868_100181578 Ga0068868_1001815782 155
642 3300005339 Ga0070660_100272244 Ga0070660_1002722442 155
643 3300005340 Ga0070689_100077140 Ga0070689_1000771402 155
644 3300005340 Ga0070689_100163455 Ga0070689_1001634552 155
645 3300005340 Ga0070689_100513304 Ga0070689_1005133042 155
646 3300005341 Ga0070691_10020766 Ga0070691_100207663 155
647 3300005343 Ga0070687_100000112 Ga0070687_10000011235 155
648 3300005344 Ga0070661_100072196 Ga0070661_1000721962 155
649 3300005345 Ga0070692_10000260 Ga0070692_100002602 155
650 3300005345 Ga0070692_10232897 Ga0070692_102328972 155
651 3300005356 Ga0070674_100387381 Ga0070674_1003873811 155
652 3300005356 Ga0070674_100832461 Ga0070674_1008324611 155
653 3300005364 Ga0070673_100699443 Ga0070673_1006994432 155
654 3300005364 Ga0070673_101725593 Ga0070673_1017255931 155
655 3300005365 Ga0070688_100572513 Ga0070688_1005725131 155
656 3300005367 Ga0070667_100209649 Ga0070667_1002096492 155
657 3300005438 Ga0070701_10003531 Ga0070701_100035313 155
658 3300005440 Ga0070705_100011432 Ga0070705_1000114323 155
659 3300005440 Ga0070705_100320451 Ga0070705_1003204512 155
660 3300005444 Ga0070694_100187862 Ga0070694_1001878621 155
661 3300005444 Ga0070694_101139573 Ga0070694_1011395731 155
662 3300005445 Ga0070708_100064500 Ga0070708_1000645003 155
663 3300005457 Ga0070662_100096492 Ga0070662_1000964922 155
664 3300005458 Ga0070681_10001458 Ga0070681_100014584 155
665 3300005458 Ga0070681_10087279 Ga0070681_100872792 155
666 3300005459 Ga0068867_100001181 Ga0068867_10000118115 155
667 3300005459 Ga0068867_100033240 Ga0068867_1000332402 155
668 3300005466 Ga0070685_10638662 Ga0070685_106386621 155
669 3300005466 Ga0070685_10790286 Ga0070685_107902861 155
670 3300005471 Ga0070698_100912975 Ga0070698_1009129751 155
671 3300005530 Ga0070679_100021105 Ga0070679_1000211054 155
672 3300005539 Ga0068853_100036438 Ga0068853_1000364385 155
673 3300005539 Ga0068853_100076380 Ga0068853_1000763803 155
674 3300005544 Ga0070686_100005999 Ga0070686_1000059993 155
675 3300005544 Ga0070686_100486760 Ga0070686_1004867602 155
676 3300005545 Ga0070695_100060766 Ga0070695_1000607662 155
677 3300005546 Ga0070696_100003044 Ga0070696_1000030443 155
678 3300005546 Ga0070696_100083140 Ga0070696_1000831402 155
679 3300005546 Ga0070696_100410052 Ga0070696_1004100522 155
680 3300005547 Ga0070693_100030068 Ga0070693_1000300682 155
681 3300005547 Ga0070693_100144158 Ga0070693_1001441582 155
682 3300005549 Ga0070704_100008163 Ga0070704_1000081634 155
683 3300005549 Ga0070704_100243771 Ga0070704_1002437711 155
684 3300005563 Ga0068855_100053051 Ga0068855_1000530513 155
685 3300005563 Ga0068855_100213198 Ga0068855_1002131982 155
686 3300005577 Ga0068857_100007353 Ga0068857_1000073534 155
687 3300005577 Ga0068857_100056140 Ga0068857_1000561404 155
688 3300005578 Ga0068854_100003215 Ga0068854_10000321511 155
689 3300005614 Ga0068856_100096496 Ga0068856_1000964962 155
690 3300005614 Ga0068856_100126582 Ga0068856_1001265822 155
691 3300005614 Ga0068856_100178994 Ga0068856_1001789942 155
692 3300005615 Ga0070702_100014801 Ga0070702_1000148013 155
693 3300005615 Ga0070702_100223864 Ga0070702_1002238642 155
694 3300005616 Ga0068852_100134170 Ga0068852_1001341702 155
695 3300005617 Ga0068859_100040783 Ga0068859_1000407834 155
696 3300005617 Ga0068859_100073919 Ga0068859_1000739192 155
697 3300005617 Ga0068859_100076303 Ga0068859_1000763032 155
698 3300005618 Ga0068864_100030981 Ga0068864_1000309813 155
699 3300005618 Ga0068864_100082692 Ga0068864_1000826923 155
700 3300005718 Ga0068866_10007632 Ga0068866_100076322 155
701 3300005718 Ga0068866_10055570 Ga0068866_100555702 155
702 3300005719 Ga0068861_100001299 Ga0068861_10000129915 155
703 3300005840 Ga0068870_10019003 Ga0068870_100190032 155
704 3300005841 Ga0068863_100247449 Ga0068863_1002474492 155
705 3300005842 Ga0068858_100035118 Ga0068858_1000351184 155
706 3300005842 Ga0068858_100136730 Ga0068858_1001367302 155
707 3300005842 Ga0068858_100379235 Ga0068858_1003792352 155
708 3300005842 Ga0068858_101080720 Ga0068858_1010807201 155
709 3300005843 Ga0068860_100049251 Ga0068860_1000492513 155
710 3300005843 Ga0068860_100165741 Ga0068860_1001657412 155
711 3300005843 Ga0068860_100183967 Ga0068860_1001839672 155
712 3300005843 Ga0068860_100347596 Ga0068860_1003475962 155
713 3300005844 Ga0068862_100002444 Ga0068862_10000244417 155
714 3300005844 Ga0068862_101186450 Ga0068862_1011864502 155
715 3300006237 Ga0097621_100008740 Ga0097621_1000087403 155
716 3300006237 Ga0097621_100218593 Ga0097621_1002185932 155
717 3300006237 Ga0097621_101255051 Ga0097621_1012550511 155
718 3300006358 Ga0068871_100014795 Ga0068871_1000147954 155
719 3300006358 Ga0068871_100017615 Ga0068871_1000176156 155
720 3300006844 Ga0075428_100008533 Ga0075428_10000853314 155
721 3300006844 Ga0075428_100027994 Ga0075428_1000279943 155
722 3300006846 Ga0075430_100798627 Ga0075430_1007986271 155
723 3300006847 Ga0075431_100227291 Ga0075431_1002272913 155
724 3300006852 Ga0075433_10001178 Ga0075433_1000117816 155
725 3300006871 Ga0075434_100001217 Ga0075434_1000012176 155
726 3300006880 Ga0075429_100005024 Ga0075429_10000502410 155
727 3300006881 Ga0068865_100002861 Ga0068865_1000028618 155
728 3300006881 Ga0068865_101028399 Ga0068865_1010283991 155
729 3300006914 Ga0075436_100003082 Ga0075436_1000030822 155
730 3300006914 Ga0075436_100375168 Ga0075436_1003751682 155
731 3300006931 Ga0097620_100040783 Ga0097620_1000407832 155
732 3300006931 Ga0097620_100073916 Ga0097620_1000739162 155
733 3300006931 Ga0097620_100076300 Ga0097620_1000763002 155
734 3300007076 Ga0075435_100000549 Ga0075435_1000005498 155
735 3300007076 Ga0075435_100630813 Ga0075435_1006308132 155
736 3300007265 Ga0099794_10018805 Ga0099794_100188054 155
737 3300009093 Ga0105240_10584684 Ga0105240_105846842 155
738 3300009094 Ga0111539_10023101 Ga0111539_100231012 155
739 3300009094 Ga0111539_10592557 Ga0111539_105925571 155
740 3300009098 Ga0105245_10000259 Ga0105245_1000025953 155
741 3300009098 Ga0105245_10020740 Ga0105245_100207403 155
742 3300009101 Ga0105247_10111952 Ga0105247_101119522 155
743 3300009147 Ga0114129_10384053 Ga0114129_103840532 155
744 3300009148 Ga0105243_10015069 Ga0105243_100150693 155
745 3300009148 Ga0105243_10248657 Ga0105243_102486571 155
746 3300009148 Ga0105243_10274551 Ga0105243_102745512 155
747 3300009176 Ga0105242_10013543 Ga0105242_100135434 155
748 3300009176 Ga0105242_10040775 Ga0105242_100407754 155
749 3300009176 Ga0105242_10303439 Ga0105242_103034391 155
750 3300009177 Ga0105248_10008114 Ga0105248_100081148 155
751 3300009177 Ga0105248_10569339 Ga0105248_105693392 155
752 3300009545 Ga0105237_10017011 Ga0105237_100170114 155
753 3300009553 Ga0105249_10065108 Ga0105249_100651083 155
754 3300010375 Ga0105239_10086505 Ga0105239_100865052 155
755 3300010375 Ga0105239_10299239 Ga0105239_102992392 155
756 3300011119 Ga0105246_10182074 Ga0105246_101820742 155
757 3300012492 Ga0157335_1019794 Ga0157335_10197942 155
758 3300013105 Ga0157369_10364019 Ga0157369_103640192 155
759 3300013296 Ga0157374_10019265 Ga0157374_100192653 155
760 3300013296 Ga0157374_12134839 Ga0157374_121348391 155
761 3300013297 Ga0157378_10011016 Ga0157378_100110165 155
762 3300013306 Ga0163162_10223351 Ga0163162_102233513 155
763 3300013306 Ga0163162_10497852 Ga0163162_104978522 155
764 3300013306 Ga0163162_11086676 Ga0163162_110866762 155
765 3300013307 Ga0157372_11226250 Ga0157372_112262502 155
766 3300013308 Ga0157375_10358208 Ga0157375_103582082 155
767 3300014325 Ga0163163_10228692 Ga0163163_102286923 155
768 3300014326 Ga0157380_10076719 Ga0157380_100767193 155
769 3300014326 Ga0157380_10527773 Ga0157380_105277732 155
770 3300014326 Ga0157380_11289430 Ga0157380_112894302 155
771 3300014968 Ga0157379_10064557 Ga0157379_100645572 155
772 3300014968 Ga0157379_10305578 Ga0157379_103055783 155
773 3300014969 Ga0157376_10004961 Ga0157376_100049619 155
774 3300014969 Ga0157376_10057987 Ga0157376_100579873 155
775 3300017792 Ga0163161_11074484 Ga0163161_110744841 155
776 3300025899 Ga0207642_10002932 Ga0207642_100029324 155
777 3300025899 Ga0207642_10513112 Ga0207642_105131122 155
778 3300025901 Ga0207688_10154686 Ga0207688_101546862 155
779 3300025903 Ga0207680_10184209 Ga0207680_101842092 155
780 3300025913 Ga0207695_10569337 Ga0207695_105693372 155
781 3300025914 Ga0207671_10015443 Ga0207671_100154434 155
782 3300025917 Ga0207660_10023363 Ga0207660_100233633 155
783 3300025918 Ga0207662_10000106 Ga0207662_1000010618 155
784 3300025919 Ga0207657_10312236 Ga0207657_103122362 155
785 3300025921 Ga0207652_10009867 Ga0207652_100098674 155
786 3300025922 Ga0207646_11103108 Ga0207646_111031081 155
787 3300025925 Ga0207650_10615567 Ga0207650_106155672 155
788 3300025927 Ga0207687_10030722 Ga0207687_100307223 155
789 3300025934 Ga0207686_10007420 Ga0207686_100074204 155
790 3300025934 Ga0207686_10049528 Ga0207686_100495281 155
791 3300025935 Ga0207709_10001408 Ga0207709_100014082 155
792 3300025935 Ga0207709_10161383 Ga0207709_101613832 155
793 3300025936 Ga0207670_10051331 Ga0207670_100513312 155
794 3300025936 Ga0207670_10299993 Ga0207670_102999932 155
795 3300025938 Ga0207704_10009742 Ga0207704_100097424 155
796 3300025938 Ga0207704_10169081 Ga0207704_101690812 155
797 3300025938 Ga0207704_11338728 Ga0207704_113387281 155
798 3300025941 Ga0207711_10264947 Ga0207711_102649472 155
799 3300025941 Ga0207711_10526631 Ga0207711_105266312 155
800 3300025942 Ga0207689_10000376 Ga0207689_100003763 155
801 3300025942 Ga0207689_10003070 Ga0207689_100030709 155
802 3300025949 Ga0207667_10070136 Ga0207667_100701364 155
803 3300025949 Ga0207667_10212080 Ga0207667_102120802 155
804 3300025960 Ga0207651_10279266 Ga0207651_102792661 155
805 3300025960 Ga0207651_10550239 Ga0207651_105502391 155
806 3300025961 Ga0207712_10212602 Ga0207712_102126022 155
807 3300025972 Ga0207668_10580070 Ga0207668_105800702 155
808 3300025981 Ga0207640_10006997 Ga0207640_100069974 155
809 3300025986 Ga0207658_10262765 Ga0207658_102627652 155
810 3300026023 Ga0207677_10003904 Ga0207677_100039044 155
811 3300026023 Ga0207677_10090834 Ga0207677_100908342 155
812 3300026023 Ga0207677_10667672 Ga0207677_106676722 155
813 3300026035 Ga0207703_10003689 Ga0207703_100036893 155
814 3300026035 Ga0207703_10193101 Ga0207703_101931012 155
815 3300026035 Ga0207703_10345043 Ga0207703_103450432 155
816 3300026035 Ga0207703_10402959 Ga0207703_104029592 155
817 3300026035 Ga0207703_11038591 Ga0207703_110385911 155
818 3300026041 Ga0207639_10060156 Ga0207639_100601563 155
819 3300026041 Ga0207639_10167638 Ga0207639_101676382 155
820 3300026075 Ga0207708_10322349 Ga0207708_103223492 155
821 3300026078 Ga0207702_10098663 Ga0207702_100986632 155
822 3300026078 Ga0207702_10228910 Ga0207702_102289102 155
823 3300026078 Ga0207702_10508597 Ga0207702_105085972 155
824 3300026088 Ga0207641_10726389 Ga0207641_107263892 155
825 3300026089 Ga0207648_10032928 Ga0207648_100329284 155
826 3300026089 Ga0207648_10057472 Ga0207648_100574723 155
827 3300026095 Ga0207676_10024443 Ga0207676_100244434 155
828 3300026095 Ga0207676_10627899 Ga0207676_106278992 155
829 3300026116 Ga0207674_10028098 Ga0207674_100280983 155
830 3300026116 Ga0207674_10972161 Ga0207674_109721612 155
831 3300026118 Ga0207675_100048496 Ga0207675_1000484963 155
832 3300026118 Ga0207675_100083503 Ga0207675_1000835032 155
833 3300026121 Ga0207683_10151638 Ga0207683_101516382 155
834 3300026121 Ga0207683_10564800 Ga0207683_105648002 155
835 3300026142 Ga0207698_10105200 Ga0207698_101052002 155
836 3300026142 Ga0207698_11545225 Ga0207698_115452251 155
837 3300027907 Ga0207428_10012800 Ga0207428_100128002 155
838 3300027907 Ga0207428_10088601 Ga0207428_100886012 155
839 3300028379 Ga0268266_10492219 Ga0268266_104922192 155
840 3300028380 Ga0268265_10029590 Ga0268265_100295902 155
841 3300028380 Ga0268265_11150833 Ga0268265_111508332 155
842 3300028381 Ga0268264_10032986 Ga0268264_100329862 155
843 3300028381 Ga0268264_10279564 Ga0268264_102795642 155
844 3300028381 Ga0268264_10332921 Ga0268264_103329212 155
845 3300031456 Ga0307513_10481528 Ga0307513_104815282 155
846 3300031548 Ga0307408_101528249 Ga0307408_1015282492 155
847 3300034817 Ga0373948_0068906 Ga0373948_0068906_257_724 155
848 3300034819 Ga0373958_0015294 Ga0373958_0015294_839_1306 155
849 3300034957 Ga0373938_0027274 Ga0373938_0027274_604_1071 155
850 3300035083 Ga0373926_0001421 Ga0373926_0001421_1674_2141 155
851 3300035088 Ga0373940_0000658 Ga0373940_0000658_2091_2558 155
852 3300035089 Ga0373944_0008050 Ga0373944_0008050_70_537 155
853 3300035092 Ga0373952_0006719 Ga0373952_0006719_1025_1492 155
854 3300035112 Ga0373932_0002462 Ga0373932_0002462_1590_2057 155
855 3300035113 Ga0373936_0029074 Ga0373936_0029074_23_490 155
856 3300035113 Ga0373936_0120651 Ga0373936_0120651_594_1064 155
857 3300035114 Ga0373939_0015512 Ga0373939_0015512_823_1290 155
858 3300035114 Ga0373939_0386107 Ga0373939_0386107_55_537 155
859 3300035115 Ga0373941_0014498 Ga0373941_0014498_1489_1956 155
860 3300035116 Ga0373945_0000803 Ga0373945_0000803_6923_7390 155
861 3300035117 Ga0373953_0007213 Ga0373953_0007213_339_809 155
862 3300035118 Ga0373954_0297813 Ga0373954_0297813_61_531 155
863 3300035119 Ga0373956_0180535 Ga0373956_0180535_501_971 155
864 3300035170 Ga0373943_0061504 Ga0373943_0061504_800_1279 155
865 3300035171 Ga0373946_0028087 Ga0373946_0028087_60_527 155
866 3300035172 Ga0373955_0068382 Ga0373955_0068382_797_1267 155
867 3300035207 Ga0373942_0057096 Ga0373942_0057096_457_924 155
868 3300035241 Ga0373961_0019706 Ga0373961_0019706_300_767 155
869 3300035242 Ga0373962_0002511 Ga0373962_0002511_1085_1552 155
870 3300035410 Ga0373924_0017690 Ga0373924_0017690_1745_2215 155
871 3300035691 Ga0373931_0001493 Ga0373931_0001493_2991_3458 155
872 3300035691 Ga0373931_0021061 Ga0373931_0021061_1485_1964 155
873 3300035692 Ga0373935_0021405 Ga0373935_0021405_2599_3066 155
874 3300035695 Ga0373927_0004507 Ga0373927_0004507_1685_2152 155
875 3300035724 Ga0373933_0006503 Ga0373933_0006503_1688_2158 155
876 3300035725 Ga0373947_0019034 Ga0373947_0019034_2555_3022 155
877 3300036401 Ga0373937_0011656 Ga0373937_0011656_4775_5245 155
878 3300037068 Ga0373925_0112428 Ga0373925_0112428_689_1156 155
879 3300042437 Ga0439444_0000648 Ga0439444_0000648_3368_3835 155
880 3300042876 Ga0451577_0121570 Ga0451577_0121570_1030_1497 155
881 3300045051 Ga0451576_0005020 Ga0451576_0005020_13857_14324 155
882 3300045051 Ga0451576_0191105 Ga0451576_0191105_755_1222 155
883 3300045051 Ga0451576_0195488 Ga0451576_0195488_755_1222 155
884 3300045051 Ga0451576_1344618 Ga0451576_1344618_35_502 155
885 3300045051 Ga0451576_1516540 Ga0451576_1516540_161_628 155
886 3300046455 Ga0495603_0002444 Ga0495603_0002444_4933_5400 155
887 3300046463 Ga0495653_0441880 Ga0495653_0441880_109_579 155
888 3300046472 Ga0495580_0017020 Ga0495580_0017020_57_524 155
889 3300046473 Ga0495582_0006969 Ga0495582_0006969_1674_2141 155
890 3300046475 Ga0495639_0057626 Ga0495639_0057626_919_1386 155
891 3300046511 Ga0495608_0134577 Ga0495608_0134577_92_565 155
892 3300046535 Ga0495586_0016097 Ga0495586_0016097_2419_2886 155
893 3300046539 Ga0495621_0123686 Ga0495621_0123686_509_979 155
894 3300046557 Ga0495622_0067906 Ga0495622_0067906_924_1391 155
895 3300046615 Ga0495656_0046959 Ga0495656_0046959_186_665 155
896 3300046663 Ga0495635_0310646 Ga0495635_0310646_168_638 155
897 3300046681 Ga0495647_0000090 Ga0495647_0000090_4326_4793 155
898 3300046683 Ga0495658_0007437 Ga0495658_0007437_4418_4885 155
899 3300047315 Ga0495581_0073293 Ga0495581_0073293_1150_1617 155
900 3300047319 Ga0495674_0611190 Ga0495674_0611190_303_773 155
901 3300047320 Ga0495672_0372644 Ga0495672_0372644_142_615 155
902 3300047321 Ga0495676_0016777 Ga0495676_0016777_2864_3331 155
903 3300047322 Ga0495680_0075253 Ga0495680_0075253_1863_2333 155
904 3300047322 Ga0495680_0624314 Ga0495680_0624314_163_636 155
905 3300047445 Ga0495677_0074775 Ga0495677_0074775_47_526 155
906 3300049568 Ga0501031_0952817 Ga0501031_0952817_30_497 155
907 3300049570 Ga0501033_0539639 Ga0501033_0539639_218_694 155
908 3300049572 Ga0501036_0056260 Ga0501036_0056260_1137_1613 155
909 3300049575 Ga0501039_0600088 Ga0501039_0600088_198_674 155
910 3300049591 Ga0501075_0254676 Ga0501075_0254676_716_1192 155
911 3300049741 Ga0501079_0097776 Ga0501079_0097776_267_743 155
912 3300049742 Ga0501080_0101151 Ga0501080_0101151_789_1262 155
913 3300050507 nmdc:mga05p37_21952_c1 nmdc:mga05p37_21952_c1_6361_6828 155
914 3300050507 nmdc:mga05p37_485301_c1 nmdc:mga05p37_485301_c1_202_672 155
915 3300050508 nmdc:mga09592_10611_c1 nmdc:mga09592_10611_c1_6346_6813 155
916 3300050508 nmdc:mga09592_248719_c1 nmdc:mga09592_248719_c1_944_1414 155
917 3300050509 nmdc:mga0qj67_52391_c1 nmdc:mga0qj67_52391_c1_1206_1691 155
918 3300050511 nmdc:mga08y16_138251_c1 nmdc:mga08y16_138251_c1_1916_2383 155
919 3300050511 nmdc:mga08y16_15715_c1 nmdc:mga08y16_15715_c1_2904_3371 155
920 3300050512 nmdc:mga0n895_12822_c1 nmdc:mga0n895_12822_c1_5276_5743 155
921 3300050513 nmdc:mga0rr50_3216_c1 nmdc:mga0rr50_3216_c1_720_1187 155
922 3300050513 nmdc:mga0rr50_665660_c1 nmdc:mga0rr50_665660_c1_192_665 155
923 3300050514 nmdc:mga08x19_5960_c1 nmdc:mga08x19_5960_c1_4685_5152 155
924 3300050514 nmdc:mga08x19_750869_c1 nmdc:mga08x19_750869_c1_32_505 155
925 3300050515 nmdc:mga0a205_1704_c1 nmdc:mga0a205_1704_c1_12336_12803 155
926 3300050515 nmdc:mga0a205_710166_c1 nmdc:mga0a205_710166_c1_63_530 155
927 3300053084 Ga0495595_0632316 Ga0495595_0632316_51_521 155
928 3300054114 Ga0501084_0068968 Ga0501084_0068968_576_1052 155
929 3300060353 Ga0501082_0026853 Ga0501082_0026853_4035_4508 155
930 3300060353 Ga0501082_0717060 Ga0501082_0717060_69_536 155
931 3300061734 Ga0530510_0627618 Ga0530510_0627618_186_662 155

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00258

Flavodoxin_1

Flavodoxin

45

180

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4oxx-assembly1.cif.gz_A crystal structure of cindoxin, surface entropy reduction mutant 0.9177 1 149
2m6s-assembly1.cif.gz_A holo_yqca 0.9068 2 147
2hnb-assembly1.cif.gz_A solution structure of a bacterial holo-flavodoxin 0.891 3 146
4oxx-assembly1.cif.gz_A crystal structure of cindoxin, surface entropy reduction mutant 0.8893 1 149
1ykg-assembly1.cif.gz_A solution structure of the flavodoxin-like domain from the escherichia coli sulfite reductase 0.8866 4 151
ID Description Score Start End Superfamily
af_P03817_1_147_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9428 3 148 3.40.50.360
4oxxA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9177 1 149 3.40.50.360
af_P03817_1_147_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9121 3 148 3.40.50.360
2m6sA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9068 2 147 3.40.50.360
af_O94613_1_159_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8935 2 150 3.40.50.360
ID Description Score Start End GO Terms
AF-A0A1F4EK06-F1-model_v4 Nitric oxide synthase 0.987 1 154 GO:0005829
GO:0010181
GO:0016491
GO:0050660
AF-A0A536T2F2-F1-model_v4 Nitric oxide synthase 0.9765 35 154 GO:0005829
GO:0010181
GO:0016491
GO:0050660
AF-A0A1F4EK06-F1-model_v4 Nitric oxide synthase 0.9745 1 154 GO:0005829
GO:0010181
GO:0016491
GO:0050660
AF-A0A536VWD1-F1-model_v4 Nitric oxide synthase 0.972 1 154 GO:0005829
GO:0010181
GO:0016491
GO:0050660
AF-A0A522J2I4-F1-model_v4 Nitric oxide synthase 0.9698 1 148 GO:0005829
GO:0010181
GO:0016491
GO:0050660

Feature Viewer

pLDDT pTM Quality
93.98 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map