F486052
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 931 | 357 | 931 | 158 |
Family's Representative Sequence
| Representative Sequence | 3300049571|Ga0501034_0000581|Ga0501034_0000581_9882_10472 |
| Length | 196 |
| Sequence | MKPPDMQDIARLVTALQDITSIIIGHNGATSTQAGGSDKMLDLKILVGTQTGVAQLVAQEIELRLDGDDVRVTTALMEDVDLSVFDDDAVFLVCTSTYGQGDVPDSAKAFYEDIVRKRPDLSAVRYGLIGLGDKGTHGATFCFAAKKFDKILGELGARRIGEPLFNDSNTHLPEDEAAEWVEGWIVLCREKVGQAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 65 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 66 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 67 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 68 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 69 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 70 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 75 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 76 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 77 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 78 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 79 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 80 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 81 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 82 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 85 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 86 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 87 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 102 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 179 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 183 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 184 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 185 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 186 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 187 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 188 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 189 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 190 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 191 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 192 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 193 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 194 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 195 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 196 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 197 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 198 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 199 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 200 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 201 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 202 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 203 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 204 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 205 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 206 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 207 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 208 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 209 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 210 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 211 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 212 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 213 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 214 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 215 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 216 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 217 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 218 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 219 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 220 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 221 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 222 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 223 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 224 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 225 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 226 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 227 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 228 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 229 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 230 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 231 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 232 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 233 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 234 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 235 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 236 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 237 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 238 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 239 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 240 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 241 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 242 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 243 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 244 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 245 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 246 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 247 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 248 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 249 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 250 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 251 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 252 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 253 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 301 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 302 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 303 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 330 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 331 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 336 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 337 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 353 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 355 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 356 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.79 |
| Metatranscriptomes | 0.21 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.21 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 99.68 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.11 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065704_10041276 | 3300005289 | Unclassified | 988 |
| 2 | Ga0065707_10009454 | 3300005295 | Bacteria | 2622 |
| 3 | Ga0065707_10330711 | 3300005295 | Unclassified | 950 |
| 4 | Ga0070683_100096140 | 3300005329 | Bacteria | 2786 |
| 5 | Ga0070683_100394875 | 3300005329 | Bacteria | 1319 |
| 6 | Ga0070690_100000758 | 3300005330 | Bacteria | 16523 |
| 7 | Ga0070690_100000906 | 3300005330 | Bacteria | 15097 |
| 8 | Ga0070690_100170184 | 3300005330 | Bacteria | 1499 |
| 9 | Ga0070690_100179335 | 3300005330 | Bacteria | 1463 |
| 10 | Ga0070670_100765812 | 3300005331 | Bacteria | 870 |
| 11 | Ga0070670_101020046 | 3300005331 | Bacteria | 753 |
| 12 | Ga0070677_10159944 | 3300005333 | Bacteria | 1056 |
| 13 | Ga0068869_100001703 | 3300005334 | Bacteria | 13138 |
| 14 | Ga0068869_100001795 | 3300005334 | Bacteria | 12871 |
| 15 | Ga0068869_100006074 | 3300005334 | Bacteria | 7635 |
| 16 | Ga0068869_100025130 | 3300005334 | Bacteria | 4133 |
| 17 | Ga0068869_100305007 | 3300005334 | Unclassified | 1287 |
| 18 | Ga0070666_10183799 | 3300005335 | Bacteria | 1467 |
| 19 | Ga0070680_100024647 | 3300005336 | Bacteria | 4808 |
| 20 | Ga0070680_100195119 | 3300005336 | Unclassified | 1707 |
| 21 | Ga0070680_100329957 | 3300005336 | Bacteria | 1296 |
| 22 | Ga0070680_101036712 | 3300005336 | Bacteria | 709 |
| 23 | Ga0070682_100004264 | 3300005337 | Bacteria | 7931 |
| 24 | Ga0068868_100000169 | 3300005338 | Bacteria | 42949 |
| 25 | Ga0068868_100117065 | 3300005338 | Bacteria | 2171 |
| 26 | Ga0068868_100164551 | 3300005338 | Bacteria | 1834 |
| 27 | Ga0068868_100181578 | 3300005338 | Bacteria | 1746 |
| 28 | Ga0068868_100613804 | 3300005338 | Bacteria | 965 |
| 29 | Ga0070660_100272244 | 3300005339 | Bacteria | 1384 |
| 30 | Ga0070689_100005385 | 3300005340 | Bacteria | 8729 |
| 31 | Ga0070689_100077140 | 3300005340 | Bacteria | 2611 |
| 32 | Ga0070689_100092168 | 3300005340 | Bacteria | 2390 |
| 33 | Ga0070689_100163455 | 3300005340 | Bacteria | 1801 |
| 34 | Ga0070689_100513304 | 3300005340 | Bacteria | 1028 |
| 35 | Ga0070689_100680869 | 3300005340 | Unclassified | 897 |
| 36 | Ga0070691_10002837 | 3300005341 | Bacteria | 7750 |
| 37 | Ga0070691_10020766 | 3300005341 | Bacteria | 3035 |
| 38 | Ga0070691_10246292 | 3300005341 | Unclassified | 957 |
| 39 | Ga0070691_10800460 | 3300005341 | Unclassified | 574 |
| 40 | Ga0070687_100000112 | 3300005343 | Bacteria | 27473 |
| 41 | Ga0070687_100139265 | 3300005343 | Bacteria | 1411 |
| 42 | Ga0070687_100150179 | 3300005343 | Bacteria | 1367 |
| 43 | Ga0070687_100176990 | 3300005343 | Bacteria | 1274 |
| 44 | Ga0070687_100446006 | 3300005343 | Bacteria | 860 |
| 45 | Ga0070661_100072196 | 3300005344 | Bacteria | 2540 |
| 46 | Ga0070692_10000260 | 3300005345 | Bacteria | 14689 |
| 47 | Ga0070692_10008357 | 3300005345 | Bacteria | 4615 |
| 48 | Ga0070692_10232897 | 3300005345 | Bacteria | 1094 |
| 49 | Ga0070692_10288351 | 3300005345 | Bacteria | 998 |
| 50 | Ga0070692_10340507 | 3300005345 | Bacteria | 929 |
| 51 | Ga0070668_100011505 | 3300005347 | Bacteria | 6589 |
| 52 | Ga0070669_100013917 | 3300005353 | Bacteria | 5721 |
| 53 | Ga0070675_100125120 | 3300005354 | Bacteria | 2187 |
| 54 | Ga0070674_100026595 | 3300005356 | Bacteria | 3782 |
| 55 | Ga0070674_100387381 | 3300005356 | Bacteria | 1139 |
| 56 | Ga0070674_100832461 | 3300005356 | Unclassified | 799 |
| 57 | Ga0070673_100420163 | 3300005364 | Bacteria | 1199 |
| 58 | Ga0070673_100699443 | 3300005364 | Bacteria | 931 |
| 59 | Ga0070673_100708229 | 3300005364 | Bacteria | 925 |
| 60 | Ga0070673_101725593 | 3300005364 | Unclassified | 593 |
| 61 | Ga0070688_100572513 | 3300005365 | Unclassified | 861 |
| 62 | Ga0070667_100209649 | 3300005367 | Bacteria | 1731 |
| 63 | Ga0070709_10312919 | 3300005434 | Bacteria | 1150 |
| 64 | Ga0070709_11314962 | 3300005434 | Unclassified | 583 |
| 65 | Ga0070714_100156934 | 3300005435 | Bacteria | 2055 |
| 66 | Ga0070713_100065706 | 3300005436 | Bacteria | 3049 |
| 67 | Ga0070701_10003531 | 3300005438 | Bacteria | 6202 |
| 68 | Ga0070701_10096270 | 3300005438 | Bacteria | 1631 |
| 69 | Ga0070701_10201137 | 3300005438 | Bacteria | 1178 |
| 70 | Ga0070711_100347503 | 3300005439 | Unclassified | 1192 |
| 71 | Ga0070705_100011432 | 3300005440 | Bacteria | 4478 |
| 72 | Ga0070705_100027713 | 3300005440 | Bacteria | 3095 |
| 73 | Ga0070705_100067286 | 3300005440 | Bacteria | 2152 |
| 74 | Ga0070705_100212536 | 3300005440 | Bacteria | 1334 |
| 75 | Ga0070705_100320451 | 3300005440 | Bacteria | 1119 |
| 76 | Ga0070705_100336229 | 3300005440 | Bacteria | 1096 |
| 77 | Ga0070705_100530481 | 3300005440 | Unclassified | 899 |
| 78 | Ga0070700_100011261 | 3300005441 | Bacteria | 4951 |
| 79 | Ga0070700_100988667 | 3300005441 | Bacteria | 691 |
| 80 | Ga0070700_101102733 | 3300005441 | Bacteria | 658 |
| 81 | Ga0070694_100005764 | 3300005444 | Bacteria | 7513 |
| 82 | Ga0070694_100012756 | 3300005444 | Bacteria | 5234 |
| 83 | Ga0070694_100022323 | 3300005444 | Bacteria | 4055 |
| 84 | Ga0070694_100033291 | 3300005444 | Bacteria | 3390 |
| 85 | Ga0070694_100052880 | 3300005444 | Bacteria | 2747 |
| 86 | Ga0070694_100056900 | 3300005444 | Bacteria | 2657 |
| 87 | Ga0070694_100187862 | 3300005444 | Bacteria | 1532 |
| 88 | Ga0070694_100241896 | 3300005444 | Bacteria | 1362 |
| 89 | Ga0070694_100262057 | 3300005444 | Bacteria | 1311 |
| 90 | Ga0070694_100275286 | 3300005444 | Bacteria | 1281 |
| 91 | Ga0070694_100389461 | 3300005444 | Bacteria | 1089 |
| 92 | Ga0070694_101139573 | 3300005444 | Unclassified | 652 |
| 93 | Ga0070708_100064500 | 3300005445 | Bacteria | 3282 |
| 94 | Ga0070678_100107548 | 3300005456 | Bacteria | 2175 |
| 95 | Ga0070662_100096492 | 3300005457 | Bacteria | 2230 |
| 96 | Ga0070681_10000198 | 3300005458 | Bacteria | 47037 |
| 97 | Ga0070681_10001458 | 3300005458 | Bacteria | 20859 |
| 98 | Ga0070681_10087279 | 3300005458 | Bacteria | 3073 |
| 99 | Ga0070681_10277060 | 3300005458 | Bacteria | 1588 |
| 100 | Ga0070681_10398303 | 3300005458 | Bacteria | 1288 |
| 101 | Ga0070681_10588537 | 3300005458 | Bacteria | 1027 |
| 102 | Ga0068867_100001181 | 3300005459 | Bacteria | 17901 |
| 103 | Ga0068867_100009709 | 3300005459 | Bacteria | 6787 |
| 104 | Ga0068867_100011272 | 3300005459 | Bacteria | 6305 |
| 105 | Ga0068867_100033240 | 3300005459 | Bacteria | 3733 |
| 106 | Ga0068867_100136196 | 3300005459 | Bacteria | 1914 |
| 107 | Ga0070685_10290062 | 3300005466 | Unclassified | 1099 |
| 108 | Ga0070685_10638662 | 3300005466 | Unclassified | 770 |
| 109 | Ga0070685_10790286 | 3300005466 | Unclassified | 699 |
| 110 | Ga0070706_100448434 | 3300005467 | Bacteria | 1201 |
| 111 | Ga0070707_100450843 | 3300005468 | Bacteria | 1247 |
| 112 | Ga0070698_100048113 | 3300005471 | Bacteria | 4357 |
| 113 | Ga0070698_100125334 | 3300005471 | Bacteria | 2526 |
| 114 | Ga0070698_100912975 | 3300005471 | Bacteria | 824 |
| 115 | Ga0070699_100026976 | 3300005518 | Bacteria | 4954 |
| 116 | Ga0070699_100887389 | 3300005518 | Bacteria | 817 |
| 117 | Ga0070679_100021105 | 3300005530 | Bacteria | 6356 |
| 118 | Ga0070679_100047847 | 3300005530 | Bacteria | 4261 |
| 119 | Ga0070684_100012632 | 3300005535 | Bacteria | 6772 |
| 120 | Ga0070697_100064994 | 3300005536 | Bacteria | 2980 |
| 121 | Ga0070697_100296274 | 3300005536 | Bacteria | 1390 |
| 122 | Ga0068853_100036438 | 3300005539 | Bacteria | 4183 |
| 123 | Ga0068853_100076380 | 3300005539 | Bacteria | 2925 |
| 124 | Ga0068853_101279183 | 3300005539 | Bacteria | 709 |
| 125 | Ga0070686_100000683 | 3300005544 | Bacteria | 19702 |
| 126 | Ga0070686_100005999 | 3300005544 | Bacteria | 6742 |
| 127 | Ga0070686_100486760 | 3300005544 | Bacteria | 955 |
| 128 | Ga0070695_100017760 | 3300005545 | Bacteria | 4316 |
| 129 | Ga0070695_100021991 | 3300005545 | Bacteria | 3909 |
| 130 | Ga0070695_100060766 | 3300005545 | Bacteria | 2449 |
| 131 | Ga0070695_100097671 | 3300005545 | Bacteria | 1972 |
| 132 | Ga0070695_100151682 | 3300005545 | Unclassified | 1618 |
| 133 | Ga0070695_100662906 | 3300005545 | Bacteria | 825 |
| 134 | Ga0070695_100678394 | 3300005545 | Bacteria | 816 |
| 135 | Ga0070696_100003044 | 3300005546 | Bacteria | 11138 |
| 136 | Ga0070696_100007503 | 3300005546 | Bacteria | 7296 |
| 137 | Ga0070696_100071908 | 3300005546 | Bacteria | 2435 |
| 138 | Ga0070696_100083140 | 3300005546 | Bacteria | 2270 |
| 139 | Ga0070696_100181329 | 3300005546 | Unclassified | 1562 |
| 140 | Ga0070696_100355522 | 3300005546 | Bacteria | 1135 |
| 141 | Ga0070696_100410052 | 3300005546 | Unclassified | 1062 |
| 142 | Ga0070696_100565417 | 3300005546 | Unclassified | 913 |
| 143 | Ga0070696_101154530 | 3300005546 | Unclassified | 653 |
| 144 | Ga0070693_100030068 | 3300005547 | Bacteria | 2967 |
| 145 | Ga0070693_100115573 | 3300005547 | Unclassified | 1657 |
| 146 | Ga0070693_100144158 | 3300005547 | Bacteria | 1502 |
| 147 | Ga0070693_100279272 | 3300005547 | Bacteria | 1118 |
| 148 | Ga0070693_100465503 | 3300005547 | Bacteria | 890 |
| 149 | Ga0070665_101396693 | 3300005548 | Bacteria | 709 |
| 150 | Ga0070704_100001415 | 3300005549 | Bacteria | 12797 |
| 151 | Ga0070704_100003271 | 3300005549 | Bacteria | 9259 |
| 152 | Ga0070704_100008163 | 3300005549 | Bacteria | 6263 |
| 153 | Ga0070704_100152996 | 3300005549 | Unclassified | 1816 |
| 154 | Ga0070704_100243771 | 3300005549 | Bacteria | 1472 |
| 155 | Ga0070704_100477051 | 3300005549 | Bacteria | 1079 |
| 156 | Ga0070704_100536038 | 3300005549 | Bacteria | 1021 |
| 157 | Ga0070704_100616783 | 3300005549 | Bacteria | 955 |
| 158 | Ga0070704_100660249 | 3300005549 | Bacteria | 924 |
| 159 | Ga0068855_100053051 | 3300005563 | Bacteria | 4771 |
| 160 | Ga0068855_100213198 | 3300005563 | Bacteria | 2169 |
| 161 | Ga0070664_100420499 | 3300005564 | Bacteria | 1224 |
| 162 | Ga0068857_100007353 | 3300005577 | Bacteria | 9482 |
| 163 | Ga0068857_100056140 | 3300005577 | Bacteria | 3495 |
| 164 | Ga0068857_100619314 | 3300005577 | Bacteria | 1024 |
| 165 | Ga0068854_100003215 | 3300005578 | Bacteria | 10192 |
| 166 | Ga0068856_100096496 | 3300005614 | Bacteria | 2945 |
| 167 | Ga0068856_100126582 | 3300005614 | Bacteria | 2558 |
| 168 | Ga0068856_100178994 | 3300005614 | Bacteria | 2133 |
| 169 | Ga0068856_100548521 | 3300005614 | Bacteria | 1177 |
| 170 | Ga0070702_100003136 | 3300005615 | Bacteria | 7325 |
| 171 | Ga0070702_100014801 | 3300005615 | Bacteria | 3967 |
| 172 | Ga0070702_100223864 | 3300005615 | Bacteria | 1260 |
| 173 | Ga0070702_100277120 | 3300005615 | Bacteria | 1150 |
| 174 | Ga0068852_100134170 | 3300005616 | Bacteria | 2284 |
| 175 | Ga0068859_100040783 | 3300005617 | Bacteria | 4662 |
| 176 | Ga0068859_100073919 | 3300005617 | Bacteria | 3447 |
| 177 | Ga0068859_100076303 | 3300005617 | Bacteria | 3392 |
| 178 | Ga0068859_100814856 | 3300005617 | Unclassified | 1021 |
| 179 | Ga0068864_100030981 | 3300005618 | Bacteria | 4536 |
| 180 | Ga0068864_100082692 | 3300005618 | Bacteria | 2818 |
| 181 | Ga0068864_100303727 | 3300005618 | Bacteria | 1495 |
| 182 | Ga0068866_10002432 | 3300005718 | Bacteria | 7684 |
| 183 | Ga0068866_10007632 | 3300005718 | Bacteria | 4534 |
| 184 | Ga0068866_10055570 | 3300005718 | Unclassified | 2034 |
| 185 | Ga0068861_100001299 | 3300005719 | Bacteria | 15627 |
| 186 | Ga0068861_100013261 | 3300005719 | Bacteria | 5767 |
| 187 | Ga0068861_100364699 | 3300005719 | Bacteria | 1271 |
| 188 | Ga0068861_100375975 | 3300005719 | Bacteria | 1254 |
| 189 | Ga0068861_100949665 | 3300005719 | Unclassified | 818 |
| 190 | Ga0068861_100966944 | 3300005719 | Unclassified | 811 |
| 191 | Ga0068870_10019003 | 3300005840 | Bacteria | 3327 |
| 192 | Ga0068863_100247449 | 3300005841 | Bacteria | 1721 |
| 193 | Ga0068858_100011781 | 3300005842 | Bacteria | 8249 |
| 194 | Ga0068858_100035118 | 3300005842 | Bacteria | 4650 |
| 195 | Ga0068858_100136730 | 3300005842 | Bacteria | 2299 |
| 196 | Ga0068858_100379235 | 3300005842 | Bacteria | 1357 |
| 197 | Ga0068858_101080720 | 3300005842 | Bacteria | 787 |
| 198 | Ga0068860_100040479 | 3300005843 | Bacteria | 4453 |
| 199 | Ga0068860_100049251 | 3300005843 | Bacteria | 4013 |
| 200 | Ga0068860_100165741 | 3300005843 | Bacteria | 2133 |
| 201 | Ga0068860_100183967 | 3300005843 | Bacteria | 2020 |
| 202 | Ga0068860_100347596 | 3300005843 | Bacteria | 1459 |
| 203 | Ga0068862_100002444 | 3300005844 | Bacteria | 16490 |
| 204 | Ga0068862_100005336 | 3300005844 | Bacteria | 10766 |
| 205 | Ga0068862_100041133 | 3300005844 | Bacteria | 3932 |
| 206 | Ga0068862_100071645 | 3300005844 | Bacteria | 2992 |
| 207 | Ga0068862_100250993 | 3300005844 | Bacteria | 1612 |
| 208 | Ga0068862_100283152 | 3300005844 | Bacteria | 1520 |
| 209 | Ga0068862_101175879 | 3300005844 | Bacteria | 765 |
| 210 | Ga0068862_101186450 | 3300005844 | Bacteria | 761 |
| 211 | Ga0081539_10000842 | 3300005985 | Bacteria | 58746 |
| 212 | Ga0070717_10749087 | 3300006028 | Bacteria | 888 |
| 213 | Ga0070716_100004507 | 3300006173 | Bacteria | 6668 |
| 214 | Ga0075366_10219168 | 3300006195 | Unclassified | 1159 |
| 215 | Ga0097621_100008740 | 3300006237 | Bacteria | 7317 |
| 216 | Ga0097621_100056029 | 3300006237 | Bacteria | 3220 |
| 217 | Ga0097621_100218593 | 3300006237 | Bacteria | 1659 |
| 218 | Ga0097621_101175211 | 3300006237 | Unclassified | 722 |
| 219 | Ga0097621_101255051 | 3300006237 | Unclassified | 699 |
| 220 | Ga0068871_100008932 | 3300006358 | Bacteria | 7231 |
| 221 | Ga0068871_100014795 | 3300006358 | Bacteria | 5826 |
| 222 | Ga0068871_100017615 | 3300006358 | Bacteria | 5410 |
| 223 | Ga0075428_100008533 | 3300006844 | Bacteria | 11367 |
| 224 | Ga0075428_100017325 | 3300006844 | Bacteria | 7961 |
| 225 | Ga0075428_100027994 | 3300006844 | Bacteria | 6235 |
| 226 | Ga0075428_100099471 | 3300006844 | Bacteria | 3171 |
| 227 | Ga0075428_100175066 | 3300006844 | Bacteria | 2324 |
| 228 | Ga0075430_100003868 | 3300006846 | Bacteria | 12611 |
| 229 | Ga0075430_100022846 | 3300006846 | Bacteria | 5319 |
| 230 | Ga0075430_100025385 | 3300006846 | Bacteria | 5041 |
| 231 | Ga0075430_100272277 | 3300006846 | Unclassified | 1401 |
| 232 | Ga0075430_100798627 | 3300006846 | Bacteria | 778 |
| 233 | Ga0075431_100012828 | 3300006847 | Bacteria | 8459 |
| 234 | Ga0075431_100227291 | 3300006847 | Bacteria | 1902 |
| 235 | Ga0075431_100295201 | 3300006847 | Bacteria | 1638 |
| 236 | Ga0075433_10001178 | 3300006852 | Bacteria | 18995 |
| 237 | Ga0075434_100000073 | 3300006871 | Bacteria | 52987 |
| 238 | Ga0075434_100001217 | 3300006871 | Bacteria | 21379 |
| 239 | Ga0075434_100036600 | 3300006871 | Bacteria | 4855 |
| 240 | Ga0075434_100638907 | 3300006871 | Bacteria | 1083 |
| 241 | Ga0075434_101294397 | 3300006871 | Unclassified | 740 |
| 242 | Ga0075434_101492886 | 3300006871 | Bacteria | 685 |
| 243 | Ga0075429_100000832 | 3300006880 | Bacteria | 24219 |
| 244 | Ga0075429_100005024 | 3300006880 | Bacteria | 11389 |
| 245 | Ga0075429_100173918 | 3300006880 | Bacteria | 1886 |
| 246 | Ga0075429_100178209 | 3300006880 | Bacteria | 1862 |
| 247 | Ga0075429_101226563 | 3300006880 | Unclassified | 654 |
| 248 | Ga0068865_100002425 | 3300006881 | Bacteria | 11015 |
| 249 | Ga0068865_100002861 | 3300006881 | Bacteria | 10282 |
| 250 | Ga0068865_100008105 | 3300006881 | Bacteria | 6483 |
| 251 | Ga0068865_101028399 | 3300006881 | Unclassified | 722 |
| 252 | Ga0068865_101889057 | 3300006881 | Bacteria | 541 |
| 253 | Ga0075436_100000205 | 3300006914 | Bacteria | 36621 |
| 254 | Ga0075436_100003082 | 3300006914 | Bacteria | 11419 |
| 255 | Ga0075436_100013578 | 3300006914 | Bacteria | 5578 |
| 256 | Ga0075436_100090711 | 3300006914 | Bacteria | 2125 |
| 257 | Ga0075436_100300374 | 3300006914 | Unclassified | 1151 |
| 258 | Ga0075436_100375168 | 3300006914 | Unclassified | 1028 |
| 259 | Ga0097620_100040783 | 3300006931 | Bacteria | 4662 |
| 260 | Ga0097620_100073916 | 3300006931 | Bacteria | 3447 |
| 261 | Ga0097620_100076300 | 3300006931 | Bacteria | 3392 |
| 262 | Ga0097620_100814887 | 3300006931 | Unclassified | 1021 |
| 263 | Ga0075435_100000549 | 3300007076 | Bacteria | 23038 |
| 264 | Ga0075435_100031439 | 3300007076 | Bacteria | 4182 |
| 265 | Ga0075435_100081861 | 3300007076 | Bacteria | 2652 |
| 266 | Ga0075435_100160136 | 3300007076 | Unclassified | 1895 |
| 267 | Ga0075435_100630813 | 3300007076 | Bacteria | 930 |
| 268 | Ga0099794_10018805 | 3300007265 | Bacteria | 3102 |
| 269 | Ga0099794_10026051 | 3300007265 | Bacteria | 2700 |
| 270 | Ga0099794_10097540 | 3300007265 | Bacteria | 1464 |
| 271 | Ga0099794_10165686 | 3300007265 | Bacteria | 1125 |
| 272 | Ga0099794_10249705 | 3300007265 | Bacteria | 915 |
| 273 | Ga0099794_10291906 | 3300007265 | Unclassified | 844 |
| 274 | Ga0099794_10544055 | 3300007265 | Bacteria | 613 |
| 275 | Ga0099795_10330843 | 3300007788 | Bacteria | 677 |
| 276 | Ga0099795_10636159 | 3300007788 | Unclassified | 510 |
| 277 | Ga0105250_10055044 | 3300009092 | Unclassified | 1596 |
| 278 | Ga0105240_10584684 | 3300009093 | Bacteria | 1231 |
| 279 | Ga0111539_10023101 | 3300009094 | Bacteria | 7638 |
| 280 | Ga0111539_10046142 | 3300009094 | Bacteria | 5214 |
| 281 | Ga0111539_10047339 | 3300009094 | Bacteria | 5139 |
| 282 | Ga0111539_10047790 | 3300009094 | Bacteria | 5113 |
| 283 | Ga0111539_10087485 | 3300009094 | Bacteria | 3660 |
| 284 | Ga0111539_10554603 | 3300009094 | Bacteria | 1338 |
| 285 | Ga0111539_10592557 | 3300009094 | Bacteria | 1291 |
| 286 | Ga0105245_10000259 | 3300009098 | Bacteria | 50388 |
| 287 | Ga0105245_10002540 | 3300009098 | Bacteria | 16450 |
| 288 | Ga0105245_10020740 | 3300009098 | Bacteria | 5761 |
| 289 | Ga0105245_10060315 | 3300009098 | Bacteria | 3416 |
| 290 | Ga0105247_10111952 | 3300009101 | Bacteria | 1758 |
| 291 | Ga0114129_10002896 | 3300009147 | Bacteria | 24008 |
| 292 | Ga0114129_10184031 | 3300009147 | Bacteria | 2841 |
| 293 | Ga0114129_10332533 | 3300009147 | Bacteria | 2017 |
| 294 | Ga0114129_10384053 | 3300009147 | Bacteria | 1854 |
| 295 | Ga0114129_10729544 | 3300009147 | Bacteria | 1270 |
| 296 | Ga0114129_12479601 | 3300009147 | Unclassified | 620 |
| 297 | Ga0114129_12650695 | 3300009147 | Unclassified | 598 |
| 298 | Ga0105243_10015069 | 3300009148 | Bacteria | 5851 |
| 299 | Ga0105243_10015877 | 3300009148 | Bacteria | 5695 |
| 300 | Ga0105243_10109524 | 3300009148 | Bacteria | 2307 |
| 301 | Ga0105243_10218457 | 3300009148 | Bacteria | 1683 |
| 302 | Ga0105243_10248657 | 3300009148 | Bacteria | 1586 |
| 303 | Ga0105243_10274551 | 3300009148 | Bacteria | 1515 |
| 304 | Ga0105242_10013543 | 3300009176 | Bacteria | 6308 |
| 305 | Ga0105242_10017789 | 3300009176 | Bacteria | 5546 |
| 306 | Ga0105242_10040775 | 3300009176 | Bacteria | 3741 |
| 307 | Ga0105242_10303439 | 3300009176 | Unclassified | 1458 |
| 308 | Ga0105242_10429485 | 3300009176 | Bacteria | 1240 |
| 309 | Ga0105248_10008114 | 3300009177 | Bacteria | 11527 |
| 310 | Ga0105248_10264831 | 3300009177 | Unclassified | 1935 |
| 311 | Ga0105248_10569339 | 3300009177 | Bacteria | 1278 |
| 312 | Ga0105237_10017011 | 3300009545 | Bacteria | 7548 |
| 313 | Ga0105238_11454569 | 3300009551 | Unclassified | 713 |
| 314 | Ga0105249_10008790 | 3300009553 | Bacteria | 8815 |
| 315 | Ga0105249_10045036 | 3300009553 | Bacteria | 4012 |
| 316 | Ga0105249_10065108 | 3300009553 | Bacteria | 3352 |
| 317 | Ga0105239_10086505 | 3300010375 | Bacteria | 3455 |
| 318 | Ga0105239_10299239 | 3300010375 | Bacteria | 1812 |
| 319 | Ga0105246_10182074 | 3300011119 | Unclassified | 1619 |
| 320 | Ga0157335_1019794 | 3300012492 | Bacteria | 630 |
| 321 | Ga0157369_10364019 | 3300013105 | Bacteria | 1501 |
| 322 | Ga0157369_10693125 | 3300013105 | Bacteria | 1049 |
| 323 | Ga0157374_10019265 | 3300013296 | Bacteria | 6037 |
| 324 | Ga0157374_12134839 | 3300013296 | Unclassified | 587 |
| 325 | Ga0157378_10011016 | 3300013297 | Bacteria | 7913 |
| 326 | Ga0157378_10016132 | 3300013297 | Bacteria | 6541 |
| 327 | Ga0163162_10223351 | 3300013306 | Bacteria | 2013 |
| 328 | Ga0163162_10497852 | 3300013306 | Unclassified | 1349 |
| 329 | Ga0163162_10645161 | 3300013306 | Bacteria | 1183 |
| 330 | Ga0163162_11086676 | 3300013306 | Unclassified | 906 |
| 331 | Ga0157372_10634216 | 3300013307 | Bacteria | 1245 |
| 332 | Ga0157372_11226250 | 3300013307 | Bacteria | 866 |
| 333 | Ga0157375_10018987 | 3300013308 | Bacteria | 6241 |
| 334 | Ga0157375_10358208 | 3300013308 | Bacteria | 1625 |
| 335 | Ga0157375_12059655 | 3300013308 | Bacteria | 679 |
| 336 | Ga0163163_10228692 | 3300014325 | Bacteria | 1909 |
| 337 | Ga0157380_10007220 | 3300014326 | Bacteria | 7876 |
| 338 | Ga0157380_10013330 | 3300014326 | Bacteria | 5991 |
| 339 | Ga0157380_10076719 | 3300014326 | Bacteria | 2721 |
| 340 | Ga0157380_10527773 | 3300014326 | Unclassified | 1153 |
| 341 | Ga0157380_11289430 | 3300014326 | Bacteria | 777 |
| 342 | Ga0157377_10151669 | 3300014745 | Bacteria | 1433 |
| 343 | Ga0157377_10333343 | 3300014745 | Bacteria | 1012 |
| 344 | Ga0157379_10064557 | 3300014968 | Bacteria | 3272 |
| 345 | Ga0157379_10089627 | 3300014968 | Unclassified | 2759 |
| 346 | Ga0157379_10305578 | 3300014968 | Bacteria | 1450 |
| 347 | Ga0157379_11282928 | 3300014968 | Unclassified | 707 |
| 348 | Ga0157376_10004961 | 3300014969 | Bacteria | 9280 |
| 349 | Ga0157376_10057987 | 3300014969 | Bacteria | 3242 |
| 350 | Ga0157376_10178381 | 3300014969 | Bacteria | 1940 |
| 351 | Ga0163161_10420652 | 3300017792 | Bacteria | 1075 |
| 352 | Ga0163161_11074484 | 3300017792 | Bacteria | 690 |
| 353 | Ga0206356_10307192 | 3300020070 | Bacteria | 746 |
| 354 | Ga0207653_10086539 | 3300025885 | Bacteria | 1092 |
| 355 | Ga0207682_10413005 | 3300025893 | Bacteria | 638 |
| 356 | Ga0207692_10323593 | 3300025898 | Bacteria | 944 |
| 357 | Ga0207642_10002932 | 3300025899 | Bacteria | 5339 |
| 358 | Ga0207642_10513112 | 3300025899 | Bacteria | 735 |
| 359 | Ga0207688_10154686 | 3300025901 | Bacteria | 1357 |
| 360 | Ga0207680_10184209 | 3300025903 | Bacteria | 1414 |
| 361 | Ga0207699_10188451 | 3300025906 | Bacteria | 1391 |
| 362 | Ga0207645_10049368 | 3300025907 | Bacteria | 2687 |
| 363 | Ga0207643_10013945 | 3300025908 | Bacteria | 4360 |
| 364 | Ga0207643_10147708 | 3300025908 | Bacteria | 1407 |
| 365 | Ga0207684_10552861 | 3300025910 | Bacteria | 985 |
| 366 | Ga0207707_10110099 | 3300025912 | Bacteria | 2407 |
| 367 | Ga0207695_10569337 | 3300025913 | Bacteria | 1014 |
| 368 | Ga0207671_10015443 | 3300025914 | Bacteria | 5977 |
| 369 | Ga0207663_10463019 | 3300025916 | Unclassified | 979 |
| 370 | Ga0207660_10023363 | 3300025917 | Bacteria | 4175 |
| 371 | Ga0207660_10062248 | 3300025917 | Bacteria | 2688 |
| 372 | Ga0207660_10106839 | 3300025917 | Bacteria | 2099 |
| 373 | Ga0207660_10425681 | 3300025917 | Unclassified | 1071 |
| 374 | Ga0207660_10956936 | 3300025917 | Unclassified | 699 |
| 375 | Ga0207662_10000106 | 3300025918 | Bacteria | 40137 |
| 376 | Ga0207662_10060345 | 3300025918 | Bacteria | 2274 |
| 377 | Ga0207662_10151910 | 3300025918 | Bacteria | 1473 |
| 378 | Ga0207662_10183190 | 3300025918 | Bacteria | 1348 |
| 379 | Ga0207662_11171181 | 3300025918 | Unclassified | 546 |
| 380 | Ga0207657_10312236 | 3300025919 | Bacteria | 1244 |
| 381 | Ga0207652_10009867 | 3300025921 | Bacteria | 7683 |
| 382 | Ga0207652_10100884 | 3300025921 | Bacteria | 2548 |
| 383 | Ga0207646_10677968 | 3300025922 | Bacteria | 922 |
| 384 | Ga0207646_11103108 | 3300025922 | Unclassified | 698 |
| 385 | Ga0207681_10005713 | 3300025923 | Bacteria | 7633 |
| 386 | Ga0207650_10615567 | 3300025925 | Bacteria | 914 |
| 387 | Ga0207659_10073547 | 3300025926 | Bacteria | 2502 |
| 388 | Ga0207687_10012762 | 3300025927 | Bacteria | 5489 |
| 389 | Ga0207687_10030722 | 3300025927 | Bacteria | 3624 |
| 390 | Ga0207687_10593501 | 3300025927 | Bacteria | 933 |
| 391 | Ga0207686_10003108 | 3300025934 | Bacteria | 8937 |
| 392 | Ga0207686_10007420 | 3300025934 | Bacteria | 5902 |
| 393 | Ga0207686_10049528 | 3300025934 | Bacteria | 2608 |
| 394 | Ga0207686_10256560 | 3300025934 | Bacteria | 1280 |
| 395 | Ga0207709_10001408 | 3300025935 | Bacteria | 16830 |
| 396 | Ga0207709_10020832 | 3300025935 | Bacteria | 3704 |
| 397 | Ga0207709_10039097 | 3300025935 | Bacteria | 2831 |
| 398 | Ga0207709_10161383 | 3300025935 | Bacteria | 1563 |
| 399 | Ga0207670_10034330 | 3300025936 | Bacteria | 3277 |
| 400 | Ga0207670_10051331 | 3300025936 | Bacteria | 2768 |
| 401 | Ga0207670_10071657 | 3300025936 | Unclassified | 2397 |
| 402 | Ga0207670_10110229 | 3300025936 | Bacteria | 1982 |
| 403 | Ga0207670_10151278 | 3300025936 | Bacteria | 1722 |
| 404 | Ga0207670_10299993 | 3300025936 | Bacteria | 1258 |
| 405 | Ga0207670_10326630 | 3300025936 | Bacteria | 1208 |
| 406 | Ga0207669_10029230 | 3300025937 | Bacteria | 3045 |
| 407 | Ga0207669_10373198 | 3300025937 | Unclassified | 1109 |
| 408 | Ga0207669_10793512 | 3300025937 | Unclassified | 785 |
| 409 | Ga0207704_10009742 | 3300025938 | Bacteria | 4652 |
| 410 | Ga0207704_10068056 | 3300025938 | Bacteria | 2243 |
| 411 | Ga0207704_10127713 | 3300025938 | Bacteria | 1754 |
| 412 | Ga0207704_10169081 | 3300025938 | Bacteria | 1565 |
| 413 | Ga0207704_11338728 | 3300025938 | Unclassified | 613 |
| 414 | Ga0207665_10007173 | 3300025939 | Bacteria | 7374 |
| 415 | Ga0207665_10186263 | 3300025939 | Unclassified | 1506 |
| 416 | Ga0207665_10873472 | 3300025939 | Unclassified | 713 |
| 417 | Ga0207691_10057731 | 3300025940 | Bacteria | 3531 |
| 418 | Ga0207711_10264947 | 3300025941 | Bacteria | 1580 |
| 419 | Ga0207711_10526631 | 3300025941 | Unclassified | 1102 |
| 420 | Ga0207689_10000376 | 3300025942 | Bacteria | 41990 |
| 421 | Ga0207689_10000558 | 3300025942 | Bacteria | 35566 |
| 422 | Ga0207689_10003070 | 3300025942 | Bacteria | 15386 |
| 423 | Ga0207689_10026651 | 3300025942 | Bacteria | 4841 |
| 424 | Ga0207689_10620262 | 3300025942 | Bacteria | 910 |
| 425 | Ga0207661_10524678 | 3300025944 | Bacteria | 1083 |
| 426 | Ga0207667_10070136 | 3300025949 | Bacteria | 3648 |
| 427 | Ga0207667_10212080 | 3300025949 | Bacteria | 1985 |
| 428 | Ga0207651_10214407 | 3300025960 | Bacteria | 1552 |
| 429 | Ga0207651_10250357 | 3300025960 | Bacteria | 1449 |
| 430 | Ga0207651_10279266 | 3300025960 | Bacteria | 1379 |
| 431 | Ga0207651_10550239 | 3300025960 | Bacteria | 1003 |
| 432 | Ga0207651_10836294 | 3300025960 | Bacteria | 817 |
| 433 | Ga0207712_10007303 | 3300025961 | Bacteria | 6971 |
| 434 | Ga0207712_10212602 | 3300025961 | Bacteria | 1541 |
| 435 | Ga0207668_10008880 | 3300025972 | Bacteria | 6011 |
| 436 | Ga0207668_10580070 | 3300025972 | Unclassified | 975 |
| 437 | Ga0207640_10006997 | 3300025981 | Bacteria | 6207 |
| 438 | Ga0207658_10262765 | 3300025986 | Bacteria | 1472 |
| 439 | Ga0207677_10003904 | 3300026023 | Bacteria | 7941 |
| 440 | Ga0207677_10090834 | 3300026023 | Bacteria | 2220 |
| 441 | Ga0207677_10399794 | 3300026023 | Bacteria | 1165 |
| 442 | Ga0207677_10667672 | 3300026023 | Bacteria | 919 |
| 443 | Ga0207677_10903151 | 3300026023 | Unclassified | 796 |
| 444 | Ga0207703_10003689 | 3300026035 | Bacteria | 12755 |
| 445 | Ga0207703_10193101 | 3300026035 | Bacteria | 1805 |
| 446 | Ga0207703_10345043 | 3300026035 | Bacteria | 1369 |
| 447 | Ga0207703_10402959 | 3300026035 | Bacteria | 1270 |
| 448 | Ga0207703_11038591 | 3300026035 | Bacteria | 787 |
| 449 | Ga0207639_10060156 | 3300026041 | Bacteria | 2930 |
| 450 | Ga0207639_10167638 | 3300026041 | Bacteria | 1857 |
| 451 | Ga0207708_10000362 | 3300026075 | Bacteria | 35576 |
| 452 | Ga0207708_10007750 | 3300026075 | Bacteria | 7952 |
| 453 | Ga0207708_10139805 | 3300026075 | Unclassified | 1898 |
| 454 | Ga0207708_10310191 | 3300026075 | Bacteria | 1285 |
| 455 | Ga0207708_10322349 | 3300026075 | Bacteria | 1261 |
| 456 | Ga0207708_10464336 | 3300026075 | Bacteria | 1056 |
| 457 | Ga0207708_10806333 | 3300026075 | Archaea | 808 |
| 458 | Ga0207702_10098663 | 3300026078 | Bacteria | 2573 |
| 459 | Ga0207702_10228910 | 3300026078 | Bacteria | 1736 |
| 460 | Ga0207702_10508597 | 3300026078 | Bacteria | 1175 |
| 461 | Ga0207641_10726389 | 3300026088 | Bacteria | 979 |
| 462 | Ga0207648_10000159 | 3300026089 | Bacteria | 69221 |
| 463 | Ga0207648_10008533 | 3300026089 | Bacteria | 9916 |
| 464 | Ga0207648_10032928 | 3300026089 | Bacteria | 4573 |
| 465 | Ga0207648_10057472 | 3300026089 | Bacteria | 3394 |
| 466 | Ga0207648_10119846 | 3300026089 | Bacteria | 2313 |
| 467 | Ga0207676_10024443 | 3300026095 | Bacteria | 4470 |
| 468 | Ga0207676_10330655 | 3300026095 | Bacteria | 1402 |
| 469 | Ga0207676_10627899 | 3300026095 | Bacteria | 1034 |
| 470 | Ga0207674_10028098 | 3300026116 | Bacteria | 5941 |
| 471 | Ga0207674_10138825 | 3300026116 | Bacteria | 2391 |
| 472 | Ga0207674_10972161 | 3300026116 | Bacteria | 818 |
| 473 | Ga0207675_100000068 | 3300026118 | Bacteria | 78105 |
| 474 | Ga0207675_100004506 | 3300026118 | Bacteria | 13456 |
| 475 | Ga0207675_100048496 | 3300026118 | Bacteria | 3964 |
| 476 | Ga0207675_100083503 | 3300026118 | Bacteria | 2996 |
| 477 | Ga0207675_100344164 | 3300026118 | Bacteria | 1460 |
| 478 | Ga0207675_100438531 | 3300026118 | Bacteria | 1293 |
| 479 | Ga0207675_101076762 | 3300026118 | Unclassified | 823 |
| 480 | Ga0207675_101805859 | 3300026118 | Bacteria | 630 |
| 481 | Ga0207683_10036881 | 3300026121 | Bacteria | 4257 |
| 482 | Ga0207683_10151638 | 3300026121 | Bacteria | 2092 |
| 483 | Ga0207683_10564800 | 3300026121 | Unclassified | 1052 |
| 484 | Ga0207698_10105200 | 3300026142 | Bacteria | 2351 |
| 485 | Ga0207698_11545225 | 3300026142 | Bacteria | 679 |
| 486 | Ga0209969_1020779 | 3300027360 | Bacteria | 978 |
| 487 | Ga0209967_1000884 | 3300027364 | Bacteria | 3844 |
| 488 | Ga0209981_1000310 | 3300027378 | Bacteria | 6258 |
| 489 | Ga0209981_1032075 | 3300027378 | Unclassified | 772 |
| 490 | Ga0209996_1018334 | 3300027395 | Bacteria | 971 |
| 491 | Ga0210000_1000624 | 3300027462 | Bacteria | 4851 |
| 492 | Ga0209995_1003506 | 3300027471 | Bacteria | 2498 |
| 493 | Ga0209995_1009839 | 3300027471 | Bacteria | 1549 |
| 494 | Ga0209995_1053600 | 3300027471 | Bacteria | 685 |
| 495 | Ga0209999_1002308 | 3300027543 | Bacteria | 3358 |
| 496 | Ga0209999_1036195 | 3300027543 | Bacteria | 921 |
| 497 | Ga0209983_1014604 | 3300027665 | Bacteria | 1618 |
| 498 | Ga0209588_1000881 | 3300027671 | Bacteria | 7625 |
| 499 | Ga0209588_1018434 | 3300027671 | Bacteria | 2173 |
| 500 | Ga0209588_1125882 | 3300027671 | Bacteria | 818 |
| 501 | Ga0209971_1057758 | 3300027682 | Bacteria | 939 |
| 502 | Ga0209966_1015486 | 3300027695 | Bacteria | 1432 |
| 503 | Ga0209974_10009659 | 3300027876 | Unclassified | 3272 |
| 504 | Ga0209974_10220301 | 3300027876 | Bacteria | 706 |
| 505 | Ga0207428_10012800 | 3300027907 | Bacteria | 7359 |
| 506 | Ga0207428_10071945 | 3300027907 | Bacteria | 2715 |
| 507 | Ga0207428_10072217 | 3300027907 | Bacteria | 2709 |
| 508 | Ga0207428_10075323 | 3300027907 | Bacteria | 2645 |
| 509 | Ga0207428_10088601 | 3300027907 | Bacteria | 2406 |
| 510 | Ga0268266_10492219 | 3300028379 | Bacteria | 1170 |
| 511 | Ga0268265_10021501 | 3300028380 | Bacteria | 4521 |
| 512 | Ga0268265_10025442 | 3300028380 | Bacteria | 4201 |
| 513 | Ga0268265_10029590 | 3300028380 | Bacteria | 3933 |
| 514 | Ga0268265_10107368 | 3300028380 | Bacteria | 2270 |
| 515 | Ga0268265_10257151 | 3300028380 | Bacteria | 1550 |
| 516 | Ga0268265_10581844 | 3300028380 | Bacteria | 1067 |
| 517 | Ga0268265_10815230 | 3300028380 | Bacteria | 911 |
| 518 | Ga0268265_11150833 | 3300028380 | Bacteria | 772 |
| 519 | Ga0268264_10032986 | 3300028381 | Bacteria | 4250 |
| 520 | Ga0268264_10077192 | 3300028381 | Bacteria | 2836 |
| 521 | Ga0268264_10279564 | 3300028381 | Bacteria | 1563 |
| 522 | Ga0268264_10332921 | 3300028381 | Bacteria | 1439 |
| 523 | Ga0268264_10539530 | 3300028381 | Bacteria | 1143 |
| 524 | Ga0265327_10044317 | 3300031251 | Bacteria | 2373 |
| 525 | Ga0307513_10481528 | 3300031456 | Bacteria | 961 |
| 526 | Ga0307408_100091441 | 3300031548 | Bacteria | 2298 |
| 527 | Ga0307408_100176698 | 3300031548 | Bacteria | 1709 |
| 528 | Ga0307408_100196788 | 3300031548 | Unclassified | 1628 |
| 529 | Ga0307408_101490570 | 3300031548 | Bacteria | 639 |
| 530 | Ga0307408_101528249 | 3300031548 | Bacteria | 632 |
| 531 | Ga0316575_10009403 | 3300031665 | Bacteria | 3580 |
| 532 | Ga0316579_10053730 | 3300031691 | Bacteria | 1887 |
| 533 | Ga0265342_10161351 | 3300031712 | Bacteria | 1239 |
| 534 | Ga0316578_10018325 | 3300031728 | Bacteria | 3834 |
| 535 | Ga0307412_10123067 | 3300031911 | Unclassified | 1871 |
| 536 | Ga0307412_10276573 | 3300031911 | Bacteria | 1316 |
| 537 | Ga0307412_10472482 | 3300031911 | Bacteria | 1038 |
| 538 | Ga0307416_100066483 | 3300032002 | Bacteria | 2968 |
| 539 | Ga0307416_100785157 | 3300032002 | Bacteria | 1047 |
| 540 | Ga0307416_102946849 | 3300032002 | Bacteria | 569 |
| 541 | Ga0307416_103419543 | 3300032002 | Unclassified | 531 |
| 542 | Ga0307414_11950188 | 3300032004 | Bacteria | 548 |
| 543 | Ga0307411_10381773 | 3300032005 | Bacteria | 1159 |
| 544 | Ga0307411_10435842 | 3300032005 | Bacteria | 1092 |
| 545 | Ga0316583_10033290 | 3300032133 | Bacteria | 1831 |
| 546 | Ga0316593_10019918 | 3300032168 | Bacteria | 2078 |
| 547 | Ga0373948_0068906 | 3300034817 | Bacteria | 790 |
| 548 | Ga0373958_0015294 | 3300034819 | Unclassified | 1353 |
| 549 | Ga0373958_0035460 | 3300034819 | Bacteria | 999 |
| 550 | Ga0373959_0007907 | 3300034820 | Bacteria | 1796 |
| 551 | Ga0373938_0027274 | 3300034957 | Bacteria | 1201 |
| 552 | Ga0373926_0001421 | 3300035083 | Bacteria | 7277 |
| 553 | Ga0373929_0037517 | 3300035085 | Bacteria | 1063 |
| 554 | Ga0373934_0000927 | 3300035086 | Bacteria | 10606 |
| 555 | Ga0373940_0000658 | 3300035088 | Bacteria | 5523 |
| 556 | Ga0373944_0008050 | 3300035089 | Bacteria | 2841 |
| 557 | Ga0373952_0006719 | 3300035092 | Bacteria | 2135 |
| 558 | Ga0373952_0073225 | 3300035092 | Bacteria | 861 |
| 559 | Ga0373923_0001061 | 3300035111 | Bacteria | 7527 |
| 560 | Ga0373932_0002462 | 3300035112 | Bacteria | 4676 |
| 561 | Ga0373936_0029074 | 3300035113 | Bacteria | 2174 |
| 562 | Ga0373936_0058554 | 3300035113 | Bacteria | 1569 |
| 563 | Ga0373936_0120651 | 3300035113 | Bacteria | 1120 |
| 564 | Ga0373939_0015512 | 3300035114 | Bacteria | 1995 |
| 565 | Ga0373939_0031855 | 3300035114 | Unclassified | 1528 |
| 566 | Ga0373939_0101195 | 3300035114 | Bacteria | 989 |
| 567 | Ga0373939_0386107 | 3300035114 | Bacteria | 577 |
| 568 | Ga0373941_0004938 | 3300035115 | Bacteria | 3107 |
| 569 | Ga0373941_0014498 | 3300035115 | Unclassified | 2107 |
| 570 | Ga0373941_0267156 | 3300035115 | Bacteria | 673 |
| 571 | Ga0373945_0000803 | 3300035116 | Bacteria | 9198 |
| 572 | Ga0373953_0002557 | 3300035117 | Bacteria | 5499 |
| 573 | Ga0373953_0007213 | 3300035117 | Bacteria | 3711 |
| 574 | Ga0373953_0386110 | 3300035117 | Bacteria | 615 |
| 575 | Ga0373954_0000025 | 3300035118 | Bacteria | 57365 |
| 576 | Ga0373954_0002423 | 3300035118 | Bacteria | 7813 |
| 577 | Ga0373954_0005281 | 3300035118 | Bacteria | 5580 |
| 578 | Ga0373954_0297813 | 3300035118 | Bacteria | 795 |
| 579 | Ga0373956_0001667 | 3300035119 | Bacteria | 9139 |
| 580 | Ga0373956_0001841 | 3300035119 | Bacteria | 8746 |
| 581 | Ga0373956_0180535 | 3300035119 | Bacteria | 998 |
| 582 | Ga0373957_0042858 | 3300035120 | Bacteria | 1708 |
| 583 | Ga0373957_0070108 | 3300035120 | Bacteria | 1369 |
| 584 | Ga0373960_0045252 | 3300035121 | Bacteria | 1288 |
| 585 | Ga0373960_0136965 | 3300035121 | Unclassified | 826 |
| 586 | Ga0373943_0061504 | 3300035170 | Bacteria | 1877 |
| 587 | Ga0373946_0028087 | 3300035171 | Bacteria | 2229 |
| 588 | Ga0373955_0068382 | 3300035172 | Bacteria | 1979 |
| 589 | Ga0373942_0002629 | 3300035207 | Bacteria | 4316 |
| 590 | Ga0373942_0057096 | 3300035207 | Unclassified | 1109 |
| 591 | Ga0373942_0220501 | 3300035207 | Unclassified | 635 |
| 592 | Ga0373961_0017229 | 3300035241 | Bacteria | 1871 |
| 593 | Ga0373961_0019706 | 3300035241 | Unclassified | 1775 |
| 594 | Ga0373961_0243589 | 3300035241 | Unclassified | 648 |
| 595 | Ga0373962_0002511 | 3300035242 | Bacteria | 4357 |
| 596 | Ga0373962_0052671 | 3300035242 | Bacteria | 1176 |
| 597 | Ga0316574_0014869 | 3300035398 | Bacteria | 4506 |
| 598 | Ga0373924_0006450 | 3300035410 | Bacteria | 4204 |
| 599 | Ga0373924_0017690 | 3300035410 | Bacteria | 2737 |
| 600 | Ga0373924_0485178 | 3300035410 | Bacteria | 555 |
| 601 | Ga0373931_0001493 | 3300035691 | Bacteria | 10064 |
| 602 | Ga0373931_0006170 | 3300035691 | Bacteria | 5588 |
| 603 | Ga0373931_0020035 | 3300035691 | Bacteria | 3344 |
| 604 | Ga0373931_0021061 | 3300035691 | Bacteria | 3268 |
| 605 | Ga0373931_0098259 | 3300035691 | Bacteria | 1643 |
| 606 | Ga0373931_0308281 | 3300035691 | Bacteria | 980 |
| 607 | Ga0373935_0003613 | 3300035692 | Bacteria | 9014 |
| 608 | Ga0373935_0021405 | 3300035692 | Bacteria | 3958 |
| 609 | Ga0373927_0004507 | 3300035695 | Bacteria | 9742 |
| 610 | Ga0373927_0010306 | 3300035695 | Bacteria | 6242 |
| 611 | Ga0373933_0006322 | 3300035724 | Bacteria | 6448 |
| 612 | Ga0373933_0006503 | 3300035724 | Bacteria | 6363 |
| 613 | Ga0373933_0081204 | 3300035724 | Bacteria | 1989 |
| 614 | Ga0373933_0091707 | 3300035724 | Bacteria | 1875 |
| 615 | Ga0373933_0492714 | 3300035724 | Bacteria | 803 |
| 616 | Ga0373947_0019034 | 3300035725 | Bacteria | 3956 |
| 617 | Ga0373937_0000296 | 3300036401 | Bacteria | 47231 |
| 618 | Ga0373937_0001026 | 3300036401 | Bacteria | 23613 |
| 619 | Ga0373937_0011656 | 3300036401 | Bacteria | 7715 |
| 620 | Ga0373937_0070854 | 3300036401 | Bacteria | 3215 |
| 621 | Ga0373937_0193158 | 3300036401 | Bacteria | 1913 |
| 622 | Ga0373937_0200648 | 3300036401 | Bacteria | 1875 |
| 623 | Ga0373937_0245262 | 3300036401 | Bacteria | 1688 |
| 624 | Ga0316582_0025338 | 3300036647 | Bacteria | 3560 |
| 625 | Ga0316584_0512087 | 3300036712 | Unclassified | 842 |
| 626 | Ga0373925_0003111 | 3300037068 | Bacteria | 13025 |
| 627 | Ga0373925_0112428 | 3300037068 | Bacteria | 2105 |
| 628 | Ga0373925_0161900 | 3300037068 | Bacteria | 1763 |
| 629 | Ga0436360_1341558 | 3300039438 | Bacteria | 1483 |
| 630 | Ga0439439_0054435 | 3300041406 | Bacteria | 1054 |
| 631 | Ga0439453_0011225 | 3300041408 | Bacteria | 1491 |
| 632 | Ga0439461_0010851 | 3300041410 | Bacteria | 1680 |
| 633 | Ga0439441_016169 | 3300042001 | Bacteria | 1328 |
| 634 | Ga0439451_015271 | 3300042009 | Unclassified | 1548 |
| 635 | Ga0439456_030254 | 3300042013 | Unclassified | 1158 |
| 636 | Ga0439446_0040964 | 3300042156 | Bacteria | 1364 |
| 637 | Ga0439446_0249041 | 3300042156 | Bacteria | 612 |
| 638 | Ga0439434_0000699 | 3300042435 | Bacteria | 9669 |
| 639 | Ga0439434_0044132 | 3300042435 | Bacteria | 1373 |
| 640 | Ga0439435_0008199 | 3300042436 | Bacteria | 2418 |
| 641 | Ga0439435_0022553 | 3300042436 | Bacteria | 1644 |
| 642 | Ga0439435_0055943 | 3300042436 | Unclassified | 1139 |
| 643 | Ga0439444_0000648 | 3300042437 | Bacteria | 4035 |
| 644 | Ga0439444_0007155 | 3300042437 | Bacteria | 1706 |
| 645 | Ga0439460_0025039 | 3300042461 | Unclassified | 1658 |
| 646 | Ga0450916_029269 | 3300042530 | Unclassified | 795 |
| 647 | Ga0451577_0121570 | 3300042876 | Bacteria | 2339 |
| 648 | Ga0451577_0948371 | 3300042876 | Bacteria | 774 |
| 649 | Ga0439440_0145382 | 3300042993 | Bacteria | 676 |
| 650 | Ga0466965_0054544 | 3300044683 | Bacteria | 1988 |
| 651 | Ga0466963_0454290 | 3300044694 | Bacteria | 904 |
| 652 | Ga0466963_0513667 | 3300044694 | Bacteria | 846 |
| 653 | Ga0451576_0005020 | 3300045051 | Bacteria | 16812 |
| 654 | Ga0451576_0163334 | 3300045051 | Bacteria | 2324 |
| 655 | Ga0451576_0191105 | 3300045051 | Bacteria | 2138 |
| 656 | Ga0451576_0195488 | 3300045051 | Bacteria | 2112 |
| 657 | Ga0451576_1312027 | 3300045051 | Bacteria | 754 |
| 658 | Ga0451576_1344618 | 3300045051 | Bacteria | 744 |
| 659 | Ga0451576_1460238 | 3300045051 | Unclassified | 711 |
| 660 | Ga0451576_1516540 | 3300045051 | Unclassified | 696 |
| 661 | Ga0466958_0882636 | 3300045836 | Unclassified | 583 |
| 662 | Ga0466967_0061026 | 3300045976 | Bacteria | 3344 |
| 663 | Ga0466967_1012436 | 3300045976 | Bacteria | 827 |
| 664 | Ga0495592_0029053 | 3300046454 | Bacteria | 4185 |
| 665 | Ga0495592_0048947 | 3300046454 | Bacteria | 3142 |
| 666 | Ga0495592_0186893 | 3300046454 | Bacteria | 1407 |
| 667 | Ga0495603_0002444 | 3300046455 | Bacteria | 10930 |
| 668 | Ga0495603_0316054 | 3300046455 | Unclassified | 897 |
| 669 | Ga0495629_0066799 | 3300046459 | Bacteria | 2510 |
| 670 | Ga0495629_0202804 | 3300046459 | Bacteria | 1371 |
| 671 | Ga0495641_0005144 | 3300046461 | Bacteria | 8951 |
| 672 | Ga0495651_0001528 | 3300046462 | Bacteria | 17892 |
| 673 | Ga0495651_0004190 | 3300046462 | Bacteria | 11042 |
| 674 | Ga0495653_0009088 | 3300046463 | Bacteria | 8126 |
| 675 | Ga0495653_0135641 | 3300046463 | Bacteria | 1736 |
| 676 | Ga0495653_0441880 | 3300046463 | Bacteria | 820 |
| 677 | Ga0495653_0743647 | 3300046463 | Bacteria | 593 |
| 678 | Ga0495580_0017020 | 3300046472 | Bacteria | 5446 |
| 679 | Ga0495580_0018844 | 3300046472 | Bacteria | 5134 |
| 680 | Ga0495582_0006969 | 3300046473 | Bacteria | 6285 |
| 681 | Ga0495639_0002185 | 3300046475 | Bacteria | 8617 |
| 682 | Ga0495639_0057626 | 3300046475 | Bacteria | 1775 |
| 683 | Ga0495662_0018325 | 3300046476 | Bacteria | 3388 |
| 684 | Ga0495662_0079289 | 3300046476 | Bacteria | 1596 |
| 685 | Ga0495664_0081074 | 3300046477 | Bacteria | 1945 |
| 686 | Ga0495608_0003114 | 3300046511 | Bacteria | 11849 |
| 687 | Ga0495608_0045756 | 3300046511 | Bacteria | 2914 |
| 688 | Ga0495608_0134577 | 3300046511 | Bacteria | 1580 |
| 689 | Ga0495618_0022879 | 3300046514 | Bacteria | 3861 |
| 690 | Ga0495618_0052136 | 3300046514 | Bacteria | 2585 |
| 691 | Ga0495628_0041512 | 3300046516 | Bacteria | 3672 |
| 692 | Ga0495630_0000851 | 3300046517 | Bacteria | 21474 |
| 693 | Ga0495630_0044464 | 3300046517 | Bacteria | 3319 |
| 694 | Ga0495630_0450554 | 3300046517 | Bacteria | 986 |
| 695 | Ga0495644_0199661 | 3300046523 | Bacteria | 771 |
| 696 | Ga0495666_0045537 | 3300046526 | Bacteria | 2116 |
| 697 | Ga0495666_0089060 | 3300046526 | Bacteria | 1457 |
| 698 | Ga0495642_0062641 | 3300046528 | Unclassified | 1545 |
| 699 | Ga0495652_0045337 | 3300046529 | Bacteria | 3781 |
| 700 | Ga0495640_0028067 | 3300046533 | Bacteria | 4054 |
| 701 | Ga0495640_0032932 | 3300046533 | Bacteria | 3687 |
| 702 | Ga0495586_0002520 | 3300046535 | Bacteria | 9923 |
| 703 | Ga0495586_0016097 | 3300046535 | Bacteria | 3978 |
| 704 | Ga0495586_0118185 | 3300046535 | Bacteria | 1479 |
| 705 | Ga0495586_0236938 | 3300046535 | Bacteria | 1039 |
| 706 | Ga0495587_0003382 | 3300046536 | Bacteria | 10640 |
| 707 | Ga0495587_0006598 | 3300046536 | Bacteria | 7555 |
| 708 | Ga0495598_0254984 | 3300046537 | Bacteria | 651 |
| 709 | Ga0495621_0051617 | 3300046539 | Bacteria | 1472 |
| 710 | Ga0495621_0123686 | 3300046539 | Bacteria | 1002 |
| 711 | Ga0495645_0037686 | 3300046543 | Bacteria | 3526 |
| 712 | Ga0495622_0067906 | 3300046557 | Unclassified | 1647 |
| 713 | Ga0495667_0047217 | 3300046559 | Bacteria | 2845 |
| 714 | Ga0495667_0079452 | 3300046559 | Bacteria | 2132 |
| 715 | Ga0495667_0228698 | 3300046559 | Bacteria | 1186 |
| 716 | Ga0495667_0240601 | 3300046559 | Bacteria | 1153 |
| 717 | Ga0495667_0373285 | 3300046559 | Bacteria | 900 |
| 718 | Ga0495656_0046959 | 3300046615 | Bacteria | 1829 |
| 719 | Ga0495634_0051715 | 3300046642 | Bacteria | 2756 |
| 720 | Ga0495634_0161296 | 3300046642 | Bacteria | 1413 |
| 721 | Ga0495635_0046410 | 3300046663 | Bacteria | 2997 |
| 722 | Ga0495635_0310646 | 3300046663 | Bacteria | 1056 |
| 723 | Ga0495657_0007456 | 3300046675 | Bacteria | 8452 |
| 724 | Ga0495657_0065254 | 3300046675 | Bacteria | 2395 |
| 725 | Ga0495657_0161532 | 3300046675 | Bacteria | 1386 |
| 726 | Ga0495657_0645830 | 3300046675 | Bacteria | 610 |
| 727 | Ga0495599_0007268 | 3300046678 | Bacteria | 6707 |
| 728 | Ga0495599_0170148 | 3300046678 | Bacteria | 1345 |
| 729 | Ga0495646_0532621 | 3300046680 | Unclassified | 601 |
| 730 | Ga0495647_0000090 | 3300046681 | Bacteria | 22381 |
| 731 | Ga0495647_0075647 | 3300046681 | Bacteria | 1356 |
| 732 | Ga0495647_0086052 | 3300046681 | Bacteria | 1281 |
| 733 | Ga0495658_0007437 | 3300046683 | Bacteria | 5420 |
| 734 | Ga0495658_0119842 | 3300046683 | Bacteria | 1590 |
| 735 | Ga0495658_0178340 | 3300046683 | Bacteria | 1317 |
| 736 | Ga0495658_0936676 | 3300046683 | Bacteria | 553 |
| 737 | Ga0495613_0412102 | 3300046689 | Bacteria | 920 |
| 738 | Ga0495624_0056008 | 3300046690 | Bacteria | 2482 |
| 739 | Ga0495624_0197977 | 3300046690 | Bacteria | 1221 |
| 740 | Ga0495600_0020078 | 3300046809 | Bacteria | 4273 |
| 741 | Ga0495600_0020363 | 3300046809 | Bacteria | 4243 |
| 742 | Ga0495581_0073293 | 3300047315 | Bacteria | 1981 |
| 743 | Ga0495581_0074892 | 3300047315 | Unclassified | 1959 |
| 744 | Ga0495581_0667494 | 3300047315 | Bacteria | 600 |
| 745 | Ga0495581_0829037 | 3300047315 | Unclassified | 530 |
| 746 | Ga0495604_0012460 | 3300047317 | Bacteria | 6763 |
| 747 | Ga0495604_0023283 | 3300047317 | Bacteria | 4940 |
| 748 | Ga0495604_0093029 | 3300047317 | Bacteria | 2232 |
| 749 | Ga0495604_0454785 | 3300047317 | Bacteria | 836 |
| 750 | Ga0495674_0005814 | 3300047319 | Bacteria | 11827 |
| 751 | Ga0495674_0611190 | 3300047319 | Bacteria | 863 |
| 752 | Ga0495672_0372644 | 3300047320 | Bacteria | 658 |
| 753 | Ga0495676_0016777 | 3300047321 | Bacteria | 6487 |
| 754 | Ga0495680_0001252 | 3300047322 | Bacteria | 27832 |
| 755 | Ga0495680_0075253 | 3300047322 | Bacteria | 2562 |
| 756 | Ga0495680_0082697 | 3300047322 | Bacteria | 2422 |
| 757 | Ga0495680_0177271 | 3300047322 | Bacteria | 1540 |
| 758 | Ga0495680_0624314 | 3300047322 | Bacteria | 719 |
| 759 | Ga0495675_0007174 | 3300047444 | Bacteria | 6863 |
| 760 | Ga0495675_0071825 | 3300047444 | Bacteria | 2184 |
| 761 | Ga0495677_0074775 | 3300047445 | Unclassified | 1265 |
| 762 | Ga0495684_0016574 | 3300047471 | Bacteria | 5676 |
| 763 | Ga0495684_0193600 | 3300047471 | Bacteria | 1502 |
| 764 | Ga0495684_0481307 | 3300047471 | Bacteria | 857 |
| 765 | Ga0501292_044861 | 3300049515 | Bacteria | 771 |
| 766 | Ga0501292_063105 | 3300049515 | Bacteria | 676 |
| 767 | Ga0501298_022598 | 3300049521 | Unclassified | 1186 |
| 768 | Ga0501299_144231 | 3300049522 | Bacteria | 595 |
| 769 | Ga0501031_0011710 | 3300049568 | Bacteria | 5720 |
| 770 | Ga0501031_0846665 | 3300049568 | Unclassified | 586 |
| 771 | Ga0501031_0952817 | 3300049568 | Unclassified | 549 |
| 772 | Ga0501032_0015532 | 3300049569 | Bacteria | 5370 |
| 773 | Ga0501032_0177298 | 3300049569 | Bacteria | 1396 |
| 774 | Ga0501033_0006483 | 3300049570 | Bacteria | 9157 |
| 775 | Ga0501033_0335109 | 3300049570 | Bacteria | 1061 |
| 776 | Ga0501033_0539639 | 3300049570 | Bacteria | 804 |
| 777 | Ga0501034_0000581 | 3300049571 | Bacteria | 57797 |
| 778 | Ga0501034_0050375 | 3300049571 | Bacteria | 4200 |
| 779 | Ga0501036_0001252 | 3300049572 | Bacteria | 19463 |
| 780 | Ga0501036_0056260 | 3300049572 | Bacteria | 3333 |
| 781 | Ga0501036_0059286 | 3300049572 | Bacteria | 3244 |
| 782 | Ga0501036_0216282 | 3300049572 | Bacteria | 1610 |
| 783 | Ga0501037_0042207 | 3300049573 | Bacteria | 3353 |
| 784 | Ga0501038_0001280 | 3300049574 | Bacteria | 22839 |
| 785 | Ga0501038_0128702 | 3300049574 | Bacteria | 2081 |
| 786 | Ga0501038_1192944 | 3300049574 | Unclassified | 553 |
| 787 | Ga0501039_0011180 | 3300049575 | Bacteria | 6839 |
| 788 | Ga0501039_0152376 | 3300049575 | Bacteria | 1816 |
| 789 | Ga0501039_0600088 | 3300049575 | Bacteria | 863 |
| 790 | Ga0501040_0000052 | 3300049576 | Bacteria | 54195 |
| 791 | Ga0501040_0078654 | 3300049576 | Bacteria | 2282 |
| 792 | Ga0501041_0004912 | 3300049577 | Bacteria | 7767 |
| 793 | Ga0501041_0090832 | 3300049577 | Bacteria | 1885 |
| 794 | Ga0501041_0110569 | 3300049577 | Bacteria | 1705 |
| 795 | Ga0501041_0129865 | 3300049577 | Bacteria | 1569 |
| 796 | Ga0501042_0013259 | 3300049578 | Bacteria | 5610 |
| 797 | Ga0501042_0074219 | 3300049578 | Bacteria | 2434 |
| 798 | Ga0501042_0115127 | 3300049578 | Bacteria | 1936 |
| 799 | Ga0501043_0015925 | 3300049579 | Bacteria | 5893 |
| 800 | Ga0501046_0000271 | 3300049580 | Bacteria | 52841 |
| 801 | Ga0501046_1072446 | 3300049580 | Bacteria | 557 |
| 802 | Ga0501047_0376999 | 3300049581 | Bacteria | 1253 |
| 803 | Ga0501048_0001409 | 3300049582 | Bacteria | 18204 |
| 804 | Ga0501048_0022699 | 3300049582 | Bacteria | 4587 |
| 805 | Ga0501048_0349719 | 3300049582 | Bacteria | 1054 |
| 806 | Ga0501048_0677235 | 3300049582 | Bacteria | 741 |
| 807 | Ga0501067_0445794 | 3300049583 | Unclassified | 723 |
| 808 | Ga0501068_0001232 | 3300049584 | Bacteria | 13570 |
| 809 | Ga0501068_0030228 | 3300049584 | Bacteria | 3212 |
| 810 | Ga0501068_0297858 | 3300049584 | Bacteria | 1032 |
| 811 | Ga0501069_0276048 | 3300049585 | Unclassified | 983 |
| 812 | Ga0501070_0100907 | 3300049586 | Bacteria | 2387 |
| 813 | Ga0501071_0033617 | 3300049587 | Bacteria | 3643 |
| 814 | Ga0501071_0307458 | 3300049587 | Bacteria | 1202 |
| 815 | Ga0501071_0876686 | 3300049587 | Bacteria | 692 |
| 816 | Ga0501072_0003349 | 3300049588 | Bacteria | 12056 |
| 817 | Ga0501072_0108153 | 3300049588 | Bacteria | 2212 |
| 818 | Ga0501072_1148486 | 3300049588 | Bacteria | 604 |
| 819 | Ga0501073_0005893 | 3300049589 | Bacteria | 9144 |
| 820 | Ga0501073_0304378 | 3300049589 | Bacteria | 1100 |
| 821 | Ga0501074_0074479 | 3300049590 | Bacteria | 2438 |
| 822 | Ga0501074_0185266 | 3300049590 | Bacteria | 1484 |
| 823 | Ga0501075_0000751 | 3300049591 | Bacteria | 20223 |
| 824 | Ga0501075_0001243 | 3300049591 | Bacteria | 16533 |
| 825 | Ga0501075_0083266 | 3300049591 | Bacteria | 2423 |
| 826 | Ga0501075_0254676 | 3300049591 | Bacteria | 1338 |
| 827 | Ga0501075_0270924 | 3300049591 | Bacteria | 1294 |
| 828 | Ga0501076_0000290 | 3300049592 | Bacteria | 31327 |
| 829 | Ga0501076_0006671 | 3300049592 | Bacteria | 8374 |
| 830 | Ga0501076_0526727 | 3300049592 | Bacteria | 974 |
| 831 | Ga0501077_0008144 | 3300049593 | Bacteria | 6479 |
| 832 | Ga0501077_0024729 | 3300049593 | Bacteria | 3813 |
| 833 | Ga0501198_021510 | 3300049649 | Unclassified | 1029 |
| 834 | Ga0501233_017091 | 3300049668 | Bacteria | 1512 |
| 835 | Ga0501079_0000061 | 3300049741 | Bacteria | 48925 |
| 836 | Ga0501079_0097776 | 3300049741 | Bacteria | 2275 |
| 837 | Ga0501079_0204890 | 3300049741 | Bacteria | 1541 |
| 838 | Ga0501079_0207768 | 3300049741 | Bacteria | 1529 |
| 839 | Ga0501080_0000712 | 3300049742 | Bacteria | 26727 |
| 840 | Ga0501080_0022971 | 3300049742 | Bacteria | 5783 |
| 841 | Ga0501080_0096381 | 3300049742 | Bacteria | 2746 |
| 842 | Ga0501080_0101151 | 3300049742 | Bacteria | 2674 |
| 843 | Ga0501080_0587171 | 3300049742 | Bacteria | 990 |
| 844 | Ga0501081_0000110 | 3300049743 | Bacteria | 34989 |
| 845 | Ga0501081_0056555 | 3300049743 | Bacteria | 2711 |
| 846 | Ga0501081_0082284 | 3300049743 | Bacteria | 2255 |
| 847 | Ga0501083_0060813 | 3300049744 | Bacteria | 2523 |
| 848 | Ga0501083_0100203 | 3300049744 | Bacteria | 1910 |
| 849 | Ga0501083_0108208 | 3300049744 | Bacteria | 1829 |
| 850 | Ga0501083_0130681 | 3300049744 | Bacteria | 1646 |
| 851 | Ga0501279_019506 | 3300049775 | Unclassified | 960 |
| 852 | Ga0501283_070470 | 3300049779 | Unclassified | 643 |
| 853 | Ga0501035_0073483 | 3300049822 | Bacteria | 3025 |
| 854 | Ga0501044_0072036 | 3300049823 | Bacteria | 3514 |
| 855 | Ga0501045_0002891 | 3300049824 | Bacteria | 11734 |
| 856 | Ga0501045_1104412 | 3300049824 | Bacteria | 580 |
| 857 | nmdc:mga05p37_21952_c1 | 3300050507 | Bacteria | 7734 |
| 858 | nmdc:mga05p37_471014_c1 | 3300050507 | Bacteria | 1449 |
| 859 | nmdc:mga05p37_485301_c1 | 3300050507 | Bacteria | 1422 |
| 860 | nmdc:mga05p37_78_c1 | 3300050507 | Bacteria | 85760 |
| 861 | nmdc:mga09592_10611_c1 | 3300050508 | Bacteria | 7502 |
| 862 | nmdc:mga09592_119266_c1 | 3300050508 | Bacteria | 2265 |
| 863 | nmdc:mga09592_248719_c1 | 3300050508 | Bacteria | 1541 |
| 864 | nmdc:mga09592_264_c1 | 3300050508 | Bacteria | 38183 |
| 865 | nmdc:mga09592_414027_c1 | 3300050508 | Bacteria | 1165 |
| 866 | nmdc:mga0qj67_201156_c1 | 3300050509 | Unclassified | 1619 |
| 867 | nmdc:mga0qj67_222839_c1 | 3300050509 | Bacteria | 1531 |
| 868 | nmdc:mga0qj67_237804_c1 | 3300050509 | Bacteria | 1478 |
| 869 | nmdc:mga0qj67_52391_c1 | 3300050509 | Bacteria | 3230 |
| 870 | nmdc:mga0qj67_915119_c1 | 3300050509 | Bacteria | 691 |
| 871 | nmdc:mga06r32_1282979_c1 | 3300050510 | Bacteria | 677 |
| 872 | nmdc:mga06r32_5387_c2 | 3300050510 | Bacteria | 8395 |
| 873 | nmdc:mga06r32_87082_c1 | 3300050510 | Bacteria | 3047 |
| 874 | nmdc:mga08y16_1062068_c1 | 3300050511 | Bacteria | 787 |
| 875 | nmdc:mga08y16_107926_c1 | 3300050511 | Bacteria | 2898 |
| 876 | nmdc:mga08y16_112219_c1 | 3300050511 | Bacteria | 2838 |
| 877 | nmdc:mga08y16_138251_c1 | 3300050511 | Bacteria | 2533 |
| 878 | nmdc:mga08y16_14672_c1 | 3300050511 | Bacteria | 8239 |
| 879 | nmdc:mga08y16_15715_c1 | 3300050511 | Bacteria | 7962 |
| 880 | nmdc:mga08y16_59668_c1 | 3300050511 | Bacteria | 3984 |
| 881 | nmdc:mga08y16_731718_c1 | 3300050511 | Unclassified | 987 |
| 882 | nmdc:mga0n895_12822_c1 | 3300050512 | Bacteria | 7531 |
| 883 | nmdc:mga0n895_19782_c1 | 3300050512 | Bacteria | 6264 |
| 884 | nmdc:mga0n895_26682_c1 | 3300050512 | Bacteria | 5476 |
| 885 | nmdc:mga0n895_582_c1 | 3300050512 | Bacteria | 25135 |
| 886 | nmdc:mga0n895_668203_c1 | 3300050512 | Bacteria | 1036 |
| 887 | nmdc:mga0n895_909447_c1 | 3300050512 | Unclassified | 865 |
| 888 | nmdc:mga0rr50_14639_c1 | 3300050513 | Bacteria | 5151 |
| 889 | nmdc:mga0rr50_2806_c1 | 3300050513 | Bacteria | 9895 |
| 890 | nmdc:mga0rr50_3216_c1 | 3300050513 | Bacteria | 9354 |
| 891 | nmdc:mga0rr50_665660_c1 | 3300050513 | Bacteria | 888 |
| 892 | nmdc:mga0rr50_836509_c1 | 3300050513 | Bacteria | 785 |
| 893 | nmdc:mga08x19_103339_c1 | 3300050514 | Bacteria | 1893 |
| 894 | nmdc:mga08x19_1308_c1 | 3300050514 | Bacteria | 15470 |
| 895 | nmdc:mga08x19_167747_c1 | 3300050514 | Bacteria | 1494 |
| 896 | nmdc:mga08x19_18933_c1 | 3300050514 | Bacteria | 4221 |
| 897 | nmdc:mga08x19_219248_c1 | 3300050514 | Bacteria | 1307 |
| 898 | nmdc:mga08x19_512384_c1 | 3300050514 | Unclassified | 847 |
| 899 | nmdc:mga08x19_5960_c1 | 3300050514 | Bacteria | 7209 |
| 900 | nmdc:mga08x19_695052_c1 | 3300050514 | Bacteria | 722 |
| 901 | nmdc:mga08x19_70207_c1 | 3300050514 | Bacteria | 2282 |
| 902 | nmdc:mga08x19_750869_c1 | 3300050514 | Bacteria | 693 |
| 903 | nmdc:mga0a205_11407_c1 | 3300050515 | Bacteria | 8179 |
| 904 | nmdc:mga0a205_1704_c1 | 3300050515 | Bacteria | 18985 |
| 905 | nmdc:mga0a205_313976_c1 | 3300050515 | Bacteria | 1439 |
| 906 | nmdc:mga0a205_344883_c1 | 3300050515 | Bacteria | 1357 |
| 907 | nmdc:mga0a205_710166_c1 | 3300050515 | Unclassified | 855 |
| 908 | Ga0495612_0069482 | 3300053078 | Bacteria | 1467 |
| 909 | Ga0495595_0632316 | 3300053084 | Bacteria | 548 |
| 910 | Ga0495619_0004389 | 3300053085 | Bacteria | 8995 |
| 911 | Ga0500566_0344287 | 3300053094 | Bacteria | 685 |
| 912 | Ga0501084_0001172 | 3300054114 | Bacteria | 20445 |
| 913 | Ga0501084_0068968 | 3300054114 | Bacteria | 2960 |
| 914 | Ga0501084_0069282 | 3300054114 | Bacteria | 2953 |
| 915 | Ga0501084_0277148 | 3300054114 | Bacteria | 1416 |
| 916 | Ga0501084_0362490 | 3300054114 | Bacteria | 1225 |
| 917 | Ga0501084_0679131 | 3300054114 | Bacteria | 869 |
| 918 | Ga0501084_1457848 | 3300054114 | Unclassified | 573 |
| 919 | Ga0590075_162224 | 3300059424 | Unclassified | 590 |
| 920 | Ga0590077_071846 | 3300059426 | Bacteria | 791 |
| 921 | Ga0501082_0004197 | 3300060353 | Bacteria | 12591 |
| 922 | Ga0501082_0026853 | 3300060353 | Bacteria | 4961 |
| 923 | Ga0501082_0096614 | 3300060353 | Bacteria | 2554 |
| 924 | Ga0501082_0120467 | 3300060353 | Bacteria | 2274 |
| 925 | Ga0501082_0367260 | 3300060353 | Bacteria | 1255 |
| 926 | Ga0501082_0717060 | 3300060353 | Bacteria | 875 |
| 927 | Ga0530510_0000048 | 3300061734 | Bacteria | 56268 |
| 928 | Ga0530510_0000186 | 3300061734 | Bacteria | 37940 |
| 929 | Ga0530510_0191812 | 3300061734 | Bacteria | 1517 |
| 930 | Ga0530510_0627618 | 3300061734 | Unclassified | 818 |
| 931 | Ga0530510_0869249 | 3300061734 | Bacteria | 689 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049581 | Ga0501047_0376999 | Ga0501047_0376999_816_1241 | 139 |
| 2 | 3300049742 | Ga0501080_0587171 | Ga0501080_0587171_22_459 | 143 |
| 3 | 3300005345 | Ga0070692_10340507 | Ga0070692_103405072 | 145 |
| 4 | 3300005615 | Ga0070702_100277120 | Ga0070702_1002771201 | 145 |
| 5 | 3300031548 | Ga0307408_100091441 | Ga0307408_1000914412 | 145 |
| 6 | 3300032002 | Ga0307416_100066483 | Ga0307416_1000664833 | 145 |
| 7 | 3300032168 | Ga0316593_10019918 | Ga0316593_100199182 | 145 |
| 8 | 3300035117 | Ga0373953_0386110 | Ga0373953_0386110_80_523 | 145 |
| 9 | 3300042001 | Ga0439441_016169 | Ga0439441_016169_861_1304 | 145 |
| 10 | 3300046454 | Ga0495592_0186893 | Ga0495592_0186893_936_1379 | 145 |
| 11 | 3300046459 | Ga0495629_0202804 | Ga0495629_0202804_83_526 | 145 |
| 12 | 3300046517 | Ga0495630_0044464 | Ga0495630_0044464_41_484 | 145 |
| 13 | 3300046533 | Ga0495640_0032932 | Ga0495640_0032932_1352_1795 | 145 |
| 14 | 3300046675 | Ga0495657_0645830 | Ga0495657_0645830_74_517 | 145 |
| 15 | 3300046680 | Ga0495646_0532621 | Ga0495646_0532621_41_484 | 145 |
| 16 | 3300046683 | Ga0495658_0178340 | Ga0495658_0178340_10_453 | 145 |
| 17 | 3300046690 | Ga0495624_0056008 | Ga0495624_0056008_1479_1922 | 145 |
| 18 | 3300047315 | Ga0495581_0829037 | Ga0495581_0829037_17_460 | 145 |
| 19 | 3300047317 | Ga0495604_0093029 | Ga0495604_0093029_706_1149 | 145 |
| 20 | 3300050514 | nmdc:mga08x19_219248_c1 | nmdc:mga08x19_219248_c1_12_455 | 145 |
| 21 | 3300046539 | Ga0495621_0051617 | Ga0495621_0051617_981_1442 | 146 |
| 22 | 3300046559 | Ga0495667_0240601 | Ga0495667_0240601_13_456 | 146 |
| 23 | 3300049582 | Ga0501048_0349719 | Ga0501048_0349719_14_457 | 146 |
| 24 | 3300054114 | Ga0501084_0679131 | Ga0501084_0679131_408_851 | 146 |
| 25 | 3300007076 | Ga0075435_100031439 | Ga0075435_1000314394 | 148 |
| 26 | 3300031251 | Ga0265327_10044317 | Ga0265327_100443172 | 148 |
| 27 | 3300031712 | Ga0265342_10161351 | Ga0265342_101613512 | 148 |
| 28 | 3300050512 | nmdc:mga0n895_909447_c1 | nmdc:mga0n895_909447_c1_54_500 | 148 |
| 29 | 3300050513 | nmdc:mga0rr50_14639_c1 | nmdc:mga0rr50_14639_c1_1965_2411 | 148 |
| 30 | 3300005844 | Ga0068862_101175879 | Ga0068862_1011758792 | 149 |
| 31 | 3300028380 | Ga0268265_10815230 | Ga0268265_108152302 | 149 |
| 32 | 3300005336 | Ga0070680_101036712 | Ga0070680_1010367121 | 150 |
| 33 | 3300005341 | Ga0070691_10800460 | Ga0070691_108004601 | 150 |
| 34 | 3300005436 | Ga0070713_100065706 | Ga0070713_1000657063 | 150 |
| 35 | 3300005444 | Ga0070694_100262057 | Ga0070694_1002620572 | 150 |
| 36 | 3300005545 | Ga0070695_100151682 | Ga0070695_1001516822 | 150 |
| 37 | 3300005546 | Ga0070696_100181329 | Ga0070696_1001813292 | 150 |
| 38 | 3300005549 | Ga0070704_100616783 | Ga0070704_1006167832 | 150 |
| 39 | 3300005549 | Ga0070704_100660249 | Ga0070704_1006602492 | 150 |
| 40 | 3300006028 | Ga0070717_10749087 | Ga0070717_107490871 | 150 |
| 41 | 3300007788 | Ga0099795_10636159 | Ga0099795_106361591 | 150 |
| 42 | 3300026075 | Ga0207708_10464336 | Ga0207708_104643362 | 150 |
| 43 | 3300035118 | Ga0373954_0000025 | Ga0373954_0000025_5426_5914 | 150 |
| 44 | 3300035691 | Ga0373931_0098259 | Ga0373931_0098259_420_887 | 150 |
| 45 | 3300035724 | Ga0373933_0081204 | Ga0373933_0081204_178_666 | 150 |
| 46 | 3300036401 | Ga0373937_0000296 | Ga0373937_0000296_36449_36937 | 150 |
| 47 | 3300045051 | Ga0451576_0163334 | Ga0451576_0163334_1534_2001 | 150 |
| 48 | 3300046528 | Ga0495642_0062641 | Ga0495642_0062641_776_1255 | 150 |
| 49 | 3300046537 | Ga0495598_0254984 | Ga0495598_0254984_67_531 | 150 |
| 50 | 3300046559 | Ga0495667_0228698 | Ga0495667_0228698_335_823 | 150 |
| 51 | 3300047317 | Ga0495604_0454785 | Ga0495604_0454785_246_734 | 150 |
| 52 | 3300049568 | Ga0501031_0846665 | Ga0501031_0846665_42_506 | 150 |
| 53 | 3300050514 | nmdc:mga08x19_70207_c1 | nmdc:mga08x19_70207_c1_139_606 | 150 |
| 54 | 3300006195 | Ga0075366_10219168 | Ga0075366_102191682 | 152 |
| 55 | 3300025939 | Ga0207665_10873472 | Ga0207665_108734722 | 152 |
| 56 | 3300026118 | Ga0207675_101805859 | Ga0207675_1018058592 | 152 |
| 57 | 3300034819 | Ga0373958_0035460 | Ga0373958_0035460_49_507 | 152 |
| 58 | 3300037068 | Ga0373925_0161900 | Ga0373925_0161900_45_509 | 152 |
| 59 | 3300042530 | Ga0450916_029269 | Ga0450916_029269_21_485 | 152 |
| 60 | 3300044694 | Ga0466963_0454290 | Ga0466963_0454290_23_499 | 152 |
| 61 | 3300044694 | Ga0466963_0513667 | Ga0466963_0513667_169_669 | 152 |
| 62 | 3300045051 | Ga0451576_1460238 | Ga0451576_1460238_43_519 | 152 |
| 63 | 3300045836 | Ga0466958_0882636 | Ga0466958_0882636_60_536 | 152 |
| 64 | 3300045976 | Ga0466967_1012436 | Ga0466967_1012436_91_591 | 152 |
| 65 | 3300046523 | Ga0495644_0199661 | Ga0495644_0199661_212_685 | 152 |
| 66 | 3300049569 | Ga0501032_0177298 | Ga0501032_0177298_399_887 | 152 |
| 67 | 3300049571 | Ga0501034_0000581 | Ga0501034_0000581_9882_10472 | 152 |
| 68 | 3300049571 | Ga0501034_0050375 | Ga0501034_0050375_2913_3386 | 152 |
| 69 | 3300049580 | Ga0501046_1072446 | Ga0501046_1072446_67_531 | 152 |
| 70 | 3300049583 | Ga0501067_0445794 | Ga0501067_0445794_62_550 | 152 |
| 71 | 3300049584 | Ga0501068_0001232 | Ga0501068_0001232_7201_7689 | 152 |
| 72 | 3300049586 | Ga0501070_0100907 | Ga0501070_0100907_950_1438 | 152 |
| 73 | 3300049589 | Ga0501073_0005893 | Ga0501073_0005893_5237_5725 | 152 |
| 74 | 3300049589 | Ga0501073_0304378 | Ga0501073_0304378_53_517 | 152 |
| 75 | 3300049590 | Ga0501074_0074479 | Ga0501074_0074479_906_1376 | 152 |
| 76 | 3300049742 | Ga0501080_0000712 | Ga0501080_0000712_19318_19806 | 152 |
| 77 | 3300049744 | Ga0501083_0060813 | Ga0501083_0060813_875_1363 | 152 |
| 78 | 3300060353 | Ga0501082_0367260 | Ga0501082_0367260_17_484 | 152 |
| 79 | 3300005330 | Ga0070690_100000906 | Ga0070690_1000009067 | 153 |
| 80 | 3300005334 | Ga0068869_100006074 | Ga0068869_1000060745 | 153 |
| 81 | 3300005338 | Ga0068868_100117065 | Ga0068868_1001170652 | 153 |
| 82 | 3300005340 | Ga0070689_100005385 | Ga0070689_1000053859 | 153 |
| 83 | 3300005341 | Ga0070691_10002837 | Ga0070691_100028373 | 153 |
| 84 | 3300005438 | Ga0070701_10096270 | Ga0070701_100962701 | 153 |
| 85 | 3300005440 | Ga0070705_100067286 | Ga0070705_1000672862 | 153 |
| 86 | 3300005444 | Ga0070694_100022323 | Ga0070694_1000223233 | 153 |
| 87 | 3300005456 | Ga0070678_100107548 | Ga0070678_1001075483 | 153 |
| 88 | 3300005458 | Ga0070681_10398303 | Ga0070681_103983032 | 153 |
| 89 | 3300005459 | Ga0068867_100009709 | Ga0068867_1000097092 | 153 |
| 90 | 3300005536 | Ga0070697_100296274 | Ga0070697_1002962741 | 153 |
| 91 | 3300005544 | Ga0070686_100000683 | Ga0070686_1000006837 | 153 |
| 92 | 3300005545 | Ga0070695_100017760 | Ga0070695_1000177604 | 153 |
| 93 | 3300005546 | Ga0070696_100355522 | Ga0070696_1003555222 | 153 |
| 94 | 3300005547 | Ga0070693_100115573 | Ga0070693_1001155732 | 153 |
| 95 | 3300005548 | Ga0070665_101396693 | Ga0070665_1013966932 | 153 |
| 96 | 3300005549 | Ga0070704_100152996 | Ga0070704_1001529963 | 153 |
| 97 | 3300005614 | Ga0068856_100548521 | Ga0068856_1005485212 | 153 |
| 98 | 3300005615 | Ga0070702_100003136 | Ga0070702_1000031362 | 153 |
| 99 | 3300005718 | Ga0068866_10002432 | Ga0068866_100024322 | 153 |
| 100 | 3300005719 | Ga0068861_100375975 | Ga0068861_1003759751 | 153 |
| 101 | 3300005842 | Ga0068858_100011781 | Ga0068858_1000117811 | 153 |
| 102 | 3300005843 | Ga0068860_100040479 | Ga0068860_1000404793 | 153 |
| 103 | 3300005844 | Ga0068862_100005336 | Ga0068862_1000053366 | 153 |
| 104 | 3300006237 | Ga0097621_100056029 | Ga0097621_1000560293 | 153 |
| 105 | 3300006358 | Ga0068871_100008932 | Ga0068871_1000089323 | 153 |
| 106 | 3300006846 | Ga0075430_100025385 | Ga0075430_1000253855 | 153 |
| 107 | 3300006881 | Ga0068865_100002425 | Ga0068865_1000024255 | 153 |
| 108 | 3300007076 | Ga0075435_100160136 | Ga0075435_1001601362 | 153 |
| 109 | 3300009092 | Ga0105250_10055044 | Ga0105250_100550442 | 153 |
| 110 | 3300009098 | Ga0105245_10002540 | Ga0105245_100025408 | 153 |
| 111 | 3300009098 | Ga0105245_10060315 | Ga0105245_100603153 | 153 |
| 112 | 3300009148 | Ga0105243_10015877 | Ga0105243_100158772 | 153 |
| 113 | 3300009176 | Ga0105242_10017789 | Ga0105242_100177894 | 153 |
| 114 | 3300009177 | Ga0105248_10264831 | Ga0105248_102648313 | 153 |
| 115 | 3300009551 | Ga0105238_11454569 | Ga0105238_114545691 | 153 |
| 116 | 3300009553 | Ga0105249_10045036 | Ga0105249_100450363 | 153 |
| 117 | 3300013297 | Ga0157378_10016132 | Ga0157378_100161326 | 153 |
| 118 | 3300013306 | Ga0163162_10645161 | Ga0163162_106451611 | 153 |
| 119 | 3300013308 | Ga0157375_10018987 | Ga0157375_100189874 | 153 |
| 120 | 3300014326 | Ga0157380_10007220 | Ga0157380_100072204 | 153 |
| 121 | 3300014968 | Ga0157379_10089627 | Ga0157379_100896273 | 153 |
| 122 | 3300025917 | Ga0207660_10106839 | Ga0207660_101068393 | 153 |
| 123 | 3300025927 | Ga0207687_10012762 | Ga0207687_100127623 | 153 |
| 124 | 3300025927 | Ga0207687_10593501 | Ga0207687_105935011 | 153 |
| 125 | 3300025934 | Ga0207686_10003108 | Ga0207686_100031082 | 153 |
| 126 | 3300025935 | Ga0207709_10020832 | Ga0207709_100208322 | 153 |
| 127 | 3300025936 | Ga0207670_10034330 | Ga0207670_100343303 | 153 |
| 128 | 3300025937 | Ga0207669_10373198 | Ga0207669_103731981 | 153 |
| 129 | 3300025938 | Ga0207704_10068056 | Ga0207704_100680561 | 153 |
| 130 | 3300025942 | Ga0207689_10000558 | Ga0207689_100005583 | 153 |
| 131 | 3300025942 | Ga0207689_10620262 | Ga0207689_106202622 | 153 |
| 132 | 3300026023 | Ga0207677_10903151 | Ga0207677_109031512 | 153 |
| 133 | 3300026075 | Ga0207708_10000362 | Ga0207708_1000036218 | 153 |
| 134 | 3300026089 | Ga0207648_10000159 | Ga0207648_100001598 | 153 |
| 135 | 3300026118 | Ga0207675_100000068 | Ga0207675_10000006815 | 153 |
| 136 | 3300026121 | Ga0207683_10036881 | Ga0207683_100368815 | 153 |
| 137 | 3300028380 | Ga0268265_10021501 | Ga0268265_100215013 | 153 |
| 138 | 3300028381 | Ga0268264_10077192 | Ga0268264_100771923 | 153 |
| 139 | 3300035398 | Ga0316574_0014869 | Ga0316574_0014869_3827_4303 | 153 |
| 140 | 3300045976 | Ga0466967_0061026 | Ga0466967_0061026_2386_2862 | 153 |
| 141 | 3300049585 | Ga0501069_0276048 | Ga0501069_0276048_492_968 | 153 |
| 142 | 3300050512 | nmdc:mga0n895_26682_c1 | nmdc:mga0n895_26682_c1_3979_4455 | 153 |
| 143 | 3300050515 | nmdc:mga0a205_11407_c1 | nmdc:mga0a205_11407_c1_6328_6804 | 153 |
| 144 | 3300005295 | Ga0065707_10009454 | Ga0065707_100094543 | 154 |
| 145 | 3300005329 | Ga0070683_100096140 | Ga0070683_1000961403 | 154 |
| 146 | 3300005329 | Ga0070683_100394875 | Ga0070683_1003948751 | 154 |
| 147 | 3300005330 | Ga0070690_100170184 | Ga0070690_1001701842 | 154 |
| 148 | 3300005331 | Ga0070670_101020046 | Ga0070670_1010200461 | 154 |
| 149 | 3300005333 | Ga0070677_10159944 | Ga0070677_101599442 | 154 |
| 150 | 3300005334 | Ga0068869_100025130 | Ga0068869_1000251302 | 154 |
| 151 | 3300005334 | Ga0068869_100305007 | Ga0068869_1003050072 | 154 |
| 152 | 3300005336 | Ga0070680_100195119 | Ga0070680_1001951192 | 154 |
| 153 | 3300005336 | Ga0070680_100329957 | Ga0070680_1003299572 | 154 |
| 154 | 3300005338 | Ga0068868_100164551 | Ga0068868_1001645513 | 154 |
| 155 | 3300005338 | Ga0068868_100613804 | Ga0068868_1006138041 | 154 |
| 156 | 3300005340 | Ga0070689_100092168 | Ga0070689_1000921682 | 154 |
| 157 | 3300005340 | Ga0070689_100680869 | Ga0070689_1006808691 | 154 |
| 158 | 3300005341 | Ga0070691_10246292 | Ga0070691_102462922 | 154 |
| 159 | 3300005343 | Ga0070687_100139265 | Ga0070687_1001392652 | 154 |
| 160 | 3300005343 | Ga0070687_100150179 | Ga0070687_1001501792 | 154 |
| 161 | 3300005343 | Ga0070687_100176990 | Ga0070687_1001769902 | 154 |
| 162 | 3300005343 | Ga0070687_100446006 | Ga0070687_1004460062 | 154 |
| 163 | 3300005345 | Ga0070692_10008357 | Ga0070692_100083573 | 154 |
| 164 | 3300005345 | Ga0070692_10288351 | Ga0070692_102883512 | 154 |
| 165 | 3300005347 | Ga0070668_100011505 | Ga0070668_1000115053 | 154 |
| 166 | 3300005353 | Ga0070669_100013917 | Ga0070669_1000139173 | 154 |
| 167 | 3300005354 | Ga0070675_100125120 | Ga0070675_1001251203 | 154 |
| 168 | 3300005356 | Ga0070674_100026595 | Ga0070674_1000265952 | 154 |
| 169 | 3300005364 | Ga0070673_100420163 | Ga0070673_1004201632 | 154 |
| 170 | 3300005364 | Ga0070673_100708229 | Ga0070673_1007082292 | 154 |
| 171 | 3300005434 | Ga0070709_10312919 | Ga0070709_103129192 | 154 |
| 172 | 3300005434 | Ga0070709_11314962 | Ga0070709_113149621 | 154 |
| 173 | 3300005435 | Ga0070714_100156934 | Ga0070714_1001569342 | 154 |
| 174 | 3300005438 | Ga0070701_10201137 | Ga0070701_102011372 | 154 |
| 175 | 3300005439 | Ga0070711_100347503 | Ga0070711_1003475032 | 154 |
| 176 | 3300005440 | Ga0070705_100027713 | Ga0070705_1000277132 | 154 |
| 177 | 3300005440 | Ga0070705_100212536 | Ga0070705_1002125362 | 154 |
| 178 | 3300005440 | Ga0070705_100336229 | Ga0070705_1003362291 | 154 |
| 179 | 3300005440 | Ga0070705_100530481 | Ga0070705_1005304812 | 154 |
| 180 | 3300005441 | Ga0070700_100011261 | Ga0070700_1000112613 | 154 |
| 181 | 3300005441 | Ga0070700_100988667 | Ga0070700_1009886671 | 154 |
| 182 | 3300005441 | Ga0070700_101102733 | Ga0070700_1011027331 | 154 |
| 183 | 3300005444 | Ga0070694_100005764 | Ga0070694_1000057646 | 154 |
| 184 | 3300005444 | Ga0070694_100012756 | Ga0070694_1000127563 | 154 |
| 185 | 3300005444 | Ga0070694_100033291 | Ga0070694_1000332913 | 154 |
| 186 | 3300005444 | Ga0070694_100052880 | Ga0070694_1000528802 | 154 |
| 187 | 3300005444 | Ga0070694_100056900 | Ga0070694_1000569001 | 154 |
| 188 | 3300005444 | Ga0070694_100241896 | Ga0070694_1002418962 | 154 |
| 189 | 3300005444 | Ga0070694_100275286 | Ga0070694_1002752862 | 154 |
| 190 | 3300005444 | Ga0070694_100389461 | Ga0070694_1003894611 | 154 |
| 191 | 3300005458 | Ga0070681_10000198 | Ga0070681_1000019858 | 154 |
| 192 | 3300005458 | Ga0070681_10277060 | Ga0070681_102770602 | 154 |
| 193 | 3300005458 | Ga0070681_10588537 | Ga0070681_105885372 | 154 |
| 194 | 3300005459 | Ga0068867_100011272 | Ga0068867_1000112725 | 154 |
| 195 | 3300005459 | Ga0068867_100136196 | Ga0068867_1001361962 | 154 |
| 196 | 3300005466 | Ga0070685_10290062 | Ga0070685_102900622 | 154 |
| 197 | 3300005467 | Ga0070706_100448434 | Ga0070706_1004484342 | 154 |
| 198 | 3300005468 | Ga0070707_100450843 | Ga0070707_1004508432 | 154 |
| 199 | 3300005471 | Ga0070698_100048113 | Ga0070698_1000481132 | 154 |
| 200 | 3300005471 | Ga0070698_100125334 | Ga0070698_1001253342 | 154 |
| 201 | 3300005518 | Ga0070699_100026976 | Ga0070699_1000269762 | 154 |
| 202 | 3300005518 | Ga0070699_100887389 | Ga0070699_1008873891 | 154 |
| 203 | 3300005530 | Ga0070679_100047847 | Ga0070679_1000478473 | 154 |
| 204 | 3300005535 | Ga0070684_100012632 | Ga0070684_1000126324 | 154 |
| 205 | 3300005536 | Ga0070697_100064994 | Ga0070697_1000649942 | 154 |
| 206 | 3300005539 | Ga0068853_101279183 | Ga0068853_1012791831 | 154 |
| 207 | 3300005545 | Ga0070695_100021991 | Ga0070695_1000219912 | 154 |
| 208 | 3300005545 | Ga0070695_100097671 | Ga0070695_1000976712 | 154 |
| 209 | 3300005545 | Ga0070695_100662906 | Ga0070695_1006629062 | 154 |
| 210 | 3300005545 | Ga0070695_100678394 | Ga0070695_1006783941 | 154 |
| 211 | 3300005546 | Ga0070696_100007503 | Ga0070696_1000075031 | 154 |
| 212 | 3300005546 | Ga0070696_100071908 | Ga0070696_1000719081 | 154 |
| 213 | 3300005546 | Ga0070696_100565417 | Ga0070696_1005654172 | 154 |
| 214 | 3300005546 | Ga0070696_101154530 | Ga0070696_1011545301 | 154 |
| 215 | 3300005547 | Ga0070693_100279272 | Ga0070693_1002792722 | 154 |
| 216 | 3300005547 | Ga0070693_100465503 | Ga0070693_1004655032 | 154 |
| 217 | 3300005549 | Ga0070704_100001415 | Ga0070704_10000141515 | 154 |
| 218 | 3300005549 | Ga0070704_100003271 | Ga0070704_1000032714 | 154 |
| 219 | 3300005549 | Ga0070704_100477051 | Ga0070704_1004770512 | 154 |
| 220 | 3300005549 | Ga0070704_100536038 | Ga0070704_1005360382 | 154 |
| 221 | 3300005564 | Ga0070664_100420499 | Ga0070664_1004204991 | 154 |
| 222 | 3300005577 | Ga0068857_100619314 | Ga0068857_1006193141 | 154 |
| 223 | 3300005617 | Ga0068859_100814856 | Ga0068859_1008148562 | 154 |
| 224 | 3300005618 | Ga0068864_100303727 | Ga0068864_1003037272 | 154 |
| 225 | 3300005719 | Ga0068861_100013261 | Ga0068861_1000132615 | 154 |
| 226 | 3300005719 | Ga0068861_100364699 | Ga0068861_1003646992 | 154 |
| 227 | 3300005719 | Ga0068861_100949665 | Ga0068861_1009496651 | 154 |
| 228 | 3300005719 | Ga0068861_100966944 | Ga0068861_1009669441 | 154 |
| 229 | 3300005844 | Ga0068862_100041133 | Ga0068862_1000411333 | 154 |
| 230 | 3300005844 | Ga0068862_100071645 | Ga0068862_1000716453 | 154 |
| 231 | 3300005844 | Ga0068862_100250993 | Ga0068862_1002509933 | 154 |
| 232 | 3300005844 | Ga0068862_100283152 | Ga0068862_1002831522 | 154 |
| 233 | 3300005985 | Ga0081539_10000842 | Ga0081539_1000084273 | 154 |
| 234 | 3300006173 | Ga0070716_100004507 | Ga0070716_1000045072 | 154 |
| 235 | 3300006237 | Ga0097621_101175211 | Ga0097621_1011752111 | 154 |
| 236 | 3300006844 | Ga0075428_100017325 | Ga0075428_1000173256 | 154 |
| 237 | 3300006844 | Ga0075428_100099471 | Ga0075428_1000994711 | 154 |
| 238 | 3300006844 | Ga0075428_100175066 | Ga0075428_1001750663 | 154 |
| 239 | 3300006846 | Ga0075430_100003868 | Ga0075430_10000386811 | 154 |
| 240 | 3300006846 | Ga0075430_100022846 | Ga0075430_1000228465 | 154 |
| 241 | 3300006846 | Ga0075430_100272277 | Ga0075430_1002722773 | 154 |
| 242 | 3300006847 | Ga0075431_100012828 | Ga0075431_1000128283 | 154 |
| 243 | 3300006847 | Ga0075431_100295201 | Ga0075431_1002952013 | 154 |
| 244 | 3300006871 | Ga0075434_100000073 | Ga0075434_10000007310 | 154 |
| 245 | 3300006871 | Ga0075434_100036600 | Ga0075434_1000366004 | 154 |
| 246 | 3300006871 | Ga0075434_100638907 | Ga0075434_1006389072 | 154 |
| 247 | 3300006871 | Ga0075434_101294397 | Ga0075434_1012943971 | 154 |
| 248 | 3300006871 | Ga0075434_101492886 | Ga0075434_1014928862 | 154 |
| 249 | 3300006880 | Ga0075429_100000832 | Ga0075429_10000083228 | 154 |
| 250 | 3300006880 | Ga0075429_100173918 | Ga0075429_1001739182 | 154 |
| 251 | 3300006880 | Ga0075429_100178209 | Ga0075429_1001782092 | 154 |
| 252 | 3300006880 | Ga0075429_101226563 | Ga0075429_1012265631 | 154 |
| 253 | 3300006881 | Ga0068865_100008105 | Ga0068865_1000081053 | 154 |
| 254 | 3300006881 | Ga0068865_101889057 | Ga0068865_1018890571 | 154 |
| 255 | 3300006914 | Ga0075436_100000205 | Ga0075436_10000020536 | 154 |
| 256 | 3300006914 | Ga0075436_100013578 | Ga0075436_1000135783 | 154 |
| 257 | 3300006914 | Ga0075436_100090711 | Ga0075436_1000907112 | 154 |
| 258 | 3300006914 | Ga0075436_100300374 | Ga0075436_1003003742 | 154 |
| 259 | 3300006931 | Ga0097620_100814887 | Ga0097620_1008148872 | 154 |
| 260 | 3300007076 | Ga0075435_100081861 | Ga0075435_1000818612 | 154 |
| 261 | 3300007265 | Ga0099794_10026051 | Ga0099794_100260513 | 154 |
| 262 | 3300007265 | Ga0099794_10097540 | Ga0099794_100975402 | 154 |
| 263 | 3300007265 | Ga0099794_10165686 | Ga0099794_101656862 | 154 |
| 264 | 3300007265 | Ga0099794_10249705 | Ga0099794_102497052 | 154 |
| 265 | 3300007265 | Ga0099794_10291906 | Ga0099794_102919061 | 154 |
| 266 | 3300007265 | Ga0099794_10544055 | Ga0099794_105440551 | 154 |
| 267 | 3300007788 | Ga0099795_10330843 | Ga0099795_103308431 | 154 |
| 268 | 3300009094 | Ga0111539_10046142 | Ga0111539_100461424 | 154 |
| 269 | 3300009094 | Ga0111539_10047339 | Ga0111539_100473393 | 154 |
| 270 | 3300009094 | Ga0111539_10047790 | Ga0111539_100477902 | 154 |
| 271 | 3300009094 | Ga0111539_10087485 | Ga0111539_100874854 | 154 |
| 272 | 3300009094 | Ga0111539_10554603 | Ga0111539_105546032 | 154 |
| 273 | 3300009147 | Ga0114129_10002896 | Ga0114129_1000289622 | 154 |
| 274 | 3300009147 | Ga0114129_10184031 | Ga0114129_101840312 | 154 |
| 275 | 3300009147 | Ga0114129_10332533 | Ga0114129_103325333 | 154 |
| 276 | 3300009147 | Ga0114129_10729544 | Ga0114129_107295442 | 154 |
| 277 | 3300009147 | Ga0114129_12479601 | Ga0114129_124796011 | 154 |
| 278 | 3300009147 | Ga0114129_12650695 | Ga0114129_126506951 | 154 |
| 279 | 3300009148 | Ga0105243_10109524 | Ga0105243_101095242 | 154 |
| 280 | 3300009148 | Ga0105243_10218457 | Ga0105243_102184572 | 154 |
| 281 | 3300009176 | Ga0105242_10429485 | Ga0105242_104294852 | 154 |
| 282 | 3300009553 | Ga0105249_10008790 | Ga0105249_100087904 | 154 |
| 283 | 3300013105 | Ga0157369_10693125 | Ga0157369_106931252 | 154 |
| 284 | 3300013307 | Ga0157372_10634216 | Ga0157372_106342161 | 154 |
| 285 | 3300013308 | Ga0157375_12059655 | Ga0157375_120596551 | 154 |
| 286 | 3300014326 | Ga0157380_10013330 | Ga0157380_100133302 | 154 |
| 287 | 3300014745 | Ga0157377_10151669 | Ga0157377_101516692 | 154 |
| 288 | 3300014745 | Ga0157377_10333343 | Ga0157377_103333432 | 154 |
| 289 | 3300014968 | Ga0157379_11282928 | Ga0157379_112829282 | 154 |
| 290 | 3300014969 | Ga0157376_10178381 | Ga0157376_101783812 | 154 |
| 291 | 3300017792 | Ga0163161_10420652 | Ga0163161_104206522 | 154 |
| 292 | 3300020070 | Ga0206356_10307192 | Ga0206356_103071921 | 154 |
| 293 | 3300025885 | Ga0207653_10086539 | Ga0207653_100865392 | 154 |
| 294 | 3300025893 | Ga0207682_10413005 | Ga0207682_104130051 | 154 |
| 295 | 3300025898 | Ga0207692_10323593 | Ga0207692_103235932 | 154 |
| 296 | 3300025906 | Ga0207699_10188451 | Ga0207699_101884511 | 154 |
| 297 | 3300025907 | Ga0207645_10049368 | Ga0207645_100493682 | 154 |
| 298 | 3300025908 | Ga0207643_10013945 | Ga0207643_100139453 | 154 |
| 299 | 3300025908 | Ga0207643_10147708 | Ga0207643_101477081 | 154 |
| 300 | 3300025910 | Ga0207684_10552861 | Ga0207684_105528611 | 154 |
| 301 | 3300025912 | Ga0207707_10110099 | Ga0207707_101100993 | 154 |
| 302 | 3300025916 | Ga0207663_10463019 | Ga0207663_104630191 | 154 |
| 303 | 3300025917 | Ga0207660_10062248 | Ga0207660_100622482 | 154 |
| 304 | 3300025917 | Ga0207660_10425681 | Ga0207660_104256811 | 154 |
| 305 | 3300025917 | Ga0207660_10956936 | Ga0207660_109569361 | 154 |
| 306 | 3300025918 | Ga0207662_10060345 | Ga0207662_100603451 | 154 |
| 307 | 3300025918 | Ga0207662_10151910 | Ga0207662_101519102 | 154 |
| 308 | 3300025918 | Ga0207662_10183190 | Ga0207662_101831902 | 154 |
| 309 | 3300025918 | Ga0207662_11171181 | Ga0207662_111711811 | 154 |
| 310 | 3300025921 | Ga0207652_10100884 | Ga0207652_101008843 | 154 |
| 311 | 3300025922 | Ga0207646_10677968 | Ga0207646_106779682 | 154 |
| 312 | 3300025923 | Ga0207681_10005713 | Ga0207681_100057136 | 154 |
| 313 | 3300025926 | Ga0207659_10073547 | Ga0207659_100735472 | 154 |
| 314 | 3300025934 | Ga0207686_10256560 | Ga0207686_102565602 | 154 |
| 315 | 3300025935 | Ga0207709_10039097 | Ga0207709_100390972 | 154 |
| 316 | 3300025936 | Ga0207670_10071657 | Ga0207670_100716572 | 154 |
| 317 | 3300025936 | Ga0207670_10110229 | Ga0207670_101102293 | 154 |
| 318 | 3300025936 | Ga0207670_10151278 | Ga0207670_101512782 | 154 |
| 319 | 3300025936 | Ga0207670_10326630 | Ga0207670_103266302 | 154 |
| 320 | 3300025937 | Ga0207669_10029230 | Ga0207669_100292303 | 154 |
| 321 | 3300025937 | Ga0207669_10793512 | Ga0207669_107935122 | 154 |
| 322 | 3300025938 | Ga0207704_10127713 | Ga0207704_101277133 | 154 |
| 323 | 3300025939 | Ga0207665_10007173 | Ga0207665_100071732 | 154 |
| 324 | 3300025939 | Ga0207665_10186263 | Ga0207665_101862632 | 154 |
| 325 | 3300025940 | Ga0207691_10057731 | Ga0207691_100577312 | 154 |
| 326 | 3300025942 | Ga0207689_10026651 | Ga0207689_100266513 | 154 |
| 327 | 3300025944 | Ga0207661_10524678 | Ga0207661_105246782 | 154 |
| 328 | 3300025960 | Ga0207651_10214407 | Ga0207651_102144072 | 154 |
| 329 | 3300025960 | Ga0207651_10250357 | Ga0207651_102503572 | 154 |
| 330 | 3300025960 | Ga0207651_10836294 | Ga0207651_108362942 | 154 |
| 331 | 3300025961 | Ga0207712_10007303 | Ga0207712_100073033 | 154 |
| 332 | 3300025972 | Ga0207668_10008880 | Ga0207668_100088806 | 154 |
| 333 | 3300026023 | Ga0207677_10399794 | Ga0207677_103997942 | 154 |
| 334 | 3300026075 | Ga0207708_10007750 | Ga0207708_100077503 | 154 |
| 335 | 3300026075 | Ga0207708_10139805 | Ga0207708_101398052 | 154 |
| 336 | 3300026075 | Ga0207708_10310191 | Ga0207708_103101912 | 154 |
| 337 | 3300026075 | Ga0207708_10806333 | Ga0207708_108063331 | 154 |
| 338 | 3300026089 | Ga0207648_10008533 | Ga0207648_100085334 | 154 |
| 339 | 3300026089 | Ga0207648_10119846 | Ga0207648_101198462 | 154 |
| 340 | 3300026095 | Ga0207676_10330655 | Ga0207676_103306552 | 154 |
| 341 | 3300026116 | Ga0207674_10138825 | Ga0207674_101388253 | 154 |
| 342 | 3300026118 | Ga0207675_100004506 | Ga0207675_1000045067 | 154 |
| 343 | 3300026118 | Ga0207675_100344164 | Ga0207675_1003441642 | 154 |
| 344 | 3300026118 | Ga0207675_100438531 | Ga0207675_1004385312 | 154 |
| 345 | 3300026118 | Ga0207675_101076762 | Ga0207675_1010767621 | 154 |
| 346 | 3300027360 | Ga0209969_1020779 | Ga0209969_10207792 | 154 |
| 347 | 3300027364 | Ga0209967_1000884 | Ga0209967_10008843 | 154 |
| 348 | 3300027378 | Ga0209981_1000310 | Ga0209981_10003102 | 154 |
| 349 | 3300027378 | Ga0209981_1032075 | Ga0209981_10320752 | 154 |
| 350 | 3300027395 | Ga0209996_1018334 | Ga0209996_10183341 | 154 |
| 351 | 3300027462 | Ga0210000_1000624 | Ga0210000_10006242 | 154 |
| 352 | 3300027471 | Ga0209995_1003506 | Ga0209995_10035061 | 154 |
| 353 | 3300027471 | Ga0209995_1009839 | Ga0209995_10098392 | 154 |
| 354 | 3300027471 | Ga0209995_1053600 | Ga0209995_10536001 | 154 |
| 355 | 3300027543 | Ga0209999_1002308 | Ga0209999_10023081 | 154 |
| 356 | 3300027543 | Ga0209999_1036195 | Ga0209999_10361952 | 154 |
| 357 | 3300027665 | Ga0209983_1014604 | Ga0209983_10146042 | 154 |
| 358 | 3300027671 | Ga0209588_1000881 | Ga0209588_10008815 | 154 |
| 359 | 3300027671 | Ga0209588_1018434 | Ga0209588_10184342 | 154 |
| 360 | 3300027671 | Ga0209588_1125882 | Ga0209588_11258821 | 154 |
| 361 | 3300027682 | Ga0209971_1057758 | Ga0209971_10577581 | 154 |
| 362 | 3300027695 | Ga0209966_1015486 | Ga0209966_10154863 | 154 |
| 363 | 3300027876 | Ga0209974_10009659 | Ga0209974_100096593 | 154 |
| 364 | 3300027876 | Ga0209974_10220301 | Ga0209974_102203012 | 154 |
| 365 | 3300027907 | Ga0207428_10071945 | Ga0207428_100719451 | 154 |
| 366 | 3300027907 | Ga0207428_10072217 | Ga0207428_100722172 | 154 |
| 367 | 3300027907 | Ga0207428_10075323 | Ga0207428_100753233 | 154 |
| 368 | 3300028380 | Ga0268265_10025442 | Ga0268265_100254423 | 154 |
| 369 | 3300028380 | Ga0268265_10107368 | Ga0268265_101073681 | 154 |
| 370 | 3300028380 | Ga0268265_10257151 | Ga0268265_102571513 | 154 |
| 371 | 3300028380 | Ga0268265_10581844 | Ga0268265_105818442 | 154 |
| 372 | 3300028381 | Ga0268264_10539530 | Ga0268264_105395302 | 154 |
| 373 | 3300031548 | Ga0307408_100176698 | Ga0307408_1001766982 | 154 |
| 374 | 3300031548 | Ga0307408_100196788 | Ga0307408_1001967882 | 154 |
| 375 | 3300031548 | Ga0307408_101490570 | Ga0307408_1014905701 | 154 |
| 376 | 3300031665 | Ga0316575_10009403 | Ga0316575_100094034 | 154 |
| 377 | 3300031691 | Ga0316579_10053730 | Ga0316579_100537301 | 154 |
| 378 | 3300031728 | Ga0316578_10018325 | Ga0316578_100183255 | 154 |
| 379 | 3300031911 | Ga0307412_10123067 | Ga0307412_101230672 | 154 |
| 380 | 3300031911 | Ga0307412_10276573 | Ga0307412_102765732 | 154 |
| 381 | 3300031911 | Ga0307412_10472482 | Ga0307412_104724822 | 154 |
| 382 | 3300032002 | Ga0307416_100785157 | Ga0307416_1007851572 | 154 |
| 383 | 3300032002 | Ga0307416_102946849 | Ga0307416_1029468491 | 154 |
| 384 | 3300032002 | Ga0307416_103419543 | Ga0307416_1034195431 | 154 |
| 385 | 3300032004 | Ga0307414_11950188 | Ga0307414_119501881 | 154 |
| 386 | 3300032005 | Ga0307411_10381773 | Ga0307411_103817732 | 154 |
| 387 | 3300032005 | Ga0307411_10435842 | Ga0307411_104358422 | 154 |
| 388 | 3300032133 | Ga0316583_10033290 | Ga0316583_100332902 | 154 |
| 389 | 3300034820 | Ga0373959_0007907 | Ga0373959_0007907_1146_1610 | 154 |
| 390 | 3300035085 | Ga0373929_0037517 | Ga0373929_0037517_39_509 | 154 |
| 391 | 3300035086 | Ga0373934_0000927 | Ga0373934_0000927_7185_7661 | 154 |
| 392 | 3300035092 | Ga0373952_0073225 | Ga0373952_0073225_104_574 | 154 |
| 393 | 3300035111 | Ga0373923_0001061 | Ga0373923_0001061_6718_7194 | 154 |
| 394 | 3300035113 | Ga0373936_0058554 | Ga0373936_0058554_934_1410 | 154 |
| 395 | 3300035114 | Ga0373939_0031855 | Ga0373939_0031855_883_1353 | 154 |
| 396 | 3300035114 | Ga0373939_0101195 | Ga0373939_0101195_203_673 | 154 |
| 397 | 3300035115 | Ga0373941_0004938 | Ga0373941_0004938_1872_2342 | 154 |
| 398 | 3300035115 | Ga0373941_0267156 | Ga0373941_0267156_182_652 | 154 |
| 399 | 3300035117 | Ga0373953_0002557 | Ga0373953_0002557_1730_2206 | 154 |
| 400 | 3300035118 | Ga0373954_0002423 | Ga0373954_0002423_6626_7102 | 154 |
| 401 | 3300035118 | Ga0373954_0005281 | Ga0373954_0005281_3660_4136 | 154 |
| 402 | 3300035119 | Ga0373956_0001667 | Ga0373956_0001667_4457_4933 | 154 |
| 403 | 3300035119 | Ga0373956_0001841 | Ga0373956_0001841_1971_2447 | 154 |
| 404 | 3300035120 | Ga0373957_0042858 | Ga0373957_0042858_1131_1607 | 154 |
| 405 | 3300035120 | Ga0373957_0070108 | Ga0373957_0070108_755_1231 | 154 |
| 406 | 3300035121 | Ga0373960_0045252 | Ga0373960_0045252_464_934 | 154 |
| 407 | 3300035121 | Ga0373960_0136965 | Ga0373960_0136965_72_542 | 154 |
| 408 | 3300035207 | Ga0373942_0002629 | Ga0373942_0002629_2201_2680 | 154 |
| 409 | 3300035207 | Ga0373942_0220501 | Ga0373942_0220501_41_511 | 154 |
| 410 | 3300035241 | Ga0373961_0017229 | Ga0373961_0017229_702_1172 | 154 |
| 411 | 3300035241 | Ga0373961_0243589 | Ga0373961_0243589_80_550 | 154 |
| 412 | 3300035242 | Ga0373962_0052671 | Ga0373962_0052671_143_613 | 154 |
| 413 | 3300035410 | Ga0373924_0006450 | Ga0373924_0006450_3174_3650 | 154 |
| 414 | 3300035410 | Ga0373924_0485178 | Ga0373924_0485178_59_535 | 154 |
| 415 | 3300035691 | Ga0373931_0006170 | Ga0373931_0006170_2380_2850 | 154 |
| 416 | 3300035691 | Ga0373931_0020035 | Ga0373931_0020035_346_816 | 154 |
| 417 | 3300035691 | Ga0373931_0308281 | Ga0373931_0308281_447_923 | 154 |
| 418 | 3300035692 | Ga0373935_0003613 | Ga0373935_0003613_1913_2389 | 154 |
| 419 | 3300035695 | Ga0373927_0010306 | Ga0373927_0010306_508_984 | 154 |
| 420 | 3300035724 | Ga0373933_0006322 | Ga0373933_0006322_4783_5259 | 154 |
| 421 | 3300035724 | Ga0373933_0091707 | Ga0373933_0091707_1107_1583 | 154 |
| 422 | 3300035724 | Ga0373933_0492714 | Ga0373933_0492714_57_542 | 154 |
| 423 | 3300036401 | Ga0373937_0001026 | Ga0373937_0001026_18354_18830 | 154 |
| 424 | 3300036401 | Ga0373937_0070854 | Ga0373937_0070854_2470_2946 | 154 |
| 425 | 3300036401 | Ga0373937_0193158 | Ga0373937_0193158_1076_1546 | 154 |
| 426 | 3300036401 | Ga0373937_0200648 | Ga0373937_0200648_313_783 | 154 |
| 427 | 3300036401 | Ga0373937_0245262 | Ga0373937_0245262_465_941 | 154 |
| 428 | 3300036647 | Ga0316582_0025338 | Ga0316582_0025338_1007_1483 | 154 |
| 429 | 3300036712 | Ga0316584_0512087 | Ga0316584_0512087_294_770 | 154 |
| 430 | 3300037068 | Ga0373925_0003111 | Ga0373925_0003111_1970_2446 | 154 |
| 431 | 3300039438 | Ga0436360_1341558 | Ga0436360_1341558_717_1193 | 154 |
| 432 | 3300041406 | Ga0439439_0054435 | Ga0439439_0054435_32_502 | 154 |
| 433 | 3300041408 | Ga0439453_0011225 | Ga0439453_0011225_1015_1479 | 154 |
| 434 | 3300041410 | Ga0439461_0010851 | Ga0439461_0010851_1077_1547 | 154 |
| 435 | 3300042009 | Ga0439451_015271 | Ga0439451_015271_602_1066 | 154 |
| 436 | 3300042013 | Ga0439456_030254 | Ga0439456_030254_14_478 | 154 |
| 437 | 3300042156 | Ga0439446_0040964 | Ga0439446_0040964_458_928 | 154 |
| 438 | 3300042156 | Ga0439446_0249041 | Ga0439446_0249041_116_580 | 154 |
| 439 | 3300042435 | Ga0439434_0000699 | Ga0439434_0000699_2777_3247 | 154 |
| 440 | 3300042435 | Ga0439434_0044132 | Ga0439434_0044132_898_1362 | 154 |
| 441 | 3300042436 | Ga0439435_0008199 | Ga0439435_0008199_581_1045 | 154 |
| 442 | 3300042436 | Ga0439435_0022553 | Ga0439435_0022553_974_1444 | 154 |
| 443 | 3300042436 | Ga0439435_0055943 | Ga0439435_0055943_244_708 | 154 |
| 444 | 3300042437 | Ga0439444_0007155 | Ga0439444_0007155_1079_1543 | 154 |
| 445 | 3300042461 | Ga0439460_0025039 | Ga0439460_0025039_1074_1538 | 154 |
| 446 | 3300042876 | Ga0451577_0948371 | Ga0451577_0948371_78_566 | 154 |
| 447 | 3300042993 | Ga0439440_0145382 | Ga0439440_0145382_49_519 | 154 |
| 448 | 3300044683 | Ga0466965_0054544 | Ga0466965_0054544_317_787 | 154 |
| 449 | 3300045051 | Ga0451576_1312027 | Ga0451576_1312027_198_674 | 154 |
| 450 | 3300046454 | Ga0495592_0029053 | Ga0495592_0029053_2812_3288 | 154 |
| 451 | 3300046454 | Ga0495592_0048947 | Ga0495592_0048947_1946_2422 | 154 |
| 452 | 3300046455 | Ga0495603_0316054 | Ga0495603_0316054_356_832 | 154 |
| 453 | 3300046459 | Ga0495629_0066799 | Ga0495629_0066799_1970_2446 | 154 |
| 454 | 3300046461 | Ga0495641_0005144 | Ga0495641_0005144_8210_8686 | 154 |
| 455 | 3300046462 | Ga0495651_0001528 | Ga0495651_0001528_9995_10471 | 154 |
| 456 | 3300046462 | Ga0495651_0004190 | Ga0495651_0004190_3603_4079 | 154 |
| 457 | 3300046463 | Ga0495653_0009088 | Ga0495653_0009088_5700_6176 | 154 |
| 458 | 3300046463 | Ga0495653_0135641 | Ga0495653_0135641_658_1134 | 154 |
| 459 | 3300046463 | Ga0495653_0743647 | Ga0495653_0743647_44_520 | 154 |
| 460 | 3300046472 | Ga0495580_0018844 | Ga0495580_0018844_2688_3164 | 154 |
| 461 | 3300046475 | Ga0495639_0002185 | Ga0495639_0002185_3603_4079 | 154 |
| 462 | 3300046476 | Ga0495662_0018325 | Ga0495662_0018325_2609_3085 | 154 |
| 463 | 3300046476 | Ga0495662_0079289 | Ga0495662_0079289_65_541 | 154 |
| 464 | 3300046477 | Ga0495664_0081074 | Ga0495664_0081074_1328_1804 | 154 |
| 465 | 3300046511 | Ga0495608_0003114 | Ga0495608_0003114_10350_10826 | 154 |
| 466 | 3300046511 | Ga0495608_0045756 | Ga0495608_0045756_1163_1639 | 154 |
| 467 | 3300046514 | Ga0495618_0022879 | Ga0495618_0022879_1654_2130 | 154 |
| 468 | 3300046514 | Ga0495618_0052136 | Ga0495618_0052136_1971_2447 | 154 |
| 469 | 3300046516 | Ga0495628_0041512 | Ga0495628_0041512_2887_3363 | 154 |
| 470 | 3300046517 | Ga0495630_0000851 | Ga0495630_0000851_1146_1622 | 154 |
| 471 | 3300046517 | Ga0495630_0450554 | Ga0495630_0450554_165_641 | 154 |
| 472 | 3300046526 | Ga0495666_0045537 | Ga0495666_0045537_991_1467 | 154 |
| 473 | 3300046526 | Ga0495666_0089060 | Ga0495666_0089060_39_560 | 154 |
| 474 | 3300046529 | Ga0495652_0045337 | Ga0495652_0045337_1375_1851 | 154 |
| 475 | 3300046533 | Ga0495640_0028067 | Ga0495640_0028067_2858_3334 | 154 |
| 476 | 3300046535 | Ga0495586_0002520 | Ga0495586_0002520_4783_5259 | 154 |
| 477 | 3300046535 | Ga0495586_0118185 | Ga0495586_0118185_239_760 | 154 |
| 478 | 3300046535 | Ga0495586_0236938 | Ga0495586_0236938_267_743 | 154 |
| 479 | 3300046536 | Ga0495587_0003382 | Ga0495587_0003382_8642_9118 | 154 |
| 480 | 3300046536 | Ga0495587_0006598 | Ga0495587_0006598_6031_6507 | 154 |
| 481 | 3300046543 | Ga0495645_0037686 | Ga0495645_0037686_1108_1584 | 154 |
| 482 | 3300046559 | Ga0495667_0047217 | Ga0495667_0047217_1953_2429 | 154 |
| 483 | 3300046559 | Ga0495667_0079452 | Ga0495667_0079452_1107_1583 | 154 |
| 484 | 3300046559 | Ga0495667_0373285 | Ga0495667_0373285_278_754 | 154 |
| 485 | 3300046642 | Ga0495634_0051715 | Ga0495634_0051715_818_1294 | 154 |
| 486 | 3300046642 | Ga0495634_0161296 | Ga0495634_0161296_267_743 | 154 |
| 487 | 3300046663 | Ga0495635_0046410 | Ga0495635_0046410_475_951 | 154 |
| 488 | 3300046675 | Ga0495657_0007456 | Ga0495657_0007456_6250_6726 | 154 |
| 489 | 3300046675 | Ga0495657_0065254 | Ga0495657_0065254_141_617 | 154 |
| 490 | 3300046675 | Ga0495657_0161532 | Ga0495657_0161532_141_617 | 154 |
| 491 | 3300046678 | Ga0495599_0007268 | Ga0495599_0007268_3894_4370 | 154 |
| 492 | 3300046678 | Ga0495599_0170148 | Ga0495599_0170148_785_1255 | 154 |
| 493 | 3300046681 | Ga0495647_0075647 | Ga0495647_0075647_540_1016 | 154 |
| 494 | 3300046681 | Ga0495647_0086052 | Ga0495647_0086052_574_1050 | 154 |
| 495 | 3300046683 | Ga0495658_0119842 | Ga0495658_0119842_1003_1479 | 154 |
| 496 | 3300046683 | Ga0495658_0936676 | Ga0495658_0936676_21_497 | 154 |
| 497 | 3300046689 | Ga0495613_0412102 | Ga0495613_0412102_380_856 | 154 |
| 498 | 3300046690 | Ga0495624_0197977 | Ga0495624_0197977_486_962 | 154 |
| 499 | 3300046809 | Ga0495600_0020078 | Ga0495600_0020078_279_755 | 154 |
| 500 | 3300046809 | Ga0495600_0020363 | Ga0495600_0020363_1148_1624 | 154 |
| 501 | 3300047315 | Ga0495581_0074892 | Ga0495581_0074892_517_1038 | 154 |
| 502 | 3300047315 | Ga0495581_0667494 | Ga0495581_0667494_45_521 | 154 |
| 503 | 3300047317 | Ga0495604_0012460 | Ga0495604_0012460_1501_1977 | 154 |
| 504 | 3300047317 | Ga0495604_0023283 | Ga0495604_0023283_1510_1986 | 154 |
| 505 | 3300047319 | Ga0495674_0005814 | Ga0495674_0005814_7148_7624 | 154 |
| 506 | 3300047322 | Ga0495680_0001252 | Ga0495680_0001252_25836_26312 | 154 |
| 507 | 3300047322 | Ga0495680_0082697 | Ga0495680_0082697_1276_1752 | 154 |
| 508 | 3300047322 | Ga0495680_0177271 | Ga0495680_0177271_1044_1520 | 154 |
| 509 | 3300047444 | Ga0495675_0007174 | Ga0495675_0007174_213_689 | 154 |
| 510 | 3300047444 | Ga0495675_0071825 | Ga0495675_0071825_1063_1539 | 154 |
| 511 | 3300047471 | Ga0495684_0016574 | Ga0495684_0016574_4904_5380 | 154 |
| 512 | 3300047471 | Ga0495684_0193600 | Ga0495684_0193600_78_554 | 154 |
| 513 | 3300047471 | Ga0495684_0481307 | Ga0495684_0481307_250_726 | 154 |
| 514 | 3300049515 | Ga0501292_044861 | Ga0501292_044861_47_535 | 154 |
| 515 | 3300049515 | Ga0501292_063105 | Ga0501292_063105_64_576 | 154 |
| 516 | 3300049521 | Ga0501298_022598 | Ga0501298_022598_43_507 | 154 |
| 517 | 3300049522 | Ga0501299_144231 | Ga0501299_144231_71_535 | 154 |
| 518 | 3300049568 | Ga0501031_0011710 | Ga0501031_0011710_2765_3241 | 154 |
| 519 | 3300049569 | Ga0501032_0015532 | Ga0501032_0015532_2955_3431 | 154 |
| 520 | 3300049570 | Ga0501033_0006483 | Ga0501033_0006483_6628_7104 | 154 |
| 521 | 3300049570 | Ga0501033_0335109 | Ga0501033_0335109_107_571 | 154 |
| 522 | 3300049572 | Ga0501036_0001252 | Ga0501036_0001252_1984_2460 | 154 |
| 523 | 3300049572 | Ga0501036_0059286 | Ga0501036_0059286_1176_1640 | 154 |
| 524 | 3300049572 | Ga0501036_0216282 | Ga0501036_0216282_1105_1569 | 154 |
| 525 | 3300049573 | Ga0501037_0042207 | Ga0501037_0042207_2861_3337 | 154 |
| 526 | 3300049574 | Ga0501038_0001280 | Ga0501038_0001280_9176_9652 | 154 |
| 527 | 3300049574 | Ga0501038_0128702 | Ga0501038_0128702_1097_1561 | 154 |
| 528 | 3300049574 | Ga0501038_1192944 | Ga0501038_1192944_54_536 | 154 |
| 529 | 3300049575 | Ga0501039_0011180 | Ga0501039_0011180_882_1358 | 154 |
| 530 | 3300049575 | Ga0501039_0152376 | Ga0501039_0152376_720_1202 | 154 |
| 531 | 3300049576 | Ga0501040_0000052 | Ga0501040_0000052_49398_49874 | 154 |
| 532 | 3300049576 | Ga0501040_0078654 | Ga0501040_0078654_688_1152 | 154 |
| 533 | 3300049577 | Ga0501041_0004912 | Ga0501041_0004912_5080_5556 | 154 |
| 534 | 3300049577 | Ga0501041_0090832 | Ga0501041_0090832_1081_1545 | 154 |
| 535 | 3300049577 | Ga0501041_0110569 | Ga0501041_0110569_355_828 | 154 |
| 536 | 3300049577 | Ga0501041_0129865 | Ga0501041_0129865_1088_1552 | 154 |
| 537 | 3300049578 | Ga0501042_0013259 | Ga0501042_0013259_4317_4793 | 154 |
| 538 | 3300049578 | Ga0501042_0074219 | Ga0501042_0074219_953_1417 | 154 |
| 539 | 3300049578 | Ga0501042_0115127 | Ga0501042_0115127_115_579 | 154 |
| 540 | 3300049579 | Ga0501043_0015925 | Ga0501043_0015925_4317_4793 | 154 |
| 541 | 3300049580 | Ga0501046_0000271 | Ga0501046_0000271_3142_3618 | 154 |
| 542 | 3300049582 | Ga0501048_0001409 | Ga0501048_0001409_14070_14546 | 154 |
| 543 | 3300049582 | Ga0501048_0022699 | Ga0501048_0022699_18_482 | 154 |
| 544 | 3300049582 | Ga0501048_0677235 | Ga0501048_0677235_118_582 | 154 |
| 545 | 3300049584 | Ga0501068_0030228 | Ga0501068_0030228_1653_2129 | 154 |
| 546 | 3300049584 | Ga0501068_0297858 | Ga0501068_0297858_360_833 | 154 |
| 547 | 3300049587 | Ga0501071_0033617 | Ga0501071_0033617_158_634 | 154 |
| 548 | 3300049587 | Ga0501071_0307458 | Ga0501071_0307458_24_488 | 154 |
| 549 | 3300049587 | Ga0501071_0876686 | Ga0501071_0876686_85_549 | 154 |
| 550 | 3300049588 | Ga0501072_0003349 | Ga0501072_0003349_4015_4491 | 154 |
| 551 | 3300049588 | Ga0501072_0108153 | Ga0501072_0108153_785_1249 | 154 |
| 552 | 3300049588 | Ga0501072_1148486 | Ga0501072_1148486_24_494 | 154 |
| 553 | 3300049590 | Ga0501074_0185266 | Ga0501074_0185266_257_733 | 154 |
| 554 | 3300049591 | Ga0501075_0000751 | Ga0501075_0000751_16505_16981 | 154 |
| 555 | 3300049591 | Ga0501075_0001243 | Ga0501075_0001243_2663_3127 | 154 |
| 556 | 3300049591 | Ga0501075_0083266 | Ga0501075_0083266_1260_1733 | 154 |
| 557 | 3300049591 | Ga0501075_0270924 | Ga0501075_0270924_49_513 | 154 |
| 558 | 3300049592 | Ga0501076_0000290 | Ga0501076_0000290_1132_1596 | 154 |
| 559 | 3300049592 | Ga0501076_0006671 | Ga0501076_0006671_6760_7236 | 154 |
| 560 | 3300049592 | Ga0501076_0526727 | Ga0501076_0526727_38_520 | 154 |
| 561 | 3300049593 | Ga0501077_0008144 | Ga0501077_0008144_2850_3326 | 154 |
| 562 | 3300049593 | Ga0501077_0024729 | Ga0501077_0024729_2283_2747 | 154 |
| 563 | 3300049649 | Ga0501198_021510 | Ga0501198_021510_499_1011 | 154 |
| 564 | 3300049668 | Ga0501233_017091 | Ga0501233_017091_17_529 | 154 |
| 565 | 3300049741 | Ga0501079_0000061 | Ga0501079_0000061_44296_44772 | 154 |
| 566 | 3300049741 | Ga0501079_0204890 | Ga0501079_0204890_530_1012 | 154 |
| 567 | 3300049741 | Ga0501079_0207768 | Ga0501079_0207768_853_1317 | 154 |
| 568 | 3300049742 | Ga0501080_0022971 | Ga0501080_0022971_4157_4633 | 154 |
| 569 | 3300049742 | Ga0501080_0096381 | Ga0501080_0096381_2226_2699 | 154 |
| 570 | 3300049743 | Ga0501081_0000110 | Ga0501081_0000110_4626_5102 | 154 |
| 571 | 3300049743 | Ga0501081_0056555 | Ga0501081_0056555_1131_1595 | 154 |
| 572 | 3300049743 | Ga0501081_0082284 | Ga0501081_0082284_1159_1641 | 154 |
| 573 | 3300049744 | Ga0501083_0100203 | Ga0501083_0100203_255_731 | 154 |
| 574 | 3300049744 | Ga0501083_0108208 | Ga0501083_0108208_1166_1630 | 154 |
| 575 | 3300049744 | Ga0501083_0130681 | Ga0501083_0130681_816_1298 | 154 |
| 576 | 3300049775 | Ga0501279_019506 | Ga0501279_019506_371_859 | 154 |
| 577 | 3300049779 | Ga0501283_070470 | Ga0501283_070470_54_518 | 154 |
| 578 | 3300049822 | Ga0501035_0073483 | Ga0501035_0073483_722_1198 | 154 |
| 579 | 3300049823 | Ga0501044_0072036 | Ga0501044_0072036_2437_2913 | 154 |
| 580 | 3300049824 | Ga0501045_0002891 | Ga0501045_0002891_5761_6237 | 154 |
| 581 | 3300049824 | Ga0501045_1104412 | Ga0501045_1104412_53_517 | 154 |
| 582 | 3300050507 | nmdc:mga05p37_471014_c1 | nmdc:mga05p37_471014_c1_863_1333 | 154 |
| 583 | 3300050507 | nmdc:mga05p37_78_c1 | nmdc:mga05p37_78_c1_38611_39096 | 154 |
| 584 | 3300050508 | nmdc:mga09592_119266_c1 | nmdc:mga09592_119266_c1_815_1291 | 154 |
| 585 | 3300050508 | nmdc:mga09592_264_c1 | nmdc:mga09592_264_c1_22714_23199 | 154 |
| 586 | 3300050508 | nmdc:mga09592_414027_c1 | nmdc:mga09592_414027_c1_642_1106 | 154 |
| 587 | 3300050509 | nmdc:mga0qj67_201156_c1 | nmdc:mga0qj67_201156_c1_510_974 | 154 |
| 588 | 3300050509 | nmdc:mga0qj67_222839_c1 | nmdc:mga0qj67_222839_c1_1001_1465 | 154 |
| 589 | 3300050509 | nmdc:mga0qj67_237804_c1 | nmdc:mga0qj67_237804_c1_71_535 | 154 |
| 590 | 3300050509 | nmdc:mga0qj67_915119_c1 | nmdc:mga0qj67_915119_c1_178_642 | 154 |
| 591 | 3300050510 | nmdc:mga06r32_1282979_c1 | nmdc:mga06r32_1282979_c1_155_619 | 154 |
| 592 | 3300050510 | nmdc:mga06r32_5387_c2 | nmdc:mga06r32_5387_c2_1825_2310 | 154 |
| 593 | 3300050510 | nmdc:mga06r32_87082_c1 | nmdc:mga06r32_87082_c1_2349_2813 | 154 |
| 594 | 3300050511 | nmdc:mga08y16_1062068_c1 | nmdc:mga08y16_1062068_c1_135_620 | 154 |
| 595 | 3300050511 | nmdc:mga08y16_107926_c1 | nmdc:mga08y16_107926_c1_1461_1937 | 154 |
| 596 | 3300050511 | nmdc:mga08y16_112219_c1 | nmdc:mga08y16_112219_c1_1097_1561 | 154 |
| 597 | 3300050511 | nmdc:mga08y16_14672_c1 | nmdc:mga08y16_14672_c1_1428_1892 | 154 |
| 598 | 3300050511 | nmdc:mga08y16_59668_c1 | nmdc:mga08y16_59668_c1_946_1410 | 154 |
| 599 | 3300050511 | nmdc:mga08y16_731718_c1 | nmdc:mga08y16_731718_c1_159_623 | 154 |
| 600 | 3300050512 | nmdc:mga0n895_19782_c1 | nmdc:mga0n895_19782_c1_3032_3508 | 154 |
| 601 | 3300050512 | nmdc:mga0n895_582_c1 | nmdc:mga0n895_582_c1_15844_16314 | 154 |
| 602 | 3300050512 | nmdc:mga0n895_668203_c1 | nmdc:mga0n895_668203_c1_422_916 | 154 |
| 603 | 3300050513 | nmdc:mga0rr50_2806_c1 | nmdc:mga0rr50_2806_c1_6772_7242 | 154 |
| 604 | 3300050513 | nmdc:mga0rr50_836509_c1 | nmdc:mga0rr50_836509_c1_16_492 | 154 |
| 605 | 3300050514 | nmdc:mga08x19_103339_c1 | nmdc:mga08x19_103339_c1_1373_1849 | 154 |
| 606 | 3300050514 | nmdc:mga08x19_1308_c1 | nmdc:mga08x19_1308_c1_12944_13414 | 154 |
| 607 | 3300050514 | nmdc:mga08x19_167747_c1 | nmdc:mga08x19_167747_c1_38_532 | 154 |
| 608 | 3300050514 | nmdc:mga08x19_18933_c1 | nmdc:mga08x19_18933_c1_1713_2183 | 154 |
| 609 | 3300050514 | nmdc:mga08x19_512384_c1 | nmdc:mga08x19_512384_c1_239_709 | 154 |
| 610 | 3300050514 | nmdc:mga08x19_695052_c1 | nmdc:mga08x19_695052_c1_194_664 | 154 |
| 611 | 3300050515 | nmdc:mga0a205_313976_c1 | nmdc:mga0a205_313976_c1_728_1204 | 154 |
| 612 | 3300050515 | nmdc:mga0a205_344883_c1 | nmdc:mga0a205_344883_c1_729_1205 | 154 |
| 613 | 3300053078 | Ga0495612_0069482 | Ga0495612_0069482_55_531 | 154 |
| 614 | 3300053085 | Ga0495619_0004389 | Ga0495619_0004389_1107_1583 | 154 |
| 615 | 3300053094 | Ga0500566_0344287 | Ga0500566_0344287_107_583 | 154 |
| 616 | 3300054114 | Ga0501084_0001172 | Ga0501084_0001172_3558_4034 | 154 |
| 617 | 3300054114 | Ga0501084_0069282 | Ga0501084_0069282_1520_1984 | 154 |
| 618 | 3300054114 | Ga0501084_0277148 | Ga0501084_0277148_812_1294 | 154 |
| 619 | 3300054114 | Ga0501084_0362490 | Ga0501084_0362490_309_797 | 154 |
| 620 | 3300054114 | Ga0501084_1457848 | Ga0501084_1457848_75_539 | 154 |
| 621 | 3300059424 | Ga0590075_162224 | Ga0590075_162224_67_531 | 154 |
| 622 | 3300059426 | Ga0590077_071846 | Ga0590077_071846_247_717 | 154 |
| 623 | 3300060353 | Ga0501082_0004197 | Ga0501082_0004197_3333_3809 | 154 |
| 624 | 3300060353 | Ga0501082_0096614 | Ga0501082_0096614_1453_1935 | 154 |
| 625 | 3300060353 | Ga0501082_0120467 | Ga0501082_0120467_883_1347 | 154 |
| 626 | 3300061734 | Ga0530510_0000048 | Ga0530510_0000048_12496_12960 | 154 |
| 627 | 3300061734 | Ga0530510_0000186 | Ga0530510_0000186_34222_34698 | 154 |
| 628 | 3300061734 | Ga0530510_0191812 | Ga0530510_0191812_1000_1473 | 154 |
| 629 | 3300061734 | Ga0530510_0869249 | Ga0530510_0869249_42_524 | 154 |
| 630 | 3300005289 | Ga0065704_10041276 | Ga0065704_100412761 | 155 |
| 631 | 3300005295 | Ga0065707_10330711 | Ga0065707_103307111 | 155 |
| 632 | 3300005330 | Ga0070690_100000758 | Ga0070690_1000007584 | 155 |
| 633 | 3300005330 | Ga0070690_100179335 | Ga0070690_1001793352 | 155 |
| 634 | 3300005331 | Ga0070670_100765812 | Ga0070670_1007658122 | 155 |
| 635 | 3300005334 | Ga0068869_100001703 | Ga0068869_1000017039 | 155 |
| 636 | 3300005334 | Ga0068869_100001795 | Ga0068869_1000017951 | 155 |
| 637 | 3300005335 | Ga0070666_10183799 | Ga0070666_101837992 | 155 |
| 638 | 3300005336 | Ga0070680_100024647 | Ga0070680_1000246473 | 155 |
| 639 | 3300005337 | Ga0070682_100004264 | Ga0070682_1000042643 | 155 |
| 640 | 3300005338 | Ga0068868_100000169 | Ga0068868_1000001694 | 155 |
| 641 | 3300005338 | Ga0068868_100181578 | Ga0068868_1001815782 | 155 |
| 642 | 3300005339 | Ga0070660_100272244 | Ga0070660_1002722442 | 155 |
| 643 | 3300005340 | Ga0070689_100077140 | Ga0070689_1000771402 | 155 |
| 644 | 3300005340 | Ga0070689_100163455 | Ga0070689_1001634552 | 155 |
| 645 | 3300005340 | Ga0070689_100513304 | Ga0070689_1005133042 | 155 |
| 646 | 3300005341 | Ga0070691_10020766 | Ga0070691_100207663 | 155 |
| 647 | 3300005343 | Ga0070687_100000112 | Ga0070687_10000011235 | 155 |
| 648 | 3300005344 | Ga0070661_100072196 | Ga0070661_1000721962 | 155 |
| 649 | 3300005345 | Ga0070692_10000260 | Ga0070692_100002602 | 155 |
| 650 | 3300005345 | Ga0070692_10232897 | Ga0070692_102328972 | 155 |
| 651 | 3300005356 | Ga0070674_100387381 | Ga0070674_1003873811 | 155 |
| 652 | 3300005356 | Ga0070674_100832461 | Ga0070674_1008324611 | 155 |
| 653 | 3300005364 | Ga0070673_100699443 | Ga0070673_1006994432 | 155 |
| 654 | 3300005364 | Ga0070673_101725593 | Ga0070673_1017255931 | 155 |
| 655 | 3300005365 | Ga0070688_100572513 | Ga0070688_1005725131 | 155 |
| 656 | 3300005367 | Ga0070667_100209649 | Ga0070667_1002096492 | 155 |
| 657 | 3300005438 | Ga0070701_10003531 | Ga0070701_100035313 | 155 |
| 658 | 3300005440 | Ga0070705_100011432 | Ga0070705_1000114323 | 155 |
| 659 | 3300005440 | Ga0070705_100320451 | Ga0070705_1003204512 | 155 |
| 660 | 3300005444 | Ga0070694_100187862 | Ga0070694_1001878621 | 155 |
| 661 | 3300005444 | Ga0070694_101139573 | Ga0070694_1011395731 | 155 |
| 662 | 3300005445 | Ga0070708_100064500 | Ga0070708_1000645003 | 155 |
| 663 | 3300005457 | Ga0070662_100096492 | Ga0070662_1000964922 | 155 |
| 664 | 3300005458 | Ga0070681_10001458 | Ga0070681_100014584 | 155 |
| 665 | 3300005458 | Ga0070681_10087279 | Ga0070681_100872792 | 155 |
| 666 | 3300005459 | Ga0068867_100001181 | Ga0068867_10000118115 | 155 |
| 667 | 3300005459 | Ga0068867_100033240 | Ga0068867_1000332402 | 155 |
| 668 | 3300005466 | Ga0070685_10638662 | Ga0070685_106386621 | 155 |
| 669 | 3300005466 | Ga0070685_10790286 | Ga0070685_107902861 | 155 |
| 670 | 3300005471 | Ga0070698_100912975 | Ga0070698_1009129751 | 155 |
| 671 | 3300005530 | Ga0070679_100021105 | Ga0070679_1000211054 | 155 |
| 672 | 3300005539 | Ga0068853_100036438 | Ga0068853_1000364385 | 155 |
| 673 | 3300005539 | Ga0068853_100076380 | Ga0068853_1000763803 | 155 |
| 674 | 3300005544 | Ga0070686_100005999 | Ga0070686_1000059993 | 155 |
| 675 | 3300005544 | Ga0070686_100486760 | Ga0070686_1004867602 | 155 |
| 676 | 3300005545 | Ga0070695_100060766 | Ga0070695_1000607662 | 155 |
| 677 | 3300005546 | Ga0070696_100003044 | Ga0070696_1000030443 | 155 |
| 678 | 3300005546 | Ga0070696_100083140 | Ga0070696_1000831402 | 155 |
| 679 | 3300005546 | Ga0070696_100410052 | Ga0070696_1004100522 | 155 |
| 680 | 3300005547 | Ga0070693_100030068 | Ga0070693_1000300682 | 155 |
| 681 | 3300005547 | Ga0070693_100144158 | Ga0070693_1001441582 | 155 |
| 682 | 3300005549 | Ga0070704_100008163 | Ga0070704_1000081634 | 155 |
| 683 | 3300005549 | Ga0070704_100243771 | Ga0070704_1002437711 | 155 |
| 684 | 3300005563 | Ga0068855_100053051 | Ga0068855_1000530513 | 155 |
| 685 | 3300005563 | Ga0068855_100213198 | Ga0068855_1002131982 | 155 |
| 686 | 3300005577 | Ga0068857_100007353 | Ga0068857_1000073534 | 155 |
| 687 | 3300005577 | Ga0068857_100056140 | Ga0068857_1000561404 | 155 |
| 688 | 3300005578 | Ga0068854_100003215 | Ga0068854_10000321511 | 155 |
| 689 | 3300005614 | Ga0068856_100096496 | Ga0068856_1000964962 | 155 |
| 690 | 3300005614 | Ga0068856_100126582 | Ga0068856_1001265822 | 155 |
| 691 | 3300005614 | Ga0068856_100178994 | Ga0068856_1001789942 | 155 |
| 692 | 3300005615 | Ga0070702_100014801 | Ga0070702_1000148013 | 155 |
| 693 | 3300005615 | Ga0070702_100223864 | Ga0070702_1002238642 | 155 |
| 694 | 3300005616 | Ga0068852_100134170 | Ga0068852_1001341702 | 155 |
| 695 | 3300005617 | Ga0068859_100040783 | Ga0068859_1000407834 | 155 |
| 696 | 3300005617 | Ga0068859_100073919 | Ga0068859_1000739192 | 155 |
| 697 | 3300005617 | Ga0068859_100076303 | Ga0068859_1000763032 | 155 |
| 698 | 3300005618 | Ga0068864_100030981 | Ga0068864_1000309813 | 155 |
| 699 | 3300005618 | Ga0068864_100082692 | Ga0068864_1000826923 | 155 |
| 700 | 3300005718 | Ga0068866_10007632 | Ga0068866_100076322 | 155 |
| 701 | 3300005718 | Ga0068866_10055570 | Ga0068866_100555702 | 155 |
| 702 | 3300005719 | Ga0068861_100001299 | Ga0068861_10000129915 | 155 |
| 703 | 3300005840 | Ga0068870_10019003 | Ga0068870_100190032 | 155 |
| 704 | 3300005841 | Ga0068863_100247449 | Ga0068863_1002474492 | 155 |
| 705 | 3300005842 | Ga0068858_100035118 | Ga0068858_1000351184 | 155 |
| 706 | 3300005842 | Ga0068858_100136730 | Ga0068858_1001367302 | 155 |
| 707 | 3300005842 | Ga0068858_100379235 | Ga0068858_1003792352 | 155 |
| 708 | 3300005842 | Ga0068858_101080720 | Ga0068858_1010807201 | 155 |
| 709 | 3300005843 | Ga0068860_100049251 | Ga0068860_1000492513 | 155 |
| 710 | 3300005843 | Ga0068860_100165741 | Ga0068860_1001657412 | 155 |
| 711 | 3300005843 | Ga0068860_100183967 | Ga0068860_1001839672 | 155 |
| 712 | 3300005843 | Ga0068860_100347596 | Ga0068860_1003475962 | 155 |
| 713 | 3300005844 | Ga0068862_100002444 | Ga0068862_10000244417 | 155 |
| 714 | 3300005844 | Ga0068862_101186450 | Ga0068862_1011864502 | 155 |
| 715 | 3300006237 | Ga0097621_100008740 | Ga0097621_1000087403 | 155 |
| 716 | 3300006237 | Ga0097621_100218593 | Ga0097621_1002185932 | 155 |
| 717 | 3300006237 | Ga0097621_101255051 | Ga0097621_1012550511 | 155 |
| 718 | 3300006358 | Ga0068871_100014795 | Ga0068871_1000147954 | 155 |
| 719 | 3300006358 | Ga0068871_100017615 | Ga0068871_1000176156 | 155 |
| 720 | 3300006844 | Ga0075428_100008533 | Ga0075428_10000853314 | 155 |
| 721 | 3300006844 | Ga0075428_100027994 | Ga0075428_1000279943 | 155 |
| 722 | 3300006846 | Ga0075430_100798627 | Ga0075430_1007986271 | 155 |
| 723 | 3300006847 | Ga0075431_100227291 | Ga0075431_1002272913 | 155 |
| 724 | 3300006852 | Ga0075433_10001178 | Ga0075433_1000117816 | 155 |
| 725 | 3300006871 | Ga0075434_100001217 | Ga0075434_1000012176 | 155 |
| 726 | 3300006880 | Ga0075429_100005024 | Ga0075429_10000502410 | 155 |
| 727 | 3300006881 | Ga0068865_100002861 | Ga0068865_1000028618 | 155 |
| 728 | 3300006881 | Ga0068865_101028399 | Ga0068865_1010283991 | 155 |
| 729 | 3300006914 | Ga0075436_100003082 | Ga0075436_1000030822 | 155 |
| 730 | 3300006914 | Ga0075436_100375168 | Ga0075436_1003751682 | 155 |
| 731 | 3300006931 | Ga0097620_100040783 | Ga0097620_1000407832 | 155 |
| 732 | 3300006931 | Ga0097620_100073916 | Ga0097620_1000739162 | 155 |
| 733 | 3300006931 | Ga0097620_100076300 | Ga0097620_1000763002 | 155 |
| 734 | 3300007076 | Ga0075435_100000549 | Ga0075435_1000005498 | 155 |
| 735 | 3300007076 | Ga0075435_100630813 | Ga0075435_1006308132 | 155 |
| 736 | 3300007265 | Ga0099794_10018805 | Ga0099794_100188054 | 155 |
| 737 | 3300009093 | Ga0105240_10584684 | Ga0105240_105846842 | 155 |
| 738 | 3300009094 | Ga0111539_10023101 | Ga0111539_100231012 | 155 |
| 739 | 3300009094 | Ga0111539_10592557 | Ga0111539_105925571 | 155 |
| 740 | 3300009098 | Ga0105245_10000259 | Ga0105245_1000025953 | 155 |
| 741 | 3300009098 | Ga0105245_10020740 | Ga0105245_100207403 | 155 |
| 742 | 3300009101 | Ga0105247_10111952 | Ga0105247_101119522 | 155 |
| 743 | 3300009147 | Ga0114129_10384053 | Ga0114129_103840532 | 155 |
| 744 | 3300009148 | Ga0105243_10015069 | Ga0105243_100150693 | 155 |
| 745 | 3300009148 | Ga0105243_10248657 | Ga0105243_102486571 | 155 |
| 746 | 3300009148 | Ga0105243_10274551 | Ga0105243_102745512 | 155 |
| 747 | 3300009176 | Ga0105242_10013543 | Ga0105242_100135434 | 155 |
| 748 | 3300009176 | Ga0105242_10040775 | Ga0105242_100407754 | 155 |
| 749 | 3300009176 | Ga0105242_10303439 | Ga0105242_103034391 | 155 |
| 750 | 3300009177 | Ga0105248_10008114 | Ga0105248_100081148 | 155 |
| 751 | 3300009177 | Ga0105248_10569339 | Ga0105248_105693392 | 155 |
| 752 | 3300009545 | Ga0105237_10017011 | Ga0105237_100170114 | 155 |
| 753 | 3300009553 | Ga0105249_10065108 | Ga0105249_100651083 | 155 |
| 754 | 3300010375 | Ga0105239_10086505 | Ga0105239_100865052 | 155 |
| 755 | 3300010375 | Ga0105239_10299239 | Ga0105239_102992392 | 155 |
| 756 | 3300011119 | Ga0105246_10182074 | Ga0105246_101820742 | 155 |
| 757 | 3300012492 | Ga0157335_1019794 | Ga0157335_10197942 | 155 |
| 758 | 3300013105 | Ga0157369_10364019 | Ga0157369_103640192 | 155 |
| 759 | 3300013296 | Ga0157374_10019265 | Ga0157374_100192653 | 155 |
| 760 | 3300013296 | Ga0157374_12134839 | Ga0157374_121348391 | 155 |
| 761 | 3300013297 | Ga0157378_10011016 | Ga0157378_100110165 | 155 |
| 762 | 3300013306 | Ga0163162_10223351 | Ga0163162_102233513 | 155 |
| 763 | 3300013306 | Ga0163162_10497852 | Ga0163162_104978522 | 155 |
| 764 | 3300013306 | Ga0163162_11086676 | Ga0163162_110866762 | 155 |
| 765 | 3300013307 | Ga0157372_11226250 | Ga0157372_112262502 | 155 |
| 766 | 3300013308 | Ga0157375_10358208 | Ga0157375_103582082 | 155 |
| 767 | 3300014325 | Ga0163163_10228692 | Ga0163163_102286923 | 155 |
| 768 | 3300014326 | Ga0157380_10076719 | Ga0157380_100767193 | 155 |
| 769 | 3300014326 | Ga0157380_10527773 | Ga0157380_105277732 | 155 |
| 770 | 3300014326 | Ga0157380_11289430 | Ga0157380_112894302 | 155 |
| 771 | 3300014968 | Ga0157379_10064557 | Ga0157379_100645572 | 155 |
| 772 | 3300014968 | Ga0157379_10305578 | Ga0157379_103055783 | 155 |
| 773 | 3300014969 | Ga0157376_10004961 | Ga0157376_100049619 | 155 |
| 774 | 3300014969 | Ga0157376_10057987 | Ga0157376_100579873 | 155 |
| 775 | 3300017792 | Ga0163161_11074484 | Ga0163161_110744841 | 155 |
| 776 | 3300025899 | Ga0207642_10002932 | Ga0207642_100029324 | 155 |
| 777 | 3300025899 | Ga0207642_10513112 | Ga0207642_105131122 | 155 |
| 778 | 3300025901 | Ga0207688_10154686 | Ga0207688_101546862 | 155 |
| 779 | 3300025903 | Ga0207680_10184209 | Ga0207680_101842092 | 155 |
| 780 | 3300025913 | Ga0207695_10569337 | Ga0207695_105693372 | 155 |
| 781 | 3300025914 | Ga0207671_10015443 | Ga0207671_100154434 | 155 |
| 782 | 3300025917 | Ga0207660_10023363 | Ga0207660_100233633 | 155 |
| 783 | 3300025918 | Ga0207662_10000106 | Ga0207662_1000010618 | 155 |
| 784 | 3300025919 | Ga0207657_10312236 | Ga0207657_103122362 | 155 |
| 785 | 3300025921 | Ga0207652_10009867 | Ga0207652_100098674 | 155 |
| 786 | 3300025922 | Ga0207646_11103108 | Ga0207646_111031081 | 155 |
| 787 | 3300025925 | Ga0207650_10615567 | Ga0207650_106155672 | 155 |
| 788 | 3300025927 | Ga0207687_10030722 | Ga0207687_100307223 | 155 |
| 789 | 3300025934 | Ga0207686_10007420 | Ga0207686_100074204 | 155 |
| 790 | 3300025934 | Ga0207686_10049528 | Ga0207686_100495281 | 155 |
| 791 | 3300025935 | Ga0207709_10001408 | Ga0207709_100014082 | 155 |
| 792 | 3300025935 | Ga0207709_10161383 | Ga0207709_101613832 | 155 |
| 793 | 3300025936 | Ga0207670_10051331 | Ga0207670_100513312 | 155 |
| 794 | 3300025936 | Ga0207670_10299993 | Ga0207670_102999932 | 155 |
| 795 | 3300025938 | Ga0207704_10009742 | Ga0207704_100097424 | 155 |
| 796 | 3300025938 | Ga0207704_10169081 | Ga0207704_101690812 | 155 |
| 797 | 3300025938 | Ga0207704_11338728 | Ga0207704_113387281 | 155 |
| 798 | 3300025941 | Ga0207711_10264947 | Ga0207711_102649472 | 155 |
| 799 | 3300025941 | Ga0207711_10526631 | Ga0207711_105266312 | 155 |
| 800 | 3300025942 | Ga0207689_10000376 | Ga0207689_100003763 | 155 |
| 801 | 3300025942 | Ga0207689_10003070 | Ga0207689_100030709 | 155 |
| 802 | 3300025949 | Ga0207667_10070136 | Ga0207667_100701364 | 155 |
| 803 | 3300025949 | Ga0207667_10212080 | Ga0207667_102120802 | 155 |
| 804 | 3300025960 | Ga0207651_10279266 | Ga0207651_102792661 | 155 |
| 805 | 3300025960 | Ga0207651_10550239 | Ga0207651_105502391 | 155 |
| 806 | 3300025961 | Ga0207712_10212602 | Ga0207712_102126022 | 155 |
| 807 | 3300025972 | Ga0207668_10580070 | Ga0207668_105800702 | 155 |
| 808 | 3300025981 | Ga0207640_10006997 | Ga0207640_100069974 | 155 |
| 809 | 3300025986 | Ga0207658_10262765 | Ga0207658_102627652 | 155 |
| 810 | 3300026023 | Ga0207677_10003904 | Ga0207677_100039044 | 155 |
| 811 | 3300026023 | Ga0207677_10090834 | Ga0207677_100908342 | 155 |
| 812 | 3300026023 | Ga0207677_10667672 | Ga0207677_106676722 | 155 |
| 813 | 3300026035 | Ga0207703_10003689 | Ga0207703_100036893 | 155 |
| 814 | 3300026035 | Ga0207703_10193101 | Ga0207703_101931012 | 155 |
| 815 | 3300026035 | Ga0207703_10345043 | Ga0207703_103450432 | 155 |
| 816 | 3300026035 | Ga0207703_10402959 | Ga0207703_104029592 | 155 |
| 817 | 3300026035 | Ga0207703_11038591 | Ga0207703_110385911 | 155 |
| 818 | 3300026041 | Ga0207639_10060156 | Ga0207639_100601563 | 155 |
| 819 | 3300026041 | Ga0207639_10167638 | Ga0207639_101676382 | 155 |
| 820 | 3300026075 | Ga0207708_10322349 | Ga0207708_103223492 | 155 |
| 821 | 3300026078 | Ga0207702_10098663 | Ga0207702_100986632 | 155 |
| 822 | 3300026078 | Ga0207702_10228910 | Ga0207702_102289102 | 155 |
| 823 | 3300026078 | Ga0207702_10508597 | Ga0207702_105085972 | 155 |
| 824 | 3300026088 | Ga0207641_10726389 | Ga0207641_107263892 | 155 |
| 825 | 3300026089 | Ga0207648_10032928 | Ga0207648_100329284 | 155 |
| 826 | 3300026089 | Ga0207648_10057472 | Ga0207648_100574723 | 155 |
| 827 | 3300026095 | Ga0207676_10024443 | Ga0207676_100244434 | 155 |
| 828 | 3300026095 | Ga0207676_10627899 | Ga0207676_106278992 | 155 |
| 829 | 3300026116 | Ga0207674_10028098 | Ga0207674_100280983 | 155 |
| 830 | 3300026116 | Ga0207674_10972161 | Ga0207674_109721612 | 155 |
| 831 | 3300026118 | Ga0207675_100048496 | Ga0207675_1000484963 | 155 |
| 832 | 3300026118 | Ga0207675_100083503 | Ga0207675_1000835032 | 155 |
| 833 | 3300026121 | Ga0207683_10151638 | Ga0207683_101516382 | 155 |
| 834 | 3300026121 | Ga0207683_10564800 | Ga0207683_105648002 | 155 |
| 835 | 3300026142 | Ga0207698_10105200 | Ga0207698_101052002 | 155 |
| 836 | 3300026142 | Ga0207698_11545225 | Ga0207698_115452251 | 155 |
| 837 | 3300027907 | Ga0207428_10012800 | Ga0207428_100128002 | 155 |
| 838 | 3300027907 | Ga0207428_10088601 | Ga0207428_100886012 | 155 |
| 839 | 3300028379 | Ga0268266_10492219 | Ga0268266_104922192 | 155 |
| 840 | 3300028380 | Ga0268265_10029590 | Ga0268265_100295902 | 155 |
| 841 | 3300028380 | Ga0268265_11150833 | Ga0268265_111508332 | 155 |
| 842 | 3300028381 | Ga0268264_10032986 | Ga0268264_100329862 | 155 |
| 843 | 3300028381 | Ga0268264_10279564 | Ga0268264_102795642 | 155 |
| 844 | 3300028381 | Ga0268264_10332921 | Ga0268264_103329212 | 155 |
| 845 | 3300031456 | Ga0307513_10481528 | Ga0307513_104815282 | 155 |
| 846 | 3300031548 | Ga0307408_101528249 | Ga0307408_1015282492 | 155 |
| 847 | 3300034817 | Ga0373948_0068906 | Ga0373948_0068906_257_724 | 155 |
| 848 | 3300034819 | Ga0373958_0015294 | Ga0373958_0015294_839_1306 | 155 |
| 849 | 3300034957 | Ga0373938_0027274 | Ga0373938_0027274_604_1071 | 155 |
| 850 | 3300035083 | Ga0373926_0001421 | Ga0373926_0001421_1674_2141 | 155 |
| 851 | 3300035088 | Ga0373940_0000658 | Ga0373940_0000658_2091_2558 | 155 |
| 852 | 3300035089 | Ga0373944_0008050 | Ga0373944_0008050_70_537 | 155 |
| 853 | 3300035092 | Ga0373952_0006719 | Ga0373952_0006719_1025_1492 | 155 |
| 854 | 3300035112 | Ga0373932_0002462 | Ga0373932_0002462_1590_2057 | 155 |
| 855 | 3300035113 | Ga0373936_0029074 | Ga0373936_0029074_23_490 | 155 |
| 856 | 3300035113 | Ga0373936_0120651 | Ga0373936_0120651_594_1064 | 155 |
| 857 | 3300035114 | Ga0373939_0015512 | Ga0373939_0015512_823_1290 | 155 |
| 858 | 3300035114 | Ga0373939_0386107 | Ga0373939_0386107_55_537 | 155 |
| 859 | 3300035115 | Ga0373941_0014498 | Ga0373941_0014498_1489_1956 | 155 |
| 860 | 3300035116 | Ga0373945_0000803 | Ga0373945_0000803_6923_7390 | 155 |
| 861 | 3300035117 | Ga0373953_0007213 | Ga0373953_0007213_339_809 | 155 |
| 862 | 3300035118 | Ga0373954_0297813 | Ga0373954_0297813_61_531 | 155 |
| 863 | 3300035119 | Ga0373956_0180535 | Ga0373956_0180535_501_971 | 155 |
| 864 | 3300035170 | Ga0373943_0061504 | Ga0373943_0061504_800_1279 | 155 |
| 865 | 3300035171 | Ga0373946_0028087 | Ga0373946_0028087_60_527 | 155 |
| 866 | 3300035172 | Ga0373955_0068382 | Ga0373955_0068382_797_1267 | 155 |
| 867 | 3300035207 | Ga0373942_0057096 | Ga0373942_0057096_457_924 | 155 |
| 868 | 3300035241 | Ga0373961_0019706 | Ga0373961_0019706_300_767 | 155 |
| 869 | 3300035242 | Ga0373962_0002511 | Ga0373962_0002511_1085_1552 | 155 |
| 870 | 3300035410 | Ga0373924_0017690 | Ga0373924_0017690_1745_2215 | 155 |
| 871 | 3300035691 | Ga0373931_0001493 | Ga0373931_0001493_2991_3458 | 155 |
| 872 | 3300035691 | Ga0373931_0021061 | Ga0373931_0021061_1485_1964 | 155 |
| 873 | 3300035692 | Ga0373935_0021405 | Ga0373935_0021405_2599_3066 | 155 |
| 874 | 3300035695 | Ga0373927_0004507 | Ga0373927_0004507_1685_2152 | 155 |
| 875 | 3300035724 | Ga0373933_0006503 | Ga0373933_0006503_1688_2158 | 155 |
| 876 | 3300035725 | Ga0373947_0019034 | Ga0373947_0019034_2555_3022 | 155 |
| 877 | 3300036401 | Ga0373937_0011656 | Ga0373937_0011656_4775_5245 | 155 |
| 878 | 3300037068 | Ga0373925_0112428 | Ga0373925_0112428_689_1156 | 155 |
| 879 | 3300042437 | Ga0439444_0000648 | Ga0439444_0000648_3368_3835 | 155 |
| 880 | 3300042876 | Ga0451577_0121570 | Ga0451577_0121570_1030_1497 | 155 |
| 881 | 3300045051 | Ga0451576_0005020 | Ga0451576_0005020_13857_14324 | 155 |
| 882 | 3300045051 | Ga0451576_0191105 | Ga0451576_0191105_755_1222 | 155 |
| 883 | 3300045051 | Ga0451576_0195488 | Ga0451576_0195488_755_1222 | 155 |
| 884 | 3300045051 | Ga0451576_1344618 | Ga0451576_1344618_35_502 | 155 |
| 885 | 3300045051 | Ga0451576_1516540 | Ga0451576_1516540_161_628 | 155 |
| 886 | 3300046455 | Ga0495603_0002444 | Ga0495603_0002444_4933_5400 | 155 |
| 887 | 3300046463 | Ga0495653_0441880 | Ga0495653_0441880_109_579 | 155 |
| 888 | 3300046472 | Ga0495580_0017020 | Ga0495580_0017020_57_524 | 155 |
| 889 | 3300046473 | Ga0495582_0006969 | Ga0495582_0006969_1674_2141 | 155 |
| 890 | 3300046475 | Ga0495639_0057626 | Ga0495639_0057626_919_1386 | 155 |
| 891 | 3300046511 | Ga0495608_0134577 | Ga0495608_0134577_92_565 | 155 |
| 892 | 3300046535 | Ga0495586_0016097 | Ga0495586_0016097_2419_2886 | 155 |
| 893 | 3300046539 | Ga0495621_0123686 | Ga0495621_0123686_509_979 | 155 |
| 894 | 3300046557 | Ga0495622_0067906 | Ga0495622_0067906_924_1391 | 155 |
| 895 | 3300046615 | Ga0495656_0046959 | Ga0495656_0046959_186_665 | 155 |
| 896 | 3300046663 | Ga0495635_0310646 | Ga0495635_0310646_168_638 | 155 |
| 897 | 3300046681 | Ga0495647_0000090 | Ga0495647_0000090_4326_4793 | 155 |
| 898 | 3300046683 | Ga0495658_0007437 | Ga0495658_0007437_4418_4885 | 155 |
| 899 | 3300047315 | Ga0495581_0073293 | Ga0495581_0073293_1150_1617 | 155 |
| 900 | 3300047319 | Ga0495674_0611190 | Ga0495674_0611190_303_773 | 155 |
| 901 | 3300047320 | Ga0495672_0372644 | Ga0495672_0372644_142_615 | 155 |
| 902 | 3300047321 | Ga0495676_0016777 | Ga0495676_0016777_2864_3331 | 155 |
| 903 | 3300047322 | Ga0495680_0075253 | Ga0495680_0075253_1863_2333 | 155 |
| 904 | 3300047322 | Ga0495680_0624314 | Ga0495680_0624314_163_636 | 155 |
| 905 | 3300047445 | Ga0495677_0074775 | Ga0495677_0074775_47_526 | 155 |
| 906 | 3300049568 | Ga0501031_0952817 | Ga0501031_0952817_30_497 | 155 |
| 907 | 3300049570 | Ga0501033_0539639 | Ga0501033_0539639_218_694 | 155 |
| 908 | 3300049572 | Ga0501036_0056260 | Ga0501036_0056260_1137_1613 | 155 |
| 909 | 3300049575 | Ga0501039_0600088 | Ga0501039_0600088_198_674 | 155 |
| 910 | 3300049591 | Ga0501075_0254676 | Ga0501075_0254676_716_1192 | 155 |
| 911 | 3300049741 | Ga0501079_0097776 | Ga0501079_0097776_267_743 | 155 |
| 912 | 3300049742 | Ga0501080_0101151 | Ga0501080_0101151_789_1262 | 155 |
| 913 | 3300050507 | nmdc:mga05p37_21952_c1 | nmdc:mga05p37_21952_c1_6361_6828 | 155 |
| 914 | 3300050507 | nmdc:mga05p37_485301_c1 | nmdc:mga05p37_485301_c1_202_672 | 155 |
| 915 | 3300050508 | nmdc:mga09592_10611_c1 | nmdc:mga09592_10611_c1_6346_6813 | 155 |
| 916 | 3300050508 | nmdc:mga09592_248719_c1 | nmdc:mga09592_248719_c1_944_1414 | 155 |
| 917 | 3300050509 | nmdc:mga0qj67_52391_c1 | nmdc:mga0qj67_52391_c1_1206_1691 | 155 |
| 918 | 3300050511 | nmdc:mga08y16_138251_c1 | nmdc:mga08y16_138251_c1_1916_2383 | 155 |
| 919 | 3300050511 | nmdc:mga08y16_15715_c1 | nmdc:mga08y16_15715_c1_2904_3371 | 155 |
| 920 | 3300050512 | nmdc:mga0n895_12822_c1 | nmdc:mga0n895_12822_c1_5276_5743 | 155 |
| 921 | 3300050513 | nmdc:mga0rr50_3216_c1 | nmdc:mga0rr50_3216_c1_720_1187 | 155 |
| 922 | 3300050513 | nmdc:mga0rr50_665660_c1 | nmdc:mga0rr50_665660_c1_192_665 | 155 |
| 923 | 3300050514 | nmdc:mga08x19_5960_c1 | nmdc:mga08x19_5960_c1_4685_5152 | 155 |
| 924 | 3300050514 | nmdc:mga08x19_750869_c1 | nmdc:mga08x19_750869_c1_32_505 | 155 |
| 925 | 3300050515 | nmdc:mga0a205_1704_c1 | nmdc:mga0a205_1704_c1_12336_12803 | 155 |
| 926 | 3300050515 | nmdc:mga0a205_710166_c1 | nmdc:mga0a205_710166_c1_63_530 | 155 |
| 927 | 3300053084 | Ga0495595_0632316 | Ga0495595_0632316_51_521 | 155 |
| 928 | 3300054114 | Ga0501084_0068968 | Ga0501084_0068968_576_1052 | 155 |
| 929 | 3300060353 | Ga0501082_0026853 | Ga0501082_0026853_4035_4508 | 155 |
| 930 | 3300060353 | Ga0501082_0717060 | Ga0501082_0717060_69_536 | 155 |
| 931 | 3300061734 | Ga0530510_0627618 | Ga0530510_0627618_186_662 | 155 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4oxx-assembly1.cif.gz_A | crystal structure of cindoxin, surface entropy reduction mutant | 0.9177 | 1 | 149 |
| 2m6s-assembly1.cif.gz_A | holo_yqca | 0.9068 | 2 | 147 |
| 2hnb-assembly1.cif.gz_A | solution structure of a bacterial holo-flavodoxin | 0.891 | 3 | 146 |
| 4oxx-assembly1.cif.gz_A | crystal structure of cindoxin, surface entropy reduction mutant | 0.8893 | 1 | 149 |
| 1ykg-assembly1.cif.gz_A | solution structure of the flavodoxin-like domain from the escherichia coli sulfite reductase | 0.8866 | 4 | 151 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P03817_1_147_3.40.50.360 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.9428 | 3 | 148 | 3.40.50.360 |
| 4oxxA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.9177 | 1 | 149 | 3.40.50.360 |
| af_P03817_1_147_3.40.50.360 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.9121 | 3 | 148 | 3.40.50.360 |
| 2m6sA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.9068 | 2 | 147 | 3.40.50.360 |
| af_O94613_1_159_3.40.50.360 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.8935 | 2 | 150 | 3.40.50.360 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F4EK06-F1-model_v4 | Nitric oxide synthase | 0.987 | 1 | 154 |
GO:0005829
GO:0010181 GO:0016491 GO:0050660 |
| AF-A0A536T2F2-F1-model_v4 | Nitric oxide synthase | 0.9765 | 35 | 154 |
GO:0005829
GO:0010181 GO:0016491 GO:0050660 |
| AF-A0A1F4EK06-F1-model_v4 | Nitric oxide synthase | 0.9745 | 1 | 154 |
GO:0005829
GO:0010181 GO:0016491 GO:0050660 |
| AF-A0A536VWD1-F1-model_v4 | Nitric oxide synthase | 0.972 | 1 | 154 |
GO:0005829
GO:0010181 GO:0016491 GO:0050660 |
| AF-A0A522J2I4-F1-model_v4 | Nitric oxide synthase | 0.9698 | 1 | 148 |
GO:0005829
GO:0010181 GO:0016491 GO:0050660 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar