F486014
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 930 | 446 | 930 | 130 |
Family's Representative Sequence
| Representative Sequence | 3300005445|Ga0070708_100397599|Ga0070708_1003975992 |
| Length | 123 |
| Sequence | MIHIIKSFTLWEFVKAHWLTLKYFFKPKATINYPFEKNPISPRFRGEHALRRYPNGEERCIACKLCEAVCPAQAITIESEGPNFEFATETREELLYDKAKLLANGDKWERVIAANLAADAPYR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 3 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 4 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 5 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 8 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 9 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 10 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 11 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 12 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 13 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 14 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 15 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 16 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 17 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 18 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 19 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 20 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 23 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 24 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 26 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 30 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 34 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 63 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 69 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 77 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 79 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 80 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 81 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 83 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 84 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 85 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 86 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 87 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 88 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 89 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 90 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 91 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 92 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 93 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 94 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 95 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 96 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 98 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 99 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 100 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 101 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 102 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 103 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 104 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 105 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 106 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 107 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 108 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 109 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 110 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 111 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 112 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 113 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 114 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 115 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 116 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 117 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 119 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 120 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 121 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 136 | 3300009984 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG | Metagenome | Rhizosphere |
| 137 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Metagenome | Rhizosphere |
| 140 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 141 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 152 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 156 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 157 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 158 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 159 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 224 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 225 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 226 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 227 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 228 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 233 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 234 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 235 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 236 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 237 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 238 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 239 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 240 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 241 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 242 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 243 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 244 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 245 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 246 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 247 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 248 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 249 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 250 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 251 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 252 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 253 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 254 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 255 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 256 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 257 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 258 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 259 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 260 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 261 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 262 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 263 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 264 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 265 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 266 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 267 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 268 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 269 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 270 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 271 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 272 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 273 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 274 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 275 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 276 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 277 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 278 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 279 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 280 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 281 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 282 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 283 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 284 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 285 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 286 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 287 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 288 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 289 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 290 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 291 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 292 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 293 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 294 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 346 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 347 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 348 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 349 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 350 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 351 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 352 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 353 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 354 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 355 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 356 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 357 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 358 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 359 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 360 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 361 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 362 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 363 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 364 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 365 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 366 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 367 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 368 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 369 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 384 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 391 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 396 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 397 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 398 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 400 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 401 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 404 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 405 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 406 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 407 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 408 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 409 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 410 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 411 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 412 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 413 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 414 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 415 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 416 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 417 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 420 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 424 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 425 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 426 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 427 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 428 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 429 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 430 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 431 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 432 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 433 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 434 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 435 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 436 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 437 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 438 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 439 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 440 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 441 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 442 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 443 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 444 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 445 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 446 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.78 |
| Metatranscriptomes | 0.22 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.31 |
| Nodule | 0.54 |
| Rhizoplane | 8.92 |
| Rhizosphere | 79.68 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1308435 | 2162886007 | Bacteria | 1244 |
| 2 | JGI24736J21556_1000469 | 3300001904 | Bacteria | 7572 |
| 3 | JGI24746J21847_1002318 | 3300001977 | Bacteria | 3043 |
| 4 | JGI24747J21853_1026391 | 3300001978 | Bacteria | 650 |
| 5 | JGI24740J21852_10049680 | 3300001979 | Bacteria | 1210 |
| 6 | JGI24737J22298_10004151 | 3300001990 | Bacteria | 5062 |
| 7 | JGI24737J22298_10148771 | 3300001990 | Bacteria | 691 |
| 8 | JGI24735J21928_10004647 | 3300002067 | Bacteria | 4593 |
| 9 | JGI24750J21931_1000848 | 3300002070 | Bacteria | 4217 |
| 10 | JGI24745J21846_1017104 | 3300002073 | Bacteria | 843 |
| 11 | JGI24748J21848_1001096 | 3300002074 | Bacteria | 2949 |
| 12 | JGI24738J21930_10000674 | 3300002075 | Bacteria | 9899 |
| 13 | JGI24749J21850_1002350 | 3300002076 | Bacteria | 2661 |
| 14 | JGI24744J21845_10000459 | 3300002077 | Bacteria | 7189 |
| 15 | JGI24033J26618_1001826 | 3300002155 | Bacteria | 2128 |
| 16 | JGI24742J22300_10003845 | 3300002244 | Bacteria | 2442 |
| 17 | JGI24742J22300_10032263 | 3300002244 | Bacteria | 918 |
| 18 | JGI24751J29686_10003221 | 3300002459 | Bacteria | 3283 |
| 19 | JGI25406J46586_10004353 | 3300003203 | Bacteria | 6608 |
| 20 | JGI25165J46597_1000041 | 3300003214 | Bacteria | 272566 |
| 21 | JGI25407J50210_10124764 | 3300003373 | Bacteria | 634 |
| 22 | Ga0055530_10001188 | 3300003791 | Bacteria | 20133 |
| 23 | Ga0055531_10001182 | 3300003794 | Bacteria | 20057 |
| 24 | JGI25405J52794_10001004 | 3300003911 | Bacteria | 4469 |
| 25 | Ga0065165_1003786 | 3300005262 | Bacteria | 10124 |
| 26 | Ga0065704_10002136 | 3300005289 | Bacteria | 6784 |
| 27 | Ga0065712_10076047 | 3300005290 | Bacteria | 3737 |
| 28 | Ga0065715_10096277 | 3300005293 | Bacteria | 3911 |
| 29 | Ga0070690_100231859 | 3300005330 | Bacteria | 1298 |
| 30 | Ga0070670_100061841 | 3300005331 | Bacteria | 3214 |
| 31 | Ga0070670_100186711 | 3300005331 | Bacteria | 1800 |
| 32 | Ga0068869_100994939 | 3300005334 | Bacteria | 730 |
| 33 | Ga0070666_10023515 | 3300005335 | Bacteria | 4012 |
| 34 | Ga0070666_10145194 | 3300005335 | Bacteria | 1654 |
| 35 | Ga0070666_10309560 | 3300005335 | Bacteria | 1126 |
| 36 | Ga0070680_100409186 | 3300005336 | Bacteria | 1157 |
| 37 | Ga0070680_100743222 | 3300005336 | Bacteria | 845 |
| 38 | Ga0070682_100024507 | 3300005337 | Bacteria | 3592 |
| 39 | Ga0068868_100053715 | 3300005338 | Bacteria | 3174 |
| 40 | Ga0068868_101315834 | 3300005338 | Bacteria | 672 |
| 41 | Ga0070660_100092540 | 3300005339 | Bacteria | 2386 |
| 42 | Ga0070660_100106546 | 3300005339 | Bacteria | 2226 |
| 43 | Ga0070689_100004610 | 3300005340 | Bacteria | 9339 |
| 44 | Ga0070689_101253761 | 3300005340 | Bacteria | 667 |
| 45 | Ga0070691_10079831 | 3300005341 | Bacteria | 1600 |
| 46 | Ga0070691_10248118 | 3300005341 | Bacteria | 954 |
| 47 | Ga0070687_100007225 | 3300005343 | Bacteria | 4611 |
| 48 | Ga0070661_100023471 | 3300005344 | Bacteria | 4421 |
| 49 | Ga0070661_100112141 | 3300005344 | Bacteria | 2037 |
| 50 | Ga0070692_10022848 | 3300005345 | Bacteria | 3059 |
| 51 | Ga0070668_100000010 | 3300005347 | Bacteria | 132833 |
| 52 | Ga0070668_100016202 | 3300005347 | Bacteria | 5577 |
| 53 | Ga0070668_100087407 | 3300005347 | Bacteria | 2453 |
| 54 | Ga0070668_100122212 | 3300005347 | Bacteria | 2082 |
| 55 | Ga0070668_100145088 | 3300005347 | Bacteria | 1915 |
| 56 | Ga0070669_100015953 | 3300005353 | Bacteria | 5359 |
| 57 | Ga0070669_100275541 | 3300005353 | Bacteria | 1347 |
| 58 | Ga0070669_101818405 | 3300005353 | Bacteria | 532 |
| 59 | Ga0070675_100039194 | 3300005354 | Bacteria | 3865 |
| 60 | Ga0070675_100275452 | 3300005354 | Bacteria | 1478 |
| 61 | Ga0070671_100018333 | 3300005355 | Bacteria | 5684 |
| 62 | Ga0070671_100166306 | 3300005355 | Bacteria | 1865 |
| 63 | Ga0070671_100642197 | 3300005355 | Bacteria | 919 |
| 64 | Ga0070674_100001953 | 3300005356 | Bacteria | 11251 |
| 65 | Ga0070674_100011062 | 3300005356 | Bacteria | 5476 |
| 66 | Ga0070674_101554764 | 3300005356 | Bacteria | 596 |
| 67 | Ga0070673_100033931 | 3300005364 | Bacteria | 3856 |
| 68 | Ga0070688_100191034 | 3300005365 | Bacteria | 1427 |
| 69 | Ga0070688_100604313 | 3300005365 | Bacteria | 840 |
| 70 | Ga0070659_100029462 | 3300005366 | Bacteria | 4243 |
| 71 | Ga0070659_100517441 | 3300005366 | Bacteria | 1018 |
| 72 | Ga0070659_100992794 | 3300005366 | Bacteria | 737 |
| 73 | Ga0070667_100000013 | 3300005367 | Bacteria | 255674 |
| 74 | Ga0070667_100059106 | 3300005367 | Bacteria | 3243 |
| 75 | Ga0070709_11088539 | 3300005434 | Bacteria | 639 |
| 76 | Ga0070713_100112794 | 3300005436 | Bacteria | 2373 |
| 77 | Ga0070710_10032843 | 3300005437 | Bacteria | 2814 |
| 78 | Ga0070701_10014832 | 3300005438 | Bacteria | 3582 |
| 79 | Ga0070711_100054944 | 3300005439 | Bacteria | 2749 |
| 80 | Ga0070711_101049494 | 3300005439 | Bacteria | 701 |
| 81 | Ga0070711_101528692 | 3300005439 | Bacteria | 583 |
| 82 | Ga0070705_100012708 | 3300005440 | Bacteria | 4288 |
| 83 | Ga0070705_100076984 | 3300005440 | Bacteria | 2036 |
| 84 | Ga0070700_100051429 | 3300005441 | Bacteria | 2564 |
| 85 | Ga0070694_100148281 | 3300005444 | Bacteria | 1711 |
| 86 | Ga0070708_100397599 | 3300005445 | Bacteria | 1299 |
| 87 | Ga0070663_100017388 | 3300005455 | Bacteria | 4692 |
| 88 | Ga0070663_100045120 | 3300005455 | Bacteria | 3112 |
| 89 | Ga0070663_100069461 | 3300005455 | Bacteria | 2559 |
| 90 | Ga0070678_100168505 | 3300005456 | Bacteria | 1781 |
| 91 | Ga0070662_100003080 | 3300005457 | Bacteria | 10344 |
| 92 | Ga0070662_100175324 | 3300005457 | Bacteria | 1686 |
| 93 | Ga0070662_101008481 | 3300005457 | Bacteria | 713 |
| 94 | Ga0070681_11184557 | 3300005458 | Bacteria | 686 |
| 95 | Ga0068867_100038190 | 3300005459 | Bacteria | 3495 |
| 96 | Ga0070685_10002290 | 3300005466 | Bacteria | 9880 |
| 97 | Ga0070707_101066339 | 3300005468 | Bacteria | 774 |
| 98 | Ga0070698_100280396 | 3300005471 | Bacteria | 1598 |
| 99 | Ga0070698_100311316 | 3300005471 | Bacteria | 1505 |
| 100 | Ga0070679_100370783 | 3300005530 | Bacteria | 1379 |
| 101 | Ga0070679_100498457 | 3300005530 | Bacteria | 1162 |
| 102 | Ga0070684_100043853 | 3300005535 | Bacteria | 3865 |
| 103 | Ga0068853_100038701 | 3300005539 | Bacteria | 4063 |
| 104 | Ga0068853_100583716 | 3300005539 | Bacteria | 1061 |
| 105 | Ga0068853_100704133 | 3300005539 | Bacteria | 964 |
| 106 | Ga0070672_100001270 | 3300005543 | Bacteria | 15500 |
| 107 | Ga0070686_100005738 | 3300005544 | Bacteria | 6881 |
| 108 | Ga0070695_100378240 | 3300005545 | Bacteria | 1068 |
| 109 | Ga0070696_100048816 | 3300005546 | Bacteria | 2939 |
| 110 | Ga0070696_100113008 | 3300005546 | Bacteria | 1958 |
| 111 | Ga0070696_100732098 | 3300005546 | Bacteria | 809 |
| 112 | Ga0070693_100048051 | 3300005547 | Bacteria | 2429 |
| 113 | Ga0070665_100108729 | 3300005548 | Bacteria | 2775 |
| 114 | Ga0070665_100114000 | 3300005548 | Bacteria | 2706 |
| 115 | Ga0070665_100775494 | 3300005548 | Bacteria | 972 |
| 116 | Ga0070665_102169407 | 3300005548 | Bacteria | 560 |
| 117 | Ga0070704_100037328 | 3300005549 | Bacteria | 3319 |
| 118 | Ga0070704_100301477 | 3300005549 | Bacteria | 1335 |
| 119 | Ga0068855_100939750 | 3300005563 | Bacteria | 911 |
| 120 | Ga0070664_100030051 | 3300005564 | Bacteria | 4531 |
| 121 | Ga0070664_100122682 | 3300005564 | Bacteria | 2276 |
| 122 | Ga0070664_101131941 | 3300005564 | Bacteria | 738 |
| 123 | Ga0070664_101523869 | 3300005564 | Bacteria | 633 |
| 124 | Ga0068857_100448519 | 3300005577 | Bacteria | 1206 |
| 125 | Ga0068854_100025737 | 3300005578 | Bacteria | 4037 |
| 126 | Ga0068854_100423270 | 3300005578 | Bacteria | 1107 |
| 127 | Ga0068856_100009471 | 3300005614 | Bacteria | 9458 |
| 128 | Ga0068856_100037704 | 3300005614 | Bacteria | 4743 |
| 129 | Ga0068856_100102901 | 3300005614 | Bacteria | 2850 |
| 130 | Ga0068856_100347030 | 3300005614 | Bacteria | 1503 |
| 131 | Ga0068856_101329519 | 3300005614 | Bacteria | 734 |
| 132 | Ga0070702_100009964 | 3300005615 | Bacteria | 4664 |
| 133 | Ga0070702_100380961 | 3300005615 | Bacteria | 1003 |
| 134 | Ga0068852_100023635 | 3300005616 | Bacteria | 4950 |
| 135 | Ga0068852_100237795 | 3300005616 | Bacteria | 1739 |
| 136 | Ga0068859_100033400 | 3300005617 | Bacteria | 5166 |
| 137 | Ga0068859_100035480 | 3300005617 | Bacteria | 5003 |
| 138 | Ga0068859_101086847 | 3300005617 | Bacteria | 880 |
| 139 | Ga0068864_100021549 | 3300005618 | Bacteria | 5398 |
| 140 | Ga0068866_10098752 | 3300005718 | Bacteria | 1606 |
| 141 | Ga0068866_10125379 | 3300005718 | Bacteria | 1453 |
| 142 | Ga0068861_100086054 | 3300005719 | Bacteria | 2470 |
| 143 | Ga0068861_100126163 | 3300005719 | Bacteria | 2071 |
| 144 | Ga0068851_10002776 | 3300005834 | Bacteria | 7716 |
| 145 | Ga0068851_10022475 | 3300005834 | Bacteria | 3073 |
| 146 | Ga0068851_10077392 | 3300005834 | Bacteria | 1732 |
| 147 | Ga0068870_10001959 | 3300005840 | Bacteria | 8514 |
| 148 | Ga0068863_100000130 | 3300005841 | Bacteria | 79433 |
| 149 | Ga0068863_100001004 | 3300005841 | Bacteria | 28270 |
| 150 | Ga0068858_100002907 | 3300005842 | Bacteria | 17232 |
| 151 | Ga0068858_100039732 | 3300005842 | Bacteria | 4362 |
| 152 | Ga0068858_100547849 | 3300005842 | Bacteria | 1120 |
| 153 | Ga0068860_100021228 | 3300005843 | Bacteria | 6290 |
| 154 | Ga0068860_100042367 | 3300005843 | Bacteria | 4348 |
| 155 | Ga0068862_100096039 | 3300005844 | Bacteria | 2586 |
| 156 | Ga0068862_100562227 | 3300005844 | Bacteria | 1090 |
| 157 | Ga0068862_100666574 | 3300005844 | Bacteria | 1005 |
| 158 | Ga0081455_10012820 | 3300005937 | Bacteria | 8327 |
| 159 | Ga0081455_10018926 | 3300005937 | Bacteria | 6531 |
| 160 | Ga0081538_10006183 | 3300005981 | Bacteria | 10617 |
| 161 | Ga0081538_10087746 | 3300005981 | Bacteria | 1622 |
| 162 | Ga0081540_1006467 | 3300005983 | Bacteria | 8525 |
| 163 | Ga0081540_1031025 | 3300005983 | Bacteria | 2948 |
| 164 | Ga0081540_1126403 | 3300005983 | Bacteria | 1051 |
| 165 | Ga0070717_10015726 | 3300006028 | Bacteria | 5848 |
| 166 | Ga0070717_10103663 | 3300006028 | Bacteria | 2419 |
| 167 | Ga0070717_10174380 | 3300006028 | Bacteria | 1872 |
| 168 | Ga0070717_10752757 | 3300006028 | Bacteria | 886 |
| 169 | Ga0075365_10080553 | 3300006038 | Bacteria | 2205 |
| 170 | Ga0075365_10248907 | 3300006038 | Bacteria | 1249 |
| 171 | Ga0075365_10471635 | 3300006038 | Bacteria | 887 |
| 172 | Ga0075365_10625046 | 3300006038 | Bacteria | 761 |
| 173 | Ga0075365_10890589 | 3300006038 | Bacteria | 627 |
| 174 | Ga0075368_10000432 | 3300006042 | Bacteria | 12392 |
| 175 | Ga0075368_10094419 | 3300006042 | Bacteria | 1225 |
| 176 | Ga0075363_100041327 | 3300006048 | Bacteria | 2432 |
| 177 | Ga0075363_100206408 | 3300006048 | Bacteria | 1124 |
| 178 | Ga0075364_10076564 | 3300006051 | Bacteria | 2208 |
| 179 | Ga0075364_10146185 | 3300006051 | Bacteria | 1592 |
| 180 | Ga0070715_10001746 | 3300006163 | Bacteria | 6467 |
| 181 | Ga0070716_100003116 | 3300006173 | Bacteria | 7747 |
| 182 | Ga0070712_100388040 | 3300006175 | Bacteria | 1151 |
| 183 | Ga0075362_10004001 | 3300006177 | Bacteria | 5243 |
| 184 | Ga0075362_10058451 | 3300006177 | Bacteria | 1739 |
| 185 | Ga0075367_10008152 | 3300006178 | Bacteria | 5412 |
| 186 | Ga0075366_10047067 | 3300006195 | Bacteria | 2556 |
| 187 | Ga0075370_10014545 | 3300006353 | Bacteria | 4201 |
| 188 | Ga0075370_10088087 | 3300006353 | Bacteria | 1789 |
| 189 | Ga0068871_100089003 | 3300006358 | Bacteria | 2569 |
| 190 | Ga0075428_100164358 | 3300006844 | Bacteria | 2408 |
| 191 | Ga0075430_100541980 | 3300006846 | Bacteria | 960 |
| 192 | Ga0075431_100004484 | 3300006847 | Bacteria | 13700 |
| 193 | Ga0075433_10373469 | 3300006852 | Bacteria | 1259 |
| 194 | Ga0075433_10425777 | 3300006852 | Bacteria | 1170 |
| 195 | Ga0075434_100057055 | 3300006871 | Bacteria | 3881 |
| 196 | Ga0075434_100082600 | 3300006871 | Bacteria | 3210 |
| 197 | Ga0075434_100127891 | 3300006871 | Bacteria | 2558 |
| 198 | Ga0075429_100212269 | 3300006880 | Bacteria | 1696 |
| 199 | Ga0068865_100816311 | 3300006881 | Bacteria | 806 |
| 200 | Ga0075436_100149175 | 3300006914 | Bacteria | 1645 |
| 201 | Ga0075436_100213385 | 3300006914 | Bacteria | 1369 |
| 202 | Ga0097620_100033400 | 3300006931 | Bacteria | 5166 |
| 203 | Ga0097620_100035479 | 3300006931 | Bacteria | 5003 |
| 204 | Ga0097620_101086905 | 3300006931 | Bacteria | 880 |
| 205 | Ga0099823_1137254 | 3300006944 | Bacteria | 568 |
| 206 | Ga0075435_100735609 | 3300007076 | Bacteria | 858 |
| 207 | Ga0075435_101004216 | 3300007076 | Bacteria | 729 |
| 208 | Ga0099794_10265146 | 3300007265 | Bacteria | 887 |
| 209 | Ga0105251_10128139 | 3300009011 | Bacteria | 1151 |
| 210 | Ga0105250_10065091 | 3300009092 | Bacteria | 1469 |
| 211 | Ga0105250_10072108 | 3300009092 | Bacteria | 1396 |
| 212 | Ga0105240_10134042 | 3300009093 | Bacteria | 2967 |
| 213 | Ga0105240_10139458 | 3300009093 | Bacteria | 2900 |
| 214 | Ga0111539_10045279 | 3300009094 | Bacteria | 5267 |
| 215 | Ga0111539_10068395 | 3300009094 | Bacteria | 4193 |
| 216 | Ga0111539_10428944 | 3300009094 | Bacteria | 1539 |
| 217 | Ga0105245_10775797 | 3300009098 | Bacteria | 996 |
| 218 | Ga0105245_11029036 | 3300009098 | Bacteria | 869 |
| 219 | Ga0105247_10008832 | 3300009101 | Bacteria | 6143 |
| 220 | Ga0105247_10019109 | 3300009101 | Bacteria | 4115 |
| 221 | Ga0105247_10631438 | 3300009101 | Bacteria | 798 |
| 222 | Ga0114129_10006400 | 3300009147 | Bacteria | 16696 |
| 223 | Ga0114129_10020510 | 3300009147 | Bacteria | 9400 |
| 224 | Ga0114129_10252747 | 3300009147 | Bacteria | 2365 |
| 225 | Ga0105243_10301107 | 3300009148 | Bacteria | 1453 |
| 226 | Ga0105243_10625964 | 3300009148 | Bacteria | 1039 |
| 227 | Ga0105243_11503365 | 3300009148 | Bacteria | 697 |
| 228 | Ga0105241_10017640 | 3300009174 | Bacteria | 5249 |
| 229 | Ga0105241_10535360 | 3300009174 | Bacteria | 1049 |
| 230 | Ga0105242_10188649 | 3300009176 | Bacteria | 1824 |
| 231 | Ga0105242_10298627 | 3300009176 | Bacteria | 1469 |
| 232 | Ga0105248_10007785 | 3300009177 | Bacteria | 11756 |
| 233 | Ga0105237_10025821 | 3300009545 | Bacteria | 6006 |
| 234 | Ga0105237_10029660 | 3300009545 | Bacteria | 5558 |
| 235 | Ga0105238_10097867 | 3300009551 | Bacteria | 2919 |
| 236 | Ga0105238_10220857 | 3300009551 | Bacteria | 1871 |
| 237 | Ga0105238_10605894 | 3300009551 | Bacteria | 1103 |
| 238 | Ga0105249_10156420 | 3300009553 | Bacteria | 2199 |
| 239 | Ga0105249_10169198 | 3300009553 | Bacteria | 2118 |
| 240 | Ga0105249_10406957 | 3300009553 | Bacteria | 1392 |
| 241 | Ga0105148_100189 | 3300009978 | Bacteria | 9023 |
| 242 | Ga0105148_109326 | 3300009978 | Bacteria | 740 |
| 243 | Ga0105029_115183 | 3300009984 | Bacteria | 616 |
| 244 | Ga0105239_10023131 | 3300010375 | Bacteria | 6848 |
| 245 | Ga0105239_10049433 | 3300010375 | Bacteria | 4611 |
| 246 | Ga0105239_10211691 | 3300010375 | Bacteria | 2173 |
| 247 | Ga0105239_10379929 | 3300010375 | Bacteria | 1597 |
| 248 | Ga0105239_10684780 | 3300010375 | Bacteria | 1172 |
| 249 | Ga0105239_10905337 | 3300010375 | Bacteria | 1013 |
| 250 | Ga0105239_11921223 | 3300010375 | Bacteria | 687 |
| 251 | Ga0105246_10032111 | 3300011119 | Bacteria | 3480 |
| 252 | Ga0157329_1002162 | 3300012491 | Bacteria | 1093 |
| 253 | Ga0157326_1016607 | 3300012513 | Bacteria | 873 |
| 254 | Ga0157373_10007215 | 3300013100 | Bacteria | 8288 |
| 255 | Ga0157370_10034345 | 3300013104 | Bacteria | 4940 |
| 256 | Ga0157369_10017317 | 3300013105 | Bacteria | 8100 |
| 257 | Ga0157369_10609394 | 3300013105 | Bacteria | 1127 |
| 258 | Ga0157369_11288208 | 3300013105 | Bacteria | 745 |
| 259 | Ga0157369_11507961 | 3300013105 | Bacteria | 684 |
| 260 | Ga0157374_10070540 | 3300013296 | Bacteria | 3293 |
| 261 | Ga0157378_10077023 | 3300013297 | Bacteria | 3006 |
| 262 | Ga0157378_11332991 | 3300013297 | Bacteria | 759 |
| 263 | Ga0163162_10053399 | 3300013306 | Bacteria | 4061 |
| 264 | Ga0163162_10515365 | 3300013306 | Bacteria | 1326 |
| 265 | Ga0163162_10840959 | 3300013306 | Bacteria | 1033 |
| 266 | Ga0157372_10385746 | 3300013307 | Bacteria | 1632 |
| 267 | Ga0157375_10935391 | 3300013308 | Bacteria | 1009 |
| 268 | Ga0163163_10029540 | 3300014325 | Bacteria | 5275 |
| 269 | Ga0163163_10065220 | 3300014325 | Bacteria | 3614 |
| 270 | Ga0157380_10278459 | 3300014326 | Bacteria | 1529 |
| 271 | Ga0157380_11051269 | 3300014326 | Bacteria | 851 |
| 272 | Ga0182008_10275455 | 3300014497 | Bacteria | 874 |
| 273 | Ga0157377_10075482 | 3300014745 | Bacteria | 1958 |
| 274 | Ga0157379_10137482 | 3300014968 | Bacteria | 2202 |
| 275 | Ga0157379_11281546 | 3300014968 | Bacteria | 707 |
| 276 | Ga0157379_11295323 | 3300014968 | Bacteria | 703 |
| 277 | Ga0163161_10099861 | 3300017792 | Bacteria | 2159 |
| 278 | Ga0206353_11317483 | 3300020082 | Bacteria | 643 |
| 279 | Ga0213872_10318372 | 3300021361 | Bacteria | 643 |
| 280 | Ga0213876_10273087 | 3300021384 | Bacteria | 898 |
| 281 | Ga0213871_10192442 | 3300021441 | Bacteria | 634 |
| 282 | Ga0209233_1000104 | 3300025261 | Bacteria | 272675 |
| 283 | Ga0209233_1049297 | 3300025261 | Bacteria | 865 |
| 284 | Ga0209050_1000010 | 3300025298 | Bacteria | 980454 |
| 285 | Ga0209257_1000009 | 3300025304 | Bacteria | 1205047 |
| 286 | Ga0209257_1047629 | 3300025304 | Bacteria | 1231 |
| 287 | Ga0207697_10369020 | 3300025315 | Bacteria | 637 |
| 288 | Ga0207656_10003231 | 3300025321 | Bacteria | 5575 |
| 289 | Ga0207656_10009468 | 3300025321 | Bacteria | 3620 |
| 290 | Ga0207656_10094294 | 3300025321 | Bacteria | 1363 |
| 291 | Ga0207655_1129677 | 3300025728 | Bacteria | 823 |
| 292 | Ga0207713_1092144 | 3300025735 | Bacteria | 1062 |
| 293 | Ga0207692_10345294 | 3300025898 | Bacteria | 916 |
| 294 | Ga0207642_10114881 | 3300025899 | Bacteria | 1378 |
| 295 | Ga0207710_10004436 | 3300025900 | Bacteria | 6128 |
| 296 | Ga0207688_10000309 | 3300025901 | Bacteria | 22442 |
| 297 | Ga0207680_10269243 | 3300025903 | Bacteria | 1181 |
| 298 | Ga0207647_10003672 | 3300025904 | Bacteria | 11482 |
| 299 | Ga0207647_10007308 | 3300025904 | Bacteria | 7993 |
| 300 | Ga0207647_10223516 | 3300025904 | Bacteria | 1084 |
| 301 | Ga0207645_10025338 | 3300025907 | Bacteria | 3838 |
| 302 | Ga0207643_10000977 | 3300025908 | Bacteria | 17154 |
| 303 | Ga0207705_10393622 | 3300025909 | Bacteria | 1071 |
| 304 | Ga0207654_10101092 | 3300025911 | Bacteria | 1777 |
| 305 | Ga0207654_10111908 | 3300025911 | Bacteria | 1700 |
| 306 | Ga0207695_10233082 | 3300025913 | Bacteria | 1745 |
| 307 | Ga0207671_10203563 | 3300025914 | Bacteria | 1546 |
| 308 | Ga0207693_10003085 | 3300025915 | Bacteria | 14364 |
| 309 | Ga0207693_10005179 | 3300025915 | Bacteria | 10915 |
| 310 | Ga0207693_10030227 | 3300025915 | Bacteria | 4277 |
| 311 | Ga0207693_10138714 | 3300025915 | Bacteria | 1912 |
| 312 | Ga0207663_10015712 | 3300025916 | Bacteria | 4184 |
| 313 | Ga0207663_10074846 | 3300025916 | Bacteria | 2196 |
| 314 | Ga0207660_10360889 | 3300025917 | Bacteria | 1166 |
| 315 | Ga0207660_10777082 | 3300025917 | Bacteria | 781 |
| 316 | Ga0207662_10002752 | 3300025918 | Bacteria | 8879 |
| 317 | Ga0207657_10005125 | 3300025919 | Bacteria | 13731 |
| 318 | Ga0207657_10023905 | 3300025919 | Bacteria | 5675 |
| 319 | Ga0207657_10032339 | 3300025919 | Bacteria | 4728 |
| 320 | Ga0207649_10031037 | 3300025920 | Bacteria | 3172 |
| 321 | Ga0207649_10391254 | 3300025920 | Bacteria | 1038 |
| 322 | Ga0207646_10199890 | 3300025922 | Bacteria | 1805 |
| 323 | Ga0207681_10034578 | 3300025923 | Bacteria | 3324 |
| 324 | Ga0207681_10045824 | 3300025923 | Bacteria | 2939 |
| 325 | Ga0207681_10391546 | 3300025923 | Bacteria | 1121 |
| 326 | Ga0207681_10454590 | 3300025923 | Bacteria | 1042 |
| 327 | Ga0207694_10091602 | 3300025924 | Bacteria | 2399 |
| 328 | Ga0207694_10419035 | 3300025924 | Bacteria | 1115 |
| 329 | Ga0207650_10043385 | 3300025925 | Bacteria | 3301 |
| 330 | Ga0207650_10066890 | 3300025925 | Bacteria | 2695 |
| 331 | Ga0207650_10359840 | 3300025925 | Bacteria | 1199 |
| 332 | Ga0207650_10524974 | 3300025925 | Bacteria | 991 |
| 333 | Ga0207659_10134242 | 3300025926 | Bacteria | 1914 |
| 334 | Ga0207687_10015506 | 3300025927 | Bacteria | 4998 |
| 335 | Ga0207700_10024217 | 3300025928 | Bacteria | 4197 |
| 336 | Ga0207700_10040473 | 3300025928 | Bacteria | 3403 |
| 337 | Ga0207700_10345608 | 3300025928 | Bacteria | 1294 |
| 338 | Ga0207700_11532370 | 3300025928 | Bacteria | 591 |
| 339 | Ga0207664_10017451 | 3300025929 | Bacteria | 5263 |
| 340 | Ga0207644_10009744 | 3300025931 | Bacteria | 6317 |
| 341 | Ga0207644_10265595 | 3300025931 | Bacteria | 1373 |
| 342 | Ga0207644_10528042 | 3300025931 | Bacteria | 975 |
| 343 | Ga0207690_10085841 | 3300025932 | Bacteria | 2210 |
| 344 | Ga0207690_10708846 | 3300025932 | Bacteria | 828 |
| 345 | Ga0207706_10001119 | 3300025933 | Bacteria | 27270 |
| 346 | Ga0207706_10200113 | 3300025933 | Bacteria | 1752 |
| 347 | Ga0207706_10336963 | 3300025933 | Bacteria | 1312 |
| 348 | Ga0207706_10354075 | 3300025933 | Bacteria | 1276 |
| 349 | Ga0207686_10116969 | 3300025934 | Bacteria | 1808 |
| 350 | Ga0207686_10276502 | 3300025934 | Bacteria | 1238 |
| 351 | Ga0207709_10265067 | 3300025935 | Bacteria | 1262 |
| 352 | Ga0207669_10000474 | 3300025937 | Bacteria | 17534 |
| 353 | Ga0207669_10003188 | 3300025937 | Bacteria | 7082 |
| 354 | Ga0207704_10429667 | 3300025938 | Bacteria | 1049 |
| 355 | Ga0207665_10004939 | 3300025939 | Bacteria | 8896 |
| 356 | Ga0207691_10000977 | 3300025940 | Bacteria | 28402 |
| 357 | Ga0207711_10072460 | 3300025941 | Bacteria | 2993 |
| 358 | Ga0207711_10278403 | 3300025941 | Bacteria | 1540 |
| 359 | Ga0207689_10034184 | 3300025942 | Bacteria | 4222 |
| 360 | Ga0207689_11188676 | 3300025942 | Bacteria | 642 |
| 361 | Ga0207679_10061522 | 3300025945 | Bacteria | 2795 |
| 362 | Ga0207679_11130228 | 3300025945 | Bacteria | 719 |
| 363 | Ga0207667_10082355 | 3300025949 | Bacteria | 3333 |
| 364 | Ga0207667_10193949 | 3300025949 | Bacteria | 2084 |
| 365 | Ga0207667_10393007 | 3300025949 | Bacteria | 1412 |
| 366 | Ga0207651_10041578 | 3300025960 | Bacteria | 3052 |
| 367 | Ga0207712_10060821 | 3300025961 | Bacteria | 2679 |
| 368 | Ga0207712_10467543 | 3300025961 | Bacteria | 1072 |
| 369 | Ga0207712_10587557 | 3300025961 | Bacteria | 962 |
| 370 | Ga0207668_10000020 | 3300025972 | Bacteria | 140737 |
| 371 | Ga0207668_10006027 | 3300025972 | Bacteria | 7146 |
| 372 | Ga0207668_10070587 | 3300025972 | Bacteria | 2491 |
| 373 | Ga0207668_10114456 | 3300025972 | Bacteria | 2030 |
| 374 | Ga0207668_10431009 | 3300025972 | Bacteria | 1121 |
| 375 | Ga0207640_10289725 | 3300025981 | Bacteria | 1290 |
| 376 | Ga0207640_10372769 | 3300025981 | Bacteria | 1154 |
| 377 | Ga0207640_11259317 | 3300025981 | Bacteria | 659 |
| 378 | Ga0207658_10000068 | 3300025986 | Bacteria | 113745 |
| 379 | Ga0207658_10005041 | 3300025986 | Bacteria | 9093 |
| 380 | Ga0207677_10004567 | 3300026023 | Bacteria | 7447 |
| 381 | Ga0207703_10000749 | 3300026035 | Bacteria | 32046 |
| 382 | Ga0207703_10005346 | 3300026035 | Bacteria | 10340 |
| 383 | Ga0207703_10456074 | 3300026035 | Bacteria | 1195 |
| 384 | Ga0207639_10001534 | 3300026041 | Bacteria | 15510 |
| 385 | Ga0207639_10002085 | 3300026041 | Bacteria | 13453 |
| 386 | Ga0207639_10021737 | 3300026041 | Bacteria | 4611 |
| 387 | Ga0207639_10302192 | 3300026041 | Bacteria | 1415 |
| 388 | Ga0207639_11222292 | 3300026041 | Bacteria | 705 |
| 389 | Ga0207678_10007310 | 3300026067 | Bacteria | 9786 |
| 390 | Ga0207678_10014829 | 3300026067 | Bacteria | 6856 |
| 391 | Ga0207678_10032842 | 3300026067 | Bacteria | 4523 |
| 392 | Ga0207708_10002666 | 3300026075 | Bacteria | 13108 |
| 393 | Ga0207702_10033718 | 3300026078 | Bacteria | 4277 |
| 394 | Ga0207702_10085430 | 3300026078 | Bacteria | 2750 |
| 395 | Ga0207702_11453487 | 3300026078 | Bacteria | 679 |
| 396 | Ga0207641_10000074 | 3300026088 | Bacteria | 145908 |
| 397 | Ga0207641_10007573 | 3300026088 | Bacteria | 9031 |
| 398 | Ga0207648_10007429 | 3300026089 | Bacteria | 10781 |
| 399 | Ga0207676_10001141 | 3300026095 | Bacteria | 20032 |
| 400 | Ga0207674_10024815 | 3300026116 | Bacteria | 6400 |
| 401 | Ga0207674_10088570 | 3300026116 | Bacteria | 3088 |
| 402 | Ga0207675_100000366 | 3300026118 | Bacteria | 43270 |
| 403 | Ga0207683_10001415 | 3300026121 | Bacteria | 21693 |
| 404 | Ga0207698_10004010 | 3300026142 | Bacteria | 8935 |
| 405 | Ga0207698_10023774 | 3300026142 | Bacteria | 4288 |
| 406 | Ga0209389_1016020 | 3300027296 | Bacteria | 6806 |
| 407 | Ga0209589_1000022 | 3300027357 | Bacteria | 180757 |
| 408 | Ga0209489_120539 | 3300027361 | Bacteria | 1872 |
| 409 | Ga0209700_100021 | 3300027363 | Bacteria | 230859 |
| 410 | Ga0209813_10000071 | 3300027866 | Bacteria | 37829 |
| 411 | Ga0209974_10035634 | 3300027876 | Bacteria | 1653 |
| 412 | Ga0268266_10076211 | 3300028379 | Bacteria | 2914 |
| 413 | Ga0268266_10105981 | 3300028379 | Bacteria | 2484 |
| 414 | Ga0268266_10197813 | 3300028379 | Bacteria | 1838 |
| 415 | Ga0268266_10757939 | 3300028379 | Bacteria | 937 |
| 416 | Ga0268266_11761137 | 3300028379 | Bacteria | 594 |
| 417 | Ga0268265_10067813 | 3300028380 | Bacteria | 2763 |
| 418 | Ga0268265_10538623 | 3300028380 | Bacteria | 1106 |
| 419 | Ga0268265_10575851 | 3300028380 | Bacteria | 1072 |
| 420 | Ga0268264_10008769 | 3300028381 | Bacteria | 8389 |
| 421 | Ga0268264_10016330 | 3300028381 | Bacteria | 6080 |
| 422 | Ga0268264_11715319 | 3300028381 | Bacteria | 638 |
| 423 | Ga0268264_11854518 | 3300028381 | Bacteria | 613 |
| 424 | Ga0307517_10041988 | 3300028786 | Bacteria | 4921 |
| 425 | Ga0316179_1029619 | 3300030734 | Bacteria | 619 |
| 426 | Ga0265325_10016146 | 3300031241 | Bacteria | 4178 |
| 427 | Ga0265325_10123893 | 3300031241 | Bacteria | 1243 |
| 428 | Ga0265325_10134613 | 3300031241 | Bacteria | 1180 |
| 429 | Ga0265340_10000121 | 3300031247 | Bacteria | 38466 |
| 430 | Ga0265340_10398794 | 3300031247 | Bacteria | 607 |
| 431 | Ga0265339_10000777 | 3300031249 | Bacteria | 24679 |
| 432 | Ga0265339_10056840 | 3300031249 | Bacteria | 2117 |
| 433 | Ga0265316_10008812 | 3300031344 | Bacteria | 9322 |
| 434 | Ga0265316_10324546 | 3300031344 | Bacteria | 1118 |
| 435 | Ga0265316_10771321 | 3300031344 | Bacteria | 675 |
| 436 | Ga0307513_10179159 | 3300031456 | Bacteria | 1985 |
| 437 | Ga0307513_10753582 | 3300031456 | Bacteria | 679 |
| 438 | Ga0307513_11026165 | 3300031456 | Bacteria | 535 |
| 439 | Ga0307509_10158201 | 3300031507 | Bacteria | 2168 |
| 440 | Ga0307408_100059593 | 3300031548 | Bacteria | 2778 |
| 441 | Ga0307408_100102136 | 3300031548 | Bacteria | 2186 |
| 442 | Ga0307408_100207781 | 3300031548 | Bacteria | 1589 |
| 443 | Ga0307408_100754174 | 3300031548 | Bacteria | 879 |
| 444 | Ga0307408_101563225 | 3300031548 | Bacteria | 625 |
| 445 | Ga0265313_10003092 | 3300031595 | Bacteria | 13805 |
| 446 | Ga0307508_10000231 | 3300031616 | Bacteria | 67806 |
| 447 | Ga0265314_10192760 | 3300031711 | Bacteria | 1211 |
| 448 | Ga0265314_10577547 | 3300031711 | Bacteria | 582 |
| 449 | Ga0265342_10011115 | 3300031712 | Bacteria | 6179 |
| 450 | Ga0265342_10153568 | 3300031712 | Bacteria | 1277 |
| 451 | Ga0265342_10341933 | 3300031712 | Bacteria | 781 |
| 452 | Ga0316576_10075593 | 3300031727 | Bacteria | 2492 |
| 453 | Ga0316576_10381507 | 3300031727 | Bacteria | 1046 |
| 454 | Ga0307516_10072447 | 3300031730 | Bacteria | 3305 |
| 455 | Ga0307405_10000513 | 3300031731 | Bacteria | 14592 |
| 456 | Ga0307405_10064635 | 3300031731 | Bacteria | 2326 |
| 457 | Ga0307405_10132893 | 3300031731 | Bacteria | 1722 |
| 458 | Ga0307405_10294204 | 3300031731 | Bacteria | 1228 |
| 459 | Ga0307405_10692929 | 3300031731 | Bacteria | 843 |
| 460 | Ga0307405_11218191 | 3300031731 | Bacteria | 652 |
| 461 | Ga0316577_10116717 | 3300031733 | Bacteria | 1499 |
| 462 | Ga0307410_10258304 | 3300031852 | Bacteria | 1357 |
| 463 | Ga0307410_11037888 | 3300031852 | Bacteria | 708 |
| 464 | Ga0307406_10068819 | 3300031901 | Bacteria | 2312 |
| 465 | Ga0307406_10146574 | 3300031901 | Bacteria | 1678 |
| 466 | Ga0307406_10907312 | 3300031901 | Bacteria | 750 |
| 467 | Ga0307412_10001044 | 3300031911 | Bacteria | 15823 |
| 468 | Ga0307412_10017584 | 3300031911 | Bacteria | 4281 |
| 469 | Ga0307412_10046050 | 3300031911 | Bacteria | 2855 |
| 470 | Ga0307412_10069434 | 3300031911 | Bacteria | 2398 |
| 471 | Ga0307412_10152344 | 3300031911 | Bacteria | 1708 |
| 472 | Ga0307412_10513760 | 3300031911 | Bacteria | 999 |
| 473 | Ga0307409_100417314 | 3300031995 | Bacteria | 1286 |
| 474 | Ga0307416_100063784 | 3300032002 | Bacteria | 3019 |
| 475 | Ga0307416_100171021 | 3300032002 | Bacteria | 2022 |
| 476 | Ga0307416_100240573 | 3300032002 | Bacteria | 1753 |
| 477 | Ga0307416_100575118 | 3300032002 | Bacteria | 1203 |
| 478 | Ga0307414_10000144 | 3300032004 | Bacteria | 48442 |
| 479 | Ga0307411_10668480 | 3300032005 | Bacteria | 901 |
| 480 | Ga0307415_100372186 | 3300032126 | Bacteria | 1210 |
| 481 | Ga0307510_10009032 | 3300033180 | Bacteria | 11869 |
| 482 | Ga0316596_1027815 | 3300033541 | Bacteria | 1460 |
| 483 | Ga0373944_0035769 | 3300035089 | Bacteria | 1515 |
| 484 | Ga0373953_0041552 | 3300035117 | Bacteria | 1830 |
| 485 | Ga0373956_0349754 | 3300035119 | Bacteria | 704 |
| 486 | Ga0373955_0316542 | 3300035172 | Bacteria | 942 |
| 487 | Ga0373962_0176425 | 3300035242 | Bacteria | 712 |
| 488 | Ga0316574_0000378 | 3300035398 | Bacteria | 17299 |
| 489 | Ga0316574_0014560 | 3300035398 | Bacteria | 4547 |
| 490 | Ga0316574_0350241 | 3300035398 | Bacteria | 934 |
| 491 | Ga0373931_0027302 | 3300035691 | Bacteria | 2914 |
| 492 | Ga0373931_0060596 | 3300035691 | Bacteria | 2038 |
| 493 | Ga0373927_0451143 | 3300035695 | Bacteria | 849 |
| 494 | Ga0373933_0158858 | 3300035724 | Bacteria | 1435 |
| 495 | Ga0373937_0460722 | 3300036401 | Bacteria | 1207 |
| 496 | Ga0373937_0870066 | 3300036401 | Bacteria | 850 |
| 497 | Ga0316584_0045154 | 3300036712 | Bacteria | 3288 |
| 498 | Ga0316584_0112334 | 3300036712 | Bacteria | 2039 |
| 499 | Ga0373925_0020370 | 3300037068 | Bacteria | 4828 |
| 500 | Ga0373925_0075831 | 3300037068 | Bacteria | 2549 |
| 501 | Ga0373925_1344119 | 3300037068 | Bacteria | 586 |
| 502 | Ga0395899_0009726 | 3300037312 | Bacteria | 7380 |
| 503 | Ga0395899_0207424 | 3300037312 | Bacteria | 1363 |
| 504 | Ga0395900_0018719 | 3300037418 | Bacteria | 7062 |
| 505 | Ga0395900_0044529 | 3300037418 | Bacteria | 4572 |
| 506 | Ga0395900_0105682 | 3300037418 | Bacteria | 2892 |
| 507 | Ga0395900_0211011 | 3300037418 | Bacteria | 1961 |
| 508 | Ga0395900_0462872 | 3300037418 | Bacteria | 1223 |
| 509 | Ga0395900_0545803 | 3300037418 | Bacteria | 1104 |
| 510 | Ga0395900_0752058 | 3300037418 | Bacteria | 905 |
| 511 | Ga0395900_1065253 | 3300037418 | Bacteria | 726 |
| 512 | Ga0395898_0008316 | 3300037466 | Bacteria | 10971 |
| 513 | Ga0395898_0013963 | 3300037466 | Bacteria | 8254 |
| 514 | Ga0395898_0018445 | 3300037466 | Bacteria | 7115 |
| 515 | Ga0395898_0077993 | 3300037466 | Bacteria | 3197 |
| 516 | Ga0395898_0133062 | 3300037466 | Bacteria | 2381 |
| 517 | Ga0395898_0386796 | 3300037466 | Bacteria | 1334 |
| 518 | Ga0395905_0617609 | 3300037471 | Bacteria | 986 |
| 519 | Ga0395901_0005378 | 3300038443 | Bacteria | 12951 |
| 520 | Ga0395901_0048533 | 3300038443 | Bacteria | 4409 |
| 521 | Ga0395901_0055412 | 3300038443 | Bacteria | 4123 |
| 522 | Ga0395901_0131330 | 3300038443 | Bacteria | 2632 |
| 523 | Ga0395901_0320981 | 3300038443 | Bacteria | 1602 |
| 524 | Ga0395901_0590738 | 3300038443 | Bacteria | 1121 |
| 525 | Ga0400489_52572 | 3300039093 | Bacteria | 2105 |
| 526 | Ga0436365_0249655 | 3300039437 | Bacteria | 887 |
| 527 | Ga0436365_1209249 | 3300039437 | Bacteria | 8241 |
| 528 | Ga0436365_1348843 | 3300039437 | Bacteria | 841 |
| 529 | Ga0436360_0152696 | 3300039438 | Bacteria | 942 |
| 530 | Ga0436360_0155171 | 3300039438 | Bacteria | 644 |
| 531 | Ga0436360_0225540 | 3300039438 | Bacteria | 634 |
| 532 | Ga0436360_0289570 | 3300039438 | Bacteria | 973 |
| 533 | Ga0436360_0510880 | 3300039438 | Bacteria | 4739 |
| 534 | Ga0436360_0700499 | 3300039438 | Bacteria | 557 |
| 535 | Ga0436360_0722024 | 3300039438 | Bacteria | 2404 |
| 536 | Ga0436360_0768310 | 3300039438 | Bacteria | 1152 |
| 537 | Ga0436361_0208690 | 3300039447 | Bacteria | 2168 |
| 538 | Ga0436361_0891828 | 3300039447 | Bacteria | 716 |
| 539 | Ga0436361_0974856 | 3300039447 | Bacteria | 778 |
| 540 | Ga0436363_0043667 | 3300039450 | Bacteria | 698 |
| 541 | Ga0436363_0848488 | 3300039450 | Bacteria | 1830 |
| 542 | Ga0436363_1289101 | 3300039450 | Bacteria | 738 |
| 543 | Ga0436362_0337065 | 3300039453 | Bacteria | 1951 |
| 544 | Ga0436362_0724793 | 3300039453 | Bacteria | 1083 |
| 545 | Ga0436362_1145969 | 3300039453 | Bacteria | 1331 |
| 546 | Ga0439466_0220801 | 3300041411 | Bacteria | 575 |
| 547 | Ga0439465_0182860 | 3300041413 | Bacteria | 759 |
| 548 | Ga0451797_1497932 | 3300041453 | Bacteria | 722 |
| 549 | Ga0451853_2582518 | 3300041512 | Bacteria | 895 |
| 550 | Ga0439460_0247836 | 3300042461 | Bacteria | 615 |
| 551 | Ga0451577_0350291 | 3300042876 | Bacteria | 1340 |
| 552 | Ga0466966_0158171 | 3300044684 | Bacteria | 1380 |
| 553 | Ga0466963_0317275 | 3300044694 | Bacteria | 1096 |
| 554 | Ga0466963_0855021 | 3300044694 | Bacteria | 641 |
| 555 | Ga0466964_0268438 | 3300044706 | Bacteria | 848 |
| 556 | Ga0466957_0078717 | 3300044842 | Bacteria | 2050 |
| 557 | Ga0466957_0235959 | 3300044842 | Bacteria | 1212 |
| 558 | Ga0466957_0809692 | 3300044842 | Bacteria | 666 |
| 559 | Ga0451576_1782262 | 3300045051 | Bacteria | 637 |
| 560 | Ga0466958_0026210 | 3300045836 | Bacteria | 3444 |
| 561 | Ga0466958_0295754 | 3300045836 | Bacteria | 1039 |
| 562 | Ga0466958_0718263 | 3300045836 | Bacteria | 651 |
| 563 | Ga0495627_058172 | 3300046453 | Bacteria | 1149 |
| 564 | Ga0495592_0561332 | 3300046454 | Bacteria | 701 |
| 565 | Ga0495603_0099964 | 3300046455 | Bacteria | 1694 |
| 566 | Ga0495590_0136758 | 3300046457 | Bacteria | 883 |
| 567 | Ga0495629_0068181 | 3300046459 | Bacteria | 2482 |
| 568 | Ga0495638_0000018 | 3300046460 | Bacteria | 389696 |
| 569 | Ga0495638_0013078 | 3300046460 | Bacteria | 5666 |
| 570 | Ga0495641_0076951 | 3300046461 | Bacteria | 1496 |
| 571 | Ga0495651_0104502 | 3300046462 | Bacteria | 2103 |
| 572 | Ga0495653_0720274 | 3300046463 | Bacteria | 605 |
| 573 | Ga0495650_0004591 | 3300046471 | Bacteria | 9387 |
| 574 | Ga0495662_0264893 | 3300046476 | Bacteria | 846 |
| 575 | Ga0495584_0133858 | 3300046491 | Bacteria | 1258 |
| 576 | Ga0495585_0053054 | 3300046492 | Bacteria | 2244 |
| 577 | Ga0495607_0475942 | 3300046501 | Bacteria | 557 |
| 578 | Ga0495616_0124137 | 3300046513 | Bacteria | 1189 |
| 579 | Ga0495620_0090829 | 3300046515 | Bacteria | 1225 |
| 580 | Ga0495632_0000049 | 3300046519 | Bacteria | 134597 |
| 581 | Ga0495632_0008303 | 3300046519 | Bacteria | 6395 |
| 582 | Ga0495637_0003069 | 3300046520 | Bacteria | 8917 |
| 583 | Ga0495643_0000061 | 3300046522 | Bacteria | 185933 |
| 584 | Ga0495643_0011319 | 3300046522 | Bacteria | 5437 |
| 585 | Ga0495644_0192941 | 3300046523 | Bacteria | 784 |
| 586 | Ga0495648_0001815 | 3300046524 | Bacteria | 20563 |
| 587 | Ga0495663_0000009 | 3300046525 | Bacteria | 256308 |
| 588 | Ga0495652_0389848 | 3300046529 | Bacteria | 989 |
| 589 | Ga0495640_0119778 | 3300046533 | Bacteria | 1712 |
| 590 | Ga0495587_0233734 | 3300046536 | Bacteria | 1036 |
| 591 | Ga0495598_0023066 | 3300046537 | Bacteria | 1672 |
| 592 | Ga0495609_0129536 | 3300046538 | Bacteria | 1081 |
| 593 | Ga0495633_0000264 | 3300046558 | Bacteria | 62296 |
| 594 | Ga0495633_0000862 | 3300046558 | Bacteria | 26407 |
| 595 | Ga0495633_0011582 | 3300046558 | Bacteria | 4746 |
| 596 | Ga0495633_0042454 | 3300046558 | Bacteria | 2159 |
| 597 | Ga0495667_0129988 | 3300046559 | Bacteria | 1625 |
| 598 | Ga0495668_0300888 | 3300046616 | Bacteria | 879 |
| 599 | Ga0495634_0483307 | 3300046642 | Bacteria | 727 |
| 600 | Ga0495625_0000583 | 3300046660 | Bacteria | 53056 |
| 601 | Ga0495625_0011321 | 3300046660 | Bacteria | 7283 |
| 602 | Ga0495625_0327018 | 3300046660 | Bacteria | 975 |
| 603 | Ga0495635_0627422 | 3300046663 | Bacteria | 700 |
| 604 | Ga0495661_0178253 | 3300046665 | Bacteria | 1128 |
| 605 | Ga0495657_0085909 | 3300046675 | Bacteria | 2028 |
| 606 | Ga0495670_0002209 | 3300046691 | Bacteria | 9614 |
| 607 | Ga0495671_0000011 | 3300046692 | Bacteria | 365582 |
| 608 | Ga0495671_0000036 | 3300046692 | Bacteria | 181192 |
| 609 | Ga0495649_0156476 | 3300046694 | Bacteria | 1196 |
| 610 | Ga0495589_0233741 | 3300046794 | Bacteria | 861 |
| 611 | Ga0495600_0028150 | 3300046809 | Bacteria | 3635 |
| 612 | Ga0495660_0136192 | 3300046810 | Bacteria | 1227 |
| 613 | Ga0495604_0479136 | 3300047317 | Bacteria | 810 |
| 614 | Ga0495676_0103330 | 3300047321 | Bacteria | 2104 |
| 615 | Ga0495676_0365182 | 3300047321 | Bacteria | 963 |
| 616 | Ga0495680_0760628 | 3300047322 | Bacteria | 636 |
| 617 | Ga0495687_000224 | 3300047443 | Bacteria | 79719 |
| 618 | Ga0495673_0000088 | 3300047469 | Bacteria | 189812 |
| 619 | Ga0495681_0014061 | 3300047470 | Bacteria | 4612 |
| 620 | Ga0495684_0086184 | 3300047471 | Bacteria | 2381 |
| 621 | Ga0495686_0008764 | 3300047472 | Bacteria | 7373 |
| 622 | Ga0495686_0070254 | 3300047472 | Bacteria | 2158 |
| 623 | Ga0495602_0109610 | 3300048088 | Bacteria | 2245 |
| 624 | Ga0495602_0244915 | 3300048088 | Bacteria | 1339 |
| 625 | Ga0495626_0338852 | 3300048091 | Bacteria | 588 |
| 626 | Ga0496100_0035676 | 3300048903 | Bacteria | 3130 |
| 627 | Ga0496100_0180625 | 3300048903 | Bacteria | 1526 |
| 628 | Ga0496100_0223598 | 3300048903 | Bacteria | 1382 |
| 629 | Ga0496100_0606847 | 3300048903 | Bacteria | 850 |
| 630 | Ga0496101_0009057 | 3300048904 | Bacteria | 6528 |
| 631 | Ga0496101_0025933 | 3300048904 | Bacteria | 4071 |
| 632 | Ga0496101_0038167 | 3300048904 | Bacteria | 3410 |
| 633 | Ga0496101_0099473 | 3300048904 | Bacteria | 2174 |
| 634 | Ga0496101_1216513 | 3300048904 | Bacteria | 590 |
| 635 | Ga0496102_0002315 | 3300048905 | Bacteria | 16265 |
| 636 | Ga0496102_0018363 | 3300048905 | Bacteria | 6144 |
| 637 | Ga0496102_0068148 | 3300048905 | Bacteria | 3265 |
| 638 | Ga0496102_0088926 | 3300048905 | Bacteria | 2856 |
| 639 | Ga0496102_0097500 | 3300048905 | Bacteria | 2727 |
| 640 | Ga0496102_0301447 | 3300048905 | Bacteria | 1510 |
| 641 | Ga0496102_0996383 | 3300048905 | Bacteria | 758 |
| 642 | Ga0496103_0005448 | 3300048906 | Bacteria | 7611 |
| 643 | Ga0496103_0420569 | 3300048906 | Bacteria | 858 |
| 644 | Ga0496103_0548184 | 3300048906 | Bacteria | 738 |
| 645 | Ga0496104_0013577 | 3300048907 | Bacteria | 7341 |
| 646 | Ga0496104_0017311 | 3300048907 | Bacteria | 6560 |
| 647 | Ga0496104_0018021 | 3300048907 | Bacteria | 6438 |
| 648 | Ga0496104_0177350 | 3300048907 | Bacteria | 2041 |
| 649 | Ga0496104_0626938 | 3300048907 | Bacteria | 985 |
| 650 | Ga0496105_0010623 | 3300048908 | Bacteria | 7243 |
| 651 | Ga0496105_0057105 | 3300048908 | Bacteria | 3223 |
| 652 | Ga0496105_0068273 | 3300048908 | Bacteria | 2936 |
| 653 | Ga0496105_0979838 | 3300048908 | Bacteria | 633 |
| 654 | Ga0496106_0003091 | 3300048909 | Bacteria | 12419 |
| 655 | Ga0496106_0007079 | 3300048909 | Bacteria | 8288 |
| 656 | Ga0496106_0021813 | 3300048909 | Bacteria | 4757 |
| 657 | Ga0496106_0040065 | 3300048909 | Bacteria | 3507 |
| 658 | Ga0496107_0004660 | 3300048910 | Bacteria | 9306 |
| 659 | Ga0496107_0011907 | 3300048910 | Bacteria | 6075 |
| 660 | Ga0496107_0046850 | 3300048910 | Bacteria | 3112 |
| 661 | Ga0496107_0103468 | 3300048910 | Bacteria | 2089 |
| 662 | Ga0496108_0013809 | 3300048911 | Bacteria | 6588 |
| 663 | Ga0496108_0025155 | 3300048911 | Bacteria | 4904 |
| 664 | Ga0496108_0034366 | 3300048911 | Bacteria | 4212 |
| 665 | Ga0496108_0037603 | 3300048911 | Bacteria | 4033 |
| 666 | Ga0496108_0119130 | 3300048911 | Bacteria | 2263 |
| 667 | Ga0496108_0132772 | 3300048911 | Bacteria | 2140 |
| 668 | Ga0496108_0156716 | 3300048911 | Bacteria | 1967 |
| 669 | Ga0496108_0179741 | 3300048911 | Bacteria | 1832 |
| 670 | Ga0496108_0181726 | 3300048911 | Bacteria | 1821 |
| 671 | Ga0496108_1683940 | 3300048911 | Bacteria | 522 |
| 672 | Ga0496109_0005494 | 3300048912 | Bacteria | 10610 |
| 673 | Ga0496109_0014810 | 3300048912 | Bacteria | 6786 |
| 674 | Ga0496109_0016058 | 3300048912 | Bacteria | 6543 |
| 675 | Ga0496109_0019497 | 3300048912 | Bacteria | 5985 |
| 676 | Ga0496109_0056139 | 3300048912 | Bacteria | 3593 |
| 677 | Ga0496109_0214301 | 3300048912 | Bacteria | 1811 |
| 678 | Ga0496109_0944506 | 3300048912 | Bacteria | 800 |
| 679 | Ga0496110_0028061 | 3300048913 | Bacteria | 4830 |
| 680 | Ga0496110_0030497 | 3300048913 | Bacteria | 4649 |
| 681 | Ga0496110_0043503 | 3300048913 | Bacteria | 3921 |
| 682 | Ga0496110_0045137 | 3300048913 | Bacteria | 3850 |
| 683 | Ga0496110_0057057 | 3300048913 | Bacteria | 3437 |
| 684 | Ga0496110_0084076 | 3300048913 | Bacteria | 2840 |
| 685 | Ga0496110_0326120 | 3300048913 | Bacteria | 1398 |
| 686 | Ga0496110_0503692 | 3300048913 | Bacteria | 1102 |
| 687 | Ga0496111_0000494 | 3300048914 | Bacteria | 20303 |
| 688 | Ga0496111_0078615 | 3300048914 | Bacteria | 2405 |
| 689 | Ga0496111_0346461 | 3300048914 | Bacteria | 1100 |
| 690 | Ga0496111_0358962 | 3300048914 | Bacteria | 1078 |
| 691 | Ga0496112_0004889 | 3300048915 | Bacteria | 11460 |
| 692 | Ga0496112_0005811 | 3300048915 | Bacteria | 10736 |
| 693 | Ga0496112_0018775 | 3300048915 | Bacteria | 6516 |
| 694 | Ga0496112_0042754 | 3300048915 | Bacteria | 4434 |
| 695 | Ga0496112_0047785 | 3300048915 | Bacteria | 4198 |
| 696 | Ga0496112_0499660 | 3300048915 | Bacteria | 1152 |
| 697 | Ga0496113_0000564 | 3300048916 | Bacteria | 18422 |
| 698 | Ga0496113_0004958 | 3300048916 | Bacteria | 8246 |
| 699 | Ga0496113_0014413 | 3300048916 | Bacteria | 5391 |
| 700 | Ga0496113_0029541 | 3300048916 | Bacteria | 3960 |
| 701 | Ga0496114_0062341 | 3300048917 | Bacteria | 3120 |
| 702 | Ga0496114_0100809 | 3300048917 | Bacteria | 2464 |
| 703 | Ga0496114_0373693 | 3300048917 | Bacteria | 1262 |
| 704 | Ga0496114_1026726 | 3300048917 | Bacteria | 708 |
| 705 | Ga0496115_0005148 | 3300048918 | Bacteria | 9512 |
| 706 | Ga0496115_0019809 | 3300048918 | Bacteria | 5182 |
| 707 | Ga0496115_0021939 | 3300048918 | Bacteria | 4938 |
| 708 | Ga0496118_0091571 | 3300048921 | Bacteria | 2091 |
| 709 | Ga0496119_0000289 | 3300048922 | Bacteria | 70660 |
| 710 | Ga0496121_0017735 | 3300048924 | Bacteria | 7243 |
| 711 | Ga0496122_0009301 | 3300048925 | Bacteria | 10387 |
| 712 | Ga0496122_0009638 | 3300048925 | Bacteria | 10111 |
| 713 | Ga0496122_0076669 | 3300048925 | Bacteria | 2352 |
| 714 | Ga0496122_0138127 | 3300048925 | Bacteria | 1531 |
| 715 | Ga0496123_0000210 | 3300048926 | Bacteria | 118956 |
| 716 | Ga0496123_0013341 | 3300048926 | Bacteria | 6909 |
| 717 | Ga0496124_0083993 | 3300048927 | Bacteria | 2612 |
| 718 | Ga0496124_0148948 | 3300048927 | Bacteria | 1838 |
| 719 | Ga0496125_0002768 | 3300048928 | Bacteria | 22192 |
| 720 | Ga0496125_0049956 | 3300048928 | Bacteria | 3468 |
| 721 | Ga0496125_0286231 | 3300048928 | Bacteria | 1018 |
| 722 | Ga0496126_0003507 | 3300048929 | Bacteria | 19762 |
| 723 | Ga0496126_0050477 | 3300048929 | Bacteria | 3790 |
| 724 | Ga0501031_0027805 | 3300049568 | Bacteria | 3687 |
| 725 | Ga0501032_0009941 | 3300049569 | Bacteria | 6868 |
| 726 | Ga0501032_0022734 | 3300049569 | Bacteria | 4344 |
| 727 | Ga0501032_0081002 | 3300049569 | Bacteria | 2160 |
| 728 | Ga0501033_0043064 | 3300049570 | Bacteria | 3363 |
| 729 | Ga0501034_0000013 | 3300049571 | Bacteria | 297898 |
| 730 | Ga0501034_0022049 | 3300049571 | Bacteria | 6488 |
| 731 | Ga0501034_0056146 | 3300049571 | Bacteria | 3963 |
| 732 | Ga0501034_0073901 | 3300049571 | Bacteria | 3418 |
| 733 | Ga0501034_0086697 | 3300049571 | Bacteria | 3131 |
| 734 | Ga0501034_0139124 | 3300049571 | Bacteria | 2408 |
| 735 | Ga0501034_0166299 | 3300049571 | Bacteria | 2174 |
| 736 | Ga0501034_0276555 | 3300049571 | Bacteria | 1619 |
| 737 | Ga0501034_0358334 | 3300049571 | Bacteria | 1386 |
| 738 | Ga0501034_0439697 | 3300049571 | Bacteria | 1223 |
| 739 | Ga0501034_0500931 | 3300049571 | Bacteria | 1128 |
| 740 | Ga0501036_0199757 | 3300049572 | Bacteria | 1682 |
| 741 | Ga0501036_0620113 | 3300049572 | Bacteria | 896 |
| 742 | Ga0501036_1029732 | 3300049572 | Bacteria | 673 |
| 743 | Ga0501037_0031279 | 3300049573 | Bacteria | 3929 |
| 744 | Ga0501037_0215217 | 3300049573 | Bacteria | 1354 |
| 745 | Ga0501037_0448206 | 3300049573 | Bacteria | 881 |
| 746 | Ga0501038_0027985 | 3300049574 | Bacteria | 5008 |
| 747 | Ga0501038_0067518 | 3300049574 | Bacteria | 3042 |
| 748 | Ga0501038_0303037 | 3300049574 | Bacteria | 1254 |
| 749 | Ga0501039_0016701 | 3300049575 | Bacteria | 5624 |
| 750 | Ga0501039_1052149 | 3300049575 | Bacteria | 631 |
| 751 | Ga0501040_0497323 | 3300049576 | Bacteria | 879 |
| 752 | Ga0501040_0632286 | 3300049576 | Bacteria | 773 |
| 753 | Ga0501041_0074735 | 3300049577 | Bacteria | 2083 |
| 754 | Ga0501042_0880278 | 3300049578 | Bacteria | 652 |
| 755 | Ga0501043_0043209 | 3300049579 | Bacteria | 3542 |
| 756 | Ga0501046_0000592 | 3300049580 | Bacteria | 35637 |
| 757 | Ga0501046_0001115 | 3300049580 | Bacteria | 26209 |
| 758 | Ga0501046_0003713 | 3300049580 | Bacteria | 13974 |
| 759 | Ga0501046_0322593 | 3300049580 | Bacteria | 1125 |
| 760 | Ga0501047_0000290 | 3300049581 | Bacteria | 57649 |
| 761 | Ga0501047_0106810 | 3300049581 | Bacteria | 2680 |
| 762 | Ga0501047_0177055 | 3300049581 | Bacteria | 2000 |
| 763 | Ga0501047_0464977 | 3300049581 | Bacteria | 1093 |
| 764 | Ga0501047_0522900 | 3300049581 | Bacteria | 1012 |
| 765 | Ga0501047_0556999 | 3300049581 | Bacteria | 970 |
| 766 | Ga0501048_0031001 | 3300049582 | Bacteria | 3870 |
| 767 | Ga0501048_0374745 | 3300049582 | Bacteria | 1016 |
| 768 | Ga0501048_0422287 | 3300049582 | Bacteria | 954 |
| 769 | Ga0501048_0572248 | 3300049582 | Bacteria | 811 |
| 770 | Ga0501067_0000905 | 3300049583 | Bacteria | 15942 |
| 771 | Ga0501067_0001682 | 3300049583 | Bacteria | 12159 |
| 772 | Ga0501067_0011601 | 3300049583 | Bacteria | 4881 |
| 773 | Ga0501067_0038503 | 3300049583 | Bacteria | 2655 |
| 774 | Ga0501067_0311226 | 3300049583 | Bacteria | 877 |
| 775 | Ga0501067_0395251 | 3300049583 | Bacteria | 771 |
| 776 | Ga0501068_0193043 | 3300049584 | Bacteria | 1290 |
| 777 | Ga0501068_0217536 | 3300049584 | Bacteria | 1214 |
| 778 | Ga0501068_0572046 | 3300049584 | Bacteria | 735 |
| 779 | Ga0501069_0058754 | 3300049585 | Bacteria | 2145 |
| 780 | Ga0501070_0006581 | 3300049586 | Bacteria | 9891 |
| 781 | Ga0501070_0018455 | 3300049586 | Bacteria | 5852 |
| 782 | Ga0501070_0159733 | 3300049586 | Bacteria | 1858 |
| 783 | Ga0501070_0251047 | 3300049586 | Bacteria | 1447 |
| 784 | Ga0501070_0360258 | 3300049586 | Bacteria | 1180 |
| 785 | Ga0501070_0519848 | 3300049586 | Bacteria | 955 |
| 786 | Ga0501070_0739244 | 3300049586 | Bacteria | 776 |
| 787 | Ga0501071_0088372 | 3300049587 | Bacteria | 2274 |
| 788 | Ga0501072_0101282 | 3300049588 | Bacteria | 2289 |
| 789 | Ga0501072_0175643 | 3300049588 | Bacteria | 1709 |
| 790 | Ga0501072_0195973 | 3300049588 | Bacteria | 1611 |
| 791 | Ga0501073_0030029 | 3300049589 | Bacteria | 3882 |
| 792 | Ga0501073_0038480 | 3300049589 | Bacteria | 3392 |
| 793 | Ga0501073_0041744 | 3300049589 | Bacteria | 3241 |
| 794 | Ga0501073_0111206 | 3300049589 | Bacteria | 1900 |
| 795 | Ga0501073_0397629 | 3300049589 | Bacteria | 952 |
| 796 | Ga0501074_0283913 | 3300049590 | Bacteria | 1177 |
| 797 | Ga0501074_0438352 | 3300049590 | Bacteria | 926 |
| 798 | Ga0501075_0218519 | 3300049591 | Bacteria | 1454 |
| 799 | Ga0501075_0292736 | 3300049591 | Bacteria | 1240 |
| 800 | Ga0501075_0395782 | 3300049591 | Bacteria | 1053 |
| 801 | Ga0501076_0122692 | 3300049592 | Bacteria | 2104 |
| 802 | Ga0501076_0216193 | 3300049592 | Bacteria | 1567 |
| 803 | Ga0501076_0285055 | 3300049592 | Bacteria | 1353 |
| 804 | Ga0501076_0351930 | 3300049592 | Bacteria | 1210 |
| 805 | Ga0501077_0163160 | 3300049593 | Bacteria | 1415 |
| 806 | Ga0501223_001272 | 3300049663 | Bacteria | 5865 |
| 807 | Ga0501225_0001724 | 3300049705 | Bacteria | 6846 |
| 808 | Ga0501079_0289942 | 3300049741 | Bacteria | 1280 |
| 809 | Ga0501079_0474767 | 3300049741 | Bacteria | 983 |
| 810 | Ga0501080_0000003 | 3300049742 | Bacteria | 214890 |
| 811 | Ga0501080_0027908 | 3300049742 | Bacteria | 5249 |
| 812 | Ga0501080_0040117 | 3300049742 | Bacteria | 4368 |
| 813 | Ga0501080_0124785 | 3300049742 | Bacteria | 2385 |
| 814 | Ga0501080_0132656 | 3300049742 | Bacteria | 2306 |
| 815 | Ga0501080_0486532 | 3300049742 | Bacteria | 1104 |
| 816 | Ga0501080_0504464 | 3300049742 | Bacteria | 1081 |
| 817 | Ga0501080_0645869 | 3300049742 | Bacteria | 937 |
| 818 | Ga0501081_0020121 | 3300049743 | Bacteria | 4449 |
| 819 | Ga0501081_0280779 | 3300049743 | Bacteria | 1219 |
| 820 | Ga0501083_0022378 | 3300049744 | Bacteria | 4387 |
| 821 | Ga0501083_0124156 | 3300049744 | Bacteria | 1692 |
| 822 | Ga0501083_0183606 | 3300049744 | Bacteria | 1365 |
| 823 | Ga0501083_0558867 | 3300049744 | Bacteria | 745 |
| 824 | Ga0501035_0000384 | 3300049822 | Bacteria | 50737 |
| 825 | Ga0501035_0084267 | 3300049822 | Bacteria | 2803 |
| 826 | Ga0501035_0918629 | 3300049822 | Bacteria | 692 |
| 827 | Ga0501044_0000570 | 3300049823 | Bacteria | 44794 |
| 828 | Ga0501044_0025210 | 3300049823 | Bacteria | 6305 |
| 829 | Ga0501044_0031555 | 3300049823 | Bacteria | 5576 |
| 830 | Ga0501044_0035407 | 3300049823 | Bacteria | 5228 |
| 831 | Ga0501044_0152904 | 3300049823 | Bacteria | 2289 |
| 832 | Ga0501044_0289359 | 3300049823 | Bacteria | 1570 |
| 833 | Ga0501044_0535068 | 3300049823 | Bacteria | 1070 |
| 834 | Ga0501045_0548708 | 3300049824 | Bacteria | 857 |
| 835 | Ga0501045_0882223 | 3300049824 | Bacteria | 657 |
| 836 | nmdc:mga03683_108270_c1 | 3300050489 | Bacteria | 1226 |
| 837 | nmdc:mga03683_40402_c1 | 3300050489 | Bacteria | 1913 |
| 838 | nmdc:mga03683_73469_c1 | 3300050489 | Bacteria | 1466 |
| 839 | nmdc:mga00v17_41449_c1 | 3300050491 | Bacteria | 2765 |
| 840 | nmdc:mga00v17_805241_c1 | 3300050491 | Bacteria | 598 |
| 841 | nmdc:mga0yw44_21491_c1 | 3300050492 | Bacteria | 3601 |
| 842 | nmdc:mga0yw44_217329_c1 | 3300050492 | Bacteria | 1266 |
| 843 | nmdc:mga0yw44_5612_c1 | 3300050492 | Bacteria | 5963 |
| 844 | nmdc:mga0yw44_95785_c1 | 3300050492 | Bacteria | 1883 |
| 845 | nmdc:mga06z11_115394_c1 | 3300050494 | Bacteria | 1492 |
| 846 | nmdc:mga06z11_25_c1 | 3300050494 | Bacteria | 65281 |
| 847 | nmdc:mga06z11_489065_c1 | 3300050494 | Bacteria | 745 |
| 848 | nmdc:mga05p37_127965_c1 | 3300050507 | Bacteria | 3118 |
| 849 | nmdc:mga05p37_17127_c1 | 3300050507 | Bacteria | 8743 |
| 850 | nmdc:mga05p37_239692_c1 | 3300050507 | Bacteria | 2181 |
| 851 | nmdc:mga05p37_88120_c1 | 3300050507 | Bacteria | 3826 |
| 852 | nmdc:mga09592_297517_c1 | 3300050508 | Bacteria | 1399 |
| 853 | nmdc:mga09592_633844_c1 | 3300050508 | Bacteria | 914 |
| 854 | nmdc:mga0qj67_46923_c1 | 3300050509 | Bacteria | 3411 |
| 855 | nmdc:mga06r32_130904_c1 | 3300050510 | Bacteria | 2481 |
| 856 | nmdc:mga06r32_245502_c1 | 3300050510 | Bacteria | 1778 |
| 857 | nmdc:mga06r32_4388_c1 | 3300050510 | Bacteria | 12616 |
| 858 | nmdc:mga06r32_761788_c1 | 3300050510 | Bacteria | 931 |
| 859 | nmdc:mga08y16_479610_c1 | 3300050511 | Bacteria | 1266 |
| 860 | nmdc:mga0n895_103401_c1 | 3300050512 | Bacteria | 2860 |
| 861 | nmdc:mga0n895_144251_c1 | 3300050512 | Bacteria | 2410 |
| 862 | nmdc:mga0n895_364655_c1 | 3300050512 | Bacteria | 1463 |
| 863 | nmdc:mga0n895_581178_c1 | 3300050512 | Bacteria | 1124 |
| 864 | nmdc:mga0n895_72373_c2 | 3300050512 | Bacteria | 2949 |
| 865 | nmdc:mga0rr50_114657_c1 | 3300050513 | Bacteria | 2137 |
| 866 | nmdc:mga0rr50_1525825_c1 | 3300050513 | Bacteria | 565 |
| 867 | nmdc:mga0rr50_771632_c1 | 3300050513 | Bacteria | 820 |
| 868 | nmdc:mga08x19_236991_c1 | 3300050514 | Bacteria | 1257 |
| 869 | nmdc:mga0a205_171087_c1 | 3300050515 | Bacteria | 2068 |
| 870 | nmdc:mga0a205_21217_c1 | 3300050515 | Bacteria | 6142 |
| 871 | nmdc:mga0a205_265388_c1 | 3300050515 | Bacteria | 1594 |
| 872 | nmdc:mga0a205_53061_c1 | 3300050515 | Bacteria | 3912 |
| 873 | Ga0495601_0044662 | 3300053077 | Bacteria | 2785 |
| 874 | Ga0495601_0685312 | 3300053077 | Bacteria | 654 |
| 875 | Ga0495612_0055835 | 3300053078 | Bacteria | 1629 |
| 876 | Ga0500635_0053863 | 3300053080 | Bacteria | 1385 |
| 877 | Ga0495655_0032310 | 3300053083 | Bacteria | 1279 |
| 878 | Ga0495595_0028737 | 3300053084 | Bacteria | 2485 |
| 879 | Ga0495595_0094409 | 3300053084 | Bacteria | 1438 |
| 880 | Ga0495619_0104291 | 3300053085 | Bacteria | 1932 |
| 881 | Ga0495619_0120672 | 3300053085 | Bacteria | 1797 |
| 882 | Ga0495619_0137487 | 3300053085 | Bacteria | 1681 |
| 883 | Ga0500643_014103 | 3300053087 | Bacteria | 2792 |
| 884 | Ga0500643_042874 | 3300053087 | Bacteria | 1321 |
| 885 | Ga0500643_087793 | 3300053087 | Bacteria | 850 |
| 886 | Ga0500566_0019670 | 3300053094 | Bacteria | 3965 |
| 887 | Ga0500640_256626 | 3300053095 | Bacteria | 556 |
| 888 | Ga0500555_052461 | 3300053103 | Bacteria | 1113 |
| 889 | Ga0500556_0000009 | 3300053104 | Bacteria | 288111 |
| 890 | Ga0500556_0000040 | 3300053104 | Bacteria | 137489 |
| 891 | Ga0500562_006970 | 3300053108 | Bacteria | 2850 |
| 892 | Ga0500572_002705 | 3300053111 | Bacteria | 4198 |
| 893 | Ga0500595_013801 | 3300053119 | Bacteria | 3086 |
| 894 | Ga0500608_009850 | 3300053122 | Bacteria | 4076 |
| 895 | Ga0500614_177525 | 3300053123 | Bacteria | 650 |
| 896 | Ga0500642_0000003 | 3300053130 | Bacteria | 544899 |
| 897 | Ga0500652_063656 | 3300053131 | Bacteria | 1522 |
| 898 | Ga0500559_0045548 | 3300053136 | Bacteria | 1921 |
| 899 | Ga0500573_0001876 | 3300053140 | Bacteria | 10257 |
| 900 | Ga0500616_0041627 | 3300053153 | Bacteria | 2464 |
| 901 | Ga0500616_0068808 | 3300053153 | Bacteria | 1812 |
| 902 | Ga0500624_000045 | 3300053157 | Bacteria | 89838 |
| 903 | Ga0500624_000049 | 3300053157 | Bacteria | 81103 |
| 904 | Ga0500627_0049624 | 3300053158 | Bacteria | 1826 |
| 905 | Ga0500630_025728 | 3300053159 | Bacteria | 2903 |
| 906 | Ga0500639_001271 | 3300053163 | Bacteria | 12769 |
| 907 | Ga0500636_0017859 | 3300053177 | Bacteria | 4192 |
| 908 | Ga0500636_0030741 | 3300053177 | Bacteria | 3178 |
| 909 | Ga0500645_024129 | 3300053730 | Bacteria | 1860 |
| 910 | Ga0500645_054489 | 3300053730 | Bacteria | 1163 |
| 911 | Ga0501084_0008472 | 3300054114 | Bacteria | 8504 |
| 912 | Ga0501084_0222497 | 3300054114 | Bacteria | 1592 |
| 913 | Ga0501084_0387471 | 3300054114 | Bacteria | 1181 |
| 914 | Ga0501084_0483026 | 3300054114 | Bacteria | 1047 |
| 915 | Ga0501084_0605467 | 3300054114 | Bacteria | 926 |
| 916 | Ga0501084_1188474 | 3300054114 | Bacteria | 640 |
| 917 | Ga0501084_1273046 | 3300054114 | Bacteria | 617 |
| 918 | Ga0501082_0022108 | 3300060353 | Bacteria | 5482 |
| 919 | Ga0501082_0025530 | 3300060353 | Bacteria | 5091 |
| 920 | Ga0501082_0062191 | 3300060353 | Bacteria | 3213 |
| 921 | Ga0501082_0168253 | 3300060353 | Bacteria | 1905 |
| 922 | Ga0501082_0192668 | 3300060353 | Bacteria | 1773 |
| 923 | Ga0501082_1012158 | 3300060353 | Bacteria | 726 |
| 924 | Ga0501082_1055990 | 3300060353 | Bacteria | 710 |
| 925 | Ga0530510_0014972 | 3300061734 | Bacteria | 5477 |
| 926 | Ga0530510_0088348 | 3300061734 | Bacteria | 2259 |
| 927 | Ga0530510_0112336 | 3300061734 | Bacteria | 1996 |
| 928 | Ga0530510_0202283 | 3300061734 | Bacteria | 1475 |
| 929 | Ga0530510_0248657 | 3300061734 | Bacteria | 1325 |
| 930 | Ga0530510_0391688 | 3300061734 | Bacteria | 1046 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049580 | Ga0501046_0322593 | Ga0501046_0322593_513_1058 | 105 |
| 2 | 3300049584 | Ga0501068_0193043 | Ga0501068_0193043_672_1217 | 105 |
| 3 | 3300049588 | Ga0501072_0101282 | Ga0501072_0101282_1561_2106 | 105 |
| 4 | 3300049591 | Ga0501075_0292736 | Ga0501075_0292736_342_887 | 105 |
| 5 | 3300061734 | Ga0530510_0014972 | Ga0530510_0014972_3982_4527 | 105 |
| 6 | 3300048911 | Ga0496108_0037603 | Ga0496108_0037603_1447_1905 | 109 |
| 7 | 3300048912 | Ga0496109_0019497 | Ga0496109_0019497_4606_5064 | 109 |
| 8 | 3300048913 | Ga0496110_0084076 | Ga0496110_0084076_1346_1804 | 109 |
| 9 | 3300048914 | Ga0496111_0358962 | Ga0496111_0358962_429_887 | 109 |
| 10 | 3300041453 | Ga0451797_1497932 | Ga0451797_1497932_104_592 | 110 |
| 11 | 3300049572 | Ga0501036_0620113 | Ga0501036_0620113_45_497 | 113 |
| 12 | 3300053095 | Ga0500640_256626 | Ga0500640_256626_21_473 | 113 |
| 13 | 3300009093 | Ga0105240_10139458 | Ga0105240_101394584 | 116 |
| 14 | 3300039450 | Ga0436363_1289101 | Ga0436363_1289101_212_697 | 116 |
| 15 | 3300049742 | Ga0501080_0124785 | Ga0501080_0124785_1420_1881 | 116 |
| 16 | 3300006038 | Ga0075365_10248907 | Ga0075365_102489072 | 122 |
| 17 | 3300005341 | Ga0070691_10079831 | Ga0070691_100798311 | 123 |
| 18 | 3300005445 | Ga0070708_100397599 | Ga0070708_1003975992 | 123 |
| 19 | 3300005548 | Ga0070665_100775494 | Ga0070665_1007754942 | 123 |
| 20 | 3300005617 | Ga0068859_101086847 | Ga0068859_1010868472 | 123 |
| 21 | 3300005719 | Ga0068861_100126163 | Ga0068861_1001261633 | 123 |
| 22 | 3300006931 | Ga0097620_101086905 | Ga0097620_1010869052 | 123 |
| 23 | 3300009148 | Ga0105243_10301107 | Ga0105243_103011072 | 123 |
| 24 | 3300009148 | Ga0105243_11503365 | Ga0105243_115033652 | 123 |
| 25 | 3300009551 | Ga0105238_10605894 | Ga0105238_106058941 | 123 |
| 26 | 3300025933 | Ga0207706_10354075 | Ga0207706_103540753 | 123 |
| 27 | 3300028379 | Ga0268266_10757939 | Ga0268266_107579392 | 123 |
| 28 | 3300031456 | Ga0307513_10179159 | Ga0307513_101791592 | 123 |
| 29 | 3300039453 | Ga0436362_0724793 | Ga0436362_0724793_160_642 | 123 |
| 30 | 3300042876 | Ga0451577_0350291 | Ga0451577_0350291_33_515 | 123 |
| 31 | 3300050507 | nmdc:mga05p37_127965_c1 | nmdc:mga05p37_127965_c1_2297_2779 | 123 |
| 32 | 3300050508 | nmdc:mga09592_633844_c1 | nmdc:mga09592_633844_c1_212_694 | 123 |
| 33 | 3300050509 | nmdc:mga0qj67_46923_c1 | nmdc:mga0qj67_46923_c1_631_1113 | 123 |
| 34 | 3300050510 | nmdc:mga06r32_245502_c1 | nmdc:mga06r32_245502_c1_253_735 | 123 |
| 35 | 3300013105 | Ga0157369_10017317 | Ga0157369_100173176 | 124 |
| 36 | 3300020082 | Ga0206353_11317483 | Ga0206353_113174831 | 124 |
| 37 | 3300026041 | Ga0207639_10002085 | Ga0207639_1000208511 | 124 |
| 38 | 3300028786 | Ga0307517_10041988 | Ga0307517_100419882 | 124 |
| 39 | 3300031911 | Ga0307412_10001044 | Ga0307412_100010449 | 124 |
| 40 | 3300032002 | Ga0307416_100063784 | Ga0307416_1000637843 | 124 |
| 41 | 3300032004 | Ga0307414_10000144 | Ga0307414_1000014437 | 124 |
| 42 | 3300046660 | Ga0495625_0011321 | Ga0495625_0011321_5473_5955 | 124 |
| 43 | 3300048925 | Ga0496122_0009301 | Ga0496122_0009301_3613_4095 | 124 |
| 44 | 3300048926 | Ga0496123_0000210 | Ga0496123_0000210_3631_4113 | 124 |
| 45 | 3300048928 | Ga0496125_0286231 | Ga0496125_0286231_369_851 | 124 |
| 46 | 3300049571 | Ga0501034_0166299 | Ga0501034_0166299_763_1245 | 124 |
| 47 | 3300053087 | Ga0500643_014103 | Ga0500643_014103_217_699 | 124 |
| 48 | 3300053087 | Ga0500643_087793 | Ga0500643_087793_93_575 | 124 |
| 49 | 3300053104 | Ga0500556_0000040 | Ga0500556_0000040_133290_133772 | 124 |
| 50 | 3300053108 | Ga0500562_006970 | Ga0500562_006970_1060_1542 | 124 |
| 51 | 3300053130 | Ga0500642_0000003 | Ga0500642_0000003_262570_263052 | 124 |
| 52 | 3300053136 | Ga0500559_0045548 | Ga0500559_0045548_260_742 | 124 |
| 53 | 3300053157 | Ga0500624_000045 | Ga0500624_000045_84959_85441 | 124 |
| 54 | 3300053177 | Ga0500636_0017859 | Ga0500636_0017859_2880_3362 | 124 |
| 55 | 2162886007 | SwRhRL2b_contig_1308435 | SwRhRL2b_0712.00005460 | 125 |
| 56 | 3300001904 | JGI24736J21556_1000469 | JGI24736J21556_10004692 | 125 |
| 57 | 3300001977 | JGI24746J21847_1002318 | JGI24746J21847_10023184 | 125 |
| 58 | 3300001978 | JGI24747J21853_1026391 | JGI24747J21853_10263911 | 125 |
| 59 | 3300001979 | JGI24740J21852_10049680 | JGI24740J21852_100496802 | 125 |
| 60 | 3300001990 | JGI24737J22298_10004151 | JGI24737J22298_100041513 | 125 |
| 61 | 3300001990 | JGI24737J22298_10148771 | JGI24737J22298_101487711 | 125 |
| 62 | 3300002067 | JGI24735J21928_10004647 | JGI24735J21928_100046474 | 125 |
| 63 | 3300002070 | JGI24750J21931_1000848 | JGI24750J21931_10008481 | 125 |
| 64 | 3300002073 | JGI24745J21846_1017104 | JGI24745J21846_10171042 | 125 |
| 65 | 3300002074 | JGI24748J21848_1001096 | JGI24748J21848_10010961 | 125 |
| 66 | 3300002075 | JGI24738J21930_10000674 | JGI24738J21930_100006742 | 125 |
| 67 | 3300002076 | JGI24749J21850_1002350 | JGI24749J21850_10023504 | 125 |
| 68 | 3300002077 | JGI24744J21845_10000459 | JGI24744J21845_100004597 | 125 |
| 69 | 3300002155 | JGI24033J26618_1001826 | JGI24033J26618_10018262 | 125 |
| 70 | 3300002244 | JGI24742J22300_10003845 | JGI24742J22300_100038454 | 125 |
| 71 | 3300002244 | JGI24742J22300_10032263 | JGI24742J22300_100322632 | 125 |
| 72 | 3300002459 | JGI24751J29686_10003221 | JGI24751J29686_100032214 | 125 |
| 73 | 3300003203 | JGI25406J46586_10004353 | JGI25406J46586_100043532 | 125 |
| 74 | 3300003214 | JGI25165J46597_1000041 | JGI25165J46597_1000041260 | 125 |
| 75 | 3300003373 | JGI25407J50210_10124764 | JGI25407J50210_101247641 | 125 |
| 76 | 3300003791 | Ga0055530_10001188 | Ga0055530_1000118824 | 125 |
| 77 | 3300003794 | Ga0055531_10001182 | Ga0055531_100011823 | 125 |
| 78 | 3300003911 | JGI25405J52794_10001004 | JGI25405J52794_100010044 | 125 |
| 79 | 3300005262 | Ga0065165_1003786 | Ga0065165_10037869 | 125 |
| 80 | 3300005289 | Ga0065704_10002136 | Ga0065704_100021364 | 125 |
| 81 | 3300005290 | Ga0065712_10076047 | Ga0065712_100760473 | 125 |
| 82 | 3300005293 | Ga0065715_10096277 | Ga0065715_100962774 | 125 |
| 83 | 3300005330 | Ga0070690_100231859 | Ga0070690_1002318591 | 125 |
| 84 | 3300005331 | Ga0070670_100061841 | Ga0070670_1000618412 | 125 |
| 85 | 3300005331 | Ga0070670_100186711 | Ga0070670_1001867113 | 125 |
| 86 | 3300005334 | Ga0068869_100994939 | Ga0068869_1009949392 | 125 |
| 87 | 3300005335 | Ga0070666_10023515 | Ga0070666_100235152 | 125 |
| 88 | 3300005335 | Ga0070666_10145194 | Ga0070666_101451942 | 125 |
| 89 | 3300005335 | Ga0070666_10309560 | Ga0070666_103095603 | 125 |
| 90 | 3300005336 | Ga0070680_100409186 | Ga0070680_1004091863 | 125 |
| 91 | 3300005336 | Ga0070680_100743222 | Ga0070680_1007432222 | 125 |
| 92 | 3300005337 | Ga0070682_100024507 | Ga0070682_1000245074 | 125 |
| 93 | 3300005338 | Ga0068868_100053715 | Ga0068868_1000537154 | 125 |
| 94 | 3300005338 | Ga0068868_101315834 | Ga0068868_1013158341 | 125 |
| 95 | 3300005339 | Ga0070660_100092540 | Ga0070660_1000925403 | 125 |
| 96 | 3300005339 | Ga0070660_100106546 | Ga0070660_1001065463 | 125 |
| 97 | 3300005340 | Ga0070689_100004610 | Ga0070689_1000046102 | 125 |
| 98 | 3300005340 | Ga0070689_101253761 | Ga0070689_1012537611 | 125 |
| 99 | 3300005341 | Ga0070691_10248118 | Ga0070691_102481182 | 125 |
| 100 | 3300005343 | Ga0070687_100007225 | Ga0070687_1000072255 | 125 |
| 101 | 3300005344 | Ga0070661_100023471 | Ga0070661_1000234714 | 125 |
| 102 | 3300005344 | Ga0070661_100112141 | Ga0070661_1001121411 | 125 |
| 103 | 3300005345 | Ga0070692_10022848 | Ga0070692_100228484 | 125 |
| 104 | 3300005347 | Ga0070668_100000010 | Ga0070668_10000001039 | 125 |
| 105 | 3300005347 | Ga0070668_100016202 | Ga0070668_1000162025 | 125 |
| 106 | 3300005347 | Ga0070668_100087407 | Ga0070668_1000874074 | 125 |
| 107 | 3300005347 | Ga0070668_100122212 | Ga0070668_1001222122 | 125 |
| 108 | 3300005347 | Ga0070668_100145088 | Ga0070668_1001450883 | 125 |
| 109 | 3300005353 | Ga0070669_100015953 | Ga0070669_1000159534 | 125 |
| 110 | 3300005353 | Ga0070669_100275541 | Ga0070669_1002755411 | 125 |
| 111 | 3300005353 | Ga0070669_101818405 | Ga0070669_1018184051 | 125 |
| 112 | 3300005354 | Ga0070675_100039194 | Ga0070675_1000391944 | 125 |
| 113 | 3300005354 | Ga0070675_100275452 | Ga0070675_1002754522 | 125 |
| 114 | 3300005355 | Ga0070671_100018333 | Ga0070671_1000183334 | 125 |
| 115 | 3300005355 | Ga0070671_100166306 | Ga0070671_1001663062 | 125 |
| 116 | 3300005355 | Ga0070671_100642197 | Ga0070671_1006421972 | 125 |
| 117 | 3300005356 | Ga0070674_100001953 | Ga0070674_10000195311 | 125 |
| 118 | 3300005356 | Ga0070674_100011062 | Ga0070674_1000110622 | 125 |
| 119 | 3300005356 | Ga0070674_101554764 | Ga0070674_1015547641 | 125 |
| 120 | 3300005364 | Ga0070673_100033931 | Ga0070673_1000339314 | 125 |
| 121 | 3300005365 | Ga0070688_100191034 | Ga0070688_1001910342 | 125 |
| 122 | 3300005365 | Ga0070688_100604313 | Ga0070688_1006043131 | 125 |
| 123 | 3300005366 | Ga0070659_100029462 | Ga0070659_1000294624 | 125 |
| 124 | 3300005366 | Ga0070659_100517441 | Ga0070659_1005174411 | 125 |
| 125 | 3300005366 | Ga0070659_100992794 | Ga0070659_1009927941 | 125 |
| 126 | 3300005367 | Ga0070667_100000013 | Ga0070667_100000013100 | 125 |
| 127 | 3300005367 | Ga0070667_100059106 | Ga0070667_1000591064 | 125 |
| 128 | 3300005434 | Ga0070709_11088539 | Ga0070709_110885391 | 125 |
| 129 | 3300005436 | Ga0070713_100112794 | Ga0070713_1001127943 | 125 |
| 130 | 3300005437 | Ga0070710_10032843 | Ga0070710_100328431 | 125 |
| 131 | 3300005438 | Ga0070701_10014832 | Ga0070701_100148324 | 125 |
| 132 | 3300005439 | Ga0070711_100054944 | Ga0070711_1000549444 | 125 |
| 133 | 3300005439 | Ga0070711_101049494 | Ga0070711_1010494941 | 125 |
| 134 | 3300005439 | Ga0070711_101528692 | Ga0070711_1015286921 | 125 |
| 135 | 3300005440 | Ga0070705_100012708 | Ga0070705_1000127084 | 125 |
| 136 | 3300005440 | Ga0070705_100076984 | Ga0070705_1000769843 | 125 |
| 137 | 3300005441 | Ga0070700_100051429 | Ga0070700_1000514292 | 125 |
| 138 | 3300005444 | Ga0070694_100148281 | Ga0070694_1001482811 | 125 |
| 139 | 3300005455 | Ga0070663_100017388 | Ga0070663_1000173883 | 125 |
| 140 | 3300005455 | Ga0070663_100045120 | Ga0070663_1000451204 | 125 |
| 141 | 3300005455 | Ga0070663_100069461 | Ga0070663_1000694613 | 125 |
| 142 | 3300005456 | Ga0070678_100168505 | Ga0070678_1001685053 | 125 |
| 143 | 3300005457 | Ga0070662_100003080 | Ga0070662_1000030807 | 125 |
| 144 | 3300005457 | Ga0070662_100175324 | Ga0070662_1001753242 | 125 |
| 145 | 3300005457 | Ga0070662_101008481 | Ga0070662_1010084811 | 125 |
| 146 | 3300005458 | Ga0070681_11184557 | Ga0070681_111845571 | 125 |
| 147 | 3300005459 | Ga0068867_100038190 | Ga0068867_1000381902 | 125 |
| 148 | 3300005466 | Ga0070685_10002290 | Ga0070685_100022904 | 125 |
| 149 | 3300005468 | Ga0070707_101066339 | Ga0070707_1010663391 | 125 |
| 150 | 3300005471 | Ga0070698_100280396 | Ga0070698_1002803963 | 125 |
| 151 | 3300005471 | Ga0070698_100311316 | Ga0070698_1003113162 | 125 |
| 152 | 3300005530 | Ga0070679_100370783 | Ga0070679_1003707832 | 125 |
| 153 | 3300005530 | Ga0070679_100498457 | Ga0070679_1004984572 | 125 |
| 154 | 3300005535 | Ga0070684_100043853 | Ga0070684_1000438534 | 125 |
| 155 | 3300005539 | Ga0068853_100038701 | Ga0068853_1000387012 | 125 |
| 156 | 3300005539 | Ga0068853_100583716 | Ga0068853_1005837162 | 125 |
| 157 | 3300005539 | Ga0068853_100704133 | Ga0068853_1007041331 | 125 |
| 158 | 3300005543 | Ga0070672_100001270 | Ga0070672_10000127015 | 125 |
| 159 | 3300005544 | Ga0070686_100005738 | Ga0070686_1000057386 | 125 |
| 160 | 3300005545 | Ga0070695_100378240 | Ga0070695_1003782402 | 125 |
| 161 | 3300005546 | Ga0070696_100048816 | Ga0070696_1000488164 | 125 |
| 162 | 3300005546 | Ga0070696_100113008 | Ga0070696_1001130084 | 125 |
| 163 | 3300005546 | Ga0070696_100732098 | Ga0070696_1007320982 | 125 |
| 164 | 3300005547 | Ga0070693_100048051 | Ga0070693_1000480514 | 125 |
| 165 | 3300005548 | Ga0070665_100108729 | Ga0070665_1001087292 | 125 |
| 166 | 3300005548 | Ga0070665_100114000 | Ga0070665_1001140002 | 125 |
| 167 | 3300005548 | Ga0070665_102169407 | Ga0070665_1021694071 | 125 |
| 168 | 3300005549 | Ga0070704_100037328 | Ga0070704_1000373283 | 125 |
| 169 | 3300005549 | Ga0070704_100301477 | Ga0070704_1003014772 | 125 |
| 170 | 3300005563 | Ga0068855_100939750 | Ga0068855_1009397502 | 125 |
| 171 | 3300005564 | Ga0070664_100030051 | Ga0070664_1000300514 | 125 |
| 172 | 3300005564 | Ga0070664_100122682 | Ga0070664_1001226823 | 125 |
| 173 | 3300005564 | Ga0070664_101131941 | Ga0070664_1011319412 | 125 |
| 174 | 3300005564 | Ga0070664_101523869 | Ga0070664_1015238691 | 125 |
| 175 | 3300005577 | Ga0068857_100448519 | Ga0068857_1004485192 | 125 |
| 176 | 3300005578 | Ga0068854_100025737 | Ga0068854_1000257374 | 125 |
| 177 | 3300005578 | Ga0068854_100423270 | Ga0068854_1004232702 | 125 |
| 178 | 3300005614 | Ga0068856_100009471 | Ga0068856_1000094714 | 125 |
| 179 | 3300005614 | Ga0068856_100037704 | Ga0068856_1000377045 | 125 |
| 180 | 3300005614 | Ga0068856_100102901 | Ga0068856_1001029014 | 125 |
| 181 | 3300005614 | Ga0068856_100347030 | Ga0068856_1003470302 | 125 |
| 182 | 3300005614 | Ga0068856_101329519 | Ga0068856_1013295192 | 125 |
| 183 | 3300005615 | Ga0070702_100009964 | Ga0070702_1000099644 | 125 |
| 184 | 3300005615 | Ga0070702_100380961 | Ga0070702_1003809611 | 125 |
| 185 | 3300005616 | Ga0068852_100023635 | Ga0068852_1000236355 | 125 |
| 186 | 3300005616 | Ga0068852_100237795 | Ga0068852_1002377952 | 125 |
| 187 | 3300005617 | Ga0068859_100033400 | Ga0068859_1000334004 | 125 |
| 188 | 3300005617 | Ga0068859_100035480 | Ga0068859_1000354802 | 125 |
| 189 | 3300005618 | Ga0068864_100021549 | Ga0068864_1000215497 | 125 |
| 190 | 3300005718 | Ga0068866_10098752 | Ga0068866_100987522 | 125 |
| 191 | 3300005718 | Ga0068866_10125379 | Ga0068866_101253792 | 125 |
| 192 | 3300005719 | Ga0068861_100086054 | Ga0068861_1000860543 | 125 |
| 193 | 3300005834 | Ga0068851_10002776 | Ga0068851_100027767 | 125 |
| 194 | 3300005834 | Ga0068851_10022475 | Ga0068851_100224752 | 125 |
| 195 | 3300005834 | Ga0068851_10077392 | Ga0068851_100773922 | 125 |
| 196 | 3300005840 | Ga0068870_10001959 | Ga0068870_100019594 | 125 |
| 197 | 3300005841 | Ga0068863_100000130 | Ga0068863_10000013041 | 125 |
| 198 | 3300005841 | Ga0068863_100001004 | Ga0068863_10000100420 | 125 |
| 199 | 3300005842 | Ga0068858_100002907 | Ga0068858_10000290710 | 125 |
| 200 | 3300005842 | Ga0068858_100039732 | Ga0068858_1000397324 | 125 |
| 201 | 3300005842 | Ga0068858_100547849 | Ga0068858_1005478492 | 125 |
| 202 | 3300005843 | Ga0068860_100021228 | Ga0068860_1000212286 | 125 |
| 203 | 3300005843 | Ga0068860_100042367 | Ga0068860_1000423672 | 125 |
| 204 | 3300005844 | Ga0068862_100096039 | Ga0068862_1000960395 | 125 |
| 205 | 3300005844 | Ga0068862_100562227 | Ga0068862_1005622272 | 125 |
| 206 | 3300005844 | Ga0068862_100666574 | Ga0068862_1006665742 | 125 |
| 207 | 3300005937 | Ga0081455_10012820 | Ga0081455_100128203 | 125 |
| 208 | 3300005937 | Ga0081455_10018926 | Ga0081455_100189265 | 125 |
| 209 | 3300005981 | Ga0081538_10006183 | Ga0081538_100061835 | 125 |
| 210 | 3300005981 | Ga0081538_10087746 | Ga0081538_100877464 | 125 |
| 211 | 3300005983 | Ga0081540_1006467 | Ga0081540_10064672 | 125 |
| 212 | 3300005983 | Ga0081540_1031025 | Ga0081540_10310253 | 125 |
| 213 | 3300005983 | Ga0081540_1126403 | Ga0081540_11264031 | 125 |
| 214 | 3300006028 | Ga0070717_10015726 | Ga0070717_100157265 | 125 |
| 215 | 3300006028 | Ga0070717_10103663 | Ga0070717_101036632 | 125 |
| 216 | 3300006028 | Ga0070717_10174380 | Ga0070717_101743802 | 125 |
| 217 | 3300006028 | Ga0070717_10752757 | Ga0070717_107527572 | 125 |
| 218 | 3300006038 | Ga0075365_10080553 | Ga0075365_100805532 | 125 |
| 219 | 3300006038 | Ga0075365_10471635 | Ga0075365_104716351 | 125 |
| 220 | 3300006038 | Ga0075365_10625046 | Ga0075365_106250461 | 125 |
| 221 | 3300006038 | Ga0075365_10890589 | Ga0075365_108905891 | 125 |
| 222 | 3300006042 | Ga0075368_10000432 | Ga0075368_100004328 | 125 |
| 223 | 3300006042 | Ga0075368_10094419 | Ga0075368_100944192 | 125 |
| 224 | 3300006048 | Ga0075363_100041327 | Ga0075363_1000413272 | 125 |
| 225 | 3300006048 | Ga0075363_100206408 | Ga0075363_1002064082 | 125 |
| 226 | 3300006051 | Ga0075364_10076564 | Ga0075364_100765642 | 125 |
| 227 | 3300006051 | Ga0075364_10146185 | Ga0075364_101461853 | 125 |
| 228 | 3300006163 | Ga0070715_10001746 | Ga0070715_100017467 | 125 |
| 229 | 3300006173 | Ga0070716_100003116 | Ga0070716_1000031166 | 125 |
| 230 | 3300006175 | Ga0070712_100388040 | Ga0070712_1003880403 | 125 |
| 231 | 3300006177 | Ga0075362_10004001 | Ga0075362_100040015 | 125 |
| 232 | 3300006177 | Ga0075362_10058451 | Ga0075362_100584512 | 125 |
| 233 | 3300006178 | Ga0075367_10008152 | Ga0075367_100081522 | 125 |
| 234 | 3300006195 | Ga0075366_10047067 | Ga0075366_100470674 | 125 |
| 235 | 3300006353 | Ga0075370_10014545 | Ga0075370_100145454 | 125 |
| 236 | 3300006353 | Ga0075370_10088087 | Ga0075370_100880872 | 125 |
| 237 | 3300006358 | Ga0068871_100089003 | Ga0068871_1000890034 | 125 |
| 238 | 3300006844 | Ga0075428_100164358 | Ga0075428_1001643582 | 125 |
| 239 | 3300006846 | Ga0075430_100541980 | Ga0075430_1005419802 | 125 |
| 240 | 3300006847 | Ga0075431_100004484 | Ga0075431_1000044847 | 125 |
| 241 | 3300006852 | Ga0075433_10373469 | Ga0075433_103734692 | 125 |
| 242 | 3300006852 | Ga0075433_10425777 | Ga0075433_104257772 | 125 |
| 243 | 3300006871 | Ga0075434_100057055 | Ga0075434_1000570552 | 125 |
| 244 | 3300006871 | Ga0075434_100082600 | Ga0075434_1000826002 | 125 |
| 245 | 3300006871 | Ga0075434_100127891 | Ga0075434_1001278914 | 125 |
| 246 | 3300006880 | Ga0075429_100212269 | Ga0075429_1002122693 | 125 |
| 247 | 3300006881 | Ga0068865_100816311 | Ga0068865_1008163111 | 125 |
| 248 | 3300006914 | Ga0075436_100149175 | Ga0075436_1001491753 | 125 |
| 249 | 3300006914 | Ga0075436_100213385 | Ga0075436_1002133852 | 125 |
| 250 | 3300006931 | Ga0097620_100033400 | Ga0097620_1000334004 | 125 |
| 251 | 3300006931 | Ga0097620_100035479 | Ga0097620_1000354792 | 125 |
| 252 | 3300006944 | Ga0099823_1137254 | Ga0099823_11372541 | 125 |
| 253 | 3300007076 | Ga0075435_100735609 | Ga0075435_1007356092 | 125 |
| 254 | 3300007076 | Ga0075435_101004216 | Ga0075435_1010042161 | 125 |
| 255 | 3300007265 | Ga0099794_10265146 | Ga0099794_102651461 | 125 |
| 256 | 3300009011 | Ga0105251_10128139 | Ga0105251_101281392 | 125 |
| 257 | 3300009092 | Ga0105250_10065091 | Ga0105250_100650911 | 125 |
| 258 | 3300009092 | Ga0105250_10072108 | Ga0105250_100721082 | 125 |
| 259 | 3300009093 | Ga0105240_10134042 | Ga0105240_101340423 | 125 |
| 260 | 3300009094 | Ga0111539_10045279 | Ga0111539_100452794 | 125 |
| 261 | 3300009094 | Ga0111539_10068395 | Ga0111539_100683955 | 125 |
| 262 | 3300009094 | Ga0111539_10428944 | Ga0111539_104289441 | 125 |
| 263 | 3300009098 | Ga0105245_10775797 | Ga0105245_107757973 | 125 |
| 264 | 3300009098 | Ga0105245_11029036 | Ga0105245_110290361 | 125 |
| 265 | 3300009101 | Ga0105247_10008832 | Ga0105247_100088325 | 125 |
| 266 | 3300009101 | Ga0105247_10019109 | Ga0105247_100191093 | 125 |
| 267 | 3300009101 | Ga0105247_10631438 | Ga0105247_106314381 | 125 |
| 268 | 3300009147 | Ga0114129_10006400 | Ga0114129_100064004 | 125 |
| 269 | 3300009147 | Ga0114129_10020510 | Ga0114129_100205105 | 125 |
| 270 | 3300009147 | Ga0114129_10252747 | Ga0114129_102527472 | 125 |
| 271 | 3300009148 | Ga0105243_10625964 | Ga0105243_106259641 | 125 |
| 272 | 3300009174 | Ga0105241_10017640 | Ga0105241_100176405 | 125 |
| 273 | 3300009174 | Ga0105241_10535360 | Ga0105241_105353602 | 125 |
| 274 | 3300009176 | Ga0105242_10188649 | Ga0105242_101886492 | 125 |
| 275 | 3300009176 | Ga0105242_10298627 | Ga0105242_102986272 | 125 |
| 276 | 3300009177 | Ga0105248_10007785 | Ga0105248_1000778510 | 125 |
| 277 | 3300009545 | Ga0105237_10025821 | Ga0105237_100258215 | 125 |
| 278 | 3300009545 | Ga0105237_10029660 | Ga0105237_100296607 | 125 |
| 279 | 3300009551 | Ga0105238_10097867 | Ga0105238_100978673 | 125 |
| 280 | 3300009551 | Ga0105238_10220857 | Ga0105238_102208572 | 125 |
| 281 | 3300009553 | Ga0105249_10156420 | Ga0105249_101564203 | 125 |
| 282 | 3300009553 | Ga0105249_10169198 | Ga0105249_101691983 | 125 |
| 283 | 3300009553 | Ga0105249_10406957 | Ga0105249_104069572 | 125 |
| 284 | 3300009978 | Ga0105148_100189 | Ga0105148_1001896 | 125 |
| 285 | 3300009978 | Ga0105148_109326 | Ga0105148_1093262 | 125 |
| 286 | 3300009984 | Ga0105029_115183 | Ga0105029_1151831 | 125 |
| 287 | 3300010375 | Ga0105239_10023131 | Ga0105239_100231318 | 125 |
| 288 | 3300010375 | Ga0105239_10049433 | Ga0105239_100494333 | 125 |
| 289 | 3300010375 | Ga0105239_10211691 | Ga0105239_102116913 | 125 |
| 290 | 3300010375 | Ga0105239_10379929 | Ga0105239_103799292 | 125 |
| 291 | 3300010375 | Ga0105239_10684780 | Ga0105239_106847802 | 125 |
| 292 | 3300010375 | Ga0105239_10905337 | Ga0105239_109053371 | 125 |
| 293 | 3300010375 | Ga0105239_11921223 | Ga0105239_119212231 | 125 |
| 294 | 3300011119 | Ga0105246_10032111 | Ga0105246_100321112 | 125 |
| 295 | 3300012491 | Ga0157329_1002162 | Ga0157329_10021622 | 125 |
| 296 | 3300012513 | Ga0157326_1016607 | Ga0157326_10166071 | 125 |
| 297 | 3300013100 | Ga0157373_10007215 | Ga0157373_100072158 | 125 |
| 298 | 3300013104 | Ga0157370_10034345 | Ga0157370_100343456 | 125 |
| 299 | 3300013105 | Ga0157369_10609394 | Ga0157369_106093942 | 125 |
| 300 | 3300013105 | Ga0157369_11288208 | Ga0157369_112882082 | 125 |
| 301 | 3300013105 | Ga0157369_11507961 | Ga0157369_115079611 | 125 |
| 302 | 3300013296 | Ga0157374_10070540 | Ga0157374_100705402 | 125 |
| 303 | 3300013297 | Ga0157378_10077023 | Ga0157378_100770233 | 125 |
| 304 | 3300013297 | Ga0157378_11332991 | Ga0157378_113329911 | 125 |
| 305 | 3300013306 | Ga0163162_10053399 | Ga0163162_100533992 | 125 |
| 306 | 3300013306 | Ga0163162_10515365 | Ga0163162_105153652 | 125 |
| 307 | 3300013306 | Ga0163162_10840959 | Ga0163162_108409592 | 125 |
| 308 | 3300013307 | Ga0157372_10385746 | Ga0157372_103857462 | 125 |
| 309 | 3300013308 | Ga0157375_10935391 | Ga0157375_109353912 | 125 |
| 310 | 3300014325 | Ga0163163_10029540 | Ga0163163_100295405 | 125 |
| 311 | 3300014325 | Ga0163163_10065220 | Ga0163163_100652203 | 125 |
| 312 | 3300014326 | Ga0157380_10278459 | Ga0157380_102784593 | 125 |
| 313 | 3300014326 | Ga0157380_11051269 | Ga0157380_110512691 | 125 |
| 314 | 3300014497 | Ga0182008_10275455 | Ga0182008_102754552 | 125 |
| 315 | 3300014745 | Ga0157377_10075482 | Ga0157377_100754823 | 125 |
| 316 | 3300014968 | Ga0157379_10137482 | Ga0157379_101374823 | 125 |
| 317 | 3300014968 | Ga0157379_11281546 | Ga0157379_112815461 | 125 |
| 318 | 3300014968 | Ga0157379_11295323 | Ga0157379_112953232 | 125 |
| 319 | 3300017792 | Ga0163161_10099861 | Ga0163161_100998613 | 125 |
| 320 | 3300021361 | Ga0213872_10318372 | Ga0213872_103183721 | 125 |
| 321 | 3300021384 | Ga0213876_10273087 | Ga0213876_102730872 | 125 |
| 322 | 3300021441 | Ga0213871_10192442 | Ga0213871_101924421 | 125 |
| 323 | 3300025261 | Ga0209233_1000104 | Ga0209233_1000104264 | 125 |
| 324 | 3300025261 | Ga0209233_1049297 | Ga0209233_10492972 | 125 |
| 325 | 3300025298 | Ga0209050_1000010 | Ga0209050_1000010634 | 125 |
| 326 | 3300025304 | Ga0209257_1000009 | Ga0209257_1000009482 | 125 |
| 327 | 3300025304 | Ga0209257_1047629 | Ga0209257_10476292 | 125 |
| 328 | 3300025315 | Ga0207697_10369020 | Ga0207697_103690202 | 125 |
| 329 | 3300025321 | Ga0207656_10003231 | Ga0207656_100032314 | 125 |
| 330 | 3300025321 | Ga0207656_10009468 | Ga0207656_100094685 | 125 |
| 331 | 3300025321 | Ga0207656_10094294 | Ga0207656_100942943 | 125 |
| 332 | 3300025728 | Ga0207655_1129677 | Ga0207655_11296772 | 125 |
| 333 | 3300025735 | Ga0207713_1092144 | Ga0207713_10921442 | 125 |
| 334 | 3300025898 | Ga0207692_10345294 | Ga0207692_103452941 | 125 |
| 335 | 3300025899 | Ga0207642_10114881 | Ga0207642_101148812 | 125 |
| 336 | 3300025900 | Ga0207710_10004436 | Ga0207710_100044364 | 125 |
| 337 | 3300025901 | Ga0207688_10000309 | Ga0207688_1000030920 | 125 |
| 338 | 3300025903 | Ga0207680_10269243 | Ga0207680_102692432 | 125 |
| 339 | 3300025904 | Ga0207647_10003672 | Ga0207647_100036727 | 125 |
| 340 | 3300025904 | Ga0207647_10007308 | Ga0207647_100073086 | 125 |
| 341 | 3300025904 | Ga0207647_10223516 | Ga0207647_102235162 | 125 |
| 342 | 3300025907 | Ga0207645_10025338 | Ga0207645_100253384 | 125 |
| 343 | 3300025908 | Ga0207643_10000977 | Ga0207643_100009778 | 125 |
| 344 | 3300025909 | Ga0207705_10393622 | Ga0207705_103936221 | 125 |
| 345 | 3300025911 | Ga0207654_10101092 | Ga0207654_101010922 | 125 |
| 346 | 3300025911 | Ga0207654_10111908 | Ga0207654_101119083 | 125 |
| 347 | 3300025913 | Ga0207695_10233082 | Ga0207695_102330822 | 125 |
| 348 | 3300025914 | Ga0207671_10203563 | Ga0207671_102035633 | 125 |
| 349 | 3300025915 | Ga0207693_10003085 | Ga0207693_100030857 | 125 |
| 350 | 3300025915 | Ga0207693_10005179 | Ga0207693_1000517910 | 125 |
| 351 | 3300025915 | Ga0207693_10030227 | Ga0207693_100302275 | 125 |
| 352 | 3300025915 | Ga0207693_10138714 | Ga0207693_101387142 | 125 |
| 353 | 3300025916 | Ga0207663_10015712 | Ga0207663_100157123 | 125 |
| 354 | 3300025916 | Ga0207663_10074846 | Ga0207663_100748464 | 125 |
| 355 | 3300025917 | Ga0207660_10360889 | Ga0207660_103608892 | 125 |
| 356 | 3300025917 | Ga0207660_10777082 | Ga0207660_107770822 | 125 |
| 357 | 3300025918 | Ga0207662_10002752 | Ga0207662_100027528 | 125 |
| 358 | 3300025919 | Ga0207657_10005125 | Ga0207657_100051252 | 125 |
| 359 | 3300025919 | Ga0207657_10023905 | Ga0207657_100239054 | 125 |
| 360 | 3300025919 | Ga0207657_10032339 | Ga0207657_100323395 | 125 |
| 361 | 3300025920 | Ga0207649_10031037 | Ga0207649_100310374 | 125 |
| 362 | 3300025920 | Ga0207649_10391254 | Ga0207649_103912542 | 125 |
| 363 | 3300025922 | Ga0207646_10199890 | Ga0207646_101998904 | 125 |
| 364 | 3300025923 | Ga0207681_10034578 | Ga0207681_100345783 | 125 |
| 365 | 3300025923 | Ga0207681_10045824 | Ga0207681_100458244 | 125 |
| 366 | 3300025923 | Ga0207681_10391546 | Ga0207681_103915462 | 125 |
| 367 | 3300025923 | Ga0207681_10454590 | Ga0207681_104545902 | 125 |
| 368 | 3300025924 | Ga0207694_10091602 | Ga0207694_100916022 | 125 |
| 369 | 3300025924 | Ga0207694_10419035 | Ga0207694_104190352 | 125 |
| 370 | 3300025925 | Ga0207650_10043385 | Ga0207650_100433854 | 125 |
| 371 | 3300025925 | Ga0207650_10066890 | Ga0207650_100668902 | 125 |
| 372 | 3300025925 | Ga0207650_10359840 | Ga0207650_103598402 | 125 |
| 373 | 3300025925 | Ga0207650_10524974 | Ga0207650_105249742 | 125 |
| 374 | 3300025926 | Ga0207659_10134242 | Ga0207659_101342421 | 125 |
| 375 | 3300025927 | Ga0207687_10015506 | Ga0207687_100155064 | 125 |
| 376 | 3300025928 | Ga0207700_10024217 | Ga0207700_100242174 | 125 |
| 377 | 3300025928 | Ga0207700_10040473 | Ga0207700_100404734 | 125 |
| 378 | 3300025928 | Ga0207700_10345608 | Ga0207700_103456082 | 125 |
| 379 | 3300025928 | Ga0207700_11532370 | Ga0207700_115323701 | 125 |
| 380 | 3300025929 | Ga0207664_10017451 | Ga0207664_100174515 | 125 |
| 381 | 3300025931 | Ga0207644_10009744 | Ga0207644_100097444 | 125 |
| 382 | 3300025931 | Ga0207644_10265595 | Ga0207644_102655952 | 125 |
| 383 | 3300025931 | Ga0207644_10528042 | Ga0207644_105280422 | 125 |
| 384 | 3300025932 | Ga0207690_10085841 | Ga0207690_100858414 | 125 |
| 385 | 3300025932 | Ga0207690_10708846 | Ga0207690_107088461 | 125 |
| 386 | 3300025933 | Ga0207706_10001119 | Ga0207706_1000111914 | 125 |
| 387 | 3300025933 | Ga0207706_10200113 | Ga0207706_102001134 | 125 |
| 388 | 3300025933 | Ga0207706_10336963 | Ga0207706_103369632 | 125 |
| 389 | 3300025934 | Ga0207686_10116969 | Ga0207686_101169692 | 125 |
| 390 | 3300025934 | Ga0207686_10276502 | Ga0207686_102765022 | 125 |
| 391 | 3300025935 | Ga0207709_10265067 | Ga0207709_102650672 | 125 |
| 392 | 3300025937 | Ga0207669_10000474 | Ga0207669_1000047411 | 125 |
| 393 | 3300025937 | Ga0207669_10003188 | Ga0207669_100031884 | 125 |
| 394 | 3300025938 | Ga0207704_10429667 | Ga0207704_104296672 | 125 |
| 395 | 3300025939 | Ga0207665_10004939 | Ga0207665_100049394 | 125 |
| 396 | 3300025940 | Ga0207691_10000977 | Ga0207691_1000097720 | 125 |
| 397 | 3300025941 | Ga0207711_10072460 | Ga0207711_100724603 | 125 |
| 398 | 3300025941 | Ga0207711_10278403 | Ga0207711_102784032 | 125 |
| 399 | 3300025942 | Ga0207689_10034184 | Ga0207689_100341843 | 125 |
| 400 | 3300025942 | Ga0207689_11188676 | Ga0207689_111886761 | 125 |
| 401 | 3300025945 | Ga0207679_10061522 | Ga0207679_100615224 | 125 |
| 402 | 3300025945 | Ga0207679_11130228 | Ga0207679_111302281 | 125 |
| 403 | 3300025949 | Ga0207667_10082355 | Ga0207667_100823554 | 125 |
| 404 | 3300025949 | Ga0207667_10193949 | Ga0207667_101939492 | 125 |
| 405 | 3300025949 | Ga0207667_10393007 | Ga0207667_103930072 | 125 |
| 406 | 3300025960 | Ga0207651_10041578 | Ga0207651_100415783 | 125 |
| 407 | 3300025961 | Ga0207712_10060821 | Ga0207712_100608213 | 125 |
| 408 | 3300025961 | Ga0207712_10467543 | Ga0207712_104675432 | 125 |
| 409 | 3300025961 | Ga0207712_10587557 | Ga0207712_105875572 | 125 |
| 410 | 3300025972 | Ga0207668_10000020 | Ga0207668_1000002039 | 125 |
| 411 | 3300025972 | Ga0207668_10006027 | Ga0207668_100060279 | 125 |
| 412 | 3300025972 | Ga0207668_10070587 | Ga0207668_100705873 | 125 |
| 413 | 3300025972 | Ga0207668_10114456 | Ga0207668_101144562 | 125 |
| 414 | 3300025972 | Ga0207668_10431009 | Ga0207668_104310092 | 125 |
| 415 | 3300025981 | Ga0207640_10289725 | Ga0207640_102897251 | 125 |
| 416 | 3300025981 | Ga0207640_10372769 | Ga0207640_103727692 | 125 |
| 417 | 3300025981 | Ga0207640_11259317 | Ga0207640_112593172 | 125 |
| 418 | 3300025986 | Ga0207658_10000068 | Ga0207658_10000068101 | 125 |
| 419 | 3300025986 | Ga0207658_10005041 | Ga0207658_100050415 | 125 |
| 420 | 3300026023 | Ga0207677_10004567 | Ga0207677_100045674 | 125 |
| 421 | 3300026035 | Ga0207703_10000749 | Ga0207703_1000074933 | 125 |
| 422 | 3300026035 | Ga0207703_10005346 | Ga0207703_100053463 | 125 |
| 423 | 3300026035 | Ga0207703_10456074 | Ga0207703_104560742 | 125 |
| 424 | 3300026041 | Ga0207639_10001534 | Ga0207639_1000153416 | 125 |
| 425 | 3300026041 | Ga0207639_10021737 | Ga0207639_100217375 | 125 |
| 426 | 3300026041 | Ga0207639_10302192 | Ga0207639_103021921 | 125 |
| 427 | 3300026041 | Ga0207639_11222292 | Ga0207639_112222922 | 125 |
| 428 | 3300026067 | Ga0207678_10007310 | Ga0207678_100073106 | 125 |
| 429 | 3300026067 | Ga0207678_10014829 | Ga0207678_100148292 | 125 |
| 430 | 3300026067 | Ga0207678_10032842 | Ga0207678_100328423 | 125 |
| 431 | 3300026075 | Ga0207708_10002666 | Ga0207708_100026663 | 125 |
| 432 | 3300026078 | Ga0207702_10033718 | Ga0207702_100337182 | 125 |
| 433 | 3300026078 | Ga0207702_10085430 | Ga0207702_100854302 | 125 |
| 434 | 3300026078 | Ga0207702_11453487 | Ga0207702_114534872 | 125 |
| 435 | 3300026088 | Ga0207641_10000074 | Ga0207641_10000074105 | 125 |
| 436 | 3300026088 | Ga0207641_10007573 | Ga0207641_100075739 | 125 |
| 437 | 3300026089 | Ga0207648_10007429 | Ga0207648_100074295 | 125 |
| 438 | 3300026095 | Ga0207676_10001141 | Ga0207676_100011412 | 125 |
| 439 | 3300026116 | Ga0207674_10024815 | Ga0207674_100248153 | 125 |
| 440 | 3300026116 | Ga0207674_10088570 | Ga0207674_100885704 | 125 |
| 441 | 3300026118 | Ga0207675_100000366 | Ga0207675_10000036611 | 125 |
| 442 | 3300026121 | Ga0207683_10001415 | Ga0207683_1000141516 | 125 |
| 443 | 3300026142 | Ga0207698_10004010 | Ga0207698_100040104 | 125 |
| 444 | 3300026142 | Ga0207698_10023774 | Ga0207698_100237743 | 125 |
| 445 | 3300027296 | Ga0209389_1016020 | Ga0209389_10160207 | 125 |
| 446 | 3300027357 | Ga0209589_1000022 | Ga0209589_1000022146 | 125 |
| 447 | 3300027361 | Ga0209489_120539 | Ga0209489_1205393 | 125 |
| 448 | 3300027363 | Ga0209700_100021 | Ga0209700_10002171 | 125 |
| 449 | 3300027866 | Ga0209813_10000071 | Ga0209813_100000713 | 125 |
| 450 | 3300027876 | Ga0209974_10035634 | Ga0209974_100356341 | 125 |
| 451 | 3300028379 | Ga0268266_10076211 | Ga0268266_100762112 | 125 |
| 452 | 3300028379 | Ga0268266_10105981 | Ga0268266_101059814 | 125 |
| 453 | 3300028379 | Ga0268266_10197813 | Ga0268266_101978131 | 125 |
| 454 | 3300028379 | Ga0268266_11761137 | Ga0268266_117611371 | 125 |
| 455 | 3300028380 | Ga0268265_10067813 | Ga0268265_100678133 | 125 |
| 456 | 3300028380 | Ga0268265_10538623 | Ga0268265_105386232 | 125 |
| 457 | 3300028380 | Ga0268265_10575851 | Ga0268265_105758512 | 125 |
| 458 | 3300028381 | Ga0268264_10008769 | Ga0268264_100087695 | 125 |
| 459 | 3300028381 | Ga0268264_10016330 | Ga0268264_100163301 | 125 |
| 460 | 3300028381 | Ga0268264_11715319 | Ga0268264_117153191 | 125 |
| 461 | 3300028381 | Ga0268264_11854518 | Ga0268264_118545181 | 125 |
| 462 | 3300030734 | Ga0316179_1029619 | Ga0316179_10296191 | 125 |
| 463 | 3300031241 | Ga0265325_10016146 | Ga0265325_100161462 | 125 |
| 464 | 3300031241 | Ga0265325_10123893 | Ga0265325_101238932 | 125 |
| 465 | 3300031241 | Ga0265325_10134613 | Ga0265325_101346132 | 125 |
| 466 | 3300031247 | Ga0265340_10000121 | Ga0265340_100001212 | 125 |
| 467 | 3300031247 | Ga0265340_10398794 | Ga0265340_103987941 | 125 |
| 468 | 3300031249 | Ga0265339_10000777 | Ga0265339_1000077721 | 125 |
| 469 | 3300031249 | Ga0265339_10056840 | Ga0265339_100568402 | 125 |
| 470 | 3300031344 | Ga0265316_10008812 | Ga0265316_100088125 | 125 |
| 471 | 3300031344 | Ga0265316_10324546 | Ga0265316_103245462 | 125 |
| 472 | 3300031344 | Ga0265316_10771321 | Ga0265316_107713212 | 125 |
| 473 | 3300031456 | Ga0307513_10753582 | Ga0307513_107535821 | 125 |
| 474 | 3300031456 | Ga0307513_11026165 | Ga0307513_110261651 | 125 |
| 475 | 3300031507 | Ga0307509_10158201 | Ga0307509_101582014 | 125 |
| 476 | 3300031548 | Ga0307408_100059593 | Ga0307408_1000595934 | 125 |
| 477 | 3300031548 | Ga0307408_100102136 | Ga0307408_1001021363 | 125 |
| 478 | 3300031548 | Ga0307408_100207781 | Ga0307408_1002077812 | 125 |
| 479 | 3300031548 | Ga0307408_100754174 | Ga0307408_1007541742 | 125 |
| 480 | 3300031548 | Ga0307408_101563225 | Ga0307408_1015632251 | 125 |
| 481 | 3300031595 | Ga0265313_10003092 | Ga0265313_100030926 | 125 |
| 482 | 3300031616 | Ga0307508_10000231 | Ga0307508_100002314 | 125 |
| 483 | 3300031711 | Ga0265314_10192760 | Ga0265314_101927602 | 125 |
| 484 | 3300031711 | Ga0265314_10577547 | Ga0265314_105775471 | 125 |
| 485 | 3300031712 | Ga0265342_10011115 | Ga0265342_100111154 | 125 |
| 486 | 3300031712 | Ga0265342_10153568 | Ga0265342_101535681 | 125 |
| 487 | 3300031712 | Ga0265342_10341933 | Ga0265342_103419332 | 125 |
| 488 | 3300031727 | Ga0316576_10075593 | Ga0316576_100755932 | 125 |
| 489 | 3300031727 | Ga0316576_10381507 | Ga0316576_103815072 | 125 |
| 490 | 3300031730 | Ga0307516_10072447 | Ga0307516_100724473 | 125 |
| 491 | 3300031731 | Ga0307405_10000513 | Ga0307405_1000051313 | 125 |
| 492 | 3300031731 | Ga0307405_10064635 | Ga0307405_100646352 | 125 |
| 493 | 3300031731 | Ga0307405_10132893 | Ga0307405_101328933 | 125 |
| 494 | 3300031731 | Ga0307405_10294204 | Ga0307405_102942042 | 125 |
| 495 | 3300031731 | Ga0307405_10692929 | Ga0307405_106929291 | 125 |
| 496 | 3300031731 | Ga0307405_11218191 | Ga0307405_112181912 | 125 |
| 497 | 3300031733 | Ga0316577_10116717 | Ga0316577_101167173 | 125 |
| 498 | 3300031852 | Ga0307410_10258304 | Ga0307410_102583042 | 125 |
| 499 | 3300031852 | Ga0307410_11037888 | Ga0307410_110378882 | 125 |
| 500 | 3300031901 | Ga0307406_10068819 | Ga0307406_100688193 | 125 |
| 501 | 3300031901 | Ga0307406_10146574 | Ga0307406_101465741 | 125 |
| 502 | 3300031901 | Ga0307406_10907312 | Ga0307406_109073122 | 125 |
| 503 | 3300031911 | Ga0307412_10017584 | Ga0307412_100175844 | 125 |
| 504 | 3300031911 | Ga0307412_10046050 | Ga0307412_100460502 | 125 |
| 505 | 3300031911 | Ga0307412_10069434 | Ga0307412_100694342 | 125 |
| 506 | 3300031911 | Ga0307412_10152344 | Ga0307412_101523442 | 125 |
| 507 | 3300031911 | Ga0307412_10513760 | Ga0307412_105137602 | 125 |
| 508 | 3300031995 | Ga0307409_100417314 | Ga0307409_1004173142 | 125 |
| 509 | 3300032002 | Ga0307416_100171021 | Ga0307416_1001710212 | 125 |
| 510 | 3300032002 | Ga0307416_100240573 | Ga0307416_1002405732 | 125 |
| 511 | 3300032002 | Ga0307416_100575118 | Ga0307416_1005751182 | 125 |
| 512 | 3300032005 | Ga0307411_10668480 | Ga0307411_106684802 | 125 |
| 513 | 3300032126 | Ga0307415_100372186 | Ga0307415_1003721862 | 125 |
| 514 | 3300033180 | Ga0307510_10009032 | Ga0307510_1000903212 | 125 |
| 515 | 3300033541 | Ga0316596_1027815 | Ga0316596_10278152 | 125 |
| 516 | 3300035089 | Ga0373944_0035769 | Ga0373944_0035769_911_1402 | 125 |
| 517 | 3300035117 | Ga0373953_0041552 | Ga0373953_0041552_920_1414 | 125 |
| 518 | 3300035119 | Ga0373956_0349754 | Ga0373956_0349754_16_510 | 125 |
| 519 | 3300035172 | Ga0373955_0316542 | Ga0373955_0316542_87_581 | 125 |
| 520 | 3300035242 | Ga0373962_0176425 | Ga0373962_0176425_145_633 | 125 |
| 521 | 3300035398 | Ga0316574_0000378 | Ga0316574_0000378_16599_17087 | 125 |
| 522 | 3300035398 | Ga0316574_0014560 | Ga0316574_0014560_845_1333 | 125 |
| 523 | 3300035398 | Ga0316574_0350241 | Ga0316574_0350241_232_720 | 125 |
| 524 | 3300035691 | Ga0373931_0027302 | Ga0373931_0027302_1314_1802 | 125 |
| 525 | 3300035691 | Ga0373931_0060596 | Ga0373931_0060596_29_517 | 125 |
| 526 | 3300035695 | Ga0373927_0451143 | Ga0373927_0451143_264_752 | 125 |
| 527 | 3300035724 | Ga0373933_0158858 | Ga0373933_0158858_18_524 | 125 |
| 528 | 3300036401 | Ga0373937_0460722 | Ga0373937_0460722_146_640 | 125 |
| 529 | 3300036401 | Ga0373937_0870066 | Ga0373937_0870066_228_716 | 125 |
| 530 | 3300036712 | Ga0316584_0045154 | Ga0316584_0045154_183_671 | 125 |
| 531 | 3300036712 | Ga0316584_0112334 | Ga0316584_0112334_1193_1681 | 125 |
| 532 | 3300037068 | Ga0373925_0020370 | Ga0373925_0020370_3612_4106 | 125 |
| 533 | 3300037068 | Ga0373925_0075831 | Ga0373925_0075831_96_602 | 125 |
| 534 | 3300037068 | Ga0373925_1344119 | Ga0373925_1344119_65_553 | 125 |
| 535 | 3300037312 | Ga0395899_0009726 | Ga0395899_0009726_5601_6089 | 125 |
| 536 | 3300037312 | Ga0395899_0207424 | Ga0395899_0207424_453_941 | 125 |
| 537 | 3300037418 | Ga0395900_0018719 | Ga0395900_0018719_2090_2578 | 125 |
| 538 | 3300037418 | Ga0395900_0044529 | Ga0395900_0044529_4016_4504 | 125 |
| 539 | 3300037418 | Ga0395900_0105682 | Ga0395900_0105682_1332_1820 | 125 |
| 540 | 3300037418 | Ga0395900_0211011 | Ga0395900_0211011_1274_1762 | 125 |
| 541 | 3300037418 | Ga0395900_0462872 | Ga0395900_0462872_656_1144 | 125 |
| 542 | 3300037418 | Ga0395900_0545803 | Ga0395900_0545803_33_521 | 125 |
| 543 | 3300037418 | Ga0395900_0752058 | Ga0395900_0752058_137_631 | 125 |
| 544 | 3300037418 | Ga0395900_1065253 | Ga0395900_1065253_162_650 | 125 |
| 545 | 3300037466 | Ga0395898_0008316 | Ga0395898_0008316_2865_3353 | 125 |
| 546 | 3300037466 | Ga0395898_0013963 | Ga0395898_0013963_634_1122 | 125 |
| 547 | 3300037466 | Ga0395898_0018445 | Ga0395898_0018445_6084_6572 | 125 |
| 548 | 3300037466 | Ga0395898_0077993 | Ga0395898_0077993_523_1011 | 125 |
| 549 | 3300037466 | Ga0395898_0133062 | Ga0395898_0133062_1315_1803 | 125 |
| 550 | 3300037466 | Ga0395898_0386796 | Ga0395898_0386796_230_718 | 125 |
| 551 | 3300037471 | Ga0395905_0617609 | Ga0395905_0617609_78_566 | 125 |
| 552 | 3300038443 | Ga0395901_0005378 | Ga0395901_0005378_3842_4330 | 125 |
| 553 | 3300038443 | Ga0395901_0048533 | Ga0395901_0048533_3374_3862 | 125 |
| 554 | 3300038443 | Ga0395901_0055412 | Ga0395901_0055412_3469_3957 | 125 |
| 555 | 3300038443 | Ga0395901_0131330 | Ga0395901_0131330_1766_2254 | 125 |
| 556 | 3300038443 | Ga0395901_0320981 | Ga0395901_0320981_351_839 | 125 |
| 557 | 3300038443 | Ga0395901_0590738 | Ga0395901_0590738_617_1105 | 125 |
| 558 | 3300039093 | Ga0400489_52572 | Ga0400489_52572_261_749 | 125 |
| 559 | 3300039437 | Ga0436365_0249655 | Ga0436365_0249655_268_753 | 125 |
| 560 | 3300039437 | Ga0436365_1209249 | Ga0436365_1209249_5877_6371 | 125 |
| 561 | 3300039437 | Ga0436365_1348843 | Ga0436365_1348843_40_528 | 125 |
| 562 | 3300039438 | Ga0436360_0152696 | Ga0436360_0152696_148_642 | 125 |
| 563 | 3300039438 | Ga0436360_0155171 | Ga0436360_0155171_51_539 | 125 |
| 564 | 3300039438 | Ga0436360_0225540 | Ga0436360_0225540_82_570 | 125 |
| 565 | 3300039438 | Ga0436360_0289570 | Ga0436360_0289570_160_648 | 125 |
| 566 | 3300039438 | Ga0436360_0510880 | Ga0436360_0510880_74_562 | 125 |
| 567 | 3300039438 | Ga0436360_0700499 | Ga0436360_0700499_49_537 | 125 |
| 568 | 3300039438 | Ga0436360_0722024 | Ga0436360_0722024_1326_1811 | 125 |
| 569 | 3300039438 | Ga0436360_0768310 | Ga0436360_0768310_503_991 | 125 |
| 570 | 3300039447 | Ga0436361_0208690 | Ga0436361_0208690_1440_1934 | 125 |
| 571 | 3300039447 | Ga0436361_0891828 | Ga0436361_0891828_179_667 | 125 |
| 572 | 3300039447 | Ga0436361_0974856 | Ga0436361_0974856_155_649 | 125 |
| 573 | 3300039450 | Ga0436363_0043667 | Ga0436363_0043667_160_648 | 125 |
| 574 | 3300039450 | Ga0436363_0848488 | Ga0436363_0848488_980_1465 | 125 |
| 575 | 3300039453 | Ga0436362_0337065 | Ga0436362_0337065_642_1130 | 125 |
| 576 | 3300039453 | Ga0436362_1145969 | Ga0436362_1145969_557_1051 | 125 |
| 577 | 3300041411 | Ga0439466_0220801 | Ga0439466_0220801_40_528 | 125 |
| 578 | 3300041413 | Ga0439465_0182860 | Ga0439465_0182860_40_528 | 125 |
| 579 | 3300041512 | Ga0451853_2582518 | Ga0451853_2582518_113_607 | 125 |
| 580 | 3300042461 | Ga0439460_0247836 | Ga0439460_0247836_23_511 | 125 |
| 581 | 3300044684 | Ga0466966_0158171 | Ga0466966_0158171_342_836 | 125 |
| 582 | 3300044694 | Ga0466963_0317275 | Ga0466963_0317275_344_832 | 125 |
| 583 | 3300044694 | Ga0466963_0855021 | Ga0466963_0855021_32_520 | 125 |
| 584 | 3300044706 | Ga0466964_0268438 | Ga0466964_0268438_139_627 | 125 |
| 585 | 3300044842 | Ga0466957_0078717 | Ga0466957_0078717_73_561 | 125 |
| 586 | 3300044842 | Ga0466957_0235959 | Ga0466957_0235959_688_1176 | 125 |
| 587 | 3300044842 | Ga0466957_0809692 | Ga0466957_0809692_131_619 | 125 |
| 588 | 3300045051 | Ga0451576_1782262 | Ga0451576_1782262_27_515 | 125 |
| 589 | 3300045836 | Ga0466958_0026210 | Ga0466958_0026210_402_890 | 125 |
| 590 | 3300045836 | Ga0466958_0295754 | Ga0466958_0295754_82_570 | 125 |
| 591 | 3300045836 | Ga0466958_0718263 | Ga0466958_0718263_41_535 | 125 |
| 592 | 3300046453 | Ga0495627_058172 | Ga0495627_058172_516_1004 | 125 |
| 593 | 3300046454 | Ga0495592_0561332 | Ga0495592_0561332_14_502 | 125 |
| 594 | 3300046455 | Ga0495603_0099964 | Ga0495603_0099964_411_899 | 125 |
| 595 | 3300046457 | Ga0495590_0136758 | Ga0495590_0136758_118_606 | 125 |
| 596 | 3300046459 | Ga0495629_0068181 | Ga0495629_0068181_597_1085 | 125 |
| 597 | 3300046460 | Ga0495638_0000018 | Ga0495638_0000018_285040_285525 | 125 |
| 598 | 3300046460 | Ga0495638_0013078 | Ga0495638_0013078_330_818 | 125 |
| 599 | 3300046461 | Ga0495641_0076951 | Ga0495641_0076951_890_1378 | 125 |
| 600 | 3300046462 | Ga0495651_0104502 | Ga0495651_0104502_1052_1546 | 125 |
| 601 | 3300046463 | Ga0495653_0720274 | Ga0495653_0720274_46_534 | 125 |
| 602 | 3300046471 | Ga0495650_0004591 | Ga0495650_0004591_7008_7493 | 125 |
| 603 | 3300046476 | Ga0495662_0264893 | Ga0495662_0264893_308_796 | 125 |
| 604 | 3300046491 | Ga0495584_0133858 | Ga0495584_0133858_746_1234 | 125 |
| 605 | 3300046492 | Ga0495585_0053054 | Ga0495585_0053054_1367_1852 | 125 |
| 606 | 3300046501 | Ga0495607_0475942 | Ga0495607_0475942_36_524 | 125 |
| 607 | 3300046513 | Ga0495616_0124137 | Ga0495616_0124137_615_1103 | 125 |
| 608 | 3300046515 | Ga0495620_0090829 | Ga0495620_0090829_525_1013 | 125 |
| 609 | 3300046519 | Ga0495632_0000049 | Ga0495632_0000049_3525_4010 | 125 |
| 610 | 3300046519 | Ga0495632_0008303 | Ga0495632_0008303_59_547 | 125 |
| 611 | 3300046520 | Ga0495637_0003069 | Ga0495637_0003069_3494_3979 | 125 |
| 612 | 3300046522 | Ga0495643_0000061 | Ga0495643_0000061_18031_18516 | 125 |
| 613 | 3300046522 | Ga0495643_0011319 | Ga0495643_0011319_2016_2501 | 125 |
| 614 | 3300046523 | Ga0495644_0192941 | Ga0495644_0192941_200_688 | 125 |
| 615 | 3300046524 | Ga0495648_0001815 | Ga0495648_0001815_2523_3008 | 125 |
| 616 | 3300046525 | Ga0495663_0000009 | Ga0495663_0000009_59165_59650 | 125 |
| 617 | 3300046529 | Ga0495652_0389848 | Ga0495652_0389848_56_544 | 125 |
| 618 | 3300046533 | Ga0495640_0119778 | Ga0495640_0119778_1143_1631 | 125 |
| 619 | 3300046536 | Ga0495587_0233734 | Ga0495587_0233734_207_695 | 125 |
| 620 | 3300046537 | Ga0495598_0023066 | Ga0495598_0023066_705_1193 | 125 |
| 621 | 3300046538 | Ga0495609_0129536 | Ga0495609_0129536_342_830 | 125 |
| 622 | 3300046558 | Ga0495633_0000264 | Ga0495633_0000264_58246_58731 | 125 |
| 623 | 3300046558 | Ga0495633_0000862 | Ga0495633_0000862_2599_3084 | 125 |
| 624 | 3300046558 | Ga0495633_0011582 | Ga0495633_0011582_2726_3211 | 125 |
| 625 | 3300046558 | Ga0495633_0042454 | Ga0495633_0042454_869_1354 | 125 |
| 626 | 3300046559 | Ga0495667_0129988 | Ga0495667_0129988_973_1467 | 125 |
| 627 | 3300046616 | Ga0495668_0300888 | Ga0495668_0300888_368_856 | 125 |
| 628 | 3300046642 | Ga0495634_0483307 | Ga0495634_0483307_12_500 | 125 |
| 629 | 3300046660 | Ga0495625_0000583 | Ga0495625_0000583_39505_39990 | 125 |
| 630 | 3300046660 | Ga0495625_0327018 | Ga0495625_0327018_13_501 | 125 |
| 631 | 3300046663 | Ga0495635_0627422 | Ga0495635_0627422_170_658 | 125 |
| 632 | 3300046665 | Ga0495661_0178253 | Ga0495661_0178253_207_695 | 125 |
| 633 | 3300046675 | Ga0495657_0085909 | Ga0495657_0085909_659_1153 | 125 |
| 634 | 3300046691 | Ga0495670_0002209 | Ga0495670_0002209_7344_7829 | 125 |
| 635 | 3300046692 | Ga0495671_0000011 | Ga0495671_0000011_347510_347995 | 125 |
| 636 | 3300046692 | Ga0495671_0000036 | Ga0495671_0000036_18031_18516 | 125 |
| 637 | 3300046694 | Ga0495649_0156476 | Ga0495649_0156476_545_1033 | 125 |
| 638 | 3300046794 | Ga0495589_0233741 | Ga0495589_0233741_194_682 | 125 |
| 639 | 3300046809 | Ga0495600_0028150 | Ga0495600_0028150_1532_2017 | 125 |
| 640 | 3300046810 | Ga0495660_0136192 | Ga0495660_0136192_286_774 | 125 |
| 641 | 3300047317 | Ga0495604_0479136 | Ga0495604_0479136_82_570 | 125 |
| 642 | 3300047321 | Ga0495676_0103330 | Ga0495676_0103330_359_853 | 125 |
| 643 | 3300047321 | Ga0495676_0365182 | Ga0495676_0365182_237_725 | 125 |
| 644 | 3300047322 | Ga0495680_0760628 | Ga0495680_0760628_10_498 | 125 |
| 645 | 3300047443 | Ga0495687_000224 | Ga0495687_000224_22756_23241 | 125 |
| 646 | 3300047469 | Ga0495673_0000088 | Ga0495673_0000088_186718_187203 | 125 |
| 647 | 3300047470 | Ga0495681_0014061 | Ga0495681_0014061_2651_3136 | 125 |
| 648 | 3300047471 | Ga0495684_0086184 | Ga0495684_0086184_720_1208 | 125 |
| 649 | 3300047472 | Ga0495686_0008764 | Ga0495686_0008764_727_1212 | 125 |
| 650 | 3300047472 | Ga0495686_0070254 | Ga0495686_0070254_1175_1663 | 125 |
| 651 | 3300048088 | Ga0495602_0109610 | Ga0495602_0109610_1074_1568 | 125 |
| 652 | 3300048088 | Ga0495602_0244915 | Ga0495602_0244915_582_1070 | 125 |
| 653 | 3300048091 | Ga0495626_0338852 | Ga0495626_0338852_53_541 | 125 |
| 654 | 3300048903 | Ga0496100_0035676 | Ga0496100_0035676_2330_2818 | 125 |
| 655 | 3300048903 | Ga0496100_0180625 | Ga0496100_0180625_254_742 | 125 |
| 656 | 3300048903 | Ga0496100_0223598 | Ga0496100_0223598_187_675 | 125 |
| 657 | 3300048903 | Ga0496100_0606847 | Ga0496100_0606847_85_579 | 125 |
| 658 | 3300048904 | Ga0496101_0009057 | Ga0496101_0009057_3046_3534 | 125 |
| 659 | 3300048904 | Ga0496101_0025933 | Ga0496101_0025933_1263_1751 | 125 |
| 660 | 3300048904 | Ga0496101_0038167 | Ga0496101_0038167_2447_2935 | 125 |
| 661 | 3300048904 | Ga0496101_0099473 | Ga0496101_0099473_448_936 | 125 |
| 662 | 3300048904 | Ga0496101_1216513 | Ga0496101_1216513_64_558 | 125 |
| 663 | 3300048905 | Ga0496102_0002315 | Ga0496102_0002315_8831_9319 | 125 |
| 664 | 3300048905 | Ga0496102_0018363 | Ga0496102_0018363_1998_2486 | 125 |
| 665 | 3300048905 | Ga0496102_0068148 | Ga0496102_0068148_1486_1971 | 125 |
| 666 | 3300048905 | Ga0496102_0088926 | Ga0496102_0088926_2334_2822 | 125 |
| 667 | 3300048905 | Ga0496102_0097500 | Ga0496102_0097500_256_747 | 125 |
| 668 | 3300048905 | Ga0496102_0301447 | Ga0496102_0301447_936_1424 | 125 |
| 669 | 3300048905 | Ga0496102_0996383 | Ga0496102_0996383_20_508 | 125 |
| 670 | 3300048906 | Ga0496103_0005448 | Ga0496103_0005448_919_1407 | 125 |
| 671 | 3300048906 | Ga0496103_0420569 | Ga0496103_0420569_173_664 | 125 |
| 672 | 3300048906 | Ga0496103_0548184 | Ga0496103_0548184_105_593 | 125 |
| 673 | 3300048907 | Ga0496104_0013577 | Ga0496104_0013577_3174_3662 | 125 |
| 674 | 3300048907 | Ga0496104_0017311 | Ga0496104_0017311_5727_6215 | 125 |
| 675 | 3300048907 | Ga0496104_0018021 | Ga0496104_0018021_927_1415 | 125 |
| 676 | 3300048907 | Ga0496104_0177350 | Ga0496104_0177350_802_1296 | 125 |
| 677 | 3300048907 | Ga0496104_0626938 | Ga0496104_0626938_163_651 | 125 |
| 678 | 3300048908 | Ga0496105_0010623 | Ga0496105_0010623_2889_3377 | 125 |
| 679 | 3300048908 | Ga0496105_0057105 | Ga0496105_0057105_2053_2541 | 125 |
| 680 | 3300048908 | Ga0496105_0068273 | Ga0496105_0068273_1548_2036 | 125 |
| 681 | 3300048908 | Ga0496105_0979838 | Ga0496105_0979838_40_534 | 125 |
| 682 | 3300048909 | Ga0496106_0003091 | Ga0496106_0003091_7291_7779 | 125 |
| 683 | 3300048909 | Ga0496106_0007079 | Ga0496106_0007079_2761_3249 | 125 |
| 684 | 3300048909 | Ga0496106_0021813 | Ga0496106_0021813_2642_3130 | 125 |
| 685 | 3300048909 | Ga0496106_0040065 | Ga0496106_0040065_2577_3065 | 125 |
| 686 | 3300048910 | Ga0496107_0004660 | Ga0496107_0004660_3023_3511 | 125 |
| 687 | 3300048910 | Ga0496107_0011907 | Ga0496107_0011907_2926_3414 | 125 |
| 688 | 3300048910 | Ga0496107_0046850 | Ga0496107_0046850_2486_2974 | 125 |
| 689 | 3300048910 | Ga0496107_0103468 | Ga0496107_0103468_599_1087 | 125 |
| 690 | 3300048911 | Ga0496108_0013809 | Ga0496108_0013809_5049_5537 | 125 |
| 691 | 3300048911 | Ga0496108_0025155 | Ga0496108_0025155_3495_3983 | 125 |
| 692 | 3300048911 | Ga0496108_0034366 | Ga0496108_0034366_1924_2412 | 125 |
| 693 | 3300048911 | Ga0496108_0119130 | Ga0496108_0119130_776_1264 | 125 |
| 694 | 3300048911 | Ga0496108_0132772 | Ga0496108_0132772_1110_1595 | 125 |
| 695 | 3300048911 | Ga0496108_0156716 | Ga0496108_0156716_701_1189 | 125 |
| 696 | 3300048911 | Ga0496108_0179741 | Ga0496108_0179741_873_1367 | 125 |
| 697 | 3300048911 | Ga0496108_0181726 | Ga0496108_0181726_411_896 | 125 |
| 698 | 3300048911 | Ga0496108_1683940 | Ga0496108_1683940_22_510 | 125 |
| 699 | 3300048912 | Ga0496109_0005494 | Ga0496109_0005494_1762_2250 | 125 |
| 700 | 3300048912 | Ga0496109_0014810 | Ga0496109_0014810_3410_3898 | 125 |
| 701 | 3300048912 | Ga0496109_0016058 | Ga0496109_0016058_1140_1628 | 125 |
| 702 | 3300048912 | Ga0496109_0056139 | Ga0496109_0056139_2457_2945 | 125 |
| 703 | 3300048912 | Ga0496109_0214301 | Ga0496109_0214301_1016_1504 | 125 |
| 704 | 3300048912 | Ga0496109_0944506 | Ga0496109_0944506_19_534 | 125 |
| 705 | 3300048913 | Ga0496110_0028061 | Ga0496110_0028061_663_1151 | 125 |
| 706 | 3300048913 | Ga0496110_0030497 | Ga0496110_0030497_1178_1663 | 125 |
| 707 | 3300048913 | Ga0496110_0043503 | Ga0496110_0043503_1000_1488 | 125 |
| 708 | 3300048913 | Ga0496110_0045137 | Ga0496110_0045137_2363_2851 | 125 |
| 709 | 3300048913 | Ga0496110_0057057 | Ga0496110_0057057_1400_1894 | 125 |
| 710 | 3300048913 | Ga0496110_0326120 | Ga0496110_0326120_17_505 | 125 |
| 711 | 3300048913 | Ga0496110_0503692 | Ga0496110_0503692_511_999 | 125 |
| 712 | 3300048914 | Ga0496111_0000494 | Ga0496111_0000494_16770_17258 | 125 |
| 713 | 3300048914 | Ga0496111_0078615 | Ga0496111_0078615_599_1087 | 125 |
| 714 | 3300048914 | Ga0496111_0346461 | Ga0496111_0346461_90_578 | 125 |
| 715 | 3300048915 | Ga0496112_0004889 | Ga0496112_0004889_10752_11240 | 125 |
| 716 | 3300048915 | Ga0496112_0005811 | Ga0496112_0005811_76_570 | 125 |
| 717 | 3300048915 | Ga0496112_0018775 | Ga0496112_0018775_5811_6299 | 125 |
| 718 | 3300048915 | Ga0496112_0042754 | Ga0496112_0042754_926_1414 | 125 |
| 719 | 3300048915 | Ga0496112_0047785 | Ga0496112_0047785_2808_3296 | 125 |
| 720 | 3300048915 | Ga0496112_0499660 | Ga0496112_0499660_325_813 | 125 |
| 721 | 3300048916 | Ga0496113_0000564 | Ga0496113_0000564_16884_17372 | 125 |
| 722 | 3300048916 | Ga0496113_0004958 | Ga0496113_0004958_3462_3950 | 125 |
| 723 | 3300048916 | Ga0496113_0014413 | Ga0496113_0014413_2698_3186 | 125 |
| 724 | 3300048916 | Ga0496113_0029541 | Ga0496113_0029541_1078_1566 | 125 |
| 725 | 3300048917 | Ga0496114_0062341 | Ga0496114_0062341_1052_1540 | 125 |
| 726 | 3300048917 | Ga0496114_0100809 | Ga0496114_0100809_30_518 | 125 |
| 727 | 3300048917 | Ga0496114_0373693 | Ga0496114_0373693_237_731 | 125 |
| 728 | 3300048917 | Ga0496114_1026726 | Ga0496114_1026726_10_498 | 125 |
| 729 | 3300048918 | Ga0496115_0005148 | Ga0496115_0005148_980_1468 | 125 |
| 730 | 3300048918 | Ga0496115_0019809 | Ga0496115_0019809_1773_2261 | 125 |
| 731 | 3300048918 | Ga0496115_0021939 | Ga0496115_0021939_335_829 | 125 |
| 732 | 3300048921 | Ga0496118_0091571 | Ga0496118_0091571_115_600 | 125 |
| 733 | 3300048922 | Ga0496119_0000289 | Ga0496119_0000289_23989_24477 | 125 |
| 734 | 3300048924 | Ga0496121_0017735 | Ga0496121_0017735_3313_3798 | 125 |
| 735 | 3300048925 | Ga0496122_0009638 | Ga0496122_0009638_6661_7149 | 125 |
| 736 | 3300048925 | Ga0496122_0076669 | Ga0496122_0076669_1648_2133 | 125 |
| 737 | 3300048925 | Ga0496122_0138127 | Ga0496122_0138127_488_976 | 125 |
| 738 | 3300048926 | Ga0496123_0013341 | Ga0496123_0013341_1931_2419 | 125 |
| 739 | 3300048927 | Ga0496124_0083993 | Ga0496124_0083993_548_1039 | 125 |
| 740 | 3300048927 | Ga0496124_0148948 | Ga0496124_0148948_1196_1681 | 125 |
| 741 | 3300048928 | Ga0496125_0002768 | Ga0496125_0002768_4168_4653 | 125 |
| 742 | 3300048928 | Ga0496125_0049956 | Ga0496125_0049956_1427_1912 | 125 |
| 743 | 3300048929 | Ga0496126_0003507 | Ga0496126_0003507_7686_8174 | 125 |
| 744 | 3300048929 | Ga0496126_0050477 | Ga0496126_0050477_2616_3101 | 125 |
| 745 | 3300049568 | Ga0501031_0027805 | Ga0501031_0027805_653_1141 | 125 |
| 746 | 3300049569 | Ga0501032_0009941 | Ga0501032_0009941_4635_5123 | 125 |
| 747 | 3300049569 | Ga0501032_0022734 | Ga0501032_0022734_3727_4215 | 125 |
| 748 | 3300049569 | Ga0501032_0081002 | Ga0501032_0081002_754_1242 | 125 |
| 749 | 3300049570 | Ga0501033_0043064 | Ga0501033_0043064_2837_3325 | 125 |
| 750 | 3300049571 | Ga0501034_0000013 | Ga0501034_0000013_90482_90970 | 125 |
| 751 | 3300049571 | Ga0501034_0022049 | Ga0501034_0022049_80_568 | 125 |
| 752 | 3300049571 | Ga0501034_0056146 | Ga0501034_0056146_2803_3291 | 125 |
| 753 | 3300049571 | Ga0501034_0073901 | Ga0501034_0073901_1551_2042 | 125 |
| 754 | 3300049571 | Ga0501034_0086697 | Ga0501034_0086697_1955_2443 | 125 |
| 755 | 3300049571 | Ga0501034_0139124 | Ga0501034_0139124_451_945 | 125 |
| 756 | 3300049571 | Ga0501034_0276555 | Ga0501034_0276555_414_902 | 125 |
| 757 | 3300049571 | Ga0501034_0358334 | Ga0501034_0358334_413_901 | 125 |
| 758 | 3300049571 | Ga0501034_0439697 | Ga0501034_0439697_457_984 | 125 |
| 759 | 3300049571 | Ga0501034_0500931 | Ga0501034_0500931_597_1085 | 125 |
| 760 | 3300049572 | Ga0501036_0199757 | Ga0501036_0199757_1020_1508 | 125 |
| 761 | 3300049572 | Ga0501036_1029732 | Ga0501036_1029732_124_612 | 125 |
| 762 | 3300049573 | Ga0501037_0031279 | Ga0501037_0031279_350_838 | 125 |
| 763 | 3300049573 | Ga0501037_0215217 | Ga0501037_0215217_647_1135 | 125 |
| 764 | 3300049573 | Ga0501037_0448206 | Ga0501037_0448206_209_697 | 125 |
| 765 | 3300049574 | Ga0501038_0027985 | Ga0501038_0027985_4342_4830 | 125 |
| 766 | 3300049574 | Ga0501038_0067518 | Ga0501038_0067518_130_618 | 125 |
| 767 | 3300049574 | Ga0501038_0303037 | Ga0501038_0303037_651_1139 | 125 |
| 768 | 3300049575 | Ga0501039_0016701 | Ga0501039_0016701_4211_4699 | 125 |
| 769 | 3300049575 | Ga0501039_1052149 | Ga0501039_1052149_25_513 | 125 |
| 770 | 3300049576 | Ga0501040_0497323 | Ga0501040_0497323_111_599 | 125 |
| 771 | 3300049576 | Ga0501040_0632286 | Ga0501040_0632286_51_539 | 125 |
| 772 | 3300049577 | Ga0501041_0074735 | Ga0501041_0074735_857_1345 | 125 |
| 773 | 3300049578 | Ga0501042_0880278 | Ga0501042_0880278_61_549 | 125 |
| 774 | 3300049579 | Ga0501043_0043209 | Ga0501043_0043209_38_526 | 125 |
| 775 | 3300049580 | Ga0501046_0000592 | Ga0501046_0000592_23193_23681 | 125 |
| 776 | 3300049580 | Ga0501046_0001115 | Ga0501046_0001115_12850_13338 | 125 |
| 777 | 3300049580 | Ga0501046_0003713 | Ga0501046_0003713_13094_13582 | 125 |
| 778 | 3300049581 | Ga0501047_0000290 | Ga0501047_0000290_17011_17499 | 125 |
| 779 | 3300049581 | Ga0501047_0106810 | Ga0501047_0106810_2037_2525 | 125 |
| 780 | 3300049581 | Ga0501047_0177055 | Ga0501047_0177055_1225_1713 | 125 |
| 781 | 3300049581 | Ga0501047_0464977 | Ga0501047_0464977_490_984 | 125 |
| 782 | 3300049581 | Ga0501047_0522900 | Ga0501047_0522900_128_616 | 125 |
| 783 | 3300049581 | Ga0501047_0556999 | Ga0501047_0556999_437_925 | 125 |
| 784 | 3300049582 | Ga0501048_0031001 | Ga0501048_0031001_2668_3159 | 125 |
| 785 | 3300049582 | Ga0501048_0374745 | Ga0501048_0374745_427_915 | 125 |
| 786 | 3300049582 | Ga0501048_0422287 | Ga0501048_0422287_313_801 | 125 |
| 787 | 3300049582 | Ga0501048_0572248 | Ga0501048_0572248_183_677 | 125 |
| 788 | 3300049583 | Ga0501067_0000905 | Ga0501067_0000905_10736_11224 | 125 |
| 789 | 3300049583 | Ga0501067_0001682 | Ga0501067_0001682_2077_2565 | 125 |
| 790 | 3300049583 | Ga0501067_0011601 | Ga0501067_0011601_2134_2622 | 125 |
| 791 | 3300049583 | Ga0501067_0038503 | Ga0501067_0038503_12_500 | 125 |
| 792 | 3300049583 | Ga0501067_0311226 | Ga0501067_0311226_209_697 | 125 |
| 793 | 3300049583 | Ga0501067_0395251 | Ga0501067_0395251_69_557 | 125 |
| 794 | 3300049584 | Ga0501068_0217536 | Ga0501068_0217536_654_1142 | 125 |
| 795 | 3300049584 | Ga0501068_0572046 | Ga0501068_0572046_178_666 | 125 |
| 796 | 3300049585 | Ga0501069_0058754 | Ga0501069_0058754_1395_1883 | 125 |
| 797 | 3300049586 | Ga0501070_0006581 | Ga0501070_0006581_1830_2318 | 125 |
| 798 | 3300049586 | Ga0501070_0018455 | Ga0501070_0018455_2388_2876 | 125 |
| 799 | 3300049586 | Ga0501070_0159733 | Ga0501070_0159733_245_739 | 125 |
| 800 | 3300049586 | Ga0501070_0251047 | Ga0501070_0251047_68_556 | 125 |
| 801 | 3300049586 | Ga0501070_0360258 | Ga0501070_0360258_137_640 | 125 |
| 802 | 3300049586 | Ga0501070_0519848 | Ga0501070_0519848_62_550 | 125 |
| 803 | 3300049586 | Ga0501070_0739244 | Ga0501070_0739244_181_669 | 125 |
| 804 | 3300049587 | Ga0501071_0088372 | Ga0501071_0088372_1248_1736 | 125 |
| 805 | 3300049588 | Ga0501072_0175643 | Ga0501072_0175643_982_1485 | 125 |
| 806 | 3300049588 | Ga0501072_0195973 | Ga0501072_0195973_418_906 | 125 |
| 807 | 3300049589 | Ga0501073_0030029 | Ga0501073_0030029_3100_3588 | 125 |
| 808 | 3300049589 | Ga0501073_0038480 | Ga0501073_0038480_598_1086 | 125 |
| 809 | 3300049589 | Ga0501073_0041744 | Ga0501073_0041744_559_1047 | 125 |
| 810 | 3300049589 | Ga0501073_0111206 | Ga0501073_0111206_468_956 | 125 |
| 811 | 3300049589 | Ga0501073_0397629 | Ga0501073_0397629_265_753 | 125 |
| 812 | 3300049590 | Ga0501074_0283913 | Ga0501074_0283913_606_1094 | 125 |
| 813 | 3300049590 | Ga0501074_0438352 | Ga0501074_0438352_190_678 | 125 |
| 814 | 3300049591 | Ga0501075_0218519 | Ga0501075_0218519_633_1121 | 125 |
| 815 | 3300049591 | Ga0501075_0395782 | Ga0501075_0395782_372_860 | 125 |
| 816 | 3300049592 | Ga0501076_0122692 | Ga0501076_0122692_163_651 | 125 |
| 817 | 3300049592 | Ga0501076_0216193 | Ga0501076_0216193_391_879 | 125 |
| 818 | 3300049592 | Ga0501076_0285055 | Ga0501076_0285055_340_828 | 125 |
| 819 | 3300049592 | Ga0501076_0351930 | Ga0501076_0351930_68_574 | 125 |
| 820 | 3300049593 | Ga0501077_0163160 | Ga0501077_0163160_688_1176 | 125 |
| 821 | 3300049663 | Ga0501223_001272 | Ga0501223_001272_3656_4141 | 125 |
| 822 | 3300049705 | Ga0501225_0001724 | Ga0501225_0001724_2914_3399 | 125 |
| 823 | 3300049741 | Ga0501079_0289942 | Ga0501079_0289942_666_1154 | 125 |
| 824 | 3300049741 | Ga0501079_0474767 | Ga0501079_0474767_48_536 | 125 |
| 825 | 3300049742 | Ga0501080_0000003 | Ga0501080_0000003_82989_83477 | 125 |
| 826 | 3300049742 | Ga0501080_0027908 | Ga0501080_0027908_163_651 | 125 |
| 827 | 3300049742 | Ga0501080_0040117 | Ga0501080_0040117_1700_2194 | 125 |
| 828 | 3300049742 | Ga0501080_0132656 | Ga0501080_0132656_815_1303 | 125 |
| 829 | 3300049742 | Ga0501080_0486532 | Ga0501080_0486532_60_566 | 125 |
| 830 | 3300049742 | Ga0501080_0504464 | Ga0501080_0504464_75_563 | 125 |
| 831 | 3300049742 | Ga0501080_0645869 | Ga0501080_0645869_431_919 | 125 |
| 832 | 3300049743 | Ga0501081_0020121 | Ga0501081_0020121_3454_3942 | 125 |
| 833 | 3300049743 | Ga0501081_0280779 | Ga0501081_0280779_336_830 | 125 |
| 834 | 3300049744 | Ga0501083_0022378 | Ga0501083_0022378_3606_4094 | 125 |
| 835 | 3300049744 | Ga0501083_0124156 | Ga0501083_0124156_838_1326 | 125 |
| 836 | 3300049744 | Ga0501083_0183606 | Ga0501083_0183606_711_1199 | 125 |
| 837 | 3300049744 | Ga0501083_0558867 | Ga0501083_0558867_113_601 | 125 |
| 838 | 3300049822 | Ga0501035_0000384 | Ga0501035_0000384_34413_34901 | 125 |
| 839 | 3300049822 | Ga0501035_0084267 | Ga0501035_0084267_62_550 | 125 |
| 840 | 3300049822 | Ga0501035_0918629 | Ga0501035_0918629_117_602 | 125 |
| 841 | 3300049823 | Ga0501044_0000570 | Ga0501044_0000570_32394_32882 | 125 |
| 842 | 3300049823 | Ga0501044_0025210 | Ga0501044_0025210_2999_3487 | 125 |
| 843 | 3300049823 | Ga0501044_0031555 | Ga0501044_0031555_3351_3839 | 125 |
| 844 | 3300049823 | Ga0501044_0035407 | Ga0501044_0035407_2088_2576 | 125 |
| 845 | 3300049823 | Ga0501044_0152904 | Ga0501044_0152904_96_590 | 125 |
| 846 | 3300049823 | Ga0501044_0289359 | Ga0501044_0289359_388_876 | 125 |
| 847 | 3300049823 | Ga0501044_0535068 | Ga0501044_0535068_420_905 | 125 |
| 848 | 3300049824 | Ga0501045_0548708 | Ga0501045_0548708_300_788 | 125 |
| 849 | 3300049824 | Ga0501045_0882223 | Ga0501045_0882223_101_589 | 125 |
| 850 | 3300050489 | nmdc:mga03683_108270_c1 | nmdc:mga03683_108270_c1_531_1019 | 125 |
| 851 | 3300050489 | nmdc:mga03683_40402_c1 | nmdc:mga03683_40402_c1_792_1280 | 125 |
| 852 | 3300050489 | nmdc:mga03683_73469_c1 | nmdc:mga03683_73469_c1_955_1455 | 125 |
| 853 | 3300050491 | nmdc:mga00v17_41449_c1 | nmdc:mga00v17_41449_c1_958_1446 | 125 |
| 854 | 3300050491 | nmdc:mga00v17_805241_c1 | nmdc:mga00v17_805241_c1_98_586 | 125 |
| 855 | 3300050492 | nmdc:mga0yw44_21491_c1 | nmdc:mga0yw44_21491_c1_2473_2961 | 125 |
| 856 | 3300050492 | nmdc:mga0yw44_217329_c1 | nmdc:mga0yw44_217329_c1_360_848 | 125 |
| 857 | 3300050492 | nmdc:mga0yw44_5612_c1 | nmdc:mga0yw44_5612_c1_1722_2210 | 125 |
| 858 | 3300050492 | nmdc:mga0yw44_95785_c1 | nmdc:mga0yw44_95785_c1_408_896 | 125 |
| 859 | 3300050494 | nmdc:mga06z11_115394_c1 | nmdc:mga06z11_115394_c1_714_1202 | 125 |
| 860 | 3300050494 | nmdc:mga06z11_25_c1 | nmdc:mga06z11_25_c1_29195_29680 | 125 |
| 861 | 3300050494 | nmdc:mga06z11_489065_c1 | nmdc:mga06z11_489065_c1_18_503 | 125 |
| 862 | 3300050507 | nmdc:mga05p37_17127_c1 | nmdc:mga05p37_17127_c1_5713_6201 | 125 |
| 863 | 3300050507 | nmdc:mga05p37_239692_c1 | nmdc:mga05p37_239692_c1_753_1241 | 125 |
| 864 | 3300050507 | nmdc:mga05p37_88120_c1 | nmdc:mga05p37_88120_c1_3110_3598 | 125 |
| 865 | 3300050508 | nmdc:mga09592_297517_c1 | nmdc:mga09592_297517_c1_335_823 | 125 |
| 866 | 3300050510 | nmdc:mga06r32_130904_c1 | nmdc:mga06r32_130904_c1_17_505 | 125 |
| 867 | 3300050510 | nmdc:mga06r32_4388_c1 | nmdc:mga06r32_4388_c1_6446_6976 | 125 |
| 868 | 3300050510 | nmdc:mga06r32_761788_c1 | nmdc:mga06r32_761788_c1_79_567 | 125 |
| 869 | 3300050511 | nmdc:mga08y16_479610_c1 | nmdc:mga08y16_479610_c1_246_734 | 125 |
| 870 | 3300050512 | nmdc:mga0n895_103401_c1 | nmdc:mga0n895_103401_c1_1354_1842 | 125 |
| 871 | 3300050512 | nmdc:mga0n895_144251_c1 | nmdc:mga0n895_144251_c1_528_1016 | 125 |
| 872 | 3300050512 | nmdc:mga0n895_364655_c1 | nmdc:mga0n895_364655_c1_118_636 | 125 |
| 873 | 3300050512 | nmdc:mga0n895_581178_c1 | nmdc:mga0n895_581178_c1_150_638 | 125 |
| 874 | 3300050512 | nmdc:mga0n895_72373_c2 | nmdc:mga0n895_72373_c2_91_579 | 125 |
| 875 | 3300050513 | nmdc:mga0rr50_114657_c1 | nmdc:mga0rr50_114657_c1_1339_1833 | 125 |
| 876 | 3300050513 | nmdc:mga0rr50_1525825_c1 | nmdc:mga0rr50_1525825_c1_39_527 | 125 |
| 877 | 3300050513 | nmdc:mga0rr50_771632_c1 | nmdc:mga0rr50_771632_c1_276_764 | 125 |
| 878 | 3300050514 | nmdc:mga08x19_236991_c1 | nmdc:mga08x19_236991_c1_205_723 | 125 |
| 879 | 3300050515 | nmdc:mga0a205_171087_c1 | nmdc:mga0a205_171087_c1_678_1166 | 125 |
| 880 | 3300050515 | nmdc:mga0a205_21217_c1 | nmdc:mga0a205_21217_c1_4718_5206 | 125 |
| 881 | 3300050515 | nmdc:mga0a205_265388_c1 | nmdc:mga0a205_265388_c1_643_1131 | 125 |
| 882 | 3300050515 | nmdc:mga0a205_53061_c1 | nmdc:mga0a205_53061_c1_1711_2199 | 125 |
| 883 | 3300053077 | Ga0495601_0044662 | Ga0495601_0044662_948_1436 | 125 |
| 884 | 3300053077 | Ga0495601_0685312 | Ga0495601_0685312_131_625 | 125 |
| 885 | 3300053078 | Ga0495612_0055835 | Ga0495612_0055835_135_629 | 125 |
| 886 | 3300053080 | Ga0500635_0053863 | Ga0500635_0053863_729_1217 | 125 |
| 887 | 3300053083 | Ga0495655_0032310 | Ga0495655_0032310_94_582 | 125 |
| 888 | 3300053084 | Ga0495595_0028737 | Ga0495595_0028737_1629_2123 | 125 |
| 889 | 3300053084 | Ga0495595_0094409 | Ga0495595_0094409_733_1221 | 125 |
| 890 | 3300053085 | Ga0495619_0104291 | Ga0495619_0104291_1164_1652 | 125 |
| 891 | 3300053085 | Ga0495619_0120672 | Ga0495619_0120672_208_702 | 125 |
| 892 | 3300053085 | Ga0495619_0137487 | Ga0495619_0137487_1098_1586 | 125 |
| 893 | 3300053087 | Ga0500643_042874 | Ga0500643_042874_441_926 | 125 |
| 894 | 3300053094 | Ga0500566_0019670 | Ga0500566_0019670_26_514 | 125 |
| 895 | 3300053103 | Ga0500555_052461 | Ga0500555_052461_441_929 | 125 |
| 896 | 3300053104 | Ga0500556_0000009 | Ga0500556_0000009_39170_39658 | 125 |
| 897 | 3300053111 | Ga0500572_002705 | Ga0500572_002705_3631_4119 | 125 |
| 898 | 3300053119 | Ga0500595_013801 | Ga0500595_013801_1992_2477 | 125 |
| 899 | 3300053122 | Ga0500608_009850 | Ga0500608_009850_71_559 | 125 |
| 900 | 3300053123 | Ga0500614_177525 | Ga0500614_177525_118_606 | 125 |
| 901 | 3300053131 | Ga0500652_063656 | Ga0500652_063656_579_1067 | 125 |
| 902 | 3300053140 | Ga0500573_0001876 | Ga0500573_0001876_1887_2372 | 125 |
| 903 | 3300053153 | Ga0500616_0041627 | Ga0500616_0041627_935_1429 | 125 |
| 904 | 3300053153 | Ga0500616_0068808 | Ga0500616_0068808_753_1244 | 125 |
| 905 | 3300053157 | Ga0500624_000049 | Ga0500624_000049_58717_59202 | 125 |
| 906 | 3300053158 | Ga0500627_0049624 | Ga0500627_0049624_758_1243 | 125 |
| 907 | 3300053159 | Ga0500630_025728 | Ga0500630_025728_2356_2844 | 125 |
| 908 | 3300053163 | Ga0500639_001271 | Ga0500639_001271_85_573 | 125 |
| 909 | 3300053177 | Ga0500636_0030741 | Ga0500636_0030741_1801_2286 | 125 |
| 910 | 3300053730 | Ga0500645_024129 | Ga0500645_024129_87_575 | 125 |
| 911 | 3300053730 | Ga0500645_054489 | Ga0500645_054489_62_550 | 125 |
| 912 | 3300054114 | Ga0501084_0008472 | Ga0501084_0008472_2613_3101 | 125 |
| 913 | 3300054114 | Ga0501084_0222497 | Ga0501084_0222497_575_1063 | 125 |
| 914 | 3300054114 | Ga0501084_0387471 | Ga0501084_0387471_520_1008 | 125 |
| 915 | 3300054114 | Ga0501084_0483026 | Ga0501084_0483026_64_552 | 125 |
| 916 | 3300054114 | Ga0501084_0605467 | Ga0501084_0605467_224_712 | 125 |
| 917 | 3300054114 | Ga0501084_1188474 | Ga0501084_1188474_130_621 | 125 |
| 918 | 3300054114 | Ga0501084_1273046 | Ga0501084_1273046_22_507 | 125 |
| 919 | 3300060353 | Ga0501082_0022108 | Ga0501082_0022108_4832_5320 | 125 |
| 920 | 3300060353 | Ga0501082_0025530 | Ga0501082_0025530_976_1464 | 125 |
| 921 | 3300060353 | Ga0501082_0062191 | Ga0501082_0062191_1416_1904 | 125 |
| 922 | 3300060353 | Ga0501082_0168253 | Ga0501082_0168253_1229_1720 | 125 |
| 923 | 3300060353 | Ga0501082_0192668 | Ga0501082_0192668_36_524 | 125 |
| 924 | 3300060353 | Ga0501082_1012158 | Ga0501082_1012158_152_640 | 125 |
| 925 | 3300060353 | Ga0501082_1055990 | Ga0501082_1055990_118_606 | 125 |
| 926 | 3300061734 | Ga0530510_0088348 | Ga0530510_0088348_1548_2036 | 125 |
| 927 | 3300061734 | Ga0530510_0112336 | Ga0530510_0112336_954_1442 | 125 |
| 928 | 3300061734 | Ga0530510_0202283 | Ga0530510_0202283_177_665 | 125 |
| 929 | 3300061734 | Ga0530510_0248657 | Ga0530510_0248657_643_1131 | 125 |
| 930 | 3300061734 | Ga0530510_0391688 | Ga0530510_0391688_445_933 | 125 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar