F485644

General Info

Members Datasets Scaffolds Average Seq Length
917 483 842 422

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_0143841|Ga0436365_0143841_37_1512
Length 491
Sequence MSEPTGTRPFSRFEWMLSLRYLGARRKDGFISVIAIFSFIGIWLGVMTLIIVMAVMNGFRQELLTKILGLNGHLLIQPLEQPLTDFAAVADRISKVPGVKLAAPVVEGQALASSPFSSSGVLVRGWRGSDLAKLPSIADNLRQGTLEGFDEGQGVLIGRRLADQLTVHAGEPVTLVAPRGAVTPMGTMPRIKTYKVAGVFEIGMSEYDLGFVFMPLPEAQAYFNRAGDVTAIEVYVDNPDQIDFYRKAITDAAGRPIFIVDWRQRNATFFSALQVERNVMFLILTLIVLVAVLNIVSGLIMLVKDKGPDIGIMRTMGASQGSVMRIFLIDWRQRNRTFFGALQVERNVMFLILTLILVVAALNIISGLIMLVKDKGHDIAILRTMGATQGAVMRVFLIAGSSIGVLGTVAGFILGLLICMNVESIRQFLSWATGSHIFPEELYFLSHLPAEMDPAETIAVVVMALTLSFLATLYPSWRAARLDPVEALRYE

Samples

Sample ID Description Type Environment
1 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
2 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
3 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
4 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
5 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
6 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
7 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
8 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
9 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
10 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
11 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
12 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
13 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
14 2643221580 Devosia sp. Root635 Isolate Unclassified
15 2643221591 Devosia sp. Root685 Isolate Unclassified
16 2643221629 Devosia sp. Root105 Isolate Unclassified
17 2643221662 Devosia sp. Root413D1 Isolate Unclassified
18 2643221674 Devosia sp. Root436 Isolate Unclassified
19 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
20 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
21 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
22 2791355199
23 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
24 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
25 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
26 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
27 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
28 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
29 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
30 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
31 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
32 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
33 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
34 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
35 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
36 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
37 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
38 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
39 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
40 2902330777 Methylobacterium sp. 2A Isolate Unclassified
41 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
42 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
43 2904699407
44 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
45 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
46 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
47 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
48 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
49 2932401849 Devosia sp. 2618 Isolate Rhizosphere
50 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
51 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
52 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
53 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
54 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
55 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
56 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
57 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
58 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
59 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
60 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
61 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
62 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
63 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
64 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
66 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
67 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
68 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
70 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
71 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
72 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
73 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
74 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
75 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
76 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
77 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
78 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
79 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
80 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
81 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
82 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
83 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
84 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
85 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
86 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
87 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
88 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
89 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
90 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
91 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
92 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
93 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
94 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
95 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
96 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
97 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
98 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
99 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
100 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
101 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
102 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
103 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
104 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
105 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
106 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
107 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
108 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
109 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
110 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
111 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
112 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
113 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
114 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
115 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
116 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
117 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
118 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
119 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
120 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
121 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
122 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
123 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
124 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
125 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
126 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
127 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
128 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
129 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
130 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
131 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
132 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
133 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
134 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
135 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
136 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
137 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
138 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
139 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
140 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
141 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
142 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
143 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
144 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
145 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
146 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
147 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
148 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
149 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
150 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
151 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
152 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
153 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
154 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
155 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
156 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
157 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
158 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
159 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
160 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
161 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
162 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
163 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
164 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
165 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
166 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
167 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
168 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
169 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
170 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
171 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
172 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
173 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
174 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
175 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
176 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
177 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
178 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
179 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
180 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
181 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
182 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
183 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
184 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
186 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
187 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
188 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
189 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
246 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
247 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
251 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
252 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
253 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
254 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
256 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
257 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
258 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
259 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
260 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
261 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
262 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
263 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
264 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
265 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
266 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
267 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
268 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
269 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
270 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
271 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
272 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
273 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
274 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
275 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
276 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
277 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
278 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
279 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
280 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
281 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
282 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
283 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
284 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
285 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
286 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
287 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
288 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
289 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
290 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
291 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
292 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
293 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
294 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
295 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
296 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
297 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
298 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
299 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
300 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
301 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
302 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
303 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
304 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
305 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
306 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
307 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
308 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
309 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
310 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
311 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
312 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
313 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
314 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
315 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
316 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
317 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
318 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
319 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
320 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
321 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
322 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
323 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
324 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
325 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
326 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
327 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
328 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
329 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
330 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
331 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
332 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
333 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
334 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
335 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
336 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
337 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
338 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
339 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
340 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
341 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
342 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
343 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
344 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
345 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
346 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
347 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
348 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
349 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
350 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
351 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
352 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
353 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
354 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
355 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
356 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
357 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
358 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
359 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
360 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
361 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
362 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
363 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
364 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
365 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
366 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
367 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
368 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
369 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
370 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
371 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
372 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
373 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
374 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
375 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
376 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
377 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
378 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
379 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
380 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
381 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
382 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
383 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
384 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
385 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
386 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
387 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
388 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
389 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
390 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
391 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
392 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
393 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
394 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
395 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
396 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
397 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
398 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
399 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
400 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
401 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
402 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
403 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
404 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
405 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
406 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
407 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
408 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
409 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
410 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
411 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
412 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
413 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
414 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
415 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
416 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
417 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
418 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
419 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
420 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
421 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
422 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
423 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
424 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
425 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
426 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
427 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
428 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
429 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
430 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
431 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
432 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
433 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
434 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
435 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
436 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
437 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
438 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
439 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
440 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
441 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
442 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
443 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
444 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
445 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
446 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
447 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
448 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
449 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
450 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
451 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
452 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
453 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
454 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
455 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
456 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
457 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
458 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
459 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
460 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
461 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
462 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
463 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
464 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
465 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
466 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
467 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
468 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
469 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
470 641522639 Methylobacterium sp. 4-46 Isolate Nodule
471 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
472 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
473 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
474 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
475 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
476 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
477 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
478 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
479 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
480 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified
481 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
482 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
483 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.02
Metatranscriptomes 0.11
Isolates 7.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.29
Nodule 4.36
Rhizoplane 4.25
Rhizosphere 74.05
Stem 0
Stem Tuber 0
Unclassified 9.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1009646 3300001977 Bacteria 1439
2 JGI24743J22301_10001131 3300001991 Bacteria 3577
3 JGI24748J21848_1000838 3300002074 Bacteria 3324
4 JGI24744J21845_10000785 3300002077 Bacteria 5947
5 JGI25156J39149_1003138 3300002705 Bacteria 5562
6 JGI25406J46586_10005795 3300003203 Bacteria 5713
7 JGI25165J46597_1000003 3300003214 Bacteria 694080
8 rootH2_10023059 3300003320 Bacteria 2926
9 rootL2_10059231 3300003322 Bacteria 6339
10 JGI25405J52794_10009494 3300003911 Bacteria 1838
11 Ga0065165_1014273 3300005262 Bacteria 3094
12 Ga0070658_10000351 3300005327 Bacteria 39857
13 Ga0070658_10008885 3300005327 Bacteria 8076
14 Ga0070658_10175010 3300005327 Bacteria 1804
15 Ga0070676_10067725 3300005328 Bacteria 2135
16 Ga0070683_100177210 3300005329 Bacteria 2024
17 Ga0070690_100065156 3300005330 Bacteria 2355
18 Ga0070670_100032008 3300005331 Bacteria 4529
19 Ga0068869_100020011 3300005334 Bacteria 4584
20 Ga0068869_100226981 3300005334 Bacteria 1482
21 Ga0070680_100100240 3300005336 Bacteria 2404
22 Ga0068868_100059313 3300005338 Bacteria 3027
23 Ga0070660_100017700 3300005339 Bacteria 5196
24 Ga0070660_100023813 3300005339 Bacteria 4538
25 Ga0070660_100054928 3300005339 Bacteria 3076
26 Ga0070691_10000026 3300005341 Bacteria 40701
27 Ga0070687_100073037 3300005343 Bacteria 1848
28 Ga0070661_100001119 3300005344 Bacteria 18814
29 Ga0070692_10014598 3300005345 Bacteria 3695
30 Ga0070669_100033359 3300005353 Bacteria 3723
31 Ga0070675_100041650 3300005354 Bacteria 3751
32 Ga0070671_100002638 3300005355 Bacteria 13889
33 Ga0070671_100070267 3300005355 Bacteria 2921
34 Ga0070674_100010253 3300005356 Bacteria 5655
35 Ga0070659_100043240 3300005366 Bacteria 3523
36 Ga0070703_10032672 3300005406 Bacteria 1582
37 Ga0070709_10000310 3300005434 Bacteria 30908
38 Ga0070709_10000739 3300005434 Bacteria 18465
39 Ga0070709_10008569 3300005434 Bacteria 5620
40 Ga0070709_10040728 3300005434 Bacteria 2858
41 Ga0070714_100001250 3300005435 Bacteria 18349
42 Ga0070714_100012169 3300005435 Bacteria 6857
43 Ga0070713_100000008 3300005436 Bacteria 160153
44 Ga0070713_100000522 3300005436 Bacteria 24346
45 Ga0070713_100024863 3300005436 Bacteria 4674
46 Ga0070713_100127594 3300005436 Bacteria 2240
47 Ga0070713_100264608 3300005436 Bacteria 1572
48 Ga0070710_10000543 3300005437 Bacteria 17852
49 Ga0070710_10002534 3300005437 Bacteria 8671
50 Ga0070711_100001947 3300005439 Bacteria 11576
51 Ga0070711_100002225 3300005439 Bacteria 11000
52 Ga0070705_100009562 3300005440 Bacteria 4825
53 Ga0070694_100137370 3300005444 Bacteria 1772
54 Ga0070663_100017486 3300005455 Bacteria 4681
55 Ga0070663_100037815 3300005455 Bacteria 3362
56 Ga0070699_100035800 3300005518 Bacteria 4292
57 Ga0070679_100093559 3300005530 Bacteria 2993
58 Ga0070684_100158634 3300005535 Bacteria 2051
59 Ga0068853_100005373 3300005539 Bacteria 10031
60 Ga0068853_100006184 3300005539 Bacteria 9480
61 Ga0068853_100015125 3300005539 Bacteria 6344
62 Ga0068853_100080394 3300005539 Bacteria 2852
63 Ga0068853_100127873 3300005539 Bacteria 2271
64 Ga0070686_100006493 3300005544 Bacteria 6503
65 Ga0070665_100000377 3300005548 Bacteria 66234
66 Ga0070665_100012096 3300005548 Bacteria 8707
67 Ga0070665_100034898 3300005548 Bacteria 5060
68 Ga0070665_100065580 3300005548 Bacteria 3642
69 Ga0070665_100103296 3300005548 Bacteria 2853
70 Ga0068855_100013342 3300005563 Bacteria 9911
71 Ga0068855_100031633 3300005563 Bacteria 6318
72 Ga0068855_100142420 3300005563 Bacteria 2731
73 Ga0070664_100018970 3300005564 Bacteria 5655
74 Ga0070664_100156385 3300005564 Bacteria 2014
75 Ga0068857_100026875 3300005577 Bacteria 5075
76 Ga0068857_100069357 3300005577 Bacteria 3139
77 Ga0068854_100005459 3300005578 Bacteria 8031
78 Ga0068854_100088901 3300005578 Bacteria 2295
79 Ga0068856_100000362 3300005614 Bacteria 49802
80 Ga0068856_100000870 3300005614 Bacteria 32355
81 Ga0068856_100076616 3300005614 Bacteria 3313
82 Ga0070702_100047408 3300005615 Bacteria 2440
83 Ga0068852_100000075 3300005616 Bacteria 69379
84 Ga0068852_100023190 3300005616 Bacteria 4990
85 Ga0068852_100025004 3300005616 Bacteria 4833
86 Ga0068852_100032917 3300005616 Bacteria 4298
87 Ga0068852_100038546 3300005616 Bacteria 4017
88 Ga0068859_100149326 3300005617 Bacteria 2413
89 Ga0068864_100002778 3300005618 Bacteria 14462
90 Ga0068861_100047107 3300005719 Bacteria 3253
91 Ga0068851_10040291 3300005834 Bacteria 2348
92 Ga0068870_10001735 3300005840 Bacteria 8925
93 Ga0068863_100001004 3300005841 Bacteria 28270
94 Ga0068860_100000258 3300005843 Bacteria 77761
95 Ga0068860_100019841 3300005843 Bacteria 6519
96 Ga0068862_100040727 3300005844 Bacteria 3949
97 Ga0081455_10002974 3300005937 Bacteria 19816
98 Ga0081455_10007544 3300005937 Bacteria 11439
99 Ga0081455_10009585 3300005937 Bacteria 9946
100 Ga0081455_10010629 3300005937 Bacteria 9315
101 Ga0081455_10010846 3300005937 Bacteria 9202
102 Ga0081455_10030415 3300005937 Bacteria 4904
103 Ga0081455_10047855 3300005937 Bacteria 3699
104 Ga0081455_10117456 3300005937 Bacteria 2102
105 Ga0081538_10013903 3300005981 Bacteria 6342
106 Ga0081538_10040597 3300005981 Bacteria 2965
107 Ga0081540_1000194 3300005983 Bacteria 62934
108 Ga0081540_1001759 3300005983 Bacteria 18225
109 Ga0081540_1001861 3300005983 Bacteria 17661
110 Ga0081540_1004924 3300005983 Bacteria 10056
111 Ga0081540_1014066 3300005983 Bacteria 5156
112 Ga0081540_1034596 3300005983 Bacteria 2721
113 Ga0081539_10034606 3300005985 Bacteria 3051
114 Ga0070717_10000447 3300006028 Bacteria 26109
115 Ga0070717_10103218 3300006028 Bacteria 2424
116 Ga0075365_10053925 3300006038 Bacteria 2665
117 Ga0075365_10080968 3300006038 Bacteria 2199
118 Ga0075365_10163517 3300006038 Bacteria 1552
119 Ga0075365_10166393 3300006038 Bacteria 1538
120 Ga0075363_100000277 3300006048 Bacteria 14859
121 Ga0075364_10023673 3300006051 Bacteria 3890
122 Ga0075364_10077019 3300006051 Bacteria 2201
123 Ga0075432_10000765 3300006058 Bacteria 9994
124 Ga0070715_10001232 3300006163 Bacteria 7364
125 Ga0070716_100015222 3300006173 Bacteria 3948
126 Ga0070712_100000435 3300006175 Bacteria 23865
127 Ga0070712_100009926 3300006175 Bacteria 6002
128 Ga0070712_100013554 3300006175 Bacteria 5212
129 Ga0070712_100031189 3300006175 Bacteria 3589
130 Ga0070712_100069673 3300006175 Bacteria 2510
131 Ga0070712_100097845 3300006175 Bacteria 2163
132 Ga0075362_10003250 3300006177 Bacteria 5642
133 Ga0075362_10017502 3300006177 Bacteria 2953
134 Ga0075362_10033274 3300006177 Bacteria 2242
135 Ga0075362_10047352 3300006177 Bacteria 1915
136 Ga0075362_10071535 3300006177 Bacteria 1585
137 Ga0075367_10003094 3300006178 Bacteria 7816
138 Ga0075367_10003260 3300006178 Bacteria 7679
139 Ga0075369_10009418 3300006186 Bacteria 3793
140 Ga0075427_10000083 3300006194 Bacteria 7551
141 Ga0075366_10085159 3300006195 Bacteria 1890
142 Ga0075370_10002012 3300006353 Bacteria 9214
143 Ga0075370_10027740 3300006353 Bacteria 3144
144 Ga0068871_100013243 3300006358 Bacteria 6116
145 Ga0075428_100013683 3300006844 Bacteria 9033
146 Ga0075428_100016545 3300006844 Bacteria 8143
147 Ga0075428_100043912 3300006844 Bacteria 4913
148 Ga0075428_100061386 3300006844 Bacteria 4116
149 Ga0075430_100000026 3300006846 Bacteria 78833
150 Ga0075430_100120227 3300006846 Bacteria 2190
151 Ga0075431_100000451 3300006847 Bacteria 33773
152 Ga0075431_100001409 3300006847 Bacteria 22063
153 Ga0075431_100019078 3300006847 Bacteria 6986
154 Ga0075431_100168458 3300006847 Bacteria 2251
155 Ga0075431_100204815 3300006847 Bacteria 2017
156 Ga0075433_10002991 3300006852 Bacteria 12983
157 Ga0075434_100000110 3300006871 Bacteria 46873
158 Ga0075429_100000247 3300006880 Bacteria 37266
159 Ga0075429_100009412 3300006880 Bacteria 8482
160 Ga0068865_100005919 3300006881 Bacteria 7440
161 Ga0068865_100006113 3300006881 Bacteria 7342
162 Ga0075436_100000099 3300006914 Bacteria 51125
163 Ga0075435_100155992 3300007076 Bacteria 1921
164 Ga0099794_10003348 3300007265 Bacteria 6099
165 Ga0099794_10003823 3300007265 Bacteria 5816
166 Ga0099795_10020770 3300007788 Bacteria 2144
167 Ga0105251_10024950 3300009011 Bacteria 3064
168 Ga0105250_10027657 3300009092 Bacteria 2286
169 Ga0105240_10002582 3300009093 Bacteria 29015
170 Ga0105240_10013140 3300009093 Bacteria 11392
171 Ga0105240_10049609 3300009093 Bacteria 5297
172 Ga0105240_10080254 3300009093 Bacteria 4013
173 Ga0105240_10176069 3300009093 Bacteria 2529
174 Ga0111539_10011184 3300009094 Bacteria 11279
175 Ga0111539_10115103 3300009094 Bacteria 3154
176 Ga0105245_10018686 3300009098 Bacteria 6064
177 Ga0105245_10060256 3300009098 Bacteria 3418
178 Ga0105245_10092135 3300009098 Bacteria 2791
179 Ga0105247_10014924 3300009101 Bacteria 4656
180 Ga0105247_10016598 3300009101 Bacteria 4415
181 Ga0105247_10081824 3300009101 Bacteria 2037
182 Ga0114129_10004371 3300009147 Bacteria 19940
183 Ga0114129_10008830 3300009147 Bacteria 14378
184 Ga0114129_10016344 3300009147 Bacteria 10565
185 Ga0114129_10063995 3300009147 Bacteria 5133
186 Ga0114129_10385561 3300009147 Bacteria 1850
187 Ga0105243_10015059 3300009148 Bacteria 5853
188 Ga0105241_10040753 3300009174 Bacteria 3506
189 Ga0105241_10158401 3300009174 Bacteria 1859
190 Ga0105241_10255250 3300009174 Bacteria 1488
191 Ga0105237_10000821 3300009545 Bacteria 42486
192 Ga0105237_10015554 3300009545 Bacteria 7914
193 Ga0105237_10103646 3300009545 Bacteria 2837
194 Ga0105237_10351600 3300009545 Bacteria 1478
195 Ga0105238_10041357 3300009551 Bacteria 4668
196 Ga0105238_10087423 3300009551 Bacteria 3104
197 Ga0105238_10204252 3300009551 Bacteria 1952
198 Ga0105238_10215860 3300009551 Bacteria 1894
199 Ga0105238_10267093 3300009551 Bacteria 1691
200 Ga0099796_10008753 3300010159 Bacteria 2709
201 Ga0099796_10030027 3300010159 Bacteria 1759
202 Ga0105239_10073728 3300010375 Bacteria 3753
203 Ga0105239_10122337 3300010375 Bacteria 2891
204 Ga0105239_10150135 3300010375 Bacteria 2600
205 Ga0105239_10178740 3300010375 Bacteria 2374
206 Ga0105246_10014170 3300011119 Bacteria 5010
207 Ga0105246_10248344 3300011119 Bacteria 1411
208 Ga0157373_10153941 3300013100 Bacteria 1618
209 Ga0157371_10017806 3300013102 Bacteria 5268
210 Ga0157370_10015443 3300013104 Bacteria 7762
211 Ga0157370_10187418 3300013104 Bacteria 1920
212 Ga0157370_10247322 3300013104 Bacteria 1650
213 Ga0157370_10315583 3300013104 Bacteria 1442
214 Ga0157369_10022874 3300013105 Bacteria 6970
215 Ga0157378_10153594 3300013297 Bacteria 2146
216 Ga0157378_10231739 3300013297 Bacteria 1760
217 Ga0157372_10307561 3300013307 Bacteria 1844
218 Ga0157375_10349374 3300013308 Bacteria 1645
219 Ga0163163_10000491 3300014325 Bacteria 35805
220 Ga0163163_10034357 3300014325 Bacteria 4909
221 Ga0157380_10010728 3300014326 Bacteria 6602
222 Ga0157377_10014115 3300014745 Bacteria 4059
223 Ga0157379_10002383 3300014968 Bacteria 15713
224 Ga0157376_10192907 3300014969 Bacteria 1869
225 Ga0183363_1001 3300015690 Bacteria 611534
226 Ga0214544_1017682 3300021320 Bacteria 6272
227 Ga0214542_1018937 3300021321 Bacteria 5631
228 Ga0214545_1018591 3300021324 Bacteria 6270
229 Ga0214543_1017937 3300021327 Bacteria 6717
230 Ga0213873_10014678 3300021358 Bacteria 1740
231 Ga0213872_10015829 3300021361 Bacteria 3504
232 Ga0213876_10000908 3300021384 Bacteria 19682
233 Ga0213871_10003652 3300021441 Bacteria 2994
234 Ga0209233_1000015 3300025261 Bacteria 980563
235 Ga0209233_1000408 3300025261 Bacteria 34052
236 Ga0209455_1002034 3300025272 Bacteria 8225
237 Ga0209564_1000943 3300025295 Bacteria 37519
238 Ga0209758_1000808 3300025297 Bacteria 44084
239 Ga0209758_1001790 3300025297 Bacteria 23719
240 Ga0209758_1001948 3300025297 Bacteria 22345
241 Ga0209758_1008526 3300025297 Bacteria 6609
242 Ga0209256_1005139 3300025299 Bacteria 7734
243 Ga0207426_1003018 3300025302 Bacteria 9757
244 Ga0207653_10028725 3300025885 Bacteria 1790
245 Ga0207682_10001151 3300025893 Bacteria 12259
246 Ga0207692_10006382 3300025898 Bacteria 4781
247 Ga0207692_10020782 3300025898 Bacteria 2993
248 Ga0207710_10019075 3300025900 Bacteria 2924
249 Ga0207680_10085364 3300025903 Bacteria 1994
250 Ga0207685_10009223 3300025905 Bacteria 2856
251 Ga0207699_10000140 3300025906 Bacteria 48523
252 Ga0207699_10013924 3300025906 Bacteria 4131
253 Ga0207645_10014613 3300025907 Bacteria 5247
254 Ga0207643_10000431 3300025908 Bacteria 27730
255 Ga0207705_10000075 3300025909 Bacteria 123551
256 Ga0207705_10015279 3300025909 Bacteria 5512
257 Ga0207705_10016993 3300025909 Bacteria 5211
258 Ga0207654_10098316 3300025911 Bacteria 1798
259 Ga0207654_10115582 3300025911 Bacteria 1676
260 Ga0207695_10041879 3300025913 Bacteria 4898
261 Ga0207695_10106086 3300025913 Bacteria 2796
262 Ga0207695_10114018 3300025913 Bacteria 2679
263 Ga0207695_10136440 3300025913 Bacteria 2406
264 Ga0207695_10353832 3300025913 Bacteria 1355
265 Ga0207671_10000227 3300025914 Bacteria 84794
266 Ga0207671_10018286 3300025914 Bacteria 5380
267 Ga0207671_10198089 3300025914 Bacteria 1568
268 Ga0207693_10001130 3300025915 Bacteria 23920
269 Ga0207693_10003998 3300025915 Bacteria 12535
270 Ga0207693_10006061 3300025915 Bacteria 10015
271 Ga0207693_10010291 3300025915 Bacteria 7591
272 Ga0207693_10064897 3300025915 Bacteria 2860
273 Ga0207693_10075861 3300025915 Bacteria 2633
274 Ga0207663_10001749 3300025916 Bacteria 10222
275 Ga0207663_10002943 3300025916 Bacteria 8232
276 Ga0207663_10015808 3300025916 Bacteria 4172
277 Ga0207663_10088641 3300025916 Bacteria 2047
278 Ga0207657_10008772 3300025919 Bacteria 10235
279 Ga0207657_10017207 3300025919 Bacteria 6944
280 Ga0207657_10025197 3300025919 Bacteria 5489
281 Ga0207657_10025318 3300025919 Bacteria 5473
282 Ga0207657_10048737 3300025919 Bacteria 3697
283 Ga0207649_10046672 3300025920 Bacteria 2662
284 Ga0207646_10247524 3300025922 Bacteria 1610
285 Ga0207694_10021178 3300025924 Bacteria 4924
286 Ga0207694_10113051 3300025924 Bacteria 2161
287 Ga0207650_10019594 3300025925 Bacteria 4756
288 Ga0207650_10100874 3300025925 Bacteria 2221
289 Ga0207659_10155066 3300025926 Bacteria 1792
290 Ga0207687_10004916 3300025927 Bacteria 8875
291 Ga0207687_10247019 3300025927 Bacteria 1417
292 Ga0207700_10000011 3300025928 Bacteria 266323
293 Ga0207700_10000580 3300025928 Bacteria 21372
294 Ga0207700_10010413 3300025928 Bacteria 5867
295 Ga0207700_10024061 3300025928 Bacteria 4211
296 Ga0207700_10030319 3300025928 Bacteria 3829
297 Ga0207700_10040436 3300025928 Bacteria 3404
298 Ga0207664_10003476 3300025929 Bacteria 10509
299 Ga0207664_10307366 3300025929 Bacteria 1396
300 Ga0207644_10007189 3300025931 Bacteria 7246
301 Ga0207690_10131151 3300025932 Bacteria 1834
302 Ga0207706_10012680 3300025933 Bacteria 7671
303 Ga0207686_10059722 3300025934 Bacteria 2410
304 Ga0207670_10132165 3300025936 Bacteria 1830
305 Ga0207669_10012368 3300025937 Bacteria 4193
306 Ga0207704_10215714 3300025938 Bacteria 1416
307 Ga0207665_10008900 3300025939 Bacteria 6593
308 Ga0207691_10000977 3300025940 Bacteria 28402
309 Ga0207691_10061074 3300025940 Bacteria 3424
310 Ga0207691_10195302 3300025940 Bacteria 1763
311 Ga0207711_10008479 3300025941 Bacteria 8599
312 Ga0207711_10113524 3300025941 Bacteria 2412
313 Ga0207689_10009633 3300025942 Bacteria 8328
314 Ga0207689_10028141 3300025942 Bacteria 4701
315 Ga0207661_10025870 3300025944 Bacteria 4466
316 Ga0207679_10026629 3300025945 Bacteria 3989
317 Ga0207667_10012235 3300025949 Bacteria 9911
318 Ga0207667_10019312 3300025949 Bacteria 7613
319 Ga0207667_10028571 3300025949 Bacteria 6056
320 Ga0207667_10073041 3300025949 Bacteria 3565
321 Ga0207667_10226843 3300025949 Bacteria 1913
322 Ga0207651_10071351 3300025960 Bacteria 2461
323 Ga0207712_10162224 3300025961 Bacteria 1739
324 Ga0207668_10127859 3300025972 Bacteria 1935
325 Ga0207640_10000996 3300025981 Bacteria 15684
326 Ga0207658_10027942 3300025986 Bacteria 3969
327 Ga0207703_10111931 3300026035 Bacteria 2331
328 Ga0207639_10004126 3300026041 Bacteria 9786
329 Ga0207639_10045949 3300026041 Bacteria 3292
330 Ga0207678_10007632 3300026067 Bacteria 9557
331 Ga0207678_10011088 3300026067 Bacteria 7918
332 Ga0207678_10022619 3300026067 Bacteria 5505
333 Ga0207678_10026945 3300026067 Bacteria 5013
334 Ga0207678_10033440 3300026067 Bacteria 4479
335 Ga0207678_10038638 3300026067 Bacteria 4146
336 Ga0207708_10012687 3300026075 Bacteria 6283
337 Ga0207708_10042582 3300026075 Bacteria 3460
338 Ga0207702_10000162 3300026078 Bacteria 79378
339 Ga0207702_10011446 3300026078 Bacteria 7396
340 Ga0207702_10065053 3300026078 Bacteria 3122
341 Ga0207702_10119146 3300026078 Bacteria 2359
342 Ga0207641_10206087 3300026088 Bacteria 1816
343 Ga0207641_10313168 3300026088 Bacteria 1486
344 Ga0207648_10000825 3300026089 Bacteria 34995
345 Ga0207648_10135498 3300026089 Bacteria 2169
346 Ga0207676_10016634 3300026095 Bacteria 5327
347 Ga0207674_10014539 3300026116 Bacteria 8690
348 Ga0207674_10031587 3300026116 Bacteria 5561
349 Ga0207674_10274086 3300026116 Bacteria 1635
350 Ga0207675_100000366 3300026118 Bacteria 43270
351 Ga0207675_100020640 3300026118 Bacteria 6140
352 Ga0207683_10028078 3300026121 Bacteria 4865
353 Ga0207683_10082337 3300026121 Bacteria 2859
354 Ga0207683_10123150 3300026121 Bacteria 2329
355 Ga0207698_10000005 3300026142 Bacteria 295687
356 Ga0207698_10004789 3300026142 Bacteria 8285
357 Ga0207698_10012030 3300026142 Bacteria 5641
358 Ga0207698_10077032 3300026142 Bacteria 2672
359 Ga0207698_10251692 3300026142 Bacteria 1617
360 Ga0209588_1009148 3300027671 Bacteria 2954
361 Ga0209974_10002714 3300027876 Bacteria 6420
362 Ga0207428_10000140 3300027907 Bacteria 97818
363 Ga0207428_10010573 3300027907 Bacteria 8234
364 Ga0268266_10000677 3300028379 Bacteria 46024
365 Ga0268266_10000727 3300028379 Bacteria 44221
366 Ga0268266_10001826 3300028379 Bacteria 24057
367 Ga0268266_10003534 3300028379 Bacteria 15519
368 Ga0268266_10096334 3300028379 Bacteria 2600
369 Ga0268265_10008971 3300028380 Bacteria 6763
370 Ga0268265_10024352 3300028380 Bacteria 4281
371 Ga0268264_10000245 3300028381 Bacteria 102529
372 Ga0268264_10025692 3300028381 Bacteria 4811
373 Ga0265318_10000015 3300028577 Bacteria 187234
374 Ga0265318_10033968 3300028577 Bacteria 1967
375 Ga0307517_10000111 3300028786 Bacteria 120304
376 Ga0307515_10197518 3300028794 Bacteria 1899
377 Ga0307515_10258980 3300028794 Bacteria 1479
378 Ga0265338_10000005 3300028800 Bacteria 571137
379 Ga0265338_10017352 3300028800 Bacteria 7766
380 Ga0265338_10017836 3300028800 Bacteria 7632
381 Ga0265760_10007492 3300031090 Bacteria 3117
382 Ga0265330_10037738 3300031235 Bacteria 2150
383 Ga0265332_10003973 3300031238 Bacteria 7048
384 Ga0265320_10000561 3300031240 Bacteria 28649
385 Ga0265325_10000005 3300031241 Bacteria 321343
386 Ga0265325_10006286 3300031241 Bacteria 7229
387 Ga0265325_10015648 3300031241 Bacteria 4260
388 Ga0265340_10006415 3300031247 Bacteria 6476
389 Ga0265340_10032893 3300031247 Bacteria 2585
390 Ga0265339_10000088 3300031249 Bacteria 78106
391 Ga0265339_10000622 3300031249 Bacteria 27479
392 Ga0265339_10000822 3300031249 Bacteria 23914
393 Ga0265339_10001947 3300031249 Bacteria 15168
394 Ga0265331_10003530 3300031250 Bacteria 10045
395 Ga0265331_10008230 3300031250 Bacteria 5947
396 Ga0265331_10050878 3300031250 Bacteria 1985
397 Ga0265313_10000032 3300031595 Bacteria 128964
398 Ga0265313_10000173 3300031595 Bacteria 68499
399 Ga0265313_10000482 3300031595 Bacteria 41863
400 Ga0307508_10001153 3300031616 Bacteria 30369
401 Ga0265314_10015573 3300031711 Bacteria 6029
402 Ga0265314_10028710 3300031711 Bacteria 4144
403 Ga0265314_10047199 3300031711 Bacteria 3033
404 Ga0265342_10000233 3300031712 Bacteria 62514
405 Ga0307409_100135333 3300031995 Bacteria 2113
406 Ga0307416_100110690 3300032002 Bacteria 2419
407 Ga0307414_10059243 3300032004 Bacteria 2703
408 Ga0307510_10003330 3300033180 Bacteria 18721
409 Ga0315911_1000001 3300033442 Bacteria 1088602
410 Ga0373934_0012522 3300035086 Bacteria 3202
411 Ga0373923_0041645 3300035111 Bacteria 1894
412 Ga0373936_0008905 3300035113 Bacteria 3783
413 Ga0373936_0041875 3300035113 Bacteria 1837
414 Ga0373945_0008371 3300035116 Bacteria 3367
415 Ga0373953_0004147 3300035117 Bacteria 4597
416 Ga0373954_0076886 3300035118 Bacteria 1591
417 Ga0373956_0061559 3300035119 Bacteria 1700
418 Ga0373943_0000440 3300035170 Bacteria 17560
419 Ga0373943_0001594 3300035170 Bacteria 10274
420 Ga0373943_0009544 3300035170 Bacteria 4350
421 Ga0373943_0041344 3300035170 Bacteria 2229
422 Ga0373946_0003168 3300035171 Bacteria 5828
423 Ga0373946_0005763 3300035171 Bacteria 4482
424 Ga0373955_0013231 3300035172 Bacteria 3983
425 Ga0373955_0033656 3300035172 Bacteria 2701
426 Ga0373924_0017653 3300035410 Bacteria 2740
427 Ga0373924_0037002 3300035410 Bacteria 1985
428 Ga0373931_0021073 3300035691 Bacteria 3268
429 Ga0373935_0034322 3300035692 Bacteria 3161
430 Ga0373935_0044142 3300035692 Bacteria 2808
431 Ga0373935_0128891 3300035692 Bacteria 1698
432 Ga0373927_0000829 3300035695 Bacteria 23662
433 Ga0373927_0006747 3300035695 Bacteria 7811
434 Ga0373927_0102460 3300035695 Bacteria 1862
435 Ga0373933_0009315 3300035724 Bacteria 5363
436 Ga0373933_0121048 3300035724 Bacteria 1639
437 Ga0373947_0000393 3300035725 Bacteria 24647
438 Ga0373947_0015918 3300035725 Bacteria 4320
439 Ga0373937_0002968 3300036401 Bacteria 14200
440 Ga0373937_0050943 3300036401 Bacteria 3794
441 Ga0373937_0113539 3300036401 Bacteria 2521
442 Ga0373937_0137423 3300036401 Bacteria 2285
443 Ga0373925_0002574 3300037068 Bacteria 14441
444 Ga0373925_0048709 3300037068 Bacteria 3158
445 Ga0373925_0066546 3300037068 Bacteria 2716
446 Ga0395899_0000151 3300037312 Bacteria 105368
447 Ga0395900_0058167 3300037418 Bacteria 3979
448 Ga0395900_0098004 3300037418 Bacteria 3012
449 Ga0395900_0351562 3300037418 Bacteria 1447
450 Ga0395905_0008572 3300037471 Bacteria 10078
451 Ga0436364_0056841 3300037853 Bacteria 4059
452 Ga0436364_0344786 3300037853 Bacteria 1431
453 Ga0436364_0883805 3300037853 Bacteria 1635
454 Ga0436364_1010630 3300037853 Bacteria 1445
455 Ga0395901_0113052 3300038443 Bacteria 2851
456 Ga0436365_0143841 3300039437 Bacteria 1853
457 Ga0436365_0300465 3300039437 Bacteria 2513
458 Ga0436365_0599448 3300039437 Bacteria 39042
459 Ga0436365_1236061 3300039437 Bacteria 1952
460 Ga0436365_1340575 3300039437 Bacteria 4079
461 Ga0436365_1578866 3300039437 Bacteria 1940
462 Ga0436365_1822707 3300039437 Bacteria 2602
463 Ga0436360_0762773 3300039438 Bacteria 7862
464 Ga0436361_0099990 3300039447 Bacteria 26378
465 Ga0436362_0044370 3300039453 Bacteria 1926
466 Ga0439445_0007388 3300042004 Bacteria 2548
467 Ga0466966_0155289 3300044684 Bacteria 1394
468 Ga0466963_0045862 3300044694 Bacteria 2880
469 Ga0466957_0115147 3300044842 Bacteria 1709
470 Ga0466959_0028565 3300045049 Bacteria 4136
471 Ga0466958_0035636 3300045836 Bacteria 2973
472 Ga0466967_0230529 3300045976 Bacteria 1763
473 Ga0495617_039501 3300046452 Bacteria 1578
474 Ga0495592_0030516 3300046454 Bacteria 4077
475 Ga0495590_0025611 3300046457 Bacteria 2073
476 Ga0495629_0018296 3300046459 Bacteria 5017
477 Ga0495629_0026350 3300046459 Bacteria 4130
478 Ga0495638_0028797 3300046460 Bacteria 3584
479 Ga0495651_0002898 3300046462 Bacteria 13282
480 Ga0495651_0053124 3300046462 Bacteria 3120
481 Ga0495653_0004703 3300046463 Bacteria 11050
482 Ga0495650_0049588 3300046471 Bacteria 1743
483 Ga0495580_0053797 3300046472 Bacteria 2840
484 Ga0495580_0063181 3300046472 Bacteria 2597
485 Ga0495639_0020683 3300046475 Bacteria 2876
486 Ga0495639_0055033 3300046475 Bacteria 1814
487 Ga0495662_0001821 3300046476 Bacteria 10677
488 Ga0495664_0000147 3300046477 Bacteria 35346
489 Ga0495584_0002124 3300046491 Bacteria 11352
490 Ga0495585_0052560 3300046492 Bacteria 2255
491 Ga0495594_0028286 3300046499 Bacteria 3024
492 Ga0495594_0063898 3300046499 Bacteria 2040
493 Ga0495607_0052549 3300046501 Bacteria 2360
494 Ga0495606_0015801 3300046507 Bacteria 5793
495 Ga0495608_0030981 3300046511 Bacteria 3617
496 Ga0495610_0024380 3300046512 Bacteria 3266
497 Ga0495610_0046336 3300046512 Bacteria 2145
498 Ga0495616_0024868 3300046513 Bacteria 3206
499 Ga0495616_0084039 3300046513 Bacteria 1518
500 Ga0495618_0001877 3300046514 Bacteria 13850
501 Ga0495618_0052262 3300046514 Bacteria 2582
502 Ga0495620_0042192 3300046515 Bacteria 1995
503 Ga0495628_0117871 3300046516 Bacteria 2039
504 Ga0495630_0001952 3300046517 Bacteria 14333
505 Ga0495630_0036955 3300046517 Bacteria 3651
506 Ga0495631_0031506 3300046518 Bacteria 2397
507 Ga0495632_0048220 3300046519 Bacteria 2110
508 Ga0495648_0055384 3300046524 Bacteria 2391
509 Ga0495648_0070035 3300046524 Bacteria 2039
510 Ga0495663_0011031 3300046525 Bacteria 2516
511 Ga0495663_0018223 3300046525 Bacteria 1998
512 Ga0495663_0026301 3300046525 Bacteria 1703
513 Ga0495642_0035680 3300046528 Bacteria 2007
514 Ga0495652_0038908 3300046529 Bacteria 4115
515 Ga0495665_0026023 3300046531 Bacteria 3142
516 Ga0495640_0003988 3300046533 Bacteria 11811
517 Ga0495640_0016016 3300046533 Bacteria 5622
518 Ga0495640_0018616 3300046533 Bacteria 5144
519 Ga0495640_0076083 3300046533 Bacteria 2240
520 Ga0495587_0005767 3300046536 Bacteria 8069
521 Ga0495587_0080216 3300046536 Bacteria 1891
522 Ga0495598_0009785 3300046537 Bacteria 2277
523 Ga0495598_0012176 3300046537 Bacteria 2103
524 Ga0495598_0012522 3300046537 Bacteria 2084
525 Ga0495598_0019139 3300046537 Bacteria 1790
526 Ga0495609_0043291 3300046538 Bacteria 2021
527 Ga0495645_0000695 3300046543 Bacteria 23113
528 Ga0495645_0020278 3300046543 Bacteria 4793
529 Ga0495645_0046620 3300046543 Bacteria 3159
530 Ga0495667_0046423 3300046559 Bacteria 2872
531 Ga0495667_0093862 3300046559 Bacteria 1943
532 Ga0495656_0004791 3300046615 Bacteria 4656
533 Ga0495656_0004869 3300046615 Bacteria 4621
534 Ga0495656_0011721 3300046615 Bacteria 3220
535 Ga0495656_0043463 3300046615 Bacteria 1887
536 Ga0495634_0003638 3300046642 Bacteria 12297
537 Ga0495634_0022313 3300046642 Bacteria 4461
538 Ga0495634_0028582 3300046642 Bacteria 3869
539 Ga0495634_0030570 3300046642 Bacteria 3719
540 Ga0495634_0051752 3300046642 Bacteria 2755
541 Ga0495611_0029288 3300046648 Bacteria 2414
542 Ga0495635_0001303 3300046663 Bacteria 16659
543 Ga0495635_0024452 3300046663 Bacteria 4210
544 Ga0495635_0082082 3300046663 Bacteria 2206
545 Ga0495661_0134686 3300046665 Bacteria 1350
546 Ga0495588_0001989 3300046674 Bacteria 8739
547 Ga0495657_0015784 3300046675 Bacteria 5518
548 Ga0495657_0058062 3300046675 Bacteria 2571
549 Ga0495599_0015104 3300046678 Bacteria 4786
550 Ga0495623_0047760 3300046679 Bacteria 2717
551 Ga0495646_0027762 3300046680 Bacteria 3548
552 Ga0495646_0036024 3300046680 Bacteria 3067
553 Ga0495647_0070743 3300046681 Bacteria 1396
554 Ga0495613_0020414 3300046689 Bacteria 4938
555 Ga0495624_0005355 3300046690 Bacteria 9256
556 Ga0495624_0007520 3300046690 Bacteria 7644
557 Ga0495624_0046918 3300046690 Bacteria 2746
558 Ga0495624_0066900 3300046690 Bacteria 2243
559 Ga0495670_0011468 3300046691 Bacteria 4360
560 Ga0495670_0052910 3300046691 Bacteria 2033
561 Ga0495670_0068679 3300046691 Bacteria 1791
562 Ga0495649_0007881 3300046694 Bacteria 6444
563 Ga0495649_0039226 3300046694 Bacteria 2597
564 Ga0495649_0069132 3300046694 Bacteria 1894
565 Ga0495589_0037484 3300046794 Bacteria 2429
566 Ga0495600_0013812 3300046809 Bacteria 5086
567 Ga0495604_0000643 3300047317 Bacteria 29876
568 Ga0495604_0066980 3300047317 Bacteria 2729
569 Ga0495604_0113211 3300047317 Bacteria 1975
570 Ga0495674_0002888 3300047319 Bacteria 16717
571 Ga0495674_0032807 3300047319 Bacteria 4706
572 Ga0495674_0053632 3300047319 Bacteria 3543
573 Ga0495674_0087934 3300047319 Bacteria 2658
574 Ga0495672_0015830 3300047320 Bacteria 5105
575 Ga0495672_0023135 3300047320 Bacteria 4028
576 Ga0495676_0111851 3300047321 Bacteria 2002
577 Ga0495680_0002277 3300047322 Bacteria 19762
578 Ga0495680_0033115 3300047322 Bacteria 4187
579 Ga0495680_0125717 3300047322 Bacteria 1889
580 Ga0495677_0049378 3300047445 Bacteria 1546
581 Ga0495684_0002109 3300047471 Bacteria 15957
582 Ga0495684_0003387 3300047471 Bacteria 12515
583 Ga0495684_0010675 3300047471 Bacteria 7101
584 Ga0495684_0038567 3300047471 Bacteria 3662
585 Ga0495686_0106874 3300047472 Bacteria 1682
586 Ga0495593_0015087 3300047673 Bacteria 4387
587 Ga0495602_0116017 3300048088 Bacteria 2164
588 Ga0495615_0030541 3300048090 Bacteria 1287
589 Ga0496100_0019308 3300048903 Bacteria 4063
590 Ga0496100_0097807 3300048903 Bacteria 2016
591 Ga0496101_0004879 3300048904 Bacteria 8513
592 Ga0496101_0026770 3300048904 Bacteria 4010
593 Ga0496101_0247270 3300048904 Bacteria 1389
594 Ga0496102_0003387 3300048905 Bacteria 13517
595 Ga0496102_0072275 3300048905 Bacteria 3169
596 Ga0496102_0076352 3300048905 Bacteria 3082
597 Ga0496102_0201928 3300048905 Bacteria 1874
598 Ga0496103_0001033 3300048906 Bacteria 19490
599 Ga0496104_0005340 3300048907 Bacteria 11240
600 Ga0496104_0007801 3300048907 Bacteria 9488
601 Ga0496104_0013744 3300048907 Bacteria 7301
602 Ga0496104_0047965 3300048907 Bacteria 4027
603 Ga0496104_0072489 3300048907 Bacteria 3275
604 Ga0496105_0006335 3300048908 Bacteria 9088
605 Ga0496105_0025501 3300048908 Bacteria 4813
606 Ga0496106_0166262 3300048909 Bacteria 1746
607 Ga0496106_0171011 3300048909 Bacteria 1722
608 Ga0496107_0075248 3300048910 Bacteria 2458
609 Ga0496107_0292237 3300048910 Bacteria 1213
610 Ga0496108_0004005 3300048911 Bacteria 11815
611 Ga0496108_0012723 3300048911 Bacteria 6853
612 Ga0496108_0111899 3300048911 Bacteria 2336
613 Ga0496108_0141917 3300048911 Bacteria 2069
614 Ga0496109_0059073 3300048912 Bacteria 3503
615 Ga0496109_0071325 3300048912 Bacteria 3189
616 Ga0496110_0015820 3300048913 Bacteria 6289
617 Ga0496110_0025176 3300048913 Bacteria 5082
618 Ga0496111_0034923 3300048914 Bacteria 3591
619 Ga0496111_0044803 3300048914 Bacteria 3180
620 Ga0496111_0064581 3300048914 Bacteria 2655
621 Ga0496112_0016711 3300048915 Bacteria 6880
622 Ga0496112_0065913 3300048915 Bacteria 3573
623 Ga0496113_0009665 3300048916 Bacteria 6334
624 Ga0496113_0039825 3300048916 Bacteria 3460
625 Ga0496114_0261513 3300048917 Bacteria 1524
626 Ga0496115_0152394 3300048918 Bacteria 1909
627 Ga0496116_0000092 3300048919 Bacteria 206620
628 Ga0496116_0004967 3300048919 Bacteria 12531
629 Ga0496117_0025927 3300048920 Bacteria 4597
630 Ga0496117_0131036 3300048920 Bacteria 1520
631 Ga0496118_0003713 3300048921 Bacteria 18913
632 Ga0496118_0140762 3300048921 Bacteria 1530
633 Ga0496119_0046060 3300048922 Bacteria 2728
634 Ga0496120_0062526 3300048923 Bacteria 2074
635 Ga0496121_0001453 3300048924 Bacteria 40007
636 Ga0496121_0076249 3300048924 Bacteria 2674
637 Ga0496121_0149551 3300048924 Bacteria 1720
638 Ga0496123_0010093 3300048926 Bacteria 8399
639 Ga0496124_0087263 3300048927 Bacteria 2552
640 Ga0496124_0223949 3300048927 Bacteria 1412
641 Ga0496125_0000600 3300048928 Bacteria 61362
642 Ga0496125_0003378 3300048928 Bacteria 19439
643 Ga0496125_0012349 3300048928 Bacteria 8486
644 Ga0496125_0016087 3300048928 Bacteria 7200
645 Ga0496126_0005363 3300048929 Bacteria 14654
646 Ga0496126_0006357 3300048929 Bacteria 13172
647 Ga0496126_0012601 3300048929 Bacteria 8655
648 Ga0496126_0013331 3300048929 Bacteria 8369
649 Ga0496126_0030143 3300048929 Bacteria 5144
650 Ga0496126_0040376 3300048929 Bacteria 4325
651 Ga0496126_0044205 3300048929 Bacteria 4104
652 Ga0496126_0052280 3300048929 Bacteria 3714
653 Ga0496126_0091007 3300048929 Bacteria 2683
654 Ga0496126_0102827 3300048929 Bacteria 2497
655 Ga0496126_0168034 3300048929 Bacteria 1871
656 Ga0496126_0182215 3300048929 Bacteria 1783
657 Ga0496126_0190562 3300048929 Bacteria 1737
658 Ga0495682_0025804 3300049460 Bacteria 2185
659 Ga0501031_0004551 3300049568 Bacteria 8991
660 Ga0501031_0005519 3300049568 Bacteria 8236
661 Ga0501031_0007975 3300049568 Bacteria 6893
662 Ga0501031_0015856 3300049568 Bacteria 4892
663 Ga0501031_0122119 3300049568 Bacteria 1702
664 Ga0501032_0017717 3300049569 Bacteria 4999
665 Ga0501032_0029614 3300049569 Bacteria 3755
666 Ga0501032_0058391 3300049569 Bacteria 2590
667 Ga0501032_0176984 3300049569 Bacteria 1397
668 Ga0501033_0002357 3300049570 Bacteria 16112
669 Ga0501033_0003960 3300049570 Bacteria 12004
670 Ga0501033_0012332 3300049570 Bacteria 6523
671 Ga0501033_0020067 3300049570 Bacteria 5052
672 Ga0501033_0049959 3300049570 Bacteria 3104
673 Ga0501033_0097648 3300049570 Bacteria 2146
674 Ga0501033_0106597 3300049570 Bacteria 2041
675 Ga0501034_0001188 3300049571 Bacteria 35870
676 Ga0501034_0005818 3300049571 Bacteria 13410
677 Ga0501034_0007444 3300049571 Bacteria 11652
678 Ga0501034_0049402 3300049571 Bacteria 4244
679 Ga0501034_0067987 3300049571 Bacteria 3574
680 Ga0501034_0079596 3300049571 Bacteria 3280
681 Ga0501034_0087883 3300049571 Bacteria 3107
682 Ga0501034_0101821 3300049571 Bacteria 2866
683 Ga0501034_0196613 3300049571 Bacteria 1976
684 Ga0501036_0000992 3300049572 Bacteria 21425
685 Ga0501036_0002298 3300049572 Bacteria 14945
686 Ga0501036_0162233 3300049572 Bacteria 1884
687 Ga0501037_0001908 3300049573 Bacteria 15140
688 Ga0501037_0026075 3300049573 Bacteria 4319
689 Ga0501037_0028885 3300049573 Bacteria 4097
690 Ga0501037_0046474 3300049573 Bacteria 3183
691 Ga0501038_0000319 3300049574 Bacteria 41269
692 Ga0501038_0017132 3300049574 Bacteria 6552
693 Ga0501038_0019199 3300049574 Bacteria 6164
694 Ga0501038_0030908 3300049574 Bacteria 4734
695 Ga0501038_0076882 3300049574 Bacteria 2819
696 Ga0501039_0018593 3300049575 Bacteria 5334
697 Ga0501039_0019245 3300049575 Bacteria 5236
698 Ga0501039_0020632 3300049575 Bacteria 5049
699 Ga0501039_0037800 3300049575 Bacteria 3727
700 Ga0501039_0047031 3300049575 Bacteria 3334
701 Ga0501040_0021621 3300049576 Bacteria 4299
702 Ga0501042_0032025 3300049578 Bacteria 3721
703 Ga0501043_0022088 3300049579 Bacteria 4993
704 Ga0501046_0013563 3300049580 Bacteria 6894
705 Ga0501046_0021773 3300049580 Bacteria 5284
706 Ga0501046_0032910 3300049580 Bacteria 4194
707 Ga0501046_0085755 3300049580 Bacteria 2428
708 Ga0501046_0098415 3300049580 Bacteria 2246
709 Ga0501046_0101309 3300049580 Bacteria 2209
710 Ga0501047_0005396 3300049581 Bacteria 12020
711 Ga0501047_0017866 3300049581 Bacteria 6794
712 Ga0501047_0047369 3300049581 Bacteria 4154
713 Ga0501047_0057254 3300049581 Bacteria 3769
714 Ga0501047_0066167 3300049581 Bacteria 3483
715 Ga0501047_0114884 3300049581 Bacteria 2574
716 Ga0501048_0011226 3300049582 Bacteria 6679
717 Ga0501048_0012479 3300049582 Bacteria 6321
718 Ga0501068_0008709 3300049584 Bacteria 5657
719 Ga0501068_0098618 3300049584 Bacteria 1809
720 Ga0501069_0007703 3300049585 Bacteria 5650
721 Ga0501069_0049752 3300049585 Bacteria 2330
722 Ga0501070_0002559 3300049586 Bacteria 15917
723 Ga0501070_0009673 3300049586 Bacteria 8152
724 Ga0501070_0019935 3300049586 Bacteria 5623
725 Ga0501071_0067076 3300049587 Bacteria 2609
726 Ga0501072_0081943 3300049588 Bacteria 2558
727 Ga0501072_0113619 3300049588 Bacteria 2156
728 Ga0501073_0000802 3300049589 Bacteria 22364
729 Ga0501073_0014281 3300049589 Bacteria 5767
730 Ga0501073_0076193 3300049589 Bacteria 2334
731 Ga0501073_0081044 3300049589 Bacteria 2257
732 Ga0501073_0180223 3300049589 Bacteria 1462
733 Ga0501074_0000138 3300049590 Bacteria 37896
734 Ga0501074_0023846 3300049590 Bacteria 4447
735 Ga0501077_0144320 3300049593 Bacteria 1510
736 Ga0501079_0002710 3300049741 Bacteria 12905
737 Ga0501080_0025164 3300049742 Bacteria 5524
738 Ga0501083_0015481 3300049744 Bacteria 5342
739 Ga0501083_0031844 3300049744 Bacteria 3618
740 Ga0501035_0001024 3300049822 Bacteria 29439
741 Ga0501035_0011540 3300049822 Bacteria 8188
742 Ga0501035_0019433 3300049822 Bacteria 6247
743 Ga0501035_0024254 3300049822 Bacteria 5563
744 Ga0501035_0027006 3300049822 Bacteria 5250
745 Ga0501035_0082971 3300049822 Bacteria 2828
746 Ga0501035_0089302 3300049822 Bacteria 2714
747 Ga0501035_0126136 3300049822 Bacteria 2234
748 Ga0501044_0001970 3300049823 Bacteria 23744
749 Ga0501044_0008807 3300049823 Bacteria 11038
750 Ga0501044_0023213 3300049823 Bacteria 6601
751 Ga0501044_0044972 3300049823 Bacteria 4578
752 Ga0501044_0064394 3300049823 Bacteria 3743
753 Ga0501044_0105644 3300049823 Bacteria 2828
754 Ga0501044_0111682 3300049823 Bacteria 2740
755 Ga0501044_0138195 3300049823 Bacteria 2426
756 Ga0501045_0011643 3300049824 Bacteria 6176
757 nmdc:mga03683_22010_c1 3300050489 Bacteria 2466
758 nmdc:mga03683_5346_c1 3300050489 Bacteria 4333
759 nmdc:mga03n38_159_c1 3300050490 Bacteria 12744
760 nmdc:mga00v17_106199_c1 3300050491 Bacteria 1777
761 nmdc:mga00v17_56888_c1 3300050491 Bacteria 2391
762 nmdc:mga00v17_61162_c1 3300050491 Bacteria 2314
763 nmdc:mga0yw44_100628_c1 3300050492 Bacteria 1841
764 nmdc:mga0yw44_3790_c1 3300050492 Bacteria 6784
765 nmdc:mga0k408_90708_c1 3300050493 Bacteria 1795
766 nmdc:mga04h51_8174_c1 3300050495 Bacteria 2792
767 nmdc:mga07m45_15508_c1 3300050496 Bacteria 4070
768 nmdc:mga07m45_27984_c1 3300050496 Bacteria 3110
769 nmdc:mga05p37_18514_c1 3300050507 Bacteria 8414
770 nmdc:mga05p37_23888_c1 3300050507 Bacteria 7422
771 nmdc:mga05p37_285554_c1 3300050507 Bacteria 1966
772 nmdc:mga05p37_853_c1 3300050507 Bacteria 34336
773 nmdc:mga09592_12918_c1 3300050508 Bacteria 6810
774 nmdc:mga09592_19678_c1 3300050508 Bacteria 5544
775 nmdc:mga0qj67_360891_c1 3300050509 Bacteria 1174
776 nmdc:mga0qj67_37662_c1 3300050509 Bacteria 3790
777 nmdc:mga06r32_146745_c1 3300050510 Bacteria 2336
778 nmdc:mga06r32_205414_c1 3300050510 Bacteria 1958
779 nmdc:mga06r32_557_c1 3300050510 Bacteria 32361
780 nmdc:mga06r32_61387_c1 3300050510 Bacteria 3618
781 nmdc:mga06r32_77538_c1 3300050510 Bacteria 3229
782 nmdc:mga08y16_202602_c1 3300050511 Bacteria 2056
783 nmdc:mga08y16_22775_c1 3300050511 Bacteria 6612
784 nmdc:mga0n895_186339_c1 3300050512 Bacteria 2106
785 nmdc:mga0n895_221558_c1 3300050512 Bacteria 1920
786 nmdc:mga0rr50_87676_c1 3300050513 Bacteria 2416
787 nmdc:mga08x19_15383_c1 3300050514 Bacteria 4655
788 nmdc:mga08x19_394_c1 3300050514 Bacteria 30675
789 nmdc:mga0sz30_7308_c1 3300050516 Bacteria 4138
790 nmdc:mga0sz30_82403_c1 3300050516 Bacteria 1393
791 Ga0495601_0000763 3300053077 Bacteria 17371
792 Ga0495601_0004531 3300053077 Bacteria 8030
793 Ga0495601_0024258 3300053077 Bacteria 3736
794 Ga0495601_0040295 3300053077 Bacteria 2925
795 Ga0495601_0068715 3300053077 Bacteria 2258
796 Ga0495601_0120394 3300053077 Bacteria 1704
797 Ga0495612_0011755 3300053078 Bacteria 3528
798 Ga0495612_0015550 3300053078 Bacteria 3050
799 Ga0495612_0024602 3300053078 Bacteria 2417
800 Ga0495595_0004091 3300053084 Bacteria 5846
801 Ga0495619_0000374 3300053085 Bacteria 30825
802 Ga0495619_0001194 3300053085 Bacteria 17106
803 Ga0495619_0047806 3300053085 Bacteria 2818
804 Ga0495619_0048814 3300053085 Bacteria 2790
805 Ga0495619_0093243 3300053085 Bacteria 2041
806 Ga0500578_0094412 3300053086 Bacteria 1898
807 Ga0500578_0155114 3300053086 Bacteria 1424
808 Ga0500566_0000082 3300053094 Bacteria 47150
809 Ga0500641_0006634 3300053096 Bacteria 4110
810 Ga0500555_029892 3300053103 Bacteria 1548
811 Ga0500556_0000002 3300053104 Bacteria 773626
812 Ga0500572_000521 3300053111 Bacteria 13138
813 Ga0500592_001387 3300053116 Bacteria 3920
814 Ga0500595_000890 3300053119 Bacteria 17032
815 Ga0500595_001314 3300053119 Bacteria 13488
816 Ga0500595_006225 3300053119 Bacteria 5095
817 Ga0500595_023161 3300053119 Bacteria 2187
818 Ga0500608_000450 3300053122 Bacteria 15389
819 Ga0500642_0000115 3300053130 Bacteria 37207
820 Ga0500559_0000282 3300053136 Bacteria 39282
821 Ga0500559_0000574 3300053136 Bacteria 25178
822 Ga0500559_0046470 3300053136 Bacteria 1904
823 Ga0500568_0002196 3300053139 Bacteria 11744
824 Ga0500577_0000716 3300053142 Bacteria 8476
825 Ga0500589_049180 3300053147 Bacteria 1959
826 Ga0500604_0006158 3300053151 Bacteria 3169
827 Ga0500604_0007717 3300053151 Bacteria 2850
828 Ga0500616_0000069 3300053153 Bacteria 234334
829 Ga0500616_0028455 3300053153 Bacteria 3079
830 Ga0500622_0036772 3300053156 Bacteria 2559
831 Ga0500634_0000517 3300053161 Bacteria 12583
832 Ga0500634_0073233 3300053161 Bacteria 1786
833 Ga0500639_011094 3300053163 Bacteria 4726
834 Ga0500639_039988 3300053163 Bacteria 2468
835 Ga0500636_0003738 3300053177 Bacteria 8587
836 Ga0500637_0094081 3300053178 Bacteria 1736
837 Ga0500609_006233 3300053731 Bacteria 1626
838 Ga0501084_0027346 3300054114 Bacteria 4766
839 Ga0501082_0000084 3300060353 Bacteria 70644
840 Ga0501082_0005189 3300060353 Bacteria 11329
841 Ga0501082_0092963 3300060353 Bacteria 2605
842 Ga0530510_0053026 3300061734 Bacteria 2930

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048927 Ga0496124_0087263 Ga0496124_0087263_531_1604 317
2 3300050509 nmdc:mga0qj67_360891_c1 nmdc:mga0qj67_360891_c1_123_1145 340
3 3300048910 Ga0496107_0292237 Ga0496107_0292237_11_1090 349
4 3300049580 Ga0501046_0098415 Ga0501046_0098415_1157_2236 357
5 3300027876 Ga0209974_10002714 Ga0209974_100027142 367
6 3300049589 Ga0501073_0180223 Ga0501073_0180223_22_1215 369
7 3300046459 Ga0495629_0026350 Ga0495629_0026350_2997_4109 370
8 3300048927 Ga0496124_0223949 Ga0496124_0223949_26_1285 378
9 3300050491 nmdc:mga00v17_61162_c1 nmdc:mga00v17_61162_c1_278_1612 381
10 iso_pu_bacteria 2643221591 2643963449 385
11 3300048913 Ga0496110_0025176 Ga0496110_0025176_3214_4467 389
12 3300048919 Ga0496116_0000092 Ga0496116_0000092_119888_121135 389
13 3300048920 Ga0496117_0025927 Ga0496117_0025927_2139_3386 389
14 3300048921 Ga0496118_0003713 Ga0496118_0003713_9036_10283 389
15 3300025297 Ga0209758_1001948 Ga0209758_100194819 390
16 3300005344 Ga0070661_100001119 Ga0070661_1000011195 391
17 3300005539 Ga0068853_100015125 Ga0068853_1000151254 391
18 3300031250 Ga0265331_10003530 Ga0265331_100035304 392
19 3300049571 Ga0501034_0001188 Ga0501034_0001188_1265_2650 392
20 3300049571 Ga0501034_0067987 Ga0501034_0067987_962_2347 392
21 3300005338 Ga0068868_100059313 Ga0068868_1000593132 393
22 3300005937 Ga0081455_10117456 Ga0081455_101174562 393
23 3300025927 Ga0207687_10004916 Ga0207687_100049166 393
24 3300046691 Ga0495670_0068679 Ga0495670_0068679_11_1192 393
25 3300048923 Ga0496120_0062526 Ga0496120_0062526_333_1613 393
26 3300049568 Ga0501031_0005519 Ga0501031_0005519_1533_2813 393
27 3300049569 Ga0501032_0058391 Ga0501032_0058391_1209_2489 393
28 3300049570 Ga0501033_0002357 Ga0501033_0002357_13668_14948 393
29 3300049574 Ga0501038_0019199 Ga0501038_0019199_2102_3382 393
30 3300049575 Ga0501039_0018593 Ga0501039_0018593_366_1646 393
31 3300049575 Ga0501039_0047031 Ga0501039_0047031_1461_2741 393
32 3300049578 Ga0501042_0032025 Ga0501042_0032025_30_1310 393
33 3300049580 Ga0501046_0021773 Ga0501046_0021773_2559_3839 393
34 3300049822 Ga0501035_0001024 Ga0501035_0001024_7759_9039 393
35 3300053111 Ga0500572_000521 Ga0500572_000521_7008_8288 393
36 3300053136 Ga0500559_0000282 Ga0500559_0000282_13608_14888 393
37 3300053163 Ga0500639_011094 Ga0500639_011094_1642_2922 393
38 3300053085 Ga0495619_0093243 Ga0495619_0093243_634_1974 394
39 3300053151 Ga0500604_0006158 Ga0500604_0006158_789_2174 394
40 3300013308 Ga0157375_10349374 Ga0157375_103493742 395
41 3300014325 Ga0163163_10034357 Ga0163163_100343572 395
42 3300014969 Ga0157376_10192907 Ga0157376_101929072 395
43 3300035086 Ga0373934_0012522 Ga0373934_0012522_568_1836 395
44 3300035111 Ga0373923_0041645 Ga0373923_0041645_195_1463 395
45 3300035117 Ga0373953_0004147 Ga0373953_0004147_1608_2876 395
46 3300035118 Ga0373954_0076886 Ga0373954_0076886_201_1469 395
47 3300035119 Ga0373956_0061559 Ga0373956_0061559_108_1376 395
48 3300035172 Ga0373955_0033656 Ga0373955_0033656_91_1359 395
49 3300035410 Ga0373924_0037002 Ga0373924_0037002_413_1681 395
50 3300046462 Ga0495651_0053124 Ga0495651_0053124_1086_2354 395
51 3300046511 Ga0495608_0030981 Ga0495608_0030981_1080_2348 395
52 3300046536 Ga0495587_0080216 Ga0495587_0080216_409_1677 395
53 3300046543 Ga0495645_0046620 Ga0495645_0046620_318_1586 395
54 3300046642 Ga0495634_0051752 Ga0495634_0051752_301_1569 395
55 3300046675 Ga0495657_0015784 Ga0495657_0015784_1688_2956 395
56 3300046680 Ga0495646_0036024 Ga0495646_0036024_1490_2758 395
57 3300047317 Ga0495604_0066980 Ga0495604_0066980_1251_2519 395
58 3300047319 Ga0495674_0032807 Ga0495674_0032807_3011_4279 395
59 3300047322 Ga0495680_0033115 Ga0495680_0033115_264_1532 395
60 3300047471 Ga0495684_0038567 Ga0495684_0038567_1394_2662 395
61 3300048905 Ga0496102_0201928 Ga0496102_0201928_365_1633 395
62 3300048907 Ga0496104_0007801 Ga0496104_0007801_3518_4786 395
63 3300048912 Ga0496109_0071325 Ga0496109_0071325_191_1459 395
64 3300048928 Ga0496125_0000600 Ga0496125_0000600_59090_60400 395
65 3300048929 Ga0496126_0006357 Ga0496126_0006357_11666_12946 395
66 3300048929 Ga0496126_0013331 Ga0496126_0013331_6792_8072 395
67 3300049571 Ga0501034_0087883 Ga0501034_0087883_1584_2864 395
68 3300053077 Ga0495601_0068715 Ga0495601_0068715_319_1587 395
69 3300053078 Ga0495612_0024602 Ga0495612_0024602_222_1490 395
70 3300053122 Ga0500608_000450 Ga0500608_000450_8469_9749 395
71 3300053136 Ga0500559_0000574 Ga0500559_0000574_12093_13373 395
72 3300053177 Ga0500636_0003738 Ga0500636_0003738_1942_3222 395
73 3300006058 Ga0075432_10000765 Ga0075432_100007657 396
74 3300006194 Ga0075427_10000083 Ga0075427_100000832 396
75 3300006844 Ga0075428_100013683 Ga0075428_1000136834 396
76 3300006846 Ga0075430_100000026 Ga0075430_10000002621 396
77 3300006847 Ga0075431_100000451 Ga0075431_1000004512 396
78 3300006852 Ga0075433_10002991 Ga0075433_100029917 396
79 3300006871 Ga0075434_100000110 Ga0075434_10000011014 396
80 3300006880 Ga0075429_100000247 Ga0075429_1000002476 396
81 3300006881 Ga0068865_100006113 Ga0068865_1000061132 396
82 3300007265 Ga0099794_10003348 Ga0099794_100033482 396
83 3300013104 Ga0157370_10315583 Ga0157370_103155831 396
84 3300027907 Ga0207428_10000140 Ga0207428_1000014082 396
85 3300037418 Ga0395900_0058167 Ga0395900_0058167_688_2055 396
86 3300049584 Ga0501068_0098618 Ga0501068_0098618_28_1254 396
87 3300050495 nmdc:mga04h51_8174_c1 nmdc:mga04h51_8174_c1_616_1956 396
88 3300005614 Ga0068856_100076616 Ga0068856_1000766164 397
89 3300014968 Ga0157379_10002383 Ga0157379_1000238315 397
90 3300026142 Ga0207698_10012030 Ga0207698_100120302 397
91 3300049570 Ga0501033_0097648 Ga0501033_0097648_696_2063 397
92 3300049580 Ga0501046_0101309 Ga0501046_0101309_267_1634 397
93 3300049581 Ga0501047_0114884 Ga0501047_0114884_548_1771 397
94 3300049823 Ga0501044_0138195 Ga0501044_0138195_115_1482 397
95 3300005563 Ga0068855_100142420 Ga0068855_1001424202 398
96 3300013100 Ga0157373_10153941 Ga0157373_101539412 398
97 3300021358 Ga0213873_10014678 Ga0213873_100146782 398
98 3300025919 Ga0207657_10008772 Ga0207657_100087722 398
99 3300039453 Ga0436362_0044370 Ga0436362_0044370_357_1745 398
100 3300049568 Ga0501031_0122119 Ga0501031_0122119_233_1600 398
101 3300015690 Ga0183363_1001 Ga0183363_100193 399
102 3300047317 Ga0495604_0113211 Ga0495604_0113211_240_1463 399
103 3300048929 Ga0496126_0190562 Ga0496126_0190562_512_1720 401
104 3300053086 Ga0500578_0155114 Ga0500578_0155114_205_1413 401
105 3300053103 Ga0500555_029892 Ga0500555_029892_13_1221 401
106 3300053119 Ga0500595_000890 Ga0500595_000890_12691_13971 402
107 3300006178 Ga0075367_10003094 Ga0075367_100030942 403
108 3300006847 Ga0075431_100001409 Ga0075431_10000140919 403
109 3300006880 Ga0075429_100009412 Ga0075429_1000094126 403
110 3300009094 Ga0111539_10011184 Ga0111539_100111848 403
111 3300026067 Ga0207678_10022619 Ga0207678_100226195 403
112 3300027907 Ga0207428_10010573 Ga0207428_100105732 403
113 3300028794 Ga0307515_10197518 Ga0307515_101975181 403
114 3300035170 Ga0373943_0041344 Ga0373943_0041344_82_1353 403
115 3300035172 Ga0373955_0013231 Ga0373955_0013231_1951_3222 403
116 3300035410 Ga0373924_0017653 Ga0373924_0017653_185_1456 403
117 3300035724 Ga0373933_0009315 Ga0373933_0009315_1199_2470 403
118 3300036401 Ga0373937_0050943 Ga0373937_0050943_1675_2946 403
119 3300037068 Ga0373925_0048709 Ga0373925_0048709_1546_2817 403
120 3300046454 Ga0495592_0030516 Ga0495592_0030516_538_1809 403
121 3300046459 Ga0495629_0018296 Ga0495629_0018296_2483_3754 403
122 3300046460 Ga0495638_0028797 Ga0495638_0028797_1380_2660 403
123 3300046462 Ga0495651_0002898 Ga0495651_0002898_5852_7123 403
124 3300046463 Ga0495653_0004703 Ga0495653_0004703_140_1411 403
125 3300046475 Ga0495639_0020683 Ga0495639_0020683_277_1548 403
126 3300046512 Ga0495610_0024380 Ga0495610_0024380_1011_2291 403
127 3300046514 Ga0495618_0052262 Ga0495618_0052262_386_1657 403
128 3300046524 Ga0495648_0055384 Ga0495648_0055384_525_1805 403
129 3300046529 Ga0495652_0038908 Ga0495652_0038908_982_2253 403
130 3300046533 Ga0495640_0016016 Ga0495640_0016016_740_2011 403
131 3300046536 Ga0495587_0005767 Ga0495587_0005767_5741_7012 403
132 3300046543 Ga0495645_0020278 Ga0495645_0020278_2090_3361 403
133 3300046559 Ga0495667_0046423 Ga0495667_0046423_135_1406 403
134 3300046642 Ga0495634_0022313 Ga0495634_0022313_1649_2920 403
135 3300046663 Ga0495635_0024452 Ga0495635_0024452_295_1566 403
136 3300046675 Ga0495657_0058062 Ga0495657_0058062_389_1660 403
137 3300046678 Ga0495599_0015104 Ga0495599_0015104_2639_3910 403
138 3300046679 Ga0495623_0047760 Ga0495623_0047760_540_1811 403
139 3300046680 Ga0495646_0027762 Ga0495646_0027762_771_2042 403
140 3300046690 Ga0495624_0007520 Ga0495624_0007520_1139_2410 403
141 3300046809 Ga0495600_0013812 Ga0495600_0013812_2897_4168 403
142 3300047317 Ga0495604_0000643 Ga0495604_0000643_2302_3573 403
143 3300047319 Ga0495674_0087934 Ga0495674_0087934_1312_2583 403
144 3300047322 Ga0495680_0002277 Ga0495680_0002277_6047_7318 403
145 3300047471 Ga0495684_0010675 Ga0495684_0010675_742_2013 403
146 3300047472 Ga0495686_0106874 Ga0495686_0106874_29_1309 403
147 3300047673 Ga0495593_0015087 Ga0495593_0015087_1336_2607 403
148 3300048088 Ga0495602_0116017 Ga0495602_0116017_850_2121 403
149 3300048919 Ga0496116_0004967 Ga0496116_0004967_6108_7388 403
150 3300048926 Ga0496123_0010093 Ga0496123_0010093_2161_3441 403
151 3300048928 Ga0496125_0016087 Ga0496125_0016087_1037_2317 403
152 3300049572 Ga0501036_0162233 Ga0501036_0162233_616_1833 403
153 3300050507 nmdc:mga05p37_853_c1 nmdc:mga05p37_853_c1_23144_24412 403
154 3300050508 nmdc:mga09592_12918_c1 nmdc:mga09592_12918_c1_1719_2987 403
155 3300050510 nmdc:mga06r32_557_c1 nmdc:mga06r32_557_c1_4113_5381 403
156 3300050511 nmdc:mga08y16_22775_c1 nmdc:mga08y16_22775_c1_1272_2540 403
157 3300050516 nmdc:mga0sz30_7308_c1 nmdc:mga0sz30_7308_c1_2514_3794 403
158 3300053077 Ga0495601_0040295 Ga0495601_0040295_1206_2477 403
159 3300053078 Ga0495612_0015550 Ga0495612_0015550_140_1411 403
160 3300053084 Ga0495595_0004091 Ga0495595_0004091_258_1529 403
161 3300053085 Ga0495619_0000374 Ga0495619_0000374_27933_29204 403
162 3300053104 Ga0500556_0000002 Ga0500556_0000002_586897_588177 403
163 3300053116 Ga0500592_001387 Ga0500592_001387_752_2032 403
164 3300053130 Ga0500642_0000115 Ga0500642_0000115_31827_33107 403
165 3300053139 Ga0500568_0002196 Ga0500568_0002196_3672_4952 403
166 3300053151 Ga0500604_0007717 Ga0500604_0007717_1139_2419 403
167 3300053153 Ga0500616_0000069 Ga0500616_0000069_70058_71338 403
168 iso_pu_bacteria 2739367655 2739612834 403
169 iso_pu_bacteria 8048746797 8048747687 403
170 3300006175 Ga0070712_100069673 Ga0070712_1000696732 404
171 3300025915 Ga0207693_10064897 Ga0207693_100648972 404
172 3300037418 Ga0395900_0098004 Ga0395900_0098004_400_1668 404
173 3300038443 Ga0395901_0113052 Ga0395901_0113052_179_1447 404
174 3300005327 Ga0070658_10000351 Ga0070658_1000035124 405
175 3300005434 Ga0070709_10000310 Ga0070709_1000031025 405
176 3300005435 Ga0070714_100012169 Ga0070714_1000121692 405
177 3300005436 Ga0070713_100127594 Ga0070713_1001275942 405
178 3300005437 Ga0070710_10002534 Ga0070710_100025344 405
179 3300005439 Ga0070711_100002225 Ga0070711_1000022252 405
180 3300005563 Ga0068855_100013342 Ga0068855_1000133427 405
181 3300005578 Ga0068854_100005459 Ga0068854_1000054594 405
182 3300005614 Ga0068856_100000870 Ga0068856_10000087020 405
183 3300005616 Ga0068852_100000075 Ga0068852_1000000757 405
184 3300006175 Ga0070712_100097845 Ga0070712_1000978452 405
185 3300009093 Ga0105240_10002582 Ga0105240_100025828 405
186 3300009093 Ga0105240_10049609 Ga0105240_100496094 405
187 3300009093 Ga0105240_10080254 Ga0105240_100802543 405
188 3300009551 Ga0105238_10041357 Ga0105238_100413572 405
189 3300010159 Ga0099796_10030027 Ga0099796_100300272 405
190 3300025906 Ga0207699_10013924 Ga0207699_100139244 405
191 3300025909 Ga0207705_10000075 Ga0207705_1000007599 405
192 3300025913 Ga0207695_10041879 Ga0207695_100418792 405
193 3300025913 Ga0207695_10106086 Ga0207695_101060862 405
194 3300025913 Ga0207695_10136440 Ga0207695_101364403 405
195 3300025915 Ga0207693_10010291 Ga0207693_100102912 405
196 3300025916 Ga0207663_10001749 Ga0207663_100017492 405
197 3300025920 Ga0207649_10046672 Ga0207649_100466722 405
198 3300025928 Ga0207700_10010413 Ga0207700_100104136 405
199 3300025949 Ga0207667_10019312 Ga0207667_100193125 405
200 3300025981 Ga0207640_10000996 Ga0207640_1000099612 405
201 3300026078 Ga0207702_10119146 Ga0207702_101191462 405
202 3300026142 Ga0207698_10000005 Ga0207698_10000005147 405
203 3300027671 Ga0209588_1009148 Ga0209588_10091482 405
204 3300028800 Ga0265338_10017352 Ga0265338_100173526 405
205 3300031711 Ga0265314_10047199 Ga0265314_100471991 405
206 3300032004 Ga0307414_10059243 Ga0307414_100592432 405
207 3300049570 Ga0501033_0106597 Ga0501033_0106597_343_1566 405
208 3300049573 Ga0501037_0046474 Ga0501037_0046474_300_1523 405
209 3300049581 Ga0501047_0005396 Ga0501047_0005396_3396_4619 405
210 3300049822 Ga0501035_0027006 Ga0501035_0027006_418_1641 405
211 3300049823 Ga0501044_0008807 Ga0501044_0008807_8372_9595 405
212 3300005539 Ga0068853_100006184 Ga0068853_1000061848 406
213 3300006177 Ga0075362_10017502 Ga0075362_100175022 406
214 3300009545 Ga0105237_10351600 Ga0105237_103516002 406
215 3300026041 Ga0207639_10004126 Ga0207639_100041264 406
216 3300048915 Ga0496112_0016711 Ga0496112_0016711_510_1790 406
217 3300050489 nmdc:mga03683_5346_c1 nmdc:mga03683_5346_c1_1915_3279 406
218 3300005334 Ga0068869_100226981 Ga0068869_1002269811 407
219 3300005434 Ga0070709_10008569 Ga0070709_100085692 407
220 3300005439 Ga0070711_100001947 Ga0070711_10000194710 407
221 3300006175 Ga0070712_100031189 Ga0070712_1000311895 407
222 3300007788 Ga0099795_10020770 Ga0099795_100207702 407
223 3300009011 Ga0105251_10024950 Ga0105251_100249504 407
224 3300009098 Ga0105245_10060256 Ga0105245_100602562 407
225 3300009147 Ga0114129_10008830 Ga0114129_100088306 407
226 3300009174 Ga0105241_10040753 Ga0105241_100407532 407
227 3300010375 Ga0105239_10178740 Ga0105239_101787402 407
228 3300011119 Ga0105246_10248344 Ga0105246_102483441 407
229 3300014745 Ga0157377_10014115 Ga0157377_100141152 407
230 3300025916 Ga0207663_10015808 Ga0207663_100158082 407
231 3300025938 Ga0207704_10215714 Ga0207704_102157142 407
232 3300026121 Ga0207683_10028078 Ga0207683_100280782 407
233 3300035695 Ga0373927_0102460 Ga0373927_0102460_398_1675 407
234 3300044684 Ga0466966_0155289 Ga0466966_0155289_42_1265 407
235 3300046475 Ga0495639_0055033 Ga0495639_0055033_26_1249 407
236 3300046513 Ga0495616_0084039 Ga0495616_0084039_199_1422 407
237 3300046515 Ga0495620_0042192 Ga0495620_0042192_234_1457 407
238 3300046533 Ga0495640_0076083 Ga0495640_0076083_239_1462 407
239 3300046689 Ga0495613_0020414 Ga0495613_0020414_600_1823 407
240 3300047322 Ga0495680_0125717 Ga0495680_0125717_189_1412 407
241 3300048090 Ga0495615_0030541 Ga0495615_0030541_43_1266 407
242 3300048903 Ga0496100_0097807 Ga0496100_0097807_177_1400 407
243 3300048911 Ga0496108_0012723 Ga0496108_0012723_3658_4881 407
244 3300048912 Ga0496109_0059073 Ga0496109_0059073_179_1402 407
245 3300048914 Ga0496111_0064581 Ga0496111_0064581_622_1845 407
246 3300048915 Ga0496112_0065913 Ga0496112_0065913_1095_2318 407
247 3300048916 Ga0496113_0009665 Ga0496113_0009665_2694_3917 407
248 3300050492 nmdc:mga0yw44_100628_c1 nmdc:mga0yw44_100628_c1_518_1741 407
249 3300050507 nmdc:mga05p37_18514_c1 nmdc:mga05p37_18514_c1_4880_6103 407
250 3300050514 nmdc:mga08x19_15383_c1 nmdc:mga08x19_15383_c1_2860_4083 407
251 3300053077 Ga0495601_0120394 Ga0495601_0120394_304_1527 407
252 3300060353 Ga0501082_0000084 Ga0501082_0000084_4255_5478 407
253 3300005937 Ga0081455_10047855 Ga0081455_100478553 408
254 3300049571 Ga0501034_0005818 Ga0501034_0005818_8967_10328 409
255 3300005937 Ga0081455_10010846 Ga0081455_100108467 410
256 3300005983 Ga0081540_1001759 Ga0081540_100175912 410
257 3300014325 Ga0163163_10000491 Ga0163163_1000049136 410
258 3300021441 Ga0213871_10003652 Ga0213871_100036522 410
259 3300025272 Ga0209455_1002034 Ga0209455_10020349 410
260 3300039438 Ga0436360_0762773 Ga0436360_0762773_198_1490 410
261 3300049589 Ga0501073_0076193 Ga0501073_0076193_17_1402 410
262 3300009101 Ga0105247_10016598 Ga0105247_100165983 411
263 3300009545 Ga0105237_10103646 Ga0105237_101036462 411
264 3300010159 Ga0099796_10008753 Ga0099796_100087532 411
265 3300025900 Ga0207710_10019075 Ga0207710_100190752 411
266 3300025914 Ga0207671_10198089 Ga0207671_101980892 411
267 3300028577 Ga0265318_10000015 Ga0265318_10000015115 411
268 3300031247 Ga0265340_10032893 Ga0265340_100328933 411
269 3300048924 Ga0496121_0076249 Ga0496121_0076249_1363_2631 411
270 3300048929 Ga0496126_0102827 Ga0496126_0102827_979_2247 411
271 3300049569 Ga0501032_0017717 Ga0501032_0017717_3265_4572 411
272 3300049570 Ga0501033_0012332 Ga0501033_0012332_3769_5076 411
273 3300049571 Ga0501034_0079596 Ga0501034_0079596_1804_3111 411
274 3300049574 Ga0501038_0076882 Ga0501038_0076882_952_2259 411
275 3300049575 Ga0501039_0037800 Ga0501039_0037800_191_1498 411
276 3300049580 Ga0501046_0032910 Ga0501046_0032910_492_1799 411
277 3300049581 Ga0501047_0057254 Ga0501047_0057254_415_1722 411
278 3300049585 Ga0501069_0049752 Ga0501069_0049752_26_1348 411
279 3300049587 Ga0501071_0067076 Ga0501071_0067076_659_1966 411
280 3300049588 Ga0501072_0081943 Ga0501072_0081943_414_1721 411
281 3300049589 Ga0501073_0081044 Ga0501073_0081044_437_1744 411
282 3300049742 Ga0501080_0025164 Ga0501080_0025164_1704_3011 411
283 3300049822 Ga0501035_0019433 Ga0501035_0019433_3966_5273 411
284 3300049823 Ga0501044_0111682 Ga0501044_0111682_952_2259 411
285 3300003322 rootL2_10059231 rootL2_100592315 412
286 3300005616 Ga0068852_100038546 Ga0068852_1000385463 412
287 3300013102 Ga0157371_10017806 Ga0157371_100178064 412
288 3300013104 Ga0157370_10187418 Ga0157370_101874182 412
289 3300013297 Ga0157378_10153594 Ga0157378_101535942 412
290 3300026078 Ga0207702_10011446 Ga0207702_100114462 412
291 3300026116 Ga0207674_10274086 Ga0207674_102740861 412
292 3300026142 Ga0207698_10077032 Ga0207698_100770322 412
293 3300033442 Ga0315911_1000001 Ga0315911_10000011015 412
294 3300037471 Ga0395905_0008572 Ga0395905_0008572_6397_7677 412
295 3300037853 Ga0436364_0883805 Ga0436364_0883805_265_1533 412
296 3300039437 Ga0436365_0300465 Ga0436365_0300465_116_1360 412
297 3300039437 Ga0436365_1822707 Ga0436365_1822707_262_1530 412
298 3300045976 Ga0466967_0230529 Ga0466967_0230529_471_1715 412
299 3300047320 Ga0495672_0023135 Ga0495672_0023135_1828_3096 412
300 3300048918 Ga0496115_0152394 Ga0496115_0152394_602_1882 412
301 3300048929 Ga0496126_0005363 Ga0496126_0005363_10354_11634 412
302 3300048929 Ga0496126_0040376 Ga0496126_0040376_2691_3971 412
303 3300053156 Ga0500622_0036772 Ga0500622_0036772_1124_2452 412
304 3300005355 Ga0070671_100070267 Ga0070671_1000702671 413
305 3300005455 Ga0070663_100017486 Ga0070663_1000174863 413
306 3300005843 Ga0068860_100000258 Ga0068860_10000025855 413
307 3300025915 Ga0207693_10003998 Ga0207693_100039984 413
308 3300026067 Ga0207678_10038638 Ga0207678_100386382 413
309 3300028381 Ga0268264_10000245 Ga0268264_1000024568 413
310 3300031616 Ga0307508_10001153 Ga0307508_100011534 413
311 3300046537 Ga0495598_0019139 Ga0495598_0019139_22_1329 413
312 3300048922 Ga0496119_0046060 Ga0496119_0046060_662_1951 413
313 3300048924 Ga0496121_0149551 Ga0496121_0149551_392_1681 413
314 3300048929 Ga0496126_0182215 Ga0496126_0182215_411_1700 413
315 3300050510 nmdc:mga06r32_146745_c1 nmdc:mga06r32_146745_c1_239_1507 413
316 3300053077 Ga0495601_0024258 Ga0495601_0024258_702_1970 413
317 3300053094 Ga0500566_0000082 Ga0500566_0000082_37249_38514 413
318 iso_pu_bacteria 643348564 643601799 413
319 3300003320 rootH2_10023059 rootH2_100230593 414
320 3300005343 Ga0070687_100073037 Ga0070687_1000730371 414
321 3300005937 Ga0081455_10009585 Ga0081455_1000958511 414
322 3300006038 Ga0075365_10166393 Ga0075365_101663931 414
323 3300025926 Ga0207659_10155066 Ga0207659_101550661 414
324 3300026075 Ga0207708_10042582 Ga0207708_100425821 414
325 3300026118 Ga0207675_100020640 Ga0207675_1000206405 414
326 3300026121 Ga0207683_10082337 Ga0207683_100823373 414
327 3300028380 Ga0268265_10008971 Ga0268265_100089716 414
328 iso_pu_bacteria 2508501127 2509144716 414
329 iso_pu_bacteria 2545555834 2545679365 414
330 iso_pu_bacteria 2889306138 2889311795 414
331 iso_pu_bacteria 2902330777 2902335374 414
332 iso_pu_bacteria 2902405164 2902409465 414
333 iso_pu_bacteria 641522639 641644550 414
334 3300021384 Ga0213876_10000908 Ga0213876_1000090814 415
335 3300039437 Ga0436365_0599448 Ga0436365_0599448_15166_16446 415
336 3300046517 Ga0495630_0036955 Ga0495630_0036955_116_1384 415
337 3300046642 Ga0495634_0030570 Ga0495634_0030570_270_1538 415
338 3300046690 Ga0495624_0046918 Ga0495624_0046918_465_1733 415
339 3300047319 Ga0495674_0053632 Ga0495674_0053632_441_1709 415
340 3300053077 Ga0495601_0004531 Ga0495601_0004531_5265_6533 415
341 iso_pu_bacteria 2508501042 2508698851 415
342 iso_pu_bacteria 2595698237 2596375124 415
343 iso_pu_bacteria 2738541281 2738744551 415
344 iso_pu_bacteria 2738543032 2739353781 415
345 iso_pu_bacteria 2829745981 2829748923 415
346 iso_pu_bacteria 2842698319 2842701408 415
347 iso_pu_bacteria 2861691609 2861694959 415
348 iso_pu_bacteria 2928125067 2928126474 415
349 iso_pu_bacteria 2935984226 2935989574 415
350 iso_pu_bacteria 3003665799 3003670801 415
351 3300005444 Ga0070694_100137370 Ga0070694_1001373702 416
352 3300009092 Ga0105250_10027657 Ga0105250_100276572 416
353 3300009094 Ga0111539_10115103 Ga0111539_101151031 416
354 3300009098 Ga0105245_10092135 Ga0105245_100921352 416
355 3300025297 Ga0209758_1001790 Ga0209758_100179013 416
356 3300025933 Ga0207706_10012680 Ga0207706_100126802 416
357 3300025961 Ga0207712_10162224 Ga0207712_101622243 416
358 3300028577 Ga0265318_10033968 Ga0265318_100339682 416
359 3300031250 Ga0265331_10008230 Ga0265331_100082305 416
360 3300031595 Ga0265313_10000482 Ga0265313_1000048215 416
361 3300031711 Ga0265314_10015573 Ga0265314_100155732 416
362 3300046525 Ga0495663_0011031 Ga0495663_0011031_760_2031 416
363 3300046537 Ga0495598_0009785 Ga0495598_0009785_729_2015 416
364 3300046615 Ga0495656_0004791 Ga0495656_0004791_2547_3833 416
365 3300046674 Ga0495588_0001989 Ga0495588_0001989_552_1823 416
366 3300046681 Ga0495647_0070743 Ga0495647_0070743_71_1342 416
367 3300046691 Ga0495670_0011468 Ga0495670_0011468_351_1637 416
368 3300048920 Ga0496117_0131036 Ga0496117_0131036_36_1307 416
369 3300048929 Ga0496126_0012601 Ga0496126_0012601_1800_3071 416
370 iso_pu_bacteria 2885366525 2885371799 416
371 iso_pu_bacteria 2903727486 2903728964 416
372 iso_pu_bacteria 2932794094 2932797443 416
373 iso_pu_bacteria 3005594810 3005599260 416
374 iso_pu_bacteria 8056967851 8056968059 416
375 3300028800 Ga0265338_10000005 Ga0265338_10000005446 417
376 3300031241 Ga0265325_10000005 Ga0265325_1000000571 417
377 3300031249 Ga0265339_10000622 Ga0265339_1000062230 417
378 3300048907 Ga0496104_0072489 Ga0496104_0072489_1841_3106 417
379 3300049568 Ga0501031_0004551 Ga0501031_0004551_3281_4561 417
380 3300049569 Ga0501032_0029614 Ga0501032_0029614_309_1589 417
381 3300049570 Ga0501033_0020067 Ga0501033_0020067_720_2000 417
382 3300049573 Ga0501037_0026075 Ga0501037_0026075_578_1858 417
383 3300049575 Ga0501039_0019245 Ga0501039_0019245_450_1730 417
384 3300049581 Ga0501047_0017866 Ga0501047_0017866_2462_3742 417
385 3300049582 Ga0501048_0011226 Ga0501048_0011226_3043_4323 417
386 3300049584 Ga0501068_0008709 Ga0501068_0008709_846_2126 417
387 3300049589 Ga0501073_0014281 Ga0501073_0014281_1105_2385 417
388 3300049590 Ga0501074_0023846 Ga0501074_0023846_436_1716 417
389 3300049744 Ga0501083_0015481 Ga0501083_0015481_2462_3742 417
390 3300049824 Ga0501045_0011643 Ga0501045_0011643_3375_4655 417
391 3300054114 Ga0501084_0027346 Ga0501084_0027346_91_1371 417
392 3300060353 Ga0501082_0092963 Ga0501082_0092963_1224_2504 417
393 iso_pu_bacteria 2513237101 2513694437 417
394 iso_pu_bacteria 2513237104 2513718655 417
395 iso_pu_bacteria 2643221629 2644167500 417
396 iso_pu_bacteria 2643221662 2644347263 417
397 iso_pu_bacteria 2874604998 2874607026 417
398 iso_pu_bacteria 2922361189 2922364696 417
399 iso_pu_bacteria 8006964411 8006972493 417
400 iso_pu_bacteria 8006994254 8006995272 417
401 3300025911 Ga0207654_10115582 Ga0207654_101155821 418
402 3300046694 Ga0495649_0007881 Ga0495649_0007881_3688_4971 418
403 3300047320 Ga0495672_0015830 Ga0495672_0015830_63_1346 418
404 3300049571 Ga0501034_0196613 Ga0501034_0196613_25_1299 418
405 3300053178 Ga0500637_0094081 Ga0500637_0094081_122_1405 418
406 iso_pu_bacteria 2524023228 2524534115 418
407 iso_pu_bacteria 2643221580 2643912255 418
408 iso_pu_bacteria 2643221629 2644167499 418
409 iso_pu_bacteria 2643221662 2644347262 418
410 iso_pu_bacteria 2643221674 2644410568 418
411 iso_pu_bacteria 2791355199 2793079789 418
412 iso_pu_bacteria 2876808645 2876817979 418
413 iso_pu_bacteria 2879110137 2879117142 418
414 iso_pu_bacteria 2881364244 2881366734 418
415 iso_pu_bacteria 2889033259 2889034875 418
416 iso_pu_bacteria 2904699407 2904702139 418
417 iso_pu_bacteria 2932401849 2932403311 418
418 iso_pu_bacteria 8006933436 8006940197 418
419 iso_pu_bacteria 8006973647 8006979976 418
420 iso_pu_bacteria 8006984368 8006988520 418
421 iso_pu_bacteria 8016548790 8016553335 418
422 iso_pu_bacteria 8056673599 8056679233 418
423 3300005262 Ga0065165_1014273 Ga0065165_10142734 419
424 3300005341 Ga0070691_10000026 Ga0070691_1000002633 419
425 3300005434 Ga0070709_10000739 Ga0070709_100007399 419
426 3300005436 Ga0070713_100000008 Ga0070713_100000008135 419
427 3300005440 Ga0070705_100009562 Ga0070705_1000095622 419
428 3300005530 Ga0070679_100093559 Ga0070679_1000935592 419
429 3300005614 Ga0068856_100000362 Ga0068856_10000036245 419
430 3300006175 Ga0070712_100000435 Ga0070712_10000043517 419
431 3300006177 Ga0075362_10003250 Ga0075362_100032502 419
432 3300006914 Ga0075436_100000099 Ga0075436_10000009923 419
433 3300007076 Ga0075435_100155992 Ga0075435_1001559922 419
434 3300009174 Ga0105241_10158401 Ga0105241_101584012 419
435 3300010375 Ga0105239_10122337 Ga0105239_101223374 419
436 3300025299 Ga0209256_1005139 Ga0209256_10051396 419
437 3300025302 Ga0207426_1003018 Ga0207426_10030188 419
438 3300025898 Ga0207692_10020782 Ga0207692_100207822 419
439 3300025906 Ga0207699_10000140 Ga0207699_100001405 419
440 3300025911 Ga0207654_10098316 Ga0207654_100983162 419
441 3300025915 Ga0207693_10001130 Ga0207693_1000113017 419
442 3300025924 Ga0207694_10021178 Ga0207694_100211782 419
443 3300025928 Ga0207700_10000011 Ga0207700_1000001178 419
444 3300025949 Ga0207667_10028571 Ga0207667_100285715 419
445 3300026078 Ga0207702_10000162 Ga0207702_100001625 419
446 3300036401 Ga0373937_0137423 Ga0373937_0137423_254_1612 419
447 3300039437 Ga0436365_1340575 Ga0436365_1340575_541_1821 419
448 3300046472 Ga0495580_0053797 Ga0495580_0053797_86_1444 419
449 3300049569 Ga0501032_0176984 Ga0501032_0176984_17_1285 419
450 3300049571 Ga0501034_0005818 Ga0501034_0005818_10325_11686 419
451 3300049822 Ga0501035_0011540 Ga0501035_0011540_1361_2629 419
452 3300049823 Ga0501044_0001970 Ga0501044_0001970_4716_5984 419
453 3300049823 Ga0501044_0064394 Ga0501044_0064394_665_1933 419
454 3300050489 nmdc:mga03683_22010_c1 nmdc:mga03683_22010_c1_51_1361 419
455 3300050513 nmdc:mga0rr50_87676_c1 nmdc:mga0rr50_87676_c1_984_2279 419
456 3300050514 nmdc:mga08x19_394_c1 nmdc:mga08x19_394_c1_156_1451 419
457 3300053119 Ga0500595_001314 Ga0500595_001314_5721_6989 419
458 3300053136 Ga0500559_0046470 Ga0500559_0046470_220_1488 419
459 3300053163 Ga0500639_039988 Ga0500639_039988_766_2034 419
460 iso_pu_bacteria 2509276022 2509396503 419
461 iso_pu_bacteria 2597489875 2597813552 419
462 iso_pu_bacteria 2841734538 2841739473 419
463 iso_pu_bacteria 2856342000 2856347445 419
464 iso_pu_bacteria 2871474448 2871479635 419
465 iso_pu_bacteria 2878788777 2878794749 419
466 iso_pu_bacteria 2885312484 2885317797 419
467 iso_pu_bacteria 2888343758 2888347002 419
468 iso_pu_bacteria 2924754689 2924755070 419
469 iso_pu_bacteria 2937836603 2937839044 419
470 iso_pu_bacteria 2958071322 2958078014 419
471 iso_pu_bacteria 2970524798 2970530523 419
472 iso_pu_bacteria 2970540015 2970544169 419
473 iso_pu_bacteria 8004395343 8004400175 419
474 iso_pu_bacteria 8004633249 8004637217 419
475 iso_pu_bacteria 8055617313 8055620968 419
476 3300003214 JGI25165J46597_1000003 JGI25165J46597_100000328 420
477 3300005327 Ga0070658_10008885 Ga0070658_100088856 420
478 3300005334 Ga0068869_100020011 Ga0068869_1000200113 420
479 3300005339 Ga0070660_100017700 Ga0070660_1000177003 420
480 3300005339 Ga0070660_100023813 Ga0070660_1000238132 420
481 3300005548 Ga0070665_100000377 Ga0070665_10000037739 420
482 3300005563 Ga0068855_100031633 Ga0068855_1000316333 420
483 3300005985 Ga0081539_10034606 Ga0081539_100346062 420
484 3300006178 Ga0075367_10003260 Ga0075367_100032602 420
485 3300006353 Ga0075370_10002012 Ga0075370_100020125 420
486 3300009545 Ga0105237_10015554 Ga0105237_100155543 420
487 3300009551 Ga0105238_10087423 Ga0105238_100874232 420
488 3300010375 Ga0105239_10073728 Ga0105239_100737282 420
489 3300021320 Ga0214544_1017682 Ga0214544_10176823 420
490 3300021321 Ga0214542_1018937 Ga0214542_10189373 420
491 3300021324 Ga0214545_1018591 Ga0214545_10185913 420
492 3300021327 Ga0214543_1017937 Ga0214543_10179373 420
493 3300025261 Ga0209233_1000015 Ga0209233_1000015752 420
494 3300025909 Ga0207705_10015279 Ga0207705_100152795 420
495 3300025909 Ga0207705_10016993 Ga0207705_100169936 420
496 3300025913 Ga0207695_10353832 Ga0207695_103538321 420
497 3300025914 Ga0207671_10018286 Ga0207671_100182861 420
498 3300025919 Ga0207657_10025197 Ga0207657_100251973 420
499 3300025919 Ga0207657_10048737 Ga0207657_100487374 420
500 3300025949 Ga0207667_10073041 Ga0207667_100730414 420
501 3300028379 Ga0268266_10000727 Ga0268266_100007276 420
502 3300028800 Ga0265338_10017836 Ga0265338_100178367 420
503 3300031235 Ga0265330_10037738 Ga0265330_100377382 420
504 3300031240 Ga0265320_10000561 Ga0265320_1000056121 420
505 3300031241 Ga0265325_10006286 Ga0265325_100062867 420
506 3300031249 Ga0265339_10001947 Ga0265339_100019479 420
507 3300031595 Ga0265313_10000032 Ga0265313_10000032128 420
508 3300037853 Ga0436364_0344786 Ga0436364_0344786_137_1399 420
509 3300039437 Ga0436365_1236061 Ga0436365_1236061_622_1938 420
510 3300042004 Ga0439445_0007388 Ga0439445_0007388_557_1921 420
511 3300044842 Ga0466957_0115147 Ga0466957_0115147_98_1384 420
512 3300046507 Ga0495606_0015801 Ga0495606_0015801_2621_3904 420
513 3300046694 Ga0495649_0039226 Ga0495649_0039226_980_2263 420
514 3300048924 Ga0496121_0001453 Ga0496121_0001453_33913_35196 420
515 3300048929 Ga0496126_0044205 Ga0496126_0044205_243_1508 420
516 3300048929 Ga0496126_0052280 Ga0496126_0052280_1830_3113 420
517 3300049571 Ga0501034_0049402 Ga0501034_0049402_410_1774 420
518 3300049822 Ga0501035_0082971 Ga0501035_0082971_1048_2406 420
519 3300050491 nmdc:mga00v17_56888_c1 nmdc:mga00v17_56888_c1_589_1953 420
520 3300050496 nmdc:mga07m45_15508_c1 nmdc:mga07m45_15508_c1_2475_3839 420
521 3300053119 Ga0500595_023161 Ga0500595_023161_199_1482 420
522 iso_pu_bacteria 2513237094 2513638954 420
523 iso_pu_bacteria 2908775508 2908779444 420
524 3300002705 JGI25156J39149_1003138 JGI25156J39149_10031385 421
525 3300005327 Ga0070658_10175010 Ga0070658_101750102 421
526 3300005339 Ga0070660_100054928 Ga0070660_1000549282 421
527 3300005366 Ga0070659_100043240 Ga0070659_1000432404 421
528 3300005455 Ga0070663_100037815 Ga0070663_1000378152 421
529 3300005539 Ga0068853_100005373 Ga0068853_1000053733 421
530 3300005539 Ga0068853_100080394 Ga0068853_1000803943 421
531 3300005548 Ga0070665_100012096 Ga0070665_1000120962 421
532 3300005548 Ga0070665_100034898 Ga0070665_1000348982 421
533 3300005548 Ga0070665_100065580 Ga0070665_1000655804 421
534 3300005548 Ga0070665_100103296 Ga0070665_1001032962 421
535 3300005564 Ga0070664_100156385 Ga0070664_1001563852 421
536 3300005577 Ga0068857_100069357 Ga0068857_1000693572 421
537 3300005578 Ga0068854_100088901 Ga0068854_1000889011 421
538 3300005616 Ga0068852_100023190 Ga0068852_1000231902 421
539 3300005616 Ga0068852_100032917 Ga0068852_1000329172 421
540 3300005834 Ga0068851_10040291 Ga0068851_100402912 421
541 3300005937 Ga0081455_10010629 Ga0081455_100106299 421
542 3300005981 Ga0081538_10040597 Ga0081538_100405972 421
543 3300005983 Ga0081540_1001861 Ga0081540_100186111 421
544 3300005983 Ga0081540_1004924 Ga0081540_10049242 421
545 3300006038 Ga0075365_10053925 Ga0075365_100539254 421
546 3300006038 Ga0075365_10080968 Ga0075365_100809681 421
547 3300006048 Ga0075363_100000277 Ga0075363_1000002771 421
548 3300006051 Ga0075364_10023673 Ga0075364_100236731 421
549 3300006051 Ga0075364_10077019 Ga0075364_100770192 421
550 3300006177 Ga0075362_10071535 Ga0075362_100715351 421
551 3300006186 Ga0075369_10009418 Ga0075369_100094182 421
552 3300006195 Ga0075366_10085159 Ga0075366_100851591 421
553 3300006353 Ga0075370_10027740 Ga0075370_100277403 421
554 3300006846 Ga0075430_100120227 Ga0075430_1001202271 421
555 3300009093 Ga0105240_10013140 Ga0105240_100131409 421
556 3300009093 Ga0105240_10176069 Ga0105240_101760692 421
557 3300009098 Ga0105245_10018686 Ga0105245_100186862 421
558 3300009101 Ga0105247_10081824 Ga0105247_100818242 421
559 3300009174 Ga0105241_10255250 Ga0105241_102552501 421
560 3300009545 Ga0105237_10000821 Ga0105237_1000082117 421
561 3300009551 Ga0105238_10204252 Ga0105238_102042522 421
562 3300009551 Ga0105238_10215860 Ga0105238_102158602 421
563 3300009551 Ga0105238_10267093 Ga0105238_102670932 421
564 3300010375 Ga0105239_10150135 Ga0105239_101501352 421
565 3300011119 Ga0105246_10014170 Ga0105246_100141702 421
566 3300013104 Ga0157370_10015443 Ga0157370_100154433 421
567 3300013104 Ga0157370_10247322 Ga0157370_102473221 421
568 3300013105 Ga0157369_10022874 Ga0157369_100228745 421
569 3300013297 Ga0157378_10231739 Ga0157378_102317392 421
570 3300013307 Ga0157372_10307561 Ga0157372_103075612 421
571 3300025261 Ga0209233_1000408 Ga0209233_100040827 421
572 3300025297 Ga0209758_1008526 Ga0209758_10085262 421
573 3300025913 Ga0207695_10114018 Ga0207695_101140181 421
574 3300025914 Ga0207671_10000227 Ga0207671_1000022775 421
575 3300025919 Ga0207657_10017207 Ga0207657_100172072 421
576 3300025924 Ga0207694_10113051 Ga0207694_101130512 421
577 3300025925 Ga0207650_10100874 Ga0207650_101008742 421
578 3300025927 Ga0207687_10247019 Ga0207687_102470191 421
579 3300025932 Ga0207690_10131151 Ga0207690_101311512 421
580 3300025940 Ga0207691_10195302 Ga0207691_101953022 421
581 3300025941 Ga0207711_10113524 Ga0207711_101135241 421
582 3300025942 Ga0207689_10028141 Ga0207689_100281415 421
583 3300025949 Ga0207667_10012235 Ga0207667_100122352 421
584 3300025949 Ga0207667_10226843 Ga0207667_102268431 421
585 3300026035 Ga0207703_10111931 Ga0207703_101119311 421
586 3300026041 Ga0207639_10045949 Ga0207639_100459492 421
587 3300026067 Ga0207678_10007632 Ga0207678_100076322 421
588 3300026067 Ga0207678_10011088 Ga0207678_1001108810 421
589 3300026067 Ga0207678_10033440 Ga0207678_100334403 421
590 3300026078 Ga0207702_10065053 Ga0207702_100650533 421
591 3300026088 Ga0207641_10206087 Ga0207641_102060872 421
592 3300026088 Ga0207641_10313168 Ga0207641_103131681 421
593 3300026089 Ga0207648_10135498 Ga0207648_101354982 421
594 3300026116 Ga0207674_10014539 Ga0207674_100145397 421
595 3300026121 Ga0207683_10123150 Ga0207683_101231501 421
596 3300026142 Ga0207698_10251692 Ga0207698_102516921 421
597 3300028379 Ga0268266_10000677 Ga0268266_1000067733 421
598 3300028379 Ga0268266_10001826 Ga0268266_1000182613 421
599 3300028379 Ga0268266_10003534 Ga0268266_100035342 421
600 3300028379 Ga0268266_10096334 Ga0268266_100963342 421
601 3300028794 Ga0307515_10258980 Ga0307515_102589801 421
602 3300031250 Ga0265331_10050878 Ga0265331_100508781 421
603 3300031711 Ga0265314_10028710 Ga0265314_100287104 421
604 3300031995 Ga0307409_100135333 Ga0307409_1001353332 421
605 3300032002 Ga0307416_100110690 Ga0307416_1001106902 421
606 3300033180 Ga0307510_10003330 Ga0307510_1000333013 421
607 3300035691 Ga0373931_0021073 Ga0373931_0021073_224_1591 421
608 3300037312 Ga0395899_0000151 Ga0395899_0000151_54263_55546 421
609 3300046452 Ga0495617_039501 Ga0495617_039501_60_1331 421
610 3300046457 Ga0495590_0025611 Ga0495590_0025611_577_1848 421
611 3300046471 Ga0495650_0049588 Ga0495650_0049588_361_1632 421
612 3300046492 Ga0495585_0052560 Ga0495585_0052560_130_1401 421
613 3300046499 Ga0495594_0028286 Ga0495594_0028286_1094_2365 421
614 3300046501 Ga0495607_0052549 Ga0495607_0052549_247_1518 421
615 3300046512 Ga0495610_0046336 Ga0495610_0046336_837_2108 421
616 3300046513 Ga0495616_0024868 Ga0495616_0024868_1648_2919 421
617 3300046518 Ga0495631_0031506 Ga0495631_0031506_305_1576 421
618 3300046519 Ga0495632_0048220 Ga0495632_0048220_207_1478 421
619 3300046524 Ga0495648_0070035 Ga0495648_0070035_541_1812 421
620 3300046525 Ga0495663_0018223 Ga0495663_0018223_693_1964 421
621 3300046528 Ga0495642_0035680 Ga0495642_0035680_449_1792 421
622 3300046538 Ga0495609_0043291 Ga0495609_0043291_263_1534 421
623 3300046615 Ga0495656_0011721 Ga0495656_0011721_481_1752 421
624 3300046648 Ga0495611_0029288 Ga0495611_0029288_888_2159 421
625 3300046665 Ga0495661_0134686 Ga0495661_0134686_15_1286 421
626 3300046691 Ga0495670_0052910 Ga0495670_0052910_114_1385 421
627 3300046694 Ga0495649_0069132 Ga0495649_0069132_150_1421 421
628 3300046794 Ga0495589_0037484 Ga0495589_0037484_682_1953 421
629 3300047445 Ga0495677_0049378 Ga0495677_0049378_87_1358 421
630 3300048905 Ga0496102_0072275 Ga0496102_0072275_1606_2871 421
631 3300048905 Ga0496102_0076352 Ga0496102_0076352_1446_2717 421
632 3300048907 Ga0496104_0047965 Ga0496104_0047965_2055_3326 421
633 3300048921 Ga0496118_0140762 Ga0496118_0140762_38_1309 421
634 3300048929 Ga0496126_0030143 Ga0496126_0030143_1217_2587 421
635 3300049460 Ga0495682_0025804 Ga0495682_0025804_840_2111 421
636 3300049568 Ga0501031_0007975 Ga0501031_0007975_2090_3400 421
637 3300049568 Ga0501031_0015856 Ga0501031_0015856_2277_3644 421
638 3300049570 Ga0501033_0003960 Ga0501033_0003960_1889_3199 421
639 3300049570 Ga0501033_0049959 Ga0501033_0049959_703_2070 421
640 3300049571 Ga0501034_0007444 Ga0501034_0007444_427_1737 421
641 3300049571 Ga0501034_0101821 Ga0501034_0101821_823_2190 421
642 3300049572 Ga0501036_0000992 Ga0501036_0000992_11291_12601 421
643 3300049572 Ga0501036_0002298 Ga0501036_0002298_12934_14301 421
644 3300049573 Ga0501037_0001908 Ga0501037_0001908_761_2071 421
645 3300049573 Ga0501037_0028885 Ga0501037_0028885_1346_2713 421
646 3300049574 Ga0501038_0017132 Ga0501038_0017132_5043_6353 421
647 3300049574 Ga0501038_0030908 Ga0501038_0030908_2469_3836 421
648 3300049575 Ga0501039_0020632 Ga0501039_0020632_2897_4264 421
649 3300049576 Ga0501040_0021621 Ga0501040_0021621_2016_3326 421
650 3300049579 Ga0501043_0022088 Ga0501043_0022088_2492_3859 421
651 3300049580 Ga0501046_0013563 Ga0501046_0013563_4920_6230 421
652 3300049581 Ga0501047_0047369 Ga0501047_0047369_1873_3240 421
653 3300049581 Ga0501047_0066167 Ga0501047_0066167_941_2308 421
654 3300049582 Ga0501048_0012479 Ga0501048_0012479_2094_3404 421
655 3300049585 Ga0501069_0007703 Ga0501069_0007703_3467_4777 421
656 3300049586 Ga0501070_0002559 Ga0501070_0002559_14180_15490 421
657 3300049586 Ga0501070_0009673 Ga0501070_0009673_6512_7879 421
658 3300049586 Ga0501070_0019935 Ga0501070_0019935_1989_3356 421
659 3300049588 Ga0501072_0113619 Ga0501072_0113619_10_1320 421
660 3300049589 Ga0501073_0000802 Ga0501073_0000802_1803_3113 421
661 3300049590 Ga0501074_0000138 Ga0501074_0000138_27296_28606 421
662 3300049593 Ga0501077_0144320 Ga0501077_0144320_72_1382 421
663 3300049741 Ga0501079_0002710 Ga0501079_0002710_6806_8116 421
664 3300049744 Ga0501083_0031844 Ga0501083_0031844_1980_3290 421
665 3300049822 Ga0501035_0024254 Ga0501035_0024254_1144_2511 421
666 3300049822 Ga0501035_0089302 Ga0501035_0089302_554_1921 421
667 3300049822 Ga0501035_0126136 Ga0501035_0126136_714_2024 421
668 3300049823 Ga0501044_0023213 Ga0501044_0023213_256_1623 421
669 3300049823 Ga0501044_0044972 Ga0501044_0044972_202_1512 421
670 3300049823 Ga0501044_0105644 Ga0501044_0105644_517_1884 421
671 3300050490 nmdc:mga03n38_159_c1 nmdc:mga03n38_159_c1_1242_2513 421
672 3300050492 nmdc:mga0yw44_3790_c1 nmdc:mga0yw44_3790_c1_2492_3763 421
673 3300050493 nmdc:mga0k408_90708_c1 nmdc:mga0k408_90708_c1_106_1377 421
674 3300050496 nmdc:mga07m45_27984_c1 nmdc:mga07m45_27984_c1_876_2147 421
675 3300050512 nmdc:mga0n895_221558_c1 nmdc:mga0n895_221558_c1_406_1677 421
676 3300050516 nmdc:mga0sz30_82403_c1 nmdc:mga0sz30_82403_c1_85_1356 421
677 3300053096 Ga0500641_0006634 Ga0500641_0006634_966_2237 421
678 3300053119 Ga0500595_006225 Ga0500595_006225_635_1906 421
679 3300053147 Ga0500589_049180 Ga0500589_049180_245_1690 421
680 3300053161 Ga0500634_0000517 Ga0500634_0000517_7136_8506 421
681 3300053161 Ga0500634_0073233 Ga0500634_0073233_298_1743 421
682 3300053731 Ga0500609_006233 Ga0500609_006233_345_1616 421
683 3300060353 Ga0501082_0005189 Ga0501082_0005189_4462_5772 421
684 iso_pu_bacteria 2891048133 2891050974 421
685 iso_pu_bacteria 2995392953 2995393177 421
686 3300001977 JGI24746J21847_1009646 JGI24746J21847_10096461 422
687 3300001991 JGI24743J22301_10001131 JGI24743J22301_100011312 422
688 3300002074 JGI24748J21848_1000838 JGI24748J21848_10008382 422
689 3300002077 JGI24744J21845_10000785 JGI24744J21845_100007857 422
690 3300003203 JGI25406J46586_10005795 JGI25406J46586_100057953 422
691 3300003911 JGI25405J52794_10009494 JGI25405J52794_100094941 422
692 3300005328 Ga0070676_10067725 Ga0070676_100677252 422
693 3300005329 Ga0070683_100177210 Ga0070683_1001772102 422
694 3300005330 Ga0070690_100065156 Ga0070690_1000651562 422
695 3300005331 Ga0070670_100032008 Ga0070670_1000320082 422
696 3300005336 Ga0070680_100100240 Ga0070680_1001002402 422
697 3300005345 Ga0070692_10014598 Ga0070692_100145982 422
698 3300005353 Ga0070669_100033359 Ga0070669_1000333592 422
699 3300005354 Ga0070675_100041650 Ga0070675_1000416503 422
700 3300005355 Ga0070671_100002638 Ga0070671_1000026387 422
701 3300005356 Ga0070674_100010253 Ga0070674_1000102533 422
702 3300005406 Ga0070703_10032672 Ga0070703_100326722 422
703 3300005434 Ga0070709_10040728 Ga0070709_100407282 422
704 3300005435 Ga0070714_100001250 Ga0070714_10000125012 422
705 3300005436 Ga0070713_100000522 Ga0070713_1000005225 422
706 3300005436 Ga0070713_100024863 Ga0070713_1000248632 422
707 3300005436 Ga0070713_100264608 Ga0070713_1002646081 422
708 3300005437 Ga0070710_10000543 Ga0070710_100005436 422
709 3300005518 Ga0070699_100035800 Ga0070699_1000358005 422
710 3300005535 Ga0070684_100158634 Ga0070684_1001586342 422
711 3300005539 Ga0068853_100127873 Ga0068853_1001278732 422
712 3300005544 Ga0070686_100006493 Ga0070686_1000064933 422
713 3300005564 Ga0070664_100018970 Ga0070664_1000189702 422
714 3300005577 Ga0068857_100026875 Ga0068857_1000268753 422
715 3300005615 Ga0070702_100047408 Ga0070702_1000474082 422
716 3300005616 Ga0068852_100025004 Ga0068852_1000250042 422
717 3300005617 Ga0068859_100149326 Ga0068859_1001493262 422
718 3300005618 Ga0068864_100002778 Ga0068864_10000277811 422
719 3300005719 Ga0068861_100047107 Ga0068861_1000471072 422
720 3300005840 Ga0068870_10001735 Ga0068870_100017356 422
721 3300005841 Ga0068863_100001004 Ga0068863_1000010046 422
722 3300005843 Ga0068860_100019841 Ga0068860_1000198417 422
723 3300005844 Ga0068862_100040727 Ga0068862_1000407273 422
724 3300005937 Ga0081455_10002974 Ga0081455_1000297411 422
725 3300005937 Ga0081455_10007544 Ga0081455_100075449 422
726 3300005937 Ga0081455_10030415 Ga0081455_100304152 422
727 3300005981 Ga0081538_10013903 Ga0081538_100139032 422
728 3300005983 Ga0081540_1000194 Ga0081540_100019443 422
729 3300005983 Ga0081540_1014066 Ga0081540_10140665 422
730 3300005983 Ga0081540_1034596 Ga0081540_10345962 422
731 3300006028 Ga0070717_10000447 Ga0070717_1000044719 422
732 3300006028 Ga0070717_10103218 Ga0070717_101032183 422
733 3300006038 Ga0075365_10163517 Ga0075365_101635171 422
734 3300006163 Ga0070715_10001232 Ga0070715_100012324 422
735 3300006173 Ga0070716_100015222 Ga0070716_1000152223 422
736 3300006175 Ga0070712_100009926 Ga0070712_1000099264 422
737 3300006175 Ga0070712_100013554 Ga0070712_1000135544 422
738 3300006177 Ga0075362_10033274 Ga0075362_100332742 422
739 3300006177 Ga0075362_10047352 Ga0075362_100473522 422
740 3300006358 Ga0068871_100013243 Ga0068871_1000132437 422
741 3300006844 Ga0075428_100016545 Ga0075428_1000165457 422
742 3300006844 Ga0075428_100043912 Ga0075428_1000439125 422
743 3300006844 Ga0075428_100061386 Ga0075428_1000613863 422
744 3300006847 Ga0075431_100019078 Ga0075431_1000190785 422
745 3300006847 Ga0075431_100168458 Ga0075431_1001684582 422
746 3300006847 Ga0075431_100204815 Ga0075431_1002048152 422
747 3300006881 Ga0068865_100005919 Ga0068865_1000059197 422
748 3300007265 Ga0099794_10003823 Ga0099794_100038235 422
749 3300009101 Ga0105247_10014924 Ga0105247_100149241 422
750 3300009147 Ga0114129_10004371 Ga0114129_1000437116 422
751 3300009147 Ga0114129_10016344 Ga0114129_100163445 422
752 3300009147 Ga0114129_10063995 Ga0114129_100639954 422
753 3300009147 Ga0114129_10385561 Ga0114129_103855612 422
754 3300009148 Ga0105243_10015059 Ga0105243_100150596 422
755 3300014326 Ga0157380_10010728 Ga0157380_100107282 422
756 3300021361 Ga0213872_10015829 Ga0213872_100158292 422
757 3300025295 Ga0209564_1000943 Ga0209564_100094318 422
758 3300025297 Ga0209758_1000808 Ga0209758_100080831 422
759 3300025885 Ga0207653_10028725 Ga0207653_100287252 422
760 3300025893 Ga0207682_10001151 Ga0207682_100011517 422
761 3300025898 Ga0207692_10006382 Ga0207692_100063822 422
762 3300025903 Ga0207680_10085364 Ga0207680_100853641 422
763 3300025905 Ga0207685_10009223 Ga0207685_100092232 422
764 3300025907 Ga0207645_10014613 Ga0207645_100146133 422
765 3300025908 Ga0207643_10000431 Ga0207643_100004318 422
766 3300025915 Ga0207693_10006061 Ga0207693_100060614 422
767 3300025915 Ga0207693_10075861 Ga0207693_100758613 422
768 3300025916 Ga0207663_10002943 Ga0207663_100029435 422
769 3300025916 Ga0207663_10088641 Ga0207663_100886412 422
770 3300025919 Ga0207657_10025318 Ga0207657_100253185 422
771 3300025922 Ga0207646_10247524 Ga0207646_102475241 422
772 3300025925 Ga0207650_10019594 Ga0207650_100195942 422
773 3300025928 Ga0207700_10000580 Ga0207700_100005807 422
774 3300025928 Ga0207700_10024061 Ga0207700_100240612 422
775 3300025928 Ga0207700_10030319 Ga0207700_100303192 422
776 3300025928 Ga0207700_10040436 Ga0207700_100404363 422
777 3300025929 Ga0207664_10003476 Ga0207664_100034765 422
778 3300025929 Ga0207664_10307366 Ga0207664_103073661 422
779 3300025931 Ga0207644_10007189 Ga0207644_100071895 422
780 3300025934 Ga0207686_10059722 Ga0207686_100597222 422
781 3300025936 Ga0207670_10132165 Ga0207670_101321652 422
782 3300025937 Ga0207669_10012368 Ga0207669_100123684 422
783 3300025939 Ga0207665_10008900 Ga0207665_100089002 422
784 3300025940 Ga0207691_10000977 Ga0207691_100009776 422
785 3300025940 Ga0207691_10061074 Ga0207691_100610742 422
786 3300025941 Ga0207711_10008479 Ga0207711_100084794 422
787 3300025942 Ga0207689_10009633 Ga0207689_100096338 422
788 3300025944 Ga0207661_10025870 Ga0207661_100258702 422
789 3300025945 Ga0207679_10026629 Ga0207679_100266292 422
790 3300025960 Ga0207651_10071351 Ga0207651_100713511 422
791 3300025972 Ga0207668_10127859 Ga0207668_101278592 422
792 3300025986 Ga0207658_10027942 Ga0207658_100279422 422
793 3300026067 Ga0207678_10026945 Ga0207678_100269452 422
794 3300026075 Ga0207708_10012687 Ga0207708_100126875 422
795 3300026089 Ga0207648_10000825 Ga0207648_1000082511 422
796 3300026095 Ga0207676_10016634 Ga0207676_100166344 422
797 3300026116 Ga0207674_10031587 Ga0207674_100315873 422
798 3300026118 Ga0207675_100000366 Ga0207675_10000036625 422
799 3300026142 Ga0207698_10004789 Ga0207698_100047896 422
800 3300028380 Ga0268265_10024352 Ga0268265_100243523 422
801 3300028381 Ga0268264_10025692 Ga0268264_100256922 422
802 3300028786 Ga0307517_10000111 Ga0307517_1000011139 422
803 3300031090 Ga0265760_10007492 Ga0265760_100074922 422
804 3300031238 Ga0265332_10003973 Ga0265332_100039735 422
805 3300031241 Ga0265325_10015648 Ga0265325_100156486 422
806 3300031247 Ga0265340_10006415 Ga0265340_100064155 422
807 3300031249 Ga0265339_10000088 Ga0265339_1000008832 422
808 3300031249 Ga0265339_10000822 Ga0265339_1000082213 422
809 3300031595 Ga0265313_10000173 Ga0265313_1000017315 422
810 3300031712 Ga0265342_10000233 Ga0265342_1000023334 422
811 3300035113 Ga0373936_0008905 Ga0373936_0008905_442_1722 422
812 3300035113 Ga0373936_0041875 Ga0373936_0041875_263_1531 422
813 3300035116 Ga0373945_0008371 Ga0373945_0008371_1012_2280 422
814 3300035170 Ga0373943_0000440 Ga0373943_0000440_6349_7617 422
815 3300035170 Ga0373943_0001594 Ga0373943_0001594_5781_7049 422
816 3300035170 Ga0373943_0009544 Ga0373943_0009544_1234_2502 422
817 3300035171 Ga0373946_0003168 Ga0373946_0003168_2982_4250 422
818 3300035171 Ga0373946_0005763 Ga0373946_0005763_1327_2595 422
819 3300035692 Ga0373935_0034322 Ga0373935_0034322_1828_3096 422
820 3300035692 Ga0373935_0044142 Ga0373935_0044142_49_1317 422
821 3300035692 Ga0373935_0128891 Ga0373935_0128891_147_1415 422
822 3300035695 Ga0373927_0000829 Ga0373927_0000829_5574_6842 422
823 3300035695 Ga0373927_0006747 Ga0373927_0006747_1668_2936 422
824 3300035724 Ga0373933_0121048 Ga0373933_0121048_11_1279 422
825 3300035725 Ga0373947_0000393 Ga0373947_0000393_16133_17401 422
826 3300035725 Ga0373947_0015918 Ga0373947_0015918_2385_3653 422
827 3300036401 Ga0373937_0002968 Ga0373937_0002968_6263_7531 422
828 3300036401 Ga0373937_0113539 Ga0373937_0113539_527_1795 422
829 3300037068 Ga0373925_0002574 Ga0373925_0002574_3802_5070 422
830 3300037068 Ga0373925_0066546 Ga0373925_0066546_380_1648 422
831 3300037418 Ga0395900_0351562 Ga0395900_0351562_124_1392 422
832 3300037853 Ga0436364_0056841 Ga0436364_0056841_2374_3642 422
833 3300037853 Ga0436364_1010630 Ga0436364_1010630_140_1420 422
834 3300039437 Ga0436365_0143841 Ga0436365_0143841_37_1512 422
835 3300039437 Ga0436365_1578866 Ga0436365_1578866_36_1316 422
836 3300039447 Ga0436361_0099990 Ga0436361_0099990_9755_11023 422
837 3300044694 Ga0466963_0045862 Ga0466963_0045862_1337_2605 422
838 3300045049 Ga0466959_0028565 Ga0466959_0028565_1286_2554 422
839 3300045836 Ga0466958_0035636 Ga0466958_0035636_1615_2883 422
840 3300046472 Ga0495580_0063181 Ga0495580_0063181_257_1525 422
841 3300046476 Ga0495662_0001821 Ga0495662_0001821_2212_3480 422
842 3300046477 Ga0495664_0000147 Ga0495664_0000147_11054_12322 422
843 3300046491 Ga0495584_0002124 Ga0495584_0002124_7260_8528 422
844 3300046499 Ga0495594_0063898 Ga0495594_0063898_413_1681 422
845 3300046514 Ga0495618_0001877 Ga0495618_0001877_9863_11131 422
846 3300046516 Ga0495628_0117871 Ga0495628_0117871_420_1688 422
847 3300046517 Ga0495630_0001952 Ga0495630_0001952_5865_7133 422
848 3300046525 Ga0495663_0026301 Ga0495663_0026301_344_1612 422
849 3300046531 Ga0495665_0026023 Ga0495665_0026023_539_1807 422
850 3300046533 Ga0495640_0003988 Ga0495640_0003988_9012_10280 422
851 3300046533 Ga0495640_0018616 Ga0495640_0018616_2415_3683 422
852 3300046537 Ga0495598_0012176 Ga0495598_0012176_438_1706 422
853 3300046537 Ga0495598_0012522 Ga0495598_0012522_738_2006 422
854 3300046543 Ga0495645_0000695 Ga0495645_0000695_21269_22537 422
855 3300046559 Ga0495667_0093862 Ga0495667_0093862_332_1600 422
856 3300046615 Ga0495656_0004869 Ga0495656_0004869_1984_3252 422
857 3300046615 Ga0495656_0043463 Ga0495656_0043463_210_1478 422
858 3300046642 Ga0495634_0003638 Ga0495634_0003638_9788_11056 422
859 3300046642 Ga0495634_0028582 Ga0495634_0028582_1018_2286 422
860 3300046663 Ga0495635_0001303 Ga0495635_0001303_8990_10258 422
861 3300046663 Ga0495635_0082082 Ga0495635_0082082_605_1873 422
862 3300046690 Ga0495624_0005355 Ga0495624_0005355_6169_7437 422
863 3300046690 Ga0495624_0066900 Ga0495624_0066900_381_1649 422
864 3300047319 Ga0495674_0002888 Ga0495674_0002888_13893_15161 422
865 3300047321 Ga0495676_0111851 Ga0495676_0111851_218_1486 422
866 3300047471 Ga0495684_0002109 Ga0495684_0002109_8449_9717 422
867 3300047471 Ga0495684_0003387 Ga0495684_0003387_1293_2561 422
868 3300048903 Ga0496100_0019308 Ga0496100_0019308_2030_3298 422
869 3300048904 Ga0496101_0004879 Ga0496101_0004879_3301_4569 422
870 3300048904 Ga0496101_0026770 Ga0496101_0026770_2727_3995 422
871 3300048904 Ga0496101_0247270 Ga0496101_0247270_94_1362 422
872 3300048905 Ga0496102_0003387 Ga0496102_0003387_4928_6196 422
873 3300048906 Ga0496103_0001033 Ga0496103_0001033_9460_10728 422
874 3300048907 Ga0496104_0005340 Ga0496104_0005340_9525_10793 422
875 3300048907 Ga0496104_0013744 Ga0496104_0013744_2137_3405 422
876 3300048908 Ga0496105_0006335 Ga0496105_0006335_7314_8582 422
877 3300048908 Ga0496105_0025501 Ga0496105_0025501_205_1473 422
878 3300048909 Ga0496106_0166262 Ga0496106_0166262_16_1284 422
879 3300048909 Ga0496106_0171011 Ga0496106_0171011_375_1643 422
880 3300048910 Ga0496107_0075248 Ga0496107_0075248_838_2106 422
881 3300048911 Ga0496108_0004005 Ga0496108_0004005_5901_7169 422
882 3300048911 Ga0496108_0111899 Ga0496108_0111899_494_1762 422
883 3300048911 Ga0496108_0141917 Ga0496108_0141917_102_1370 422
884 3300048913 Ga0496110_0015820 Ga0496110_0015820_750_2018 422
885 3300048914 Ga0496111_0034923 Ga0496111_0034923_2285_3553 422
886 3300048914 Ga0496111_0044803 Ga0496111_0044803_1725_2993 422
887 3300048916 Ga0496113_0039825 Ga0496113_0039825_1636_2904 422
888 3300048917 Ga0496114_0261513 Ga0496114_0261513_131_1399 422
889 3300048928 Ga0496125_0003378 Ga0496125_0003378_7405_8685 422
890 3300048928 Ga0496125_0012349 Ga0496125_0012349_1365_2645 422
891 3300048929 Ga0496126_0091007 Ga0496126_0091007_725_2005 422
892 3300048929 Ga0496126_0168034 Ga0496126_0168034_33_1316 422
893 3300049574 Ga0501038_0000319 Ga0501038_0000319_17472_18752 422
894 3300049580 Ga0501046_0085755 Ga0501046_0085755_944_2212 422
895 3300050491 nmdc:mga00v17_106199_c1 nmdc:mga00v17_106199_c1_247_1515 422
896 3300050507 nmdc:mga05p37_23888_c1 nmdc:mga05p37_23888_c1_5279_6547 422
897 3300050507 nmdc:mga05p37_285554_c1 nmdc:mga05p37_285554_c1_434_1702 422
898 3300050508 nmdc:mga09592_19678_c1 nmdc:mga09592_19678_c1_2650_3918 422
899 3300050509 nmdc:mga0qj67_37662_c1 nmdc:mga0qj67_37662_c1_1445_2713 422
900 3300050510 nmdc:mga06r32_205414_c1 nmdc:mga06r32_205414_c1_284_1552 422
901 3300050510 nmdc:mga06r32_61387_c1 nmdc:mga06r32_61387_c1_1790_3058 422
902 3300050510 nmdc:mga06r32_77538_c1 nmdc:mga06r32_77538_c1_1355_2623 422
903 3300050511 nmdc:mga08y16_202602_c1 nmdc:mga08y16_202602_c1_592_1860 422
904 3300050512 nmdc:mga0n895_186339_c1 nmdc:mga0n895_186339_c1_83_1351 422
905 3300053077 Ga0495601_0000763 Ga0495601_0000763_8203_9471 422
906 3300053078 Ga0495612_0011755 Ga0495612_0011755_1735_3003 422
907 3300053085 Ga0495619_0001194 Ga0495619_0001194_6757_8025 422
908 3300053085 Ga0495619_0047806 Ga0495619_0047806_1506_2774 422
909 3300053085 Ga0495619_0048814 Ga0495619_0048814_991_2259 422
910 3300053086 Ga0500578_0094412 Ga0500578_0094412_152_1432 422
911 3300053142 Ga0500577_0000716 Ga0500577_0000716_1261_2541 422
912 3300053153 Ga0500616_0028455 Ga0500616_0028455_817_2085 422
913 3300061734 Ga0530510_0053026 Ga0530510_0053026_36_1304 422
914 iso_pu_bacteria 2602042107 2603858889 422
915 iso_pu_bacteria 2643221550 2643773087 422
916 iso_pu_bacteria 2643221551 2643775927 422
917 iso_pu_bacteria 2919450847 2919453915 422

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02687

FtsX

FtsX-like permease family

350

484

0.93

PF12704

MacB_PCD

MacB-like periplasmic core domain

35

252

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
5udf-assembly1.cif.gz_B structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii 0.8866 61 262
5udf-assembly1.cif.gz_D structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii 0.8707 61 262
5udf-assembly1.cif.gz_C structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii 0.8613 61 262
5udf-assembly1.cif.gz_B structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii 0.8532 61 262
5udf-assembly1.cif.gz_D structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii 0.8508 61 262
ID Description Score Start End Superfamily
af_Q9BPU3_378_783_3.40.850.10 Alpha Beta;3-Layer(aba) Sandwich;Kinesin;Kinesin motor domain 0.5593 170 202 3.40.850.10
af_A0A1D6JR45_49_209_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.5165 288 420 1.10.1760.20
1cz5A01 Mainly Beta;Beta Barrel;Barwin-like endoglucanases; 0.5158 150 236 2.40.40.20
af_Q1PDX9_48_208_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.5063 292 420 1.10.1760.20
af_Q92376_420_824_3.40.850.10 Alpha Beta;3-Layer(aba) Sandwich;Kinesin;Kinesin motor domain 0.5032 172 202 3.40.850.10
ID Description Score Start End GO Terms
AF-A0A2D9KPG3-F1-model_v4 Lipoprotein-releasing system transmembrane subunit LolC 0.9502 8 422 GO:0042953
GO:0044874
GO:0098797
AF-A0A7C1AI24-F1-model_v4 Lipoprotein-releasing ABC transporter permease subunit 0.9424 1 362 GO:0042953
GO:0044874
GO:0098797
AF-A0A2D9KPG3-F1-model_v4 Lipoprotein-releasing system transmembrane subunit LolC 0.9371 8 422 GO:0042953
GO:0044874
GO:0098797
AF-A0A7C1AI24-F1-model_v4 Lipoprotein-releasing ABC transporter permease subunit 0.935 1 362 GO:0042953
GO:0044874
GO:0098797
AF-A0A1F2Z7J5-F1-model_v4 Multidrug ABC transporter substrate-binding protein 0.9308 11 422 GO:0042953
GO:0044874
GO:0098797

Feature Viewer

pLDDT pTM Quality
82.46 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map