F485484

General Info

Members Datasets Scaffolds Average Seq Length
911 367 908 380

Family's Representative Sequence

Representative Sequence 3300053085|Ga0495619_0018357|Ga0495619_0018357_91_1413
Length 440
Sequence MSAPAAGFFSVSQSLGRPIIVVIIKVPACISHVPLLVGSGLLHDARRPTKQETPMLMSTDRILVSHVGSLPRPPTLSELLIRQEAGETVDAAELARQVEIATTHVIDKQVEAGVDVGNDGEQSRVGFQTYVSRCIGGFGGESRRPPSRDQIDFPSYARQTELRFPHSARVANAPAALSDVRYVDSAPINEDAARLKRMGSRFSECFMTAPSPGVVATTMLNQHYDSHEAYLTALAKALSNEYRAIHNAGMVLQIDAPDLAMERNRFFSHLGEAEFLRQLELHIVAINLGIEGIPRERVRLHVCWGNNDGPHVHDIAMTAILPELYRANVGALSIEFANPRHQHEYDALRKNPLPAHMLLMPGVLDSTTNFVEHPELVARRLEEAVSVVGDRERVVTGTDCGFGTFAGREYVAEEVVWVKLAAAAEGARIASLRLWGRAAG

Samples

Sample ID Description Type Environment
1 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
2 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
3 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
73 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
77 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
78 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
124 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
125 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
126 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
127 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
128 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
129 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
190 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
194 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
195 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
196 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
197 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
198 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
199 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
200 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
201 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
202 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
203 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
204 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
205 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
206 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
207 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
208 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
209 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
210 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
211 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
212 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
213 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
214 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
215 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
216 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
217 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
218 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
219 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
220 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
221 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
222 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
223 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
224 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
225 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
226 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
227 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
228 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
229 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
230 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
231 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
232 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
233 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
234 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
235 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
236 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
237 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
238 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
239 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
240 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
241 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
242 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
243 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
244 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
245 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
246 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
247 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
248 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
249 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
250 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
251 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
252 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
253 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
254 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
255 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
256 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
257 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
258 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
259 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
260 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
261 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
262 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
263 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
264 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
265 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
266 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
267 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
268 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
269 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
270 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
271 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
272 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
273 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
274 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
275 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
276 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
277 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
278 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
279 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
280 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
281 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
282 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
283 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
284 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
285 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
286 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
287 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
288 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
289 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
290 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
291 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
292 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
293 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
294 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
295 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
296 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
297 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
298 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
299 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
300 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
301 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
302 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
303 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
304 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
305 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
306 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
307 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
308 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
309 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
310 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
311 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
312 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
313 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
314 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
315 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
316 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
317 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
318 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
333 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
334 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
335 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
336 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
337 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
338 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
339 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
340 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
341 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
344 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
345 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
346 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
347 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
348 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
349 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
350 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
351 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
352 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
353 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
354 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
355 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
356 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
357 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
358 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
359 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
360 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
361 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
362 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
363 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
364 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
365 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
366 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
367 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.56
Metatranscriptomes 0.11
Isolates 0.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.54
Nodule 0
Rhizoplane 3.73
Rhizosphere 91.44
Stem 0
Stem Tuber 0
Unclassified 3.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1003497 3300003214 Bacteria 3869
2 Ga0065715_10162750 3300005293 Bacteria 1614
3 Ga0065707_10011490 3300005295 Bacteria 2155
4 Ga0065707_10117557 3300005295 Bacteria 2203
5 Ga0070683_100037823 3300005329 Bacteria 4419
6 Ga0070683_100061805 3300005329 Bacteria 3482
7 Ga0070683_100272743 3300005329 Bacteria 1609
8 Ga0070690_100010201 3300005330 Bacteria 5459
9 Ga0070670_100020562 3300005331 Bacteria 5676
10 Ga0070670_100178534 3300005331 Bacteria 1843
11 Ga0068869_100004929 3300005334 Bacteria 8348
12 Ga0068869_100057295 3300005334 Unclassified 2844
13 Ga0068869_100192207 3300005334 Bacteria 1605
14 Ga0070666_10001637 3300005335 Bacteria 13641
15 Ga0070680_100007542 3300005336 Bacteria 8294
16 Ga0070680_100024494 3300005336 Bacteria 4822
17 Ga0070680_100034557 3300005336 Bacteria 4075
18 Ga0070680_100090001 3300005336 Bacteria 2540
19 Ga0070680_100167770 3300005336 Bacteria 1846
20 Ga0070680_100257705 3300005336 Bacteria 1475
21 Ga0070682_100137193 3300005337 Bacteria 1663
22 Ga0068868_100003513 3300005338 Bacteria 10917
23 Ga0068868_100023719 3300005338 Bacteria 4647
24 Ga0068868_100071594 3300005338 Bacteria 2765
25 Ga0068868_100156789 3300005338 Bacteria 1878
26 Ga0070660_100034853 3300005339 Bacteria 3806
27 Ga0070660_100043798 3300005339 Bacteria 3421
28 Ga0070660_100069740 3300005339 Bacteria 2742
29 Ga0070660_100162675 3300005339 Bacteria 1799
30 Ga0070689_100002549 3300005340 Bacteria 11942
31 Ga0070689_100041208 3300005340 Bacteria 3544
32 Ga0070691_10034253 3300005341 Bacteria 2390
33 Ga0070687_100003797 3300005343 Bacteria 5928
34 Ga0070687_100094860 3300005343 Bacteria 1658
35 Ga0070661_100023233 3300005344 Bacteria 4443
36 Ga0070661_100025559 3300005344 Bacteria 4245
37 Ga0070692_10025198 3300005345 Bacteria 2931
38 Ga0070668_100080017 3300005347 Bacteria 2559
39 Ga0070669_100075843 3300005353 Bacteria 2495
40 Ga0070671_100016608 3300005355 Bacteria 5950
41 Ga0070673_100037606 3300005364 Unclassified 3689
42 Ga0070673_100068359 3300005364 Bacteria 2844
43 Ga0070673_100196660 3300005364 Bacteria 1735
44 Ga0070688_100088610 3300005365 Bacteria 2018
45 Ga0070659_100043687 3300005366 Bacteria 3505
46 Ga0070659_100130958 3300005366 Bacteria 2037
47 Ga0070659_100148235 3300005366 Bacteria 1913
48 Ga0070667_100032365 3300005367 Bacteria 4361
49 Ga0070709_10059178 3300005434 Unclassified 2432
50 Ga0070709_10065148 3300005434 Bacteria 2332
51 Ga0070714_100018622 3300005435 Bacteria 5645
52 Ga0070713_100107619 3300005436 Bacteria 2426
53 Ga0070701_10001046 3300005438 Bacteria 10103
54 Ga0070711_100350758 3300005439 Bacteria 1186
55 Ga0070705_100007132 3300005440 Bacteria 5500
56 Ga0070700_100256734 3300005441 Bacteria 1257
57 Ga0070694_100031176 3300005444 Bacteria 3494
58 Ga0070708_100066600 3300005445 Bacteria 3233
59 Ga0070708_100118153 3300005445 Bacteria 2443
60 Ga0070708_100134142 3300005445 Bacteria 2293
61 Ga0070708_100231245 3300005445 Bacteria 1735
62 Ga0070708_100326435 3300005445 Bacteria 1446
63 Ga0070663_100007013 3300005455 Bacteria 6826
64 Ga0070663_100026339 3300005455 Bacteria 3938
65 Ga0070678_100032209 3300005456 Bacteria 3626
66 Ga0070678_100269764 3300005456 Bacteria 1435
67 Ga0070662_100080444 3300005457 Bacteria 2425
68 Ga0070681_10000570 3300005458 Bacteria 30413
69 Ga0070681_10002183 3300005458 Bacteria 17813
70 Ga0070681_10040095 3300005458 Bacteria 4695
71 Ga0068867_100028571 3300005459 Bacteria 4016
72 Ga0070685_10092530 3300005466 Bacteria 1833
73 Ga0070706_100007777 3300005467 Bacteria 10018
74 Ga0070706_100016382 3300005467 Bacteria 6849
75 Ga0070706_100102260 3300005467 Unclassified 2664
76 Ga0070706_100116252 3300005467 Bacteria 2491
77 Ga0070706_100149314 3300005467 Bacteria 2182
78 Ga0070706_100167321 3300005467 Bacteria 2053
79 Ga0070706_100175155 3300005467 Bacteria 2003
80 Ga0070706_100313078 3300005467 Bacteria 1464
81 Ga0070707_100023686 3300005468 Bacteria 5807
82 Ga0070707_100024323 3300005468 Bacteria 5736
83 Ga0070707_100114498 3300005468 Bacteria 2617
84 Ga0070707_100231922 3300005468 Bacteria 1797
85 Ga0070698_100014405 3300005471 Bacteria 8353
86 Ga0070698_100070742 3300005471 Bacteria 3500
87 Ga0070698_100082917 3300005471 Bacteria 3197
88 Ga0070698_100115579 3300005471 Bacteria 2647
89 Ga0070698_100173455 3300005471 Unclassified 2096
90 Ga0070698_100185251 3300005471 Bacteria 2020
91 Ga0070699_100007625 3300005518 Bacteria 9409
92 Ga0070699_100101785 3300005518 Bacteria 2518
93 Ga0070679_100000922 3300005530 Bacteria 25584
94 Ga0070679_100010342 3300005530 Bacteria 8848
95 Ga0070679_100017263 3300005530 Bacteria 6982
96 Ga0070679_100087472 3300005530 Bacteria 3103
97 Ga0070679_100217002 3300005530 Bacteria 1875
98 Ga0070684_100038278 3300005535 Bacteria 4119
99 Ga0070684_100233262 3300005535 Bacteria 1680
100 Ga0070684_100371168 3300005535 Unclassified 1317
101 Ga0070697_100006825 3300005536 Bacteria 8860
102 Ga0070697_100021341 3300005536 Bacteria 5131
103 Ga0070672_100000667 3300005543 Bacteria 20169
104 Ga0070672_100093193 3300005543 Bacteria 2433
105 Ga0070672_100217024 3300005543 Bacteria 1603
106 Ga0070686_100016963 3300005544 Bacteria 4245
107 Ga0070695_100025562 3300005545 Bacteria 3647
108 Ga0070696_100027041 3300005546 Bacteria 3906
109 Ga0070696_100045126 3300005546 Bacteria 3053
110 Ga0070696_100067363 3300005546 Bacteria 2512
111 Ga0070696_100088395 3300005546 Bacteria 2202
112 Ga0070693_100119135 3300005547 Bacteria 1635
113 Ga0070665_100082394 3300005548 Bacteria 3222
114 Ga0070665_100124789 3300005548 Bacteria 2577
115 Ga0070704_100029435 3300005549 Bacteria 3667
116 Ga0070704_100341524 3300005549 Bacteria 1261
117 Ga0068855_100029394 3300005563 Bacteria 6571
118 Ga0068855_100328165 3300005563 Bacteria 1690
119 Ga0070664_100009636 3300005564 Bacteria 7835
120 Ga0068857_100081789 3300005577 Bacteria 2884
121 Ga0068857_100109764 3300005577 Bacteria 2479
122 Ga0068857_100196828 3300005577 Bacteria 1836
123 Ga0068854_100025961 3300005578 Bacteria 4021
124 Ga0068856_100032742 3300005614 Bacteria 5091
125 Ga0068856_100133675 3300005614 Bacteria 2486
126 Ga0068856_100169502 3300005614 Bacteria 2195
127 Ga0070702_100002299 3300005615 Bacteria 8191
128 Ga0070702_100057912 3300005615 Bacteria 2242
129 Ga0070702_100082236 3300005615 Bacteria 1932
130 Ga0068852_100039260 3300005616 Bacteria 3985
131 Ga0068859_100011958 3300005617 Bacteria 8717
132 Ga0068859_100065503 3300005617 Bacteria 3667
133 Ga0068859_100083668 3300005617 Bacteria 3234
134 Ga0068859_100120601 3300005617 Bacteria 2689
135 Ga0068859_100406562 3300005617 Bacteria 1457
136 Ga0068859_100480495 3300005617 Bacteria 1338
137 Ga0068859_100544079 3300005617 Bacteria 1256
138 Ga0068864_100006211 3300005618 Bacteria 9795
139 Ga0068864_100046531 3300005618 Bacteria 3723
140 Ga0068864_100160479 3300005618 Bacteria 2043
141 Ga0068866_10019605 3300005718 Bacteria 3084
142 Ga0068866_10148749 3300005718 Bacteria 1353
143 Ga0068863_100015581 3300005841 Bacteria 7304
144 Ga0068863_100140765 3300005841 Bacteria 2306
145 Ga0068863_100182422 3300005841 Unclassified 2015
146 Ga0068858_100023083 3300005842 Bacteria 5803
147 Ga0068858_100099970 3300005842 Bacteria 2705
148 Ga0068858_100243051 3300005842 Bacteria 1708
149 Ga0068860_100028444 3300005843 Bacteria 5380
150 Ga0068860_100344067 3300005843 Bacteria 1467
151 Ga0068862_100029396 3300005844 Bacteria 4631
152 Ga0068862_100031243 3300005844 Bacteria 4493
153 Ga0068862_100036791 3300005844 Bacteria 4149
154 Ga0068862_100058122 3300005844 Bacteria 3317
155 Ga0068862_100173990 3300005844 Bacteria 1929
156 Ga0068862_100225575 3300005844 Bacteria 1698
157 Ga0081455_10005146 3300005937 Bacteria 14408
158 Ga0081455_10083710 3300005937 Bacteria 2606
159 Ga0081455_10241278 3300005937 Bacteria 1328
160 Ga0081538_10002331 3300005981 Bacteria 18723
161 Ga0081538_10008822 3300005981 Bacteria 8492
162 Ga0081538_10009571 3300005981 Bacteria 8066
163 Ga0081538_10084555 3300005981 Bacteria 1671
164 Ga0081540_1000027 3300005983 Bacteria 151880
165 Ga0081540_1000267 3300005983 Bacteria 54407
166 Ga0081540_1018211 3300005983 Unclassified 4317
167 Ga0081540_1036113 3300005983 Bacteria 2640
168 Ga0081539_10000161 3300005985 Bacteria 156560
169 Ga0081539_10003167 3300005985 Bacteria 20845
170 Ga0081539_10041662 3300005985 Bacteria 2682
171 Ga0070717_10029598 3300006028 Unclassified 4394
172 Ga0070717_10159849 3300006028 Bacteria 1954
173 Ga0075365_10000277 3300006038 Bacteria 17577
174 Ga0075432_10054592 3300006058 Bacteria 1415
175 Ga0070715_10041093 3300006163 Bacteria 1936
176 Ga0070712_100007120 3300006175 Bacteria 6978
177 Ga0070712_100017527 3300006175 Bacteria 4637
178 Ga0075367_10019228 3300006178 Bacteria 3785
179 Ga0068871_100089771 3300006358 Unclassified 2558
180 Ga0075428_100011730 3300006844 Bacteria 9756
181 Ga0075428_100013841 3300006844 Bacteria 8984
182 Ga0075428_100015268 3300006844 Bacteria 8517
183 Ga0075428_100024635 3300006844 Bacteria 6660
184 Ga0075428_100037393 3300006844 Bacteria 5344
185 Ga0075428_100038810 3300006844 Bacteria 5240
186 Ga0075428_100050845 3300006844 Bacteria 4544
187 Ga0075428_100056716 3300006844 Bacteria 4290
188 Ga0075428_100086324 3300006844 Bacteria 3423
189 Ga0075428_100106570 3300006844 Bacteria 3055
190 Ga0075428_100139221 3300006844 Bacteria 2638
191 Ga0075428_100139280 3300006844 Bacteria 2638
192 Ga0075428_100254903 3300006844 Bacteria 1890
193 Ga0075430_100001115 3300006846 Bacteria 21384
194 Ga0075430_100021883 3300006846 Bacteria 5433
195 Ga0075430_100067524 3300006846 Bacteria 3001
196 Ga0075430_100165617 3300006846 Bacteria 1839
197 Ga0075431_100001427 3300006847 Bacteria 21965
198 Ga0075431_100001810 3300006847 Bacteria 20184
199 Ga0075431_100012050 3300006847 Bacteria 8725
200 Ga0075431_100029649 3300006847 Bacteria 5633
201 Ga0075431_100050012 3300006847 Bacteria 4310
202 Ga0075431_100234926 3300006847 Unclassified 1867
203 Ga0075433_10003975 3300006852 Bacteria 11441
204 Ga0075433_10021970 3300006852 Bacteria 5354
205 Ga0075433_10029368 3300006852 Bacteria 4683
206 Ga0075433_10078201 3300006852 Bacteria 2915
207 Ga0075433_10079461 3300006852 Bacteria 2890
208 Ga0075434_100022950 3300006871 Bacteria 6074
209 Ga0075434_100034862 3300006871 Bacteria 4973
210 Ga0075434_100047260 3300006871 Bacteria 4271
211 Ga0075434_100052150 3300006871 Bacteria 4064
212 Ga0075434_100067074 3300006871 Bacteria 3575
213 Ga0075434_100158582 3300006871 Bacteria 2282
214 Ga0075434_100303287 3300006871 Bacteria 1618
215 Ga0075434_100356032 3300006871 Bacteria 1485
216 Ga0075429_100004783 3300006880 Bacteria 11659
217 Ga0075429_100008882 3300006880 Bacteria 8735
218 Ga0075429_100019368 3300006880 Bacteria 5894
219 Ga0075429_100022165 3300006880 Bacteria 5510
220 Ga0075429_100042166 3300006880 Bacteria 3972
221 Ga0075429_100104516 3300006880 Bacteria 2474
222 Ga0075436_100017898 3300006914 Bacteria 4852
223 Ga0097620_100011958 3300006931 Bacteria 8717
224 Ga0097620_100065502 3300006931 Bacteria 3667
225 Ga0097620_100083665 3300006931 Bacteria 3234
226 Ga0097620_100120603 3300006931 Bacteria 2689
227 Ga0097620_100406597 3300006931 Bacteria 1457
228 Ga0097620_100480523 3300006931 Bacteria 1338
229 Ga0097620_100544042 3300006931 Bacteria 1256
230 Ga0075435_100005780 3300007076 Bacteria 8688
231 Ga0075435_100011847 3300007076 Bacteria 6437
232 Ga0075435_100019257 3300007076 Bacteria 5208
233 Ga0075435_100024060 3300007076 Bacteria 4721
234 Ga0075435_100032924 3300007076 Bacteria 4096
235 Ga0075435_100038327 3300007076 Bacteria 3820
236 Ga0075435_100076539 3300007076 Bacteria 2742
237 Ga0075435_100154789 3300007076 Bacteria 1928
238 Ga0099794_10018357 3300007265 Bacteria 3135
239 Ga0105240_10003178 3300009093 Bacteria 25815
240 Ga0105240_10041372 3300009093 Bacteria 5882
241 Ga0111539_10001898 3300009094 Bacteria 27828
242 Ga0111539_10007134 3300009094 Bacteria 14323
243 Ga0111539_10008663 3300009094 Bacteria 12913
244 Ga0111539_10012036 3300009094 Bacteria 10851
245 Ga0111539_10051364 3300009094 Bacteria 4911
246 Ga0111539_10056895 3300009094 Bacteria 4647
247 Ga0111539_10078138 3300009094 Bacteria 3894
248 Ga0111539_10225445 3300009094 Bacteria 2183
249 Ga0105245_10019082 3300009098 Bacteria 6002
250 Ga0105245_10097990 3300009098 Bacteria 2709
251 Ga0105245_10199494 3300009098 Bacteria 1921
252 Ga0105245_10340018 3300009098 Bacteria 1484
253 Ga0105247_10021235 3300009101 Bacteria 3907
254 Ga0105247_10030105 3300009101 Bacteria 3290
255 Ga0114129_10000742 3300009147 Bacteria 41451
256 Ga0114129_10003520 3300009147 Bacteria 22037
257 Ga0114129_10006595 3300009147 Bacteria 16474
258 Ga0114129_10014293 3300009147 Bacteria 11312
259 Ga0114129_10015551 3300009147 Bacteria 10819
260 Ga0114129_10017185 3300009147 Bacteria 10304
261 Ga0114129_10035111 3300009147 Bacteria 7084
262 Ga0114129_10156530 3300009147 Bacteria 3115
263 Ga0114129_10163315 3300009147 Bacteria 3041
264 Ga0114129_10442659 3300009147 Bacteria 1706
265 Ga0114129_10660947 3300009147 Bacteria 1348
266 Ga0105243_10006161 3300009148 Bacteria 9274
267 Ga0105243_10017984 3300009148 Bacteria 5347
268 Ga0105243_10099418 3300009148 Bacteria 2411
269 Ga0105241_10064937 3300009174 Bacteria 2819
270 Ga0105242_10070835 3300009176 Bacteria 2892
271 Ga0105242_10115546 3300009176 Bacteria 2294
272 Ga0105242_10119233 3300009176 Bacteria 2261
273 Ga0105248_10002810 3300009177 Bacteria 19331
274 Ga0105248_10117043 3300009177 Bacteria 3006
275 Ga0105248_10140793 3300009177 Bacteria 2721
276 Ga0105248_10170786 3300009177 Bacteria 2450
277 Ga0105248_10466354 3300009177 Bacteria 1424
278 Ga0105237_10081198 3300009545 Bacteria 3233
279 Ga0105237_10081636 3300009545 Bacteria 3224
280 Ga0105238_10012727 3300009551 Bacteria 8492
281 Ga0105249_10008299 3300009553 Bacteria 9044
282 Ga0105249_10022576 3300009553 Bacteria 5637
283 Ga0105249_10037491 3300009553 Bacteria 4400
284 Ga0105249_10056486 3300009553 Bacteria 3594
285 Ga0105249_10157992 3300009553 Bacteria 2188
286 Ga0105249_10177569 3300009553 Bacteria 2069
287 Ga0105249_10341598 3300009553 Unclassified 1514
288 Ga0099796_10018590 3300010159 Bacteria 2091
289 Ga0105239_10061616 3300010375 Bacteria 4117
290 Ga0105239_10068804 3300010375 Bacteria 3891
291 Ga0105246_10068715 3300011119 Bacteria 2486
292 Ga0105246_10124617 3300011119 Unclassified 1915
293 Ga0157338_1000655 3300012515 Bacteria 2148
294 Ga0157371_10177034 3300013102 Bacteria 1525
295 Ga0157371_10235832 3300013102 Bacteria 1315
296 Ga0157370_10007251 3300013104 Bacteria 12097
297 Ga0157369_10008533 3300013105 Bacteria 11752
298 Ga0157369_10137994 3300013105 Bacteria 2581
299 Ga0157374_10007958 3300013296 Bacteria 9056
300 Ga0157374_10303963 3300013296 Bacteria 1578
301 Ga0157374_10322100 3300013296 Bacteria 1532
302 Ga0157378_10520481 3300013297 Bacteria 1191
303 Ga0163162_10002246 3300013306 Bacteria 18142
304 Ga0163162_10020095 3300013306 Bacteria 6557
305 Ga0163162_10136180 3300013306 Bacteria 2567
306 Ga0163162_10149765 3300013306 Bacteria 2450
307 Ga0163162_10159984 3300013306 Bacteria 2373
308 Ga0163162_10534287 3300013306 Bacteria 1302
309 Ga0157372_10090652 3300013307 Bacteria 3476
310 Ga0157375_10018373 3300013308 Bacteria 6340
311 Ga0157375_10032173 3300013308 Bacteria 4972
312 Ga0157375_10172837 3300013308 Bacteria 2309
313 Ga0157375_10212630 3300013308 Bacteria 2092
314 Ga0157375_10325398 3300013308 Bacteria 1702
315 Ga0157375_10338243 3300013308 Bacteria 1670
316 Ga0157375_10369997 3300013308 Bacteria 1599
317 Ga0163163_10024718 3300014325 Bacteria 5720
318 Ga0163163_10080177 3300014325 Bacteria 3264
319 Ga0163163_10162689 3300014325 Bacteria 2277
320 Ga0157380_10035984 3300014326 Bacteria 3828
321 Ga0157380_10045592 3300014326 Bacteria 3442
322 Ga0157380_10348064 3300014326 Bacteria 1385
323 Ga0157377_10031207 3300014745 Bacteria 2894
324 Ga0157379_10028668 3300014968 Unclassified 4951
325 Ga0157379_10408074 3300014968 Bacteria 1250
326 Ga0157376_10144481 3300014969 Bacteria 2138
327 Ga0163161_10145439 3300017792 Bacteria 1798
328 Ga0206354_11178749 3300020081 Bacteria 3699
329 Ga0213876_10002947 3300021384 Bacteria 9859
330 Ga0213876_10009634 3300021384 Bacteria 5197
331 Ga0213876_10031741 3300021384 Bacteria 2786
332 Ga0213876_10040035 3300021384 Bacteria 2476
333 Ga0213876_10075032 3300021384 Bacteria 1786
334 Ga0213875_10000826 3300021388 Bacteria 23045
335 Ga0213875_10032935 3300021388 Bacteria 2448
336 Ga0224572_1005549 3300024225 Bacteria 2252
337 Ga0207427_103358 3300025231 Bacteria 3427
338 Ga0209233_1000371 3300025261 Bacteria 39670
339 Ga0209025_1028927 3300025294 Bacteria 2698
340 Ga0207656_10052386 3300025321 Bacteria 1767
341 Ga0207653_10022210 3300025885 Bacteria 2015
342 Ga0207692_10142026 3300025898 Bacteria 1366
343 Ga0207642_10021185 3300025899 Bacteria 2555
344 Ga0207688_10006766 3300025901 Bacteria 6240
345 Ga0207688_10008209 3300025901 Bacteria 5674
346 Ga0207688_10017499 3300025901 Bacteria 3895
347 Ga0207688_10021184 3300025901 Bacteria 3551
348 Ga0207688_10045783 3300025901 Bacteria 2441
349 Ga0207647_10018615 3300025904 Bacteria 4690
350 Ga0207647_10052839 3300025904 Bacteria 2506
351 Ga0207685_10008994 3300025905 Bacteria 2880
352 Ga0207685_10055792 3300025905 Bacteria 1543
353 Ga0207685_10062620 3300025905 Bacteria 1479
354 Ga0207699_10039819 3300025906 Bacteria 2703
355 Ga0207699_10043999 3300025906 Bacteria 2597
356 Ga0207699_10048136 3300025906 Bacteria 2503
357 Ga0207699_10065872 3300025906 Bacteria 2198
358 Ga0207699_10080705 3300025906 Bacteria 2016
359 Ga0207699_10096867 3300025906 Bacteria 1863
360 Ga0207645_10014227 3300025907 Bacteria 5330
361 Ga0207643_10004374 3300025908 Bacteria 7594
362 Ga0207643_10021033 3300025908 Bacteria 3583
363 Ga0207643_10023320 3300025908 Bacteria 3411
364 Ga0207643_10097013 3300025908 Bacteria 1724
365 Ga0207705_10071355 3300025909 Bacteria 2518
366 Ga0207684_10013282 3300025910 Bacteria 7125
367 Ga0207684_10013816 3300025910 Bacteria 6973
368 Ga0207684_10026292 3300025910 Bacteria 4962
369 Ga0207684_10030715 3300025910 Unclassified 4573
370 Ga0207684_10064503 3300025910 Bacteria 3109
371 Ga0207684_10117729 3300025910 Bacteria 2276
372 Ga0207707_10000094 3300025912 Bacteria 89818
373 Ga0207707_10005320 3300025912 Bacteria 11245
374 Ga0207707_10014021 3300025912 Bacteria 6987
375 Ga0207707_10070136 3300025912 Bacteria 3054
376 Ga0207707_10087089 3300025912 Bacteria 2729
377 Ga0207707_10258417 3300025912 Bacteria 1512
378 Ga0207707_10323460 3300025912 Unclassified 1331
379 Ga0207695_10012536 3300025913 Bacteria 10164
380 Ga0207695_10135766 3300025913 Bacteria 2413
381 Ga0207671_10177077 3300025914 Bacteria 1658
382 Ga0207693_10003783 3300025915 Bacteria 12887
383 Ga0207693_10015613 3300025915 Bacteria 6089
384 Ga0207693_10032674 3300025915 Bacteria 4106
385 Ga0207693_10131577 3300025915 Bacteria 1967
386 Ga0207663_10067454 3300025916 Bacteria 2294
387 Ga0207663_10205093 3300025916 Bacteria 1425
388 Ga0207660_10015684 3300025917 Bacteria 5005
389 Ga0207660_10035783 3300025917 Bacteria 3449
390 Ga0207660_10148113 3300025917 Bacteria 1801
391 Ga0207662_10006040 3300025918 Bacteria 6509
392 Ga0207662_10018084 3300025918 Bacteria 3993
393 Ga0207662_10142463 3300025918 Bacteria 1519
394 Ga0207657_10069453 3300025919 Bacteria 2989
395 Ga0207657_10070564 3300025919 Bacteria 2960
396 Ga0207657_10074348 3300025919 Bacteria 2870
397 Ga0207657_10076357 3300025919 Bacteria 2826
398 Ga0207657_10163011 3300025919 Bacteria 1810
399 Ga0207657_10220757 3300025919 Bacteria 1519
400 Ga0207649_10062402 3300025920 Bacteria 2349
401 Ga0207652_10076816 3300025921 Bacteria 2913
402 Ga0207652_10084714 3300025921 Bacteria 2777
403 Ga0207652_10084878 3300025921 Bacteria 2774
404 Ga0207652_10154643 3300025921 Bacteria 2054
405 Ga0207646_10019819 3300025922 Bacteria 6243
406 Ga0207646_10062072 3300025922 Bacteria 3336
407 Ga0207646_10123364 3300025922 Bacteria 2329
408 Ga0207694_10048531 3300025924 Bacteria 3285
409 Ga0207694_10325279 3300025924 Bacteria 1269
410 Ga0207650_10057524 3300025925 Bacteria 2892
411 Ga0207659_10098493 3300025926 Bacteria 2199
412 Ga0207659_10110111 3300025926 Bacteria 2092
413 Ga0207687_10062146 3300025927 Bacteria 2640
414 Ga0207687_10190224 3300025927 Bacteria 1597
415 Ga0207700_10022083 3300025928 Unclassified 4359
416 Ga0207700_10126479 3300025928 Bacteria 2080
417 Ga0207700_10134500 3300025928 Bacteria 2023
418 Ga0207664_10019156 3300025929 Bacteria 5052
419 Ga0207664_10110234 3300025929 Bacteria 2288
420 Ga0207644_10033644 3300025931 Bacteria 3584
421 Ga0207644_10088675 3300025931 Bacteria 2301
422 Ga0207690_10037072 3300025932 Bacteria 3163
423 Ga0207690_10106763 3300025932 Bacteria 2010
424 Ga0207690_10216644 3300025932 Bacteria 1463
425 Ga0207706_10001683 3300025933 Bacteria 21818
426 Ga0207706_10026852 3300025933 Bacteria 5154
427 Ga0207706_10166825 3300025933 Bacteria 1935
428 Ga0207706_10187882 3300025933 Bacteria 1814
429 Ga0207709_10026655 3300025935 Bacteria 3322
430 Ga0207709_10026813 3300025935 Bacteria 3313
431 Ga0207709_10031139 3300025935 Bacteria 3112
432 Ga0207709_10145516 3300025935 Bacteria 1635
433 Ga0207670_10014123 3300025936 Bacteria 4730
434 Ga0207670_10133230 3300025936 Bacteria 1824
435 Ga0207670_10199374 3300025936 Bacteria 1520
436 Ga0207670_10252554 3300025936 Bacteria 1363
437 Ga0207665_10030366 3300025939 Bacteria 3570
438 Ga0207665_10095719 3300025939 Bacteria 2064
439 Ga0207665_10190954 3300025939 Bacteria 1488
440 Ga0207691_10000550 3300025940 Bacteria 37583
441 Ga0207691_10003308 3300025940 Bacteria 15702
442 Ga0207691_10045616 3300025940 Bacteria 4028
443 Ga0207691_10076248 3300025940 Bacteria 3022
444 Ga0207691_10079660 3300025940 Bacteria 2947
445 Ga0207711_10105491 3300025941 Bacteria 2499
446 Ga0207689_10020853 3300025942 Bacteria 5512
447 Ga0207689_10126764 3300025942 Unclassified 2100
448 Ga0207661_10042482 3300025944 Bacteria 3584
449 Ga0207661_10111678 3300025944 Bacteria 2313
450 Ga0207667_10020143 3300025949 Bacteria 7427
451 Ga0207667_10251653 3300025949 Bacteria 1807
452 Ga0207651_10288273 3300025960 Bacteria 1360
453 Ga0207712_10003656 3300025961 Bacteria 9696
454 Ga0207712_10109667 3300025961 Bacteria 2068
455 Ga0207640_10089116 3300025981 Bacteria 2132
456 Ga0207658_10310334 3300025986 Bacteria 1362
457 Ga0207677_10007594 3300026023 Bacteria 6014
458 Ga0207703_10006779 3300026035 Bacteria 9133
459 Ga0207639_10295406 3300026041 Bacteria 1430
460 Ga0207678_10001201 3300026067 Bacteria 23769
461 Ga0207678_10117214 3300026067 Bacteria 2272
462 Ga0207678_10127482 3300026067 Bacteria 2171
463 Ga0207708_10003878 3300026075 Bacteria 11004
464 Ga0207702_10081848 3300026078 Bacteria 2805
465 Ga0207702_10098775 3300026078 Bacteria 2572
466 Ga0207702_10124187 3300026078 Bacteria 2314
467 Ga0207702_10260763 3300026078 Unclassified 1632
468 Ga0207702_10278141 3300026078 Bacteria 1581
469 Ga0207702_10297126 3300026078 Bacteria 1532
470 Ga0207641_10320359 3300026088 Unclassified 1470
471 Ga0207641_10334448 3300026088 Bacteria 1439
472 Ga0207648_10036025 3300026089 Bacteria 4359
473 Ga0207648_10040563 3300026089 Bacteria 4090
474 Ga0207648_10076413 3300026089 Bacteria 2919
475 Ga0207648_10112164 3300026089 Bacteria 2394
476 Ga0207648_10142287 3300026089 Bacteria 2114
477 Ga0207676_10193276 3300026095 Bacteria 1792
478 Ga0207676_10274765 3300026095 Bacteria 1527
479 Ga0207674_10001978 3300026116 Bacteria 25950
480 Ga0207674_10033113 3300026116 Bacteria 5412
481 Ga0207674_10053822 3300026116 Bacteria 4101
482 Ga0207674_10148097 3300026116 Bacteria 2305
483 Ga0207674_10204447 3300026116 Bacteria 1924
484 Ga0207674_10280990 3300026116 Bacteria 1612
485 Ga0207675_100011869 3300026118 Bacteria 8139
486 Ga0207675_100026881 3300026118 Bacteria 5356
487 Ga0207675_100048901 3300026118 Bacteria 3947
488 Ga0207675_100060125 3300026118 Bacteria 3547
489 Ga0207675_100115555 3300026118 Bacteria 2536
490 Ga0207683_10014351 3300026121 Bacteria 6748
491 Ga0207683_10018125 3300026121 Bacteria 6005
492 Ga0207683_10022343 3300026121 Bacteria 5429
493 Ga0207683_10339943 3300026121 Bacteria 1377
494 Ga0207698_10163513 3300026142 Bacteria 1950
495 Ga0207698_10212310 3300026142 Bacteria 1742
496 Ga0207698_10225169 3300026142 Bacteria 1698
497 Ga0207698_10350905 3300026142 Bacteria 1393
498 Ga0209983_1001445 3300027665 Bacteria 5278
499 Ga0209998_10000168 3300027717 Bacteria 24295
500 Ga0209974_10000232 3300027876 Bacteria 18009
501 Ga0207428_10005490 3300027907 Bacteria 11818
502 Ga0207428_10005596 3300027907 Bacteria 11682
503 Ga0207428_10018858 3300027907 Bacteria 5886
504 Ga0207428_10034266 3300027907 Bacteria 4163
505 Ga0207428_10046063 3300027907 Bacteria 3509
506 Ga0207428_10176378 3300027907 Bacteria 1616
507 Ga0268266_10158452 3300028379 Bacteria 2046
508 Ga0268265_10031164 3300028380 Bacteria 3849
509 Ga0268265_10037736 3300028380 Bacteria 3548
510 Ga0268264_10099355 3300028381 Bacteria 2525
511 Ga0268264_10111841 3300028381 Bacteria 2393
512 Ga0265334_10061114 3300028573 Bacteria 1420
513 Ga0307515_10027465 3300028794 Bacteria 9728
514 Ga0265338_10003183 3300028800 Bacteria 23421
515 Ga0265325_10000646 3300031241 Bacteria 25305
516 Ga0265340_10019251 3300031247 Bacteria 3515
517 Ga0265339_10000347 3300031249 Bacteria 36868
518 Ga0265331_10026150 3300031250 Bacteria 2938
519 Ga0307513_10004704 3300031456 Bacteria 18152
520 Ga0307513_10177897 3300031456 Unclassified 1995
521 Ga0265313_10000288 3300031595 Bacteria 55189
522 Ga0265314_10056215 3300031711 Bacteria 2710
523 Ga0265342_10014881 3300031712 Bacteria 5145
524 Ga0316576_10079672 3300031727 Bacteria 2428
525 Ga0316576_10219599 3300031727 Bacteria 1430
526 Ga0307413_10022345 3300031824 Bacteria 3408
527 Ga0307406_10030661 3300031901 Unclassified 3267
528 Ga0307406_10145001 3300031901 Unclassified 1686
529 Ga0307412_10321830 3300031911 Bacteria 1231
530 Ga0373930_0002595 3300034816 Bacteria 2807
531 Ga0373959_0023875 3300034820 Bacteria 1192
532 Ga0373926_0008055 3300035083 Bacteria 3510
533 Ga0373926_0015763 3300035083 Bacteria 2578
534 Ga0373928_0000388 3300035084 Bacteria 8754
535 Ga0373929_0006391 3300035085 Bacteria 2130
536 Ga0373934_0023998 3300035086 Bacteria 2358
537 Ga0373940_0004329 3300035088 Bacteria 2995
538 Ga0373940_0017428 3300035088 Bacteria 1791
539 Ga0373949_0011681 3300035090 Bacteria 1937
540 Ga0373923_0005254 3300035111 Bacteria 4386
541 Ga0373945_0000070 3300035116 Bacteria 23249
542 Ga0373953_0007481 3300035117 Bacteria 3661
543 Ga0373956_0009708 3300035119 Bacteria 3918
544 Ga0373956_0040964 3300035119 Unclassified 2056
545 Ga0373957_0014317 3300035120 Bacteria 2709
546 Ga0373957_0055197 3300035120 Bacteria 1527
547 Ga0373960_0043500 3300035121 Bacteria 1308
548 Ga0373943_0000087 3300035170 Bacteria 33416
549 Ga0373943_0015586 3300035170 Bacteria 3455
550 Ga0373946_0000186 3300035171 Bacteria 19207
551 Ga0373946_0001168 3300035171 Bacteria 9091
552 Ga0373946_0042885 3300035171 Unclassified 1862
553 Ga0373955_0003588 3300035172 Bacteria 6825
554 Ga0373955_0024869 3300035172 Bacteria 3067
555 Ga0373955_0217071 3300035172 Bacteria 1141
556 Ga0373962_0007592 3300035242 Bacteria 2659
557 Ga0316574_0015446 3300035398 Bacteria 4430
558 Ga0373931_0000001 3300035691 Bacteria 634029
559 Ga0373931_0000038 3300035691 Bacteria 74311
560 Ga0373931_0014145 3300035691 Bacteria 3897
561 Ga0373931_0115511 3300035691 Bacteria 1528
562 Ga0373931_0123003 3300035691 Bacteria 1485
563 Ga0373935_0000270 3300035692 Bacteria 25587
564 Ga0373927_0002157 3300035695 Bacteria 14460
565 Ga0373927_0047231 3300035695 Bacteria 2785
566 Ga0373927_0050211 3300035695 Bacteria 2697
567 Ga0373927_0084187 3300035695 Bacteria 2062
568 Ga0373933_0013928 3300035724 Bacteria 4461
569 Ga0373933_0050558 3300035724 Bacteria 2482
570 Ga0373947_0003066 3300035725 Bacteria 9946
571 Ga0373947_0014593 3300035725 Bacteria 4505
572 Ga0373947_0035108 3300035725 Bacteria 2968
573 Ga0373947_0135713 3300035725 Bacteria 1574
574 Ga0373937_0002383 3300036401 Bacteria 15644
575 Ga0373937_0004271 3300036401 Bacteria 12100
576 Ga0373937_0008219 3300036401 Bacteria 9062
577 Ga0373937_0019106 3300036401 Bacteria 6132
578 Ga0373937_0059231 3300036401 Bacteria 3519
579 Ga0373937_0268671 3300036401 Bacteria 1609
580 Ga0373937_0289182 3300036401 Bacteria 1548
581 Ga0373925_0002000 3300037068 Bacteria 16895
582 Ga0373925_0011760 3300037068 Bacteria 6333
583 Ga0373925_0063888 3300037068 Bacteria 2770
584 Ga0373925_0065677 3300037068 Bacteria 2733
585 Ga0395899_0223337 3300037312 Bacteria 1304
586 Ga0395900_0049263 3300037418 Bacteria 4340
587 Ga0395898_0002265 3300037466 Bacteria 23319
588 Ga0395898_0030125 3300037466 Bacteria 5432
589 Ga0436364_0371684 3300037853 Bacteria 24141
590 Ga0436364_0699396 3300037853 Bacteria 5304
591 Ga0436364_1016419 3300037853 Bacteria 19962
592 Ga0436364_1096538 3300037853 Bacteria 3291
593 Ga0436364_1424456 3300037853 Bacteria 5815
594 Ga0436364_1434162 3300037853 Bacteria 3592
595 Ga0395901_0004608 3300038443 Bacteria 13909
596 Ga0395901_0043511 3300038443 Bacteria 4658
597 Ga0242420_001892 3300038996 Bacteria 2901
598 Ga0400483_059098 3300039062 Bacteria 3328
599 Ga0400483_266747 3300039062 Bacteria 1326
600 Ga0400483_275305 3300039062 Bacteria 8007
601 Ga0400483_286861 3300039062 Bacteria 2869
602 Ga0436365_0142943 3300039437 Bacteria 1786
603 Ga0436365_0443006 3300039437 Unclassified 1262
604 Ga0436365_1475458 3300039437 Bacteria 25190
605 Ga0436365_1670297 3300039437 Bacteria 5562
606 Ga0436360_0897651 3300039438 Unclassified 1470
607 Ga0436360_1038104 3300039438 Bacteria 3053
608 Ga0436361_0781316 3300039447 Bacteria 1328
609 Ga0436362_0251003 3300039453 Bacteria 3176
610 Ga0436362_1255597 3300039453 Bacteria 1938
611 Ga0451853_0689240 3300041512 Bacteria 2258
612 Ga0450895_000659 3300042132 Bacteria 2101
613 Ga0451577_0003484 3300042876 Bacteria 17506
614 Ga0451577_0047288 3300042876 Bacteria 3848
615 Ga0466963_0026252 3300044694 Bacteria 3724
616 Ga0453684_0077520 3300044712 Bacteria 4164
617 Ga0453684_0313632 3300044712 Unclassified 1779
618 Ga0466960_0097851 3300044901 Bacteria 1506
619 Ga0451576_0025862 3300045051 Bacteria 6321
620 Ga0466967_0026297 3300045976 Bacteria 4818
621 Ga0466967_0247447 3300045976 Bacteria 1702
622 Ga0495592_0011507 3300046454 Bacteria 6697
623 Ga0495592_0056767 3300046454 Bacteria 2891
624 Ga0495592_0142321 3300046454 Bacteria 1667
625 Ga0495603_0010187 3300046455 Bacteria 5689
626 Ga0495629_0054470 3300046459 Bacteria 2797
627 Ga0495651_0019572 3300046462 Bacteria 5250
628 Ga0495651_0027545 3300046462 Bacteria 4427
629 Ga0495651_0074424 3300046462 Bacteria 2576
630 Ga0495653_0000347 3300046463 Bacteria 37809
631 Ga0495653_0008043 3300046463 Bacteria 8637
632 Ga0495653_0079924 3300046463 Bacteria 2420
633 Ga0495580_0008722 3300046472 Bacteria 8037
634 Ga0495580_0136512 3300046472 Bacteria 1701
635 Ga0495582_0002355 3300046473 Bacteria 10575
636 Ga0495582_0095384 3300046473 Bacteria 1661
637 Ga0495639_0000749 3300046475 Bacteria 14836
638 Ga0495664_0000408 3300046477 Bacteria 21027
639 Ga0495664_0003253 3300046477 Bacteria 8825
640 Ga0495594_0007204 3300046499 Bacteria 5720
641 Ga0495594_0027014 3300046499 Bacteria 3092
642 Ga0495608_0010944 3300046511 Bacteria 6323
643 Ga0495608_0059514 3300046511 Bacteria 2516
644 Ga0495618_0019598 3300046514 Bacteria 4163
645 Ga0495618_0049994 3300046514 Bacteria 2640
646 Ga0495618_0101675 3300046514 Bacteria 1840
647 Ga0495618_0138624 3300046514 Bacteria 1556
648 Ga0495618_0142552 3300046514 Bacteria 1532
649 Ga0495628_0078052 3300046516 Bacteria 2575
650 Ga0495628_0082523 3300046516 Bacteria 2497
651 Ga0495628_0140141 3300046516 Bacteria 1846
652 Ga0495630_0009036 3300046517 Bacteria 7162
653 Ga0495630_0022767 3300046517 Bacteria 4628
654 Ga0495630_0313243 3300046517 Unclassified 1200
655 Ga0495666_0004171 3300046526 Bacteria 7289
656 Ga0495652_0043556 3300046529 Bacteria 3865
657 Ga0495652_0096174 3300046529 Bacteria 2412
658 Ga0495652_0161740 3300046529 Bacteria 1737
659 Ga0495665_0013826 3300046531 Bacteria 4359
660 Ga0495665_0021712 3300046531 Bacteria 3451
661 Ga0495640_0040636 3300046533 Bacteria 3255
662 Ga0495586_0007549 3300046535 Bacteria 5801
663 Ga0495587_0030463 3300046536 Bacteria 3271
664 Ga0495645_0008561 3300046543 Bacteria 7145
665 Ga0495645_0027708 3300046543 Bacteria 4115
666 Ga0495645_0105856 3300046543 Bacteria 1995
667 Ga0495667_0004364 3300046559 Bacteria 9549
668 Ga0495667_0017454 3300046559 Bacteria 4846
669 Ga0495667_0038592 3300046559 Bacteria 3179
670 Ga0495667_0055381 3300046559 Bacteria 2608
671 Ga0495667_0056726 3300046559 Unclassified 2575
672 Ga0495667_0066494 3300046559 Bacteria 2356
673 Ga0495656_0015156 3300046615 Bacteria 2905
674 Ga0495634_0027057 3300046642 Bacteria 3994
675 Ga0495635_0003702 3300046663 Bacteria 10597
676 Ga0495635_0019395 3300046663 Bacteria 4741
677 Ga0495635_0067997 3300046663 Bacteria 2443
678 Ga0495635_0133766 3300046663 Bacteria 1690
679 Ga0495659_0038210 3300046664 Bacteria 1704
680 Ga0495588_0011421 3300046674 Bacteria 4167
681 Ga0495657_0004574 3300046675 Bacteria 11048
682 Ga0495657_0031845 3300046675 Bacteria 3683
683 Ga0495657_0032282 3300046675 Bacteria 3656
684 Ga0495657_0073456 3300046675 Bacteria 2227
685 Ga0495657_0131624 3300046675 Bacteria 1566
686 Ga0495599_0026497 3300046678 Bacteria 3633
687 Ga0495623_0014444 3300046679 Bacteria 5110
688 Ga0495646_0030069 3300046680 Bacteria 3393
689 Ga0495646_0046981 3300046680 Bacteria 2629
690 Ga0495658_0027295 3300046683 Bacteria 3070
691 Ga0495669_0011629 3300046684 Bacteria 3741
692 Ga0495613_0011279 3300046689 Bacteria 6637
693 Ga0495613_0100039 3300046689 Bacteria 2094
694 Ga0495624_0003374 3300046690 Bacteria 11854
695 Ga0495624_0014171 3300046690 Bacteria 5418
696 Ga0495600_0012987 3300046809 Bacteria 5222
697 Ga0495600_0023375 3300046809 Bacteria 3976
698 Ga0495600_0204443 3300046809 Bacteria 1267
699 Ga0495581_0003281 3300047315 Bacteria 9283
700 Ga0495604_0004463 3300047317 Bacteria 11084
701 Ga0495604_0025245 3300047317 Bacteria 4736
702 Ga0495636_0016336 3300047318 Bacteria 2964
703 Ga0495674_0000477 3300047319 Bacteria 36402
704 Ga0495674_0015244 3300047319 Bacteria 7189
705 Ga0495674_0265181 3300047319 Bacteria 1410
706 Ga0495676_0000213 3300047321 Bacteria 46318
707 Ga0495676_0011576 3300047321 Bacteria 7958
708 Ga0495680_0003820 3300047322 Bacteria 14619
709 Ga0495680_0023632 3300047322 Bacteria 5108
710 Ga0495680_0024929 3300047322 Bacteria 4953
711 Ga0495680_0058629 3300047322 Bacteria 2974
712 Ga0495680_0070681 3300047322 Bacteria 2660
713 Ga0495675_0002915 3300047444 Bacteria 10276
714 Ga0495675_0121614 3300047444 Bacteria 1625
715 Ga0495684_0001287 3300047471 Bacteria 20139
716 Ga0495684_0044512 3300047471 Bacteria 3398
717 Ga0495684_0056526 3300047471 Bacteria 2992
718 Ga0495686_0046870 3300047472 Bacteria 2731
719 Ga0495593_0024105 3300047673 Bacteria 3375
720 Ga0495602_0002111 3300048088 Bacteria 20026
721 Ga0495602_0069239 3300048088 Bacteria 3025
722 Ga0495614_0038178 3300048089 Bacteria 2061
723 Ga0496101_0050514 3300048904 Bacteria 2994
724 Ga0496102_0135989 3300048905 Bacteria 2303
725 Ga0496102_0248358 3300048905 Bacteria 1677
726 Ga0496102_0398304 3300048905 Bacteria 1294
727 Ga0496103_0013368 3300048906 Bacteria 4865
728 Ga0496103_0028211 3300048906 Bacteria 3405
729 Ga0496104_0062614 3300048907 Bacteria 3527
730 Ga0496104_0137267 3300048907 Bacteria 2349
731 Ga0496105_0188736 3300048908 Bacteria 1686
732 Ga0496106_0003244 3300048909 Bacteria 12170
733 Ga0496106_0063683 3300048909 Bacteria 2803
734 Ga0496106_0086571 3300048909 Bacteria 2413
735 Ga0496106_0150526 3300048909 Bacteria 1835
736 Ga0496107_0001966 3300048910 Bacteria 13066
737 Ga0496107_0028883 3300048910 Bacteria 3943
738 Ga0496107_0069434 3300048910 Bacteria 2557
739 Ga0496108_0001455 3300048911 Bacteria 18720
740 Ga0496108_0029145 3300048911 Bacteria 4569
741 Ga0496108_0185184 3300048911 Bacteria 1803
742 Ga0496109_0154853 3300048912 Bacteria 2146
743 Ga0496109_0290843 3300048912 Bacteria 1540
744 Ga0496110_0008677 3300048913 Bacteria 8187
745 Ga0496110_0053833 3300048913 Bacteria 3539
746 Ga0496110_0153558 3300048913 Bacteria 2085
747 Ga0496110_0226221 3300048913 Bacteria 1701
748 Ga0496111_0081682 3300048914 Bacteria 2359
749 Ga0496111_0081711 3300048914 Bacteria 2359
750 Ga0496111_0214125 3300048914 Bacteria 1431
751 Ga0496112_0116968 3300048915 Bacteria 2636
752 Ga0496113_0027105 3300048916 Bacteria 4103
753 Ga0496113_0155478 3300048916 Bacteria 1806
754 Ga0496113_0209825 3300048916 Bacteria 1550
755 Ga0496114_0112126 3300048917 Bacteria 2338
756 Ga0496115_0021283 3300048918 Bacteria 5009
757 Ga0496119_0005142 3300048922 Bacteria 12671
758 Ga0496125_0001945 3300048928 Bacteria 28207
759 Ga0501031_0000959 3300049568 Bacteria 17470
760 Ga0501031_0024122 3300049568 Bacteria 3965
761 Ga0501031_0046233 3300049568 Bacteria 2839
762 Ga0501032_0000336 3300049569 Bacteria 39319
763 Ga0501032_0001789 3300049569 Bacteria 16961
764 Ga0501032_0085167 3300049569 Bacteria 2101
765 Ga0501033_0000090 3300049570 Bacteria 86596
766 Ga0501033_0006860 3300049570 Bacteria 8891
767 Ga0501033_0081116 3300049570 Bacteria 2379
768 Ga0501034_0000140 3300049571 Bacteria 134996
769 Ga0501034_0007273 3300049571 Bacteria 11804
770 Ga0501034_0015032 3300049571 Bacteria 7960
771 Ga0501034_0089211 3300049571 Bacteria 3081
772 Ga0501034_0121996 3300049571 Bacteria 2592
773 Ga0501036_0000048 3300049572 Bacteria 75517
774 Ga0501036_0009528 3300049572 Bacteria 7989
775 Ga0501036_0041617 3300049572 Bacteria 3886
776 Ga0501037_0000024 3300049573 Bacteria 146046
777 Ga0501037_0009575 3300049573 Bacteria 7110
778 Ga0501037_0186355 3300049573 Bacteria 1470
779 Ga0501038_0000247 3300049574 Bacteria 45720
780 Ga0501038_0007063 3300049574 Bacteria 10368
781 Ga0501038_0048744 3300049574 Bacteria 3664
782 Ga0501039_0000017 3300049575 Bacteria 189412
783 Ga0501039_0011247 3300049575 Bacteria 6821
784 Ga0501039_0274841 3300049575 Bacteria 1324
785 Ga0501040_0029353 3300049576 Bacteria 3712
786 Ga0501041_0152611 3300049577 Bacteria 1443
787 Ga0501042_0077176 3300049578 Bacteria 2385
788 Ga0501043_0000146 3300049579 Bacteria 65887
789 Ga0501043_0092662 3300049579 Bacteria 2375
790 Ga0501046_0079592 3300049580 Bacteria 2533
791 Ga0501047_0002914 3300049581 Bacteria 16250
792 Ga0501047_0042303 3300049581 Bacteria 4403
793 Ga0501070_0007417 3300049586 Bacteria 9316
794 Ga0501070_0031397 3300049586 Bacteria 4451
795 Ga0501070_0080969 3300049586 Bacteria 2686
796 Ga0501072_0002045 3300049588 Bacteria 15003
797 Ga0501072_0012743 3300049588 Bacteria 6429
798 Ga0501074_0076995 3300049590 Bacteria 2394
799 Ga0501075_0009407 3300049591 Bacteria 6835
800 Ga0501075_0024630 3300049591 Bacteria 4417
801 Ga0501076_0000486 3300049592 Bacteria 25056
802 Ga0501076_0220506 3300049592 Bacteria 1550
803 Ga0501077_0031041 3300049593 Unclassified 3399
804 Ga0501079_0013152 3300049741 Bacteria 6308
805 Ga0501079_0037082 3300049741 Bacteria 3756
806 Ga0501080_0107400 3300049742 Bacteria 2587
807 Ga0501081_0011103 3300049743 Bacteria 5890
808 Ga0501081_0022985 3300049743 Bacteria 4175
809 Ga0501081_0034429 3300049743 Bacteria 3446
810 Ga0501081_0087901 3300049743 Bacteria 2183
811 Ga0501035_0000021 3300049822 Bacteria 209085
812 Ga0501035_0021703 3300049822 Bacteria 5903
813 Ga0501044_0012955 3300049823 Bacteria 9028
814 Ga0501044_0044902 3300049823 Bacteria 4582
815 Ga0501044_0049246 3300049823 Bacteria 4349
816 Ga0501044_0194755 3300049823 Bacteria 1987
817 Ga0501044_0224921 3300049823 Bacteria 1826
818 Ga0501045_0046010 3300049824 Bacteria 3178
819 Ga0501045_0209800 3300049824 Bacteria 1451
820 Ga0501045_0333277 3300049824 Unclassified 1129
821 nmdc:mga0yw44_112_c1 3300050492 Bacteria 28571
822 nmdc:mga06z11_110070_c1 3300050494 Bacteria 1524
823 nmdc:mga05p37_100096_c1 3300050507 Bacteria 3570
824 nmdc:mga05p37_1851_c1 3300050507 Bacteria 24645
825 nmdc:mga05p37_202676_c1 3300050507 Bacteria 2402
826 nmdc:mga05p37_20592_c1 3300050507 Bacteria 7320
827 nmdc:mga05p37_216052_c1 3300050507 Bacteria 2316
828 nmdc:mga05p37_220724_c1 3300050507 Bacteria 2288
829 nmdc:mga05p37_276313_c1 3300050507 Bacteria 2005
830 nmdc:mga05p37_350383_c1 3300050507 Bacteria 1739
831 nmdc:mga05p37_508_c1 3300050507 Bacteria 34964
832 nmdc:mga05p37_59454_c1 3300050507 Bacteria 4707
833 nmdc:mga05p37_71764_c1 3300050507 Bacteria 4260
834 nmdc:mga05p37_7394_c1 3300050507 Bacteria 12957
835 nmdc:mga05p37_88618_c1 3300050507 Bacteria 3814
836 nmdc:mga09592_14119_c1 3300050508 Bacteria 6519
837 nmdc:mga09592_26976_c1 3300050508 Bacteria 4763
838 nmdc:mga09592_4532_c1 3300050508 Bacteria 11235
839 nmdc:mga09592_49665_c1 3300050508 Bacteria 3537
840 nmdc:mga09592_52794_c1 3300050508 Bacteria 3431
841 nmdc:mga09592_5379_c1 3300050508 Bacteria 10412
842 nmdc:mga09592_53936_c1 3300050508 Bacteria 3396
843 nmdc:mga0qj67_22279_c1 3300050509 Bacteria 4866
844 nmdc:mga0qj67_25726_c1 3300050509 Bacteria 4551
845 nmdc:mga0qj67_387_c1 3300050509 Bacteria 30412
846 nmdc:mga0qj67_43190_c1 3300050509 Bacteria 3550
847 nmdc:mga0qj67_85047_c1 3300050509 Bacteria 2537
848 nmdc:mga06r32_116721_c1 3300050510 Bacteria 2630
849 nmdc:mga06r32_12420_c1 3300050510 Bacteria 7685
850 nmdc:mga06r32_161028_c1 3300050510 Bacteria 2227
851 nmdc:mga06r32_184246_c1 3300050510 Bacteria 2074
852 nmdc:mga06r32_193613_c1 3300050510 Bacteria 2020
853 nmdc:mga06r32_1960_c1 3300050510 Bacteria 18367
854 nmdc:mga06r32_19944_c1 3300050510 Bacteria 6164
855 nmdc:mga06r32_45638_c1 3300050510 Bacteria 4178
856 nmdc:mga06r32_56844_c1 3300050510 Bacteria 3757
857 nmdc:mga08y16_115302_c1 3300050511 Bacteria 2797
858 nmdc:mga08y16_147487_c1 3300050511 Bacteria 2446
859 nmdc:mga08y16_192317_c1 3300050511 Bacteria 2116
860 nmdc:mga08y16_226680_c1 3300050511 Bacteria 1934
861 nmdc:mga08y16_2332_c1 3300050511 Bacteria 19466
862 nmdc:mga08y16_27870_c1 3300050511 Bacteria 5955
863 nmdc:mga08y16_52323_c1 3300050511 Bacteria 4273
864 nmdc:mga08y16_542_c1 3300050511 Bacteria 34971
865 nmdc:mga08y16_64038_c1 3300050511 Bacteria 3840
866 nmdc:mga08y16_794_c1 3300050511 Bacteria 30179
867 nmdc:mga0n895_100746_c1 3300050512 Bacteria 2898
868 nmdc:mga0n895_16837_c1 3300050512 Bacteria 6719
869 nmdc:mga0n895_2920_c1 3300050512 Bacteria 13550
870 nmdc:mga0n895_297603_c1 3300050512 Bacteria 1636
871 nmdc:mga0n895_4136_c1 3300050512 Bacteria 11832
872 nmdc:mga0n895_64822_c1 3300050512 Bacteria 3615
873 nmdc:mga0rr50_1886_c1 3300050513 Bacteria 11635
874 nmdc:mga0rr50_19263_c1 3300050513 Bacteria 4601
875 nmdc:mga0rr50_22223_c1 3300050513 Bacteria 4350
876 nmdc:mga0rr50_37693_c1 3300050513 Bacteria 3492
877 nmdc:mga0rr50_46073_c1 3300050513 Bacteria 3209
878 nmdc:mga08x19_251611_c1 3300050514 Bacteria 1220
879 nmdc:mga08x19_53009_c1 3300050514 Bacteria 2609
880 nmdc:mga08x19_638_c1 3300050514 Bacteria 22652
881 nmdc:mga0a205_118100_c1 3300050515 Bacteria 2551
882 nmdc:mga0a205_4196_c1 3300050515 Bacteria 12922
883 nmdc:mga0a205_51911_c1 3300050515 Bacteria 3958
884 nmdc:mga0a205_73375_c1 3300050515 Bacteria 3306
885 Ga0495601_0010758 3300053077 Bacteria 5459
886 Ga0495612_0001008 3300053078 Bacteria 11600
887 Ga0495595_0019099 3300053084 Bacteria 2970
888 Ga0495595_0028611 3300053084 Bacteria 2489
889 Ga0495619_0001832 3300053085 Bacteria 14130
890 Ga0495619_0004096 3300053085 Bacteria 9330
891 Ga0495619_0014924 3300053085 Bacteria 4906
892 Ga0495619_0018357 3300053085 Bacteria 4439
893 Ga0500641_0020597 3300053096 Bacteria 2505
894 Ga0500595_026204 3300053119 Bacteria 2011
895 Ga0500617_024133 3300053124 Bacteria 2692
896 Ga0500642_0083514 3300053130 Bacteria 1470
897 Ga0500658_0025782 3300053134 Bacteria 2261
898 Ga0500616_0000856 3300053153 Bacteria 33765
899 Ga0501084_0107892 3300054114 Bacteria 2339
900 Ga0501084_0220078 3300054114 Bacteria 1602
901 Ga0501082_0185295 3300060353 Bacteria 1811
902 Ga0530510_0000079 3300061734 Bacteria 50366
903 Ga0530510_0011724 3300061734 Bacteria 6152
904 Ga0530510_0022724 3300061734 Bacteria 4468
905 Ga0530510_0042960 3300061734 Bacteria 3265
906 Ga0530510_0046953 3300061734 Bacteria 3120
907 Ga0530510_0141830 3300061734 Bacteria 1771
908 Ga0530510_0207005 3300061734 Bacteria 1458

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026089 Ga0207648_10036025 Ga0207648_100360251 304
2 3300014326 Ga0157380_10348064 Ga0157380_103480641 309
3 3300009176 Ga0105242_10119233 Ga0105242_101192333 310
4 3300025901 Ga0207688_10017499 Ga0207688_100174992 310
5 3300037312 Ga0395899_0223337 Ga0395899_0223337_316_1263 315
6 3300025906 Ga0207699_10080705 Ga0207699_100807052 317
7 3300039437 Ga0436365_0443006 Ga0436365_0443006_72_1073 317
8 3300013306 Ga0163162_10149765 Ga0163162_101497652 318
9 3300050510 nmdc:mga06r32_193613_c1 nmdc:mga06r32_193613_c1_987_1997 328
10 3300050514 nmdc:mga08x19_53009_c1 nmdc:mga08x19_53009_c1_107_1102 328
11 3300035695 Ga0373927_0084187 Ga0373927_0084187_18_1052 332
12 3300036401 Ga0373937_0268671 Ga0373937_0268671_37_1071 332
13 3300048089 Ga0495614_0038178 Ga0495614_0038178_1011_2045 332
14 3300061734 Ga0530510_0046953 Ga0530510_0046953_342_1409 347
15 3300005329 Ga0070683_100061805 Ga0070683_1000618053 348
16 3300005577 Ga0068857_100109764 Ga0068857_1001097643 348
17 3300026116 Ga0207674_10033113 Ga0207674_100331135 348
18 3300039447 Ga0436361_0781316 Ga0436361_0781316_134_1204 348
19 3300039453 Ga0436362_0251003 Ga0436362_0251003_1082_2152 348
20 3300048916 Ga0496113_0155478 Ga0496113_0155478_20_1135 348
21 3300005439 Ga0070711_100350758 Ga0070711_1003507581 349
22 3300013308 Ga0157375_10338243 Ga0157375_103382431 349
23 3300014968 Ga0157379_10408074 Ga0157379_104080741 349
24 3300035172 Ga0373955_0217071 Ga0373955_0217071_13_1098 349
25 3300044694 Ga0466963_0026252 Ga0466963_0026252_2524_3585 349
26 3300005338 Ga0068868_100156789 Ga0068868_1001567892 350
27 3300005366 Ga0070659_100043687 Ga0070659_1000436872 350
28 3300009553 Ga0105249_10008299 Ga0105249_100082997 350
29 3300013306 Ga0163162_10136180 Ga0163162_101361802 350
30 3300014745 Ga0157377_10031207 Ga0157377_100312072 350
31 3300025901 Ga0207688_10006766 Ga0207688_100067662 350
32 3300025919 Ga0207657_10220757 Ga0207657_102207571 350
33 3300025932 Ga0207690_10037072 Ga0207690_100370723 350
34 3300025935 Ga0207709_10031139 Ga0207709_100311391 350
35 3300025961 Ga0207712_10003656 Ga0207712_100036563 350
36 3300026041 Ga0207639_10295406 Ga0207639_102954061 350
37 3300049742 Ga0501080_0107400 Ga0501080_0107400_779_1918 350
38 3300009147 Ga0114129_10017185 Ga0114129_100171856 351
39 3300007076 Ga0075435_100024060 Ga0075435_1000240602 354
40 3300026118 Ga0207675_100060125 Ga0207675_1000601253 354
41 3300050510 nmdc:mga06r32_12420_c1 nmdc:mga06r32_12420_c1_4468_5547 354
42 3300009553 Ga0105249_10341598 Ga0105249_103415981 355
43 3300025924 Ga0207694_10325279 Ga0207694_103252791 355
44 3300025935 Ga0207709_10026655 Ga0207709_100266553 355
45 3300026142 Ga0207698_10225169 Ga0207698_102251692 355
46 3300031901 Ga0307406_10145001 Ga0307406_101450011 355
47 3300049593 Ga0501077_0031041 Ga0501077_0031041_13_1083 355
48 3300049824 Ga0501045_0333277 Ga0501045_0333277_43_1113 355
49 3300005336 Ga0070680_100007542 Ga0070680_1000075426 356
50 3300005530 Ga0070679_100000922 Ga0070679_1000009222 356
51 3300025912 Ga0207707_10070136 Ga0207707_100701362 356
52 3300049568 Ga0501031_0024122 Ga0501031_0024122_1825_2961 356
53 3300049569 Ga0501032_0000336 Ga0501032_0000336_18768_19904 356
54 3300049570 Ga0501033_0000090 Ga0501033_0000090_74616_75752 356
55 3300049571 Ga0501034_0000140 Ga0501034_0000140_112503_113639 356
56 3300049572 Ga0501036_0000048 Ga0501036_0000048_35333_36469 356
57 3300049573 Ga0501037_0000024 Ga0501037_0000024_40824_41960 356
58 3300049574 Ga0501038_0000247 Ga0501038_0000247_25817_26953 356
59 3300049575 Ga0501039_0000017 Ga0501039_0000017_162460_163596 356
60 3300049579 Ga0501043_0000146 Ga0501043_0000146_19416_20552 356
61 3300049822 Ga0501035_0000021 Ga0501035_0000021_45502_46638 356
62 3300049823 Ga0501044_0044902 Ga0501044_0044902_219_1355 356
63 3300005985 Ga0081539_10003167 Ga0081539_1000316711 357
64 3300021384 Ga0213876_10009634 Ga0213876_100096344 359
65 3300021384 Ga0213876_10075032 Ga0213876_100750322 360
66 3300037853 Ga0436364_1424456 Ga0436364_1424456_168_1277 360
67 3300039437 Ga0436365_0142943 Ga0436365_0142943_218_1327 360
68 3300049588 Ga0501072_0012743 Ga0501072_0012743_4965_6104 360
69 3300049591 Ga0501075_0024630 Ga0501075_0024630_2741_3880 360
70 3300049741 Ga0501079_0013152 Ga0501079_0013152_176_1315 360
71 3300049743 Ga0501081_0022985 Ga0501081_0022985_2989_4128 360
72 3300049824 Ga0501045_0209800 Ga0501045_0209800_78_1217 360
73 3300060353 Ga0501082_0185295 Ga0501082_0185295_589_1728 360
74 3300061734 Ga0530510_0011724 Ga0530510_0011724_4740_5879 360
75 3300005334 Ga0068869_100057295 Ga0068869_1000572953 361
76 3300014968 Ga0157379_10028668 Ga0157379_100286685 361
77 3300025942 Ga0207689_10126764 Ga0207689_101267642 361
78 3300049577 Ga0501041_0152611 Ga0501041_0152611_160_1269 361
79 iso_pu_bacteria 2816332139 2816511457 362
80 3300005340 Ga0070689_100041208 Ga0070689_1000412083 363
81 3300005365 Ga0070688_100088610 Ga0070688_1000886102 363
82 3300017792 Ga0163161_10145439 Ga0163161_101454392 363
83 3300025936 Ga0207670_10199374 Ga0207670_101993741 363
84 3300048922 Ga0496119_0005142 Ga0496119_0005142_10723_11835 363
85 3300005546 Ga0070696_100067363 Ga0070696_1000673632 364
86 3300049743 Ga0501081_0034429 Ga0501081_0034429_2213_3322 364
87 3300011119 Ga0105246_10068715 Ga0105246_100687152 365
88 3300025908 Ga0207643_10023320 Ga0207643_100233203 365
89 3300026075 Ga0207708_10003878 Ga0207708_100038787 365
90 3300048905 Ga0496102_0248358 Ga0496102_0248358_112_1242 365
91 3300048906 Ga0496103_0028211 Ga0496103_0028211_760_1890 365
92 3300048907 Ga0496104_0062614 Ga0496104_0062614_1569_2699 365
93 3300048909 Ga0496106_0150526 Ga0496106_0150526_89_1219 365
94 3300048910 Ga0496107_0069434 Ga0496107_0069434_1135_2265 365
95 3300048911 Ga0496108_0029145 Ga0496108_0029145_810_1940 365
96 3300005445 Ga0070708_100231245 Ga0070708_1002312452 366
97 3300006871 Ga0075434_100356032 Ga0075434_1003560321 366
98 3300007076 Ga0075435_100076539 Ga0075435_1000765392 366
99 3300039438 Ga0436360_1038104 Ga0436360_1038104_1909_3030 366
100 3300050512 nmdc:mga0n895_297603_c1 nmdc:mga0n895_297603_c1_203_1348 366
101 3300050513 nmdc:mga0rr50_46073_c1 nmdc:mga0rr50_46073_c1_318_1463 366
102 3300005467 Ga0070706_100175155 Ga0070706_1001751552 367
103 3300005937 Ga0081455_10005146 Ga0081455_100051463 367
104 3300005981 Ga0081538_10084555 Ga0081538_100845551 367
105 3300005983 Ga0081540_1018211 Ga0081540_10182112 367
106 3300005985 Ga0081539_10041662 Ga0081539_100416624 367
107 3300006844 Ga0075428_100024635 Ga0075428_1000246352 367
108 3300006844 Ga0075428_100106570 Ga0075428_1001065702 367
109 3300006847 Ga0075431_100234926 Ga0075431_1002349262 367
110 3300006880 Ga0075429_100019368 Ga0075429_1000193684 367
111 3300009094 Ga0111539_10008663 Ga0111539_100086634 367
112 3300009147 Ga0114129_10014293 Ga0114129_100142934 367
113 3300011119 Ga0105246_10124617 Ga0105246_101246171 367
114 3300021384 Ga0213876_10002947 Ga0213876_100029473 367
115 3300025905 Ga0207685_10008994 Ga0207685_100089941 367
116 3300025939 Ga0207665_10190954 Ga0207665_101909542 367
117 3300037853 Ga0436364_1016419 Ga0436364_1016419_10531_11700 367
118 3300039437 Ga0436365_1475458 Ga0436365_1475458_6563_7732 367
119 3300039453 Ga0436362_1255597 Ga0436362_1255597_132_1271 367
120 3300049576 Ga0501040_0029353 Ga0501040_0029353_2534_3658 367
121 3300050507 nmdc:mga05p37_202676_c1 nmdc:mga05p37_202676_c1_450_1589 367
122 3300050507 nmdc:mga05p37_7394_c1 nmdc:mga05p37_7394_c1_8090_9253 367
123 3300050507 nmdc:mga05p37_88618_c1 nmdc:mga05p37_88618_c1_2176_3315 367
124 3300050508 nmdc:mga09592_49665_c1 nmdc:mga09592_49665_c1_516_1655 367
125 3300050508 nmdc:mga09592_52794_c1 nmdc:mga09592_52794_c1_1460_2623 367
126 3300050510 nmdc:mga06r32_184246_c1 nmdc:mga06r32_184246_c1_228_1367 367
127 3300050510 nmdc:mga06r32_45638_c1 nmdc:mga06r32_45638_c1_2997_4136 367
128 3300050511 nmdc:mga08y16_147487_c1 nmdc:mga08y16_147487_c1_1271_2410 367
129 3300050515 nmdc:mga0a205_73375_c1 nmdc:mga0a205_73375_c1_363_1502 367
130 3300006844 Ga0075428_100050845 Ga0075428_1000508455 368
131 3300006880 Ga0075429_100042166 Ga0075429_1000421663 368
132 iso_pu_bacteria 2990088156 2990090202 368
133 3300005329 Ga0070683_100272743 Ga0070683_1002727431 369
134 3300005337 Ga0070682_100137193 Ga0070682_1001371931 369
135 3300005338 Ga0068868_100023719 Ga0068868_1000237192 369
136 3300005340 Ga0070689_100002549 Ga0070689_1000025495 369
137 3300005343 Ga0070687_100003797 Ga0070687_1000037972 369
138 3300005366 Ga0070659_100148235 Ga0070659_1001482351 369
139 3300005438 Ga0070701_10001046 Ga0070701_100010464 369
140 3300005441 Ga0070700_100256734 Ga0070700_1002567341 369
141 3300005459 Ga0068867_100028571 Ga0068867_1000285711 369
142 3300005466 Ga0070685_10092530 Ga0070685_100925302 369
143 3300005543 Ga0070672_100093193 Ga0070672_1000931932 369
144 3300005544 Ga0070686_100016963 Ga0070686_1000169631 369
145 3300005549 Ga0070704_100341524 Ga0070704_1003415241 369
146 3300005615 Ga0070702_100002299 Ga0070702_1000022993 369
147 3300005615 Ga0070702_100057912 Ga0070702_1000579122 369
148 3300005616 Ga0068852_100039260 Ga0068852_1000392602 369
149 3300005617 Ga0068859_100011958 Ga0068859_1000119585 369
150 3300005618 Ga0068864_100046531 Ga0068864_1000465312 369
151 3300005718 Ga0068866_10019605 Ga0068866_100196052 369
152 3300005842 Ga0068858_100023083 Ga0068858_1000230832 369
153 3300005981 Ga0081538_10002331 Ga0081538_100023317 369
154 3300006931 Ga0097620_100011958 Ga0097620_1000119585 369
155 3300009094 Ga0111539_10078138 Ga0111539_100781383 369
156 3300009094 Ga0111539_10225445 Ga0111539_102254451 369
157 3300009098 Ga0105245_10019082 Ga0105245_100190824 369
158 3300009098 Ga0105245_10097990 Ga0105245_100979903 369
159 3300009101 Ga0105247_10030105 Ga0105247_100301053 369
160 3300009148 Ga0105243_10006161 Ga0105243_100061613 369
161 3300009176 Ga0105242_10115546 Ga0105242_101155462 369
162 3300009177 Ga0105248_10117043 Ga0105248_101170431 369
163 3300009553 Ga0105249_10022576 Ga0105249_100225762 369
164 3300009553 Ga0105249_10037491 Ga0105249_100374913 369
165 3300009553 Ga0105249_10157992 Ga0105249_101579922 369
166 3300010375 Ga0105239_10068804 Ga0105239_100688041 369
167 3300013308 Ga0157375_10032173 Ga0157375_100321732 369
168 3300013308 Ga0157375_10172837 Ga0157375_101728372 369
169 3300014326 Ga0157380_10045592 Ga0157380_100455922 369
170 3300021384 Ga0213876_10040035 Ga0213876_100400353 369
171 3300025899 Ga0207642_10021185 Ga0207642_100211852 369
172 3300025901 Ga0207688_10045783 Ga0207688_100457832 369
173 3300025914 Ga0207671_10177077 Ga0207671_101770771 369
174 3300025918 Ga0207662_10006040 Ga0207662_100060402 369
175 3300025919 Ga0207657_10163011 Ga0207657_101630112 369
176 3300025927 Ga0207687_10190224 Ga0207687_101902242 369
177 3300025932 Ga0207690_10106763 Ga0207690_101067632 369
178 3300025935 Ga0207709_10026813 Ga0207709_100268131 369
179 3300025935 Ga0207709_10145516 Ga0207709_101455162 369
180 3300025936 Ga0207670_10014123 Ga0207670_100141234 369
181 3300026023 Ga0207677_10007594 Ga0207677_100075942 369
182 3300026035 Ga0207703_10006779 Ga0207703_100067794 369
183 3300026089 Ga0207648_10142287 Ga0207648_101422871 369
184 3300026095 Ga0207676_10274765 Ga0207676_102747652 369
185 3300026121 Ga0207683_10339943 Ga0207683_103399432 369
186 3300026142 Ga0207698_10163513 Ga0207698_101635131 369
187 3300027907 Ga0207428_10176378 Ga0207428_101763782 369
188 3300028381 Ga0268264_10111841 Ga0268264_101118412 369
189 3300039437 Ga0436365_1670297 Ga0436365_1670297_2711_3838 369
190 3300044901 Ga0466960_0097851 Ga0466960_0097851_139_1266 369
191 3300045976 Ga0466967_0026297 Ga0466967_0026297_3597_4724 369
192 3300048904 Ga0496101_0050514 Ga0496101_0050514_19_1146 369
193 3300048905 Ga0496102_0398304 Ga0496102_0398304_34_1161 369
194 3300048907 Ga0496104_0137267 Ga0496104_0137267_1207_2334 369
195 3300048908 Ga0496105_0188736 Ga0496105_0188736_310_1437 369
196 3300048909 Ga0496106_0003244 Ga0496106_0003244_5600_6727 369
197 3300048909 Ga0496106_0086571 Ga0496106_0086571_285_1412 369
198 3300048910 Ga0496107_0001966 Ga0496107_0001966_7202_8329 369
199 3300048911 Ga0496108_0001455 Ga0496108_0001455_16990_18117 369
200 3300048912 Ga0496109_0154853 Ga0496109_0154853_243_1370 369
201 3300048912 Ga0496109_0290843 Ga0496109_0290843_344_1471 369
202 3300048913 Ga0496110_0008677 Ga0496110_0008677_395_1522 369
203 3300048913 Ga0496110_0226221 Ga0496110_0226221_113_1240 369
204 3300048914 Ga0496111_0081711 Ga0496111_0081711_1165_2292 369
205 3300048914 Ga0496111_0214125 Ga0496111_0214125_85_1212 369
206 3300048915 Ga0496112_0116968 Ga0496112_0116968_141_1268 369
207 3300048916 Ga0496113_0027105 Ga0496113_0027105_1884_3011 369
208 3300048916 Ga0496113_0209825 Ga0496113_0209825_185_1312 369
209 3300049580 Ga0501046_0079592 Ga0501046_0079592_1047_2165 369
210 3300049592 Ga0501076_0000486 Ga0501076_0000486_6243_7361 369
211 3300049741 Ga0501079_0037082 Ga0501079_0037082_904_2022 369
212 3300049743 Ga0501081_0011103 Ga0501081_0011103_3860_4978 369
213 3300050511 nmdc:mga08y16_115302_c1 nmdc:mga08y16_115302_c1_859_1986 369
214 3300061734 Ga0530510_0022724 Ga0530510_0022724_2206_3324 369
215 3300005434 Ga0070709_10065148 Ga0070709_100651482 370
216 3300005844 Ga0068862_100225575 Ga0068862_1002255752 370
217 3300025885 Ga0207653_10022210 Ga0207653_100222102 370
218 3300025906 Ga0207699_10043999 Ga0207699_100439993 370
219 3300025906 Ga0207699_10096867 Ga0207699_100968672 370
220 3300025915 Ga0207693_10131577 Ga0207693_101315772 370
221 3300025928 Ga0207700_10134500 Ga0207700_101345002 370
222 3300025929 Ga0207664_10110234 Ga0207664_101102342 370
223 3300026078 Ga0207702_10081848 Ga0207702_100818482 370
224 3300026118 Ga0207675_100011869 Ga0207675_1000118692 370
225 3300034820 Ga0373959_0023875 Ga0373959_0023875_67_1182 370
226 3300035083 Ga0373926_0008055 Ga0373926_0008055_1914_3074 370
227 3300035083 Ga0373926_0015763 Ga0373926_0015763_1116_2288 370
228 3300035111 Ga0373923_0005254 Ga0373923_0005254_767_1939 370
229 3300035116 Ga0373945_0000070 Ga0373945_0000070_10029_11189 370
230 3300035119 Ga0373956_0009708 Ga0373956_0009708_977_2149 370
231 3300035170 Ga0373943_0000087 Ga0373943_0000087_21407_22567 370
232 3300035170 Ga0373943_0015586 Ga0373943_0015586_1202_2374 370
233 3300035171 Ga0373946_0000186 Ga0373946_0000186_7950_9110 370
234 3300035171 Ga0373946_0001168 Ga0373946_0001168_3052_4224 370
235 3300035172 Ga0373955_0003588 Ga0373955_0003588_3051_4223 370
236 3300035692 Ga0373935_0000270 Ga0373935_0000270_8669_9829 370
237 3300035695 Ga0373927_0002157 Ga0373927_0002157_11105_12265 370
238 3300035725 Ga0373947_0003066 Ga0373947_0003066_3543_4703 370
239 3300035725 Ga0373947_0014593 Ga0373947_0014593_868_2040 370
240 3300037068 Ga0373925_0002000 Ga0373925_0002000_104_1264 370
241 3300037068 Ga0373925_0065677 Ga0373925_0065677_372_1544 370
242 3300039062 Ga0400483_266747 Ga0400483_266747_118_1236 370
243 3300041512 Ga0451853_0689240 Ga0451853_0689240_805_1965 370
244 3300045976 Ga0466967_0247447 Ga0466967_0247447_131_1261 370
245 3300046454 Ga0495592_0056767 Ga0495592_0056767_872_2044 370
246 3300046455 Ga0495603_0010187 Ga0495603_0010187_2616_3788 370
247 3300046459 Ga0495629_0054470 Ga0495629_0054470_586_1758 370
248 3300046462 Ga0495651_0074424 Ga0495651_0074424_1193_2353 370
249 3300046463 Ga0495653_0000347 Ga0495653_0000347_19422_20582 370
250 3300046463 Ga0495653_0079924 Ga0495653_0079924_199_1359 370
251 3300046472 Ga0495580_0008722 Ga0495580_0008722_5877_7049 370
252 3300046473 Ga0495582_0002355 Ga0495582_0002355_7966_9138 370
253 3300046473 Ga0495582_0095384 Ga0495582_0095384_115_1275 370
254 3300046475 Ga0495639_0000749 Ga0495639_0000749_9922_11094 370
255 3300046477 Ga0495664_0000408 Ga0495664_0000408_14775_15935 370
256 3300046499 Ga0495594_0007204 Ga0495594_0007204_4436_5608 370
257 3300046514 Ga0495618_0019598 Ga0495618_0019598_1748_2920 370
258 3300046514 Ga0495618_0049994 Ga0495618_0049994_231_1391 370
259 3300046516 Ga0495628_0078052 Ga0495628_0078052_69_1229 370
260 3300046517 Ga0495630_0009036 Ga0495630_0009036_2532_3704 370
261 3300046517 Ga0495630_0022767 Ga0495630_0022767_3114_4274 370
262 3300046526 Ga0495666_0004171 Ga0495666_0004171_856_2028 370
263 3300046529 Ga0495652_0043556 Ga0495652_0043556_588_1748 370
264 3300046529 Ga0495652_0096174 Ga0495652_0096174_1044_2204 370
265 3300046531 Ga0495665_0013826 Ga0495665_0013826_3007_4167 370
266 3300046531 Ga0495665_0021712 Ga0495665_0021712_1405_2577 370
267 3300046533 Ga0495640_0040636 Ga0495640_0040636_1214_2386 370
268 3300046535 Ga0495586_0007549 Ga0495586_0007549_3369_4541 370
269 3300046536 Ga0495587_0030463 Ga0495587_0030463_539_1711 370
270 3300046543 Ga0495645_0027708 Ga0495645_0027708_1912_3084 370
271 3300046559 Ga0495667_0038592 Ga0495667_0038592_1463_2635 370
272 3300046559 Ga0495667_0066494 Ga0495667_0066494_521_1681 370
273 3300046642 Ga0495634_0027057 Ga0495634_0027057_1494_2666 370
274 3300046663 Ga0495635_0003702 Ga0495635_0003702_7454_8614 370
275 3300046663 Ga0495635_0019395 Ga0495635_0019395_39_1199 370
276 3300046674 Ga0495588_0011421 Ga0495588_0011421_926_2098 370
277 3300046675 Ga0495657_0073456 Ga0495657_0073456_475_1635 370
278 3300046678 Ga0495599_0026497 Ga0495599_0026497_901_2073 370
279 3300046679 Ga0495623_0014444 Ga0495623_0014444_1136_2308 370
280 3300046680 Ga0495646_0046981 Ga0495646_0046981_1214_2386 370
281 3300046683 Ga0495658_0027295 Ga0495658_0027295_495_1667 370
282 3300046689 Ga0495613_0011279 Ga0495613_0011279_1341_2513 370
283 3300046690 Ga0495624_0003374 Ga0495624_0003374_1695_2855 370
284 3300046690 Ga0495624_0014171 Ga0495624_0014171_328_1500 370
285 3300046809 Ga0495600_0023375 Ga0495600_0023375_1561_2733 370
286 3300046809 Ga0495600_0204443 Ga0495600_0204443_15_1175 370
287 3300047315 Ga0495581_0003281 Ga0495581_0003281_3987_5159 370
288 3300047317 Ga0495604_0025245 Ga0495604_0025245_2321_3493 370
289 3300047321 Ga0495676_0000213 Ga0495676_0000213_9018_10178 370
290 3300047321 Ga0495676_0011576 Ga0495676_0011576_5325_6497 370
291 3300047322 Ga0495680_0003820 Ga0495680_0003820_9002_10162 370
292 3300047322 Ga0495680_0023632 Ga0495680_0023632_1829_2989 370
293 3300047322 Ga0495680_0024929 Ga0495680_0024929_2377_3549 370
294 3300047471 Ga0495684_0001287 Ga0495684_0001287_18969_20129 370
295 3300047471 Ga0495684_0044512 Ga0495684_0044512_1226_2386 370
296 3300047673 Ga0495593_0024105 Ga0495593_0024105_244_1416 370
297 3300048088 Ga0495602_0069239 Ga0495602_0069239_752_1912 370
298 3300053084 Ga0495595_0019099 Ga0495595_0019099_78_1238 370
299 3300053084 Ga0495595_0028611 Ga0495595_0028611_1011_2183 370
300 3300053085 Ga0495619_0001832 Ga0495619_0001832_4632_5804 370
301 3300005295 Ga0065707_10011490 Ga0065707_100114902 371
302 3300005295 Ga0065707_10117557 Ga0065707_101175572 371
303 3300005467 Ga0070706_100016382 Ga0070706_1000163822 371
304 3300005467 Ga0070706_100116252 Ga0070706_1001162522 371
305 3300005471 Ga0070698_100070742 Ga0070698_1000707423 371
306 3300005518 Ga0070699_100007625 Ga0070699_1000076251 371
307 3300005536 Ga0070697_100006825 Ga0070697_1000068255 371
308 3300006038 Ga0075365_10000277 Ga0075365_100002774 371
309 3300006844 Ga0075428_100139221 Ga0075428_1001392213 371
310 3300006852 Ga0075433_10021970 Ga0075433_100219702 371
311 3300006852 Ga0075433_10029368 Ga0075433_100293683 371
312 3300006871 Ga0075434_100052150 Ga0075434_1000521502 371
313 3300006871 Ga0075434_100067074 Ga0075434_1000670742 371
314 3300006871 Ga0075434_100303287 Ga0075434_1003032872 371
315 3300006880 Ga0075429_100104516 Ga0075429_1001045162 371
316 3300007076 Ga0075435_100019257 Ga0075435_1000192572 371
317 3300007265 Ga0099794_10018357 Ga0099794_100183572 371
318 3300009094 Ga0111539_10051364 Ga0111539_100513645 371
319 3300009147 Ga0114129_10015551 Ga0114129_100155516 371
320 3300010159 Ga0099796_10018590 Ga0099796_100185902 371
321 3300014326 Ga0157380_10035984 Ga0157380_100359843 371
322 3300025910 Ga0207684_10013282 Ga0207684_100132822 371
323 3300025910 Ga0207684_10117729 Ga0207684_101177293 371
324 3300027907 Ga0207428_10034266 Ga0207428_100342662 371
325 3300027907 Ga0207428_10046063 Ga0207428_100460633 371
326 3300035084 Ga0373928_0000388 Ga0373928_0000388_3494_4636 371
327 3300035085 Ga0373929_0006391 Ga0373929_0006391_727_1869 371
328 3300035691 Ga0373931_0000001 Ga0373931_0000001_544741_545883 371
329 3300035691 Ga0373931_0000038 Ga0373931_0000038_59551_60693 371
330 3300035695 Ga0373927_0050211 Ga0373927_0050211_469_1683 371
331 3300037853 Ga0436364_1096538 Ga0436364_1096538_1148_2335 371
332 3300039062 Ga0400483_286861 Ga0400483_286861_1566_2687 371
333 3300046514 Ga0495618_0142552 Ga0495618_0142552_57_1223 371
334 3300046543 Ga0495645_0105856 Ga0495645_0105856_351_1517 371
335 3300046559 Ga0495667_0055381 Ga0495667_0055381_213_1379 371
336 3300046663 Ga0495635_0133766 Ga0495635_0133766_34_1200 371
337 3300046675 Ga0495657_0131624 Ga0495657_0131624_170_1336 371
338 3300047318 Ga0495636_0016336 Ga0495636_0016336_1560_2678 371
339 3300049578 Ga0501042_0077176 Ga0501042_0077176_1053_2189 371
340 3300049824 Ga0501045_0046010 Ga0501045_0046010_189_1325 371
341 3300050492 nmdc:mga0yw44_112_c1 nmdc:mga0yw44_112_c1_7415_8557 371
342 3300050507 nmdc:mga05p37_220724_c1 nmdc:mga05p37_220724_c1_903_2039 371
343 3300050507 nmdc:mga05p37_350383_c1 nmdc:mga05p37_350383_c1_552_1688 371
344 3300050508 nmdc:mga09592_5379_c1 nmdc:mga09592_5379_c1_4854_6050 371
345 3300050511 nmdc:mga08y16_27870_c1 nmdc:mga08y16_27870_c1_1053_2249 371
346 3300050511 nmdc:mga08y16_64038_c1 nmdc:mga08y16_64038_c1_2112_3248 371
347 3300050513 nmdc:mga0rr50_22223_c1 nmdc:mga0rr50_22223_c1_3080_4216 371
348 3300050515 nmdc:mga0a205_118100_c1 nmdc:mga0a205_118100_c1_507_1703 371
349 3300053119 Ga0500595_026204 Ga0500595_026204_108_1247 371
350 3300053153 Ga0500616_0000856 Ga0500616_0000856_7444_8607 371
351 3300061734 Ga0530510_0000079 Ga0530510_0000079_8869_10005 371
352 3300061734 Ga0530510_0042960 Ga0530510_0042960_1825_2961 371
353 3300005336 Ga0070680_100090001 Ga0070680_1000900012 372
354 3300005339 Ga0070660_100069740 Ga0070660_1000697402 372
355 3300005345 Ga0070692_10025198 Ga0070692_100251983 372
356 3300005347 Ga0070668_100080017 Ga0070668_1000800172 372
357 3300005436 Ga0070713_100107619 Ga0070713_1001076192 372
358 3300005445 Ga0070708_100066600 Ga0070708_1000666002 372
359 3300005445 Ga0070708_100118153 Ga0070708_1001181532 372
360 3300005445 Ga0070708_100134142 Ga0070708_1001341422 372
361 3300005445 Ga0070708_100326435 Ga0070708_1003264351 372
362 3300005455 Ga0070663_100026339 Ga0070663_1000263392 372
363 3300005467 Ga0070706_100007777 Ga0070706_10000777711 372
364 3300005467 Ga0070706_100102260 Ga0070706_1001022602 372
365 3300005467 Ga0070706_100167321 Ga0070706_1001673212 372
366 3300005467 Ga0070706_100313078 Ga0070706_1003130782 372
367 3300005468 Ga0070707_100023686 Ga0070707_1000236863 372
368 3300005468 Ga0070707_100024323 Ga0070707_1000243235 372
369 3300005471 Ga0070698_100115579 Ga0070698_1001155792 372
370 3300005471 Ga0070698_100173455 Ga0070698_1001734552 372
371 3300005518 Ga0070699_100101785 Ga0070699_1001017852 372
372 3300005530 Ga0070679_100217002 Ga0070679_1002170022 372
373 3300005536 Ga0070697_100021341 Ga0070697_1000213416 372
374 3300005546 Ga0070696_100027041 Ga0070696_1000270414 372
375 3300005548 Ga0070665_100082394 Ga0070665_1000823943 372
376 3300005549 Ga0070704_100029435 Ga0070704_1000294352 372
377 3300005615 Ga0070702_100082236 Ga0070702_1000822361 372
378 3300005617 Ga0068859_100065503 Ga0068859_1000655034 372
379 3300005617 Ga0068859_100083668 Ga0068859_1000836684 372
380 3300005617 Ga0068859_100406562 Ga0068859_1004065622 372
381 3300005617 Ga0068859_100480495 Ga0068859_1004804951 372
382 3300005718 Ga0068866_10148749 Ga0068866_101487491 372
383 3300005842 Ga0068858_100243051 Ga0068858_1002430512 372
384 3300005843 Ga0068860_100344067 Ga0068860_1003440672 372
385 3300005844 Ga0068862_100029396 Ga0068862_1000293963 372
386 3300005844 Ga0068862_100031243 Ga0068862_1000312432 372
387 3300005844 Ga0068862_100058122 Ga0068862_1000581224 372
388 3300005981 Ga0081538_10008822 Ga0081538_100088226 372
389 3300005981 Ga0081538_10009571 Ga0081538_100095714 372
390 3300005983 Ga0081540_1000027 Ga0081540_1000027122 372
391 3300006058 Ga0075432_10054592 Ga0075432_100545921 372
392 3300006844 Ga0075428_100037393 Ga0075428_1000373934 372
393 3300006844 Ga0075428_100038810 Ga0075428_1000388102 372
394 3300006844 Ga0075428_100056716 Ga0075428_1000567164 372
395 3300006846 Ga0075430_100001115 Ga0075430_1000011153 372
396 3300006847 Ga0075431_100001427 Ga0075431_10000142718 372
397 3300006847 Ga0075431_100012050 Ga0075431_1000120505 372
398 3300006852 Ga0075433_10003975 Ga0075433_100039755 372
399 3300006852 Ga0075433_10078201 Ga0075433_100782012 372
400 3300006852 Ga0075433_10079461 Ga0075433_100794613 372
401 3300006871 Ga0075434_100022950 Ga0075434_1000229502 372
402 3300006871 Ga0075434_100034862 Ga0075434_1000348622 372
403 3300006871 Ga0075434_100047260 Ga0075434_1000472602 372
404 3300006871 Ga0075434_100158582 Ga0075434_1001585823 372
405 3300006880 Ga0075429_100008882 Ga0075429_1000088822 372
406 3300006880 Ga0075429_100022165 Ga0075429_1000221653 372
407 3300006914 Ga0075436_100017898 Ga0075436_1000178985 372
408 3300006931 Ga0097620_100065502 Ga0097620_1000655024 372
409 3300006931 Ga0097620_100083665 Ga0097620_1000836652 372
410 3300006931 Ga0097620_100406597 Ga0097620_1004065972 372
411 3300006931 Ga0097620_100480523 Ga0097620_1004805231 372
412 3300007076 Ga0075435_100005780 Ga0075435_1000057806 372
413 3300007076 Ga0075435_100011847 Ga0075435_1000118476 372
414 3300007076 Ga0075435_100032924 Ga0075435_1000329242 372
415 3300007076 Ga0075435_100038327 Ga0075435_1000383274 372
416 3300007076 Ga0075435_100154789 Ga0075435_1001547892 372
417 3300009094 Ga0111539_10012036 Ga0111539_100120369 372
418 3300009094 Ga0111539_10056895 Ga0111539_100568953 372
419 3300009098 Ga0105245_10199494 Ga0105245_101994942 372
420 3300009101 Ga0105247_10021235 Ga0105247_100212352 372
421 3300009147 Ga0114129_10003520 Ga0114129_1000352010 372
422 3300009147 Ga0114129_10006595 Ga0114129_100065956 372
423 3300009147 Ga0114129_10163315 Ga0114129_101633152 372
424 3300009147 Ga0114129_10660947 Ga0114129_106609472 372
425 3300009177 Ga0105248_10140793 Ga0105248_101407933 372
426 3300009177 Ga0105248_10170786 Ga0105248_101707864 372
427 3300009545 Ga0105237_10081636 Ga0105237_100816361 372
428 3300009553 Ga0105249_10056486 Ga0105249_100564862 372
429 3300009553 Ga0105249_10177569 Ga0105249_101775692 372
430 3300013102 Ga0157371_10177034 Ga0157371_101770341 372
431 3300013296 Ga0157374_10303963 Ga0157374_103039631 372
432 3300013297 Ga0157378_10520481 Ga0157378_105204811 372
433 3300013306 Ga0163162_10020095 Ga0163162_100200955 372
434 3300013306 Ga0163162_10159984 Ga0163162_101599842 372
435 3300013306 Ga0163162_10534287 Ga0163162_105342871 372
436 3300013308 Ga0157375_10325398 Ga0157375_103253982 372
437 3300024225 Ga0224572_1005549 Ga0224572_10055492 372
438 3300025901 Ga0207688_10021184 Ga0207688_100211841 372
439 3300025908 Ga0207643_10004374 Ga0207643_100043742 372
440 3300025910 Ga0207684_10013816 Ga0207684_100138166 372
441 3300025910 Ga0207684_10026292 Ga0207684_100262922 372
442 3300025910 Ga0207684_10030715 Ga0207684_100307156 372
443 3300025910 Ga0207684_10064503 Ga0207684_100645034 372
444 3300025917 Ga0207660_10035783 Ga0207660_100357831 372
445 3300025918 Ga0207662_10018084 Ga0207662_100180843 372
446 3300025919 Ga0207657_10076357 Ga0207657_100763573 372
447 3300025921 Ga0207652_10154643 Ga0207652_101546432 372
448 3300025922 Ga0207646_10019819 Ga0207646_100198191 372
449 3300025922 Ga0207646_10123364 Ga0207646_101233642 372
450 3300025926 Ga0207659_10098493 Ga0207659_100984932 372
451 3300025927 Ga0207687_10062146 Ga0207687_100621462 372
452 3300025933 Ga0207706_10187882 Ga0207706_101878822 372
453 3300025940 Ga0207691_10076248 Ga0207691_100762482 372
454 3300025940 Ga0207691_10079660 Ga0207691_100796602 372
455 3300025981 Ga0207640_10089116 Ga0207640_100891162 372
456 3300026067 Ga0207678_10127482 Ga0207678_101274823 372
457 3300026089 Ga0207648_10040563 Ga0207648_100405632 372
458 3300026089 Ga0207648_10076413 Ga0207648_100764132 372
459 3300026116 Ga0207674_10148097 Ga0207674_101480972 372
460 3300026116 Ga0207674_10204447 Ga0207674_102044472 372
461 3300026118 Ga0207675_100026881 Ga0207675_1000268814 372
462 3300026118 Ga0207675_100048901 Ga0207675_1000489012 372
463 3300026118 Ga0207675_100115555 Ga0207675_1001155552 372
464 3300026121 Ga0207683_10022343 Ga0207683_100223433 372
465 3300026142 Ga0207698_10212310 Ga0207698_102123101 372
466 3300027907 Ga0207428_10005490 Ga0207428_1000549010 372
467 3300028379 Ga0268266_10158452 Ga0268266_101584522 372
468 3300028380 Ga0268265_10031164 Ga0268265_100311642 372
469 3300028380 Ga0268265_10037736 Ga0268265_100377363 372
470 3300028381 Ga0268264_10099355 Ga0268264_100993552 372
471 3300031901 Ga0307406_10030661 Ga0307406_100306612 372
472 3300031911 Ga0307412_10321830 Ga0307412_103218301 372
473 3300035691 Ga0373931_0014145 Ga0373931_0014145_2448_3587 372
474 3300035724 Ga0373933_0050558 Ga0373933_0050558_631_1782 372
475 3300038996 Ga0242420_001892 Ga0242420_001892_785_1921 372
476 3300042876 Ga0451577_0003484 Ga0451577_0003484_1612_2748 372
477 3300044712 Ga0453684_0077520 Ga0453684_0077520_1643_2779 372
478 3300045051 Ga0451576_0025862 Ga0451576_0025862_659_1795 372
479 3300046615 Ga0495656_0015156 Ga0495656_0015156_1336_2475 372
480 3300046684 Ga0495669_0011629 Ga0495669_0011629_2008_3147 372
481 3300048905 Ga0496102_0135989 Ga0496102_0135989_948_2087 372
482 3300048911 Ga0496108_0185184 Ga0496108_0185184_363_1517 372
483 3300048913 Ga0496110_0053833 Ga0496110_0053833_2116_3270 372
484 3300048917 Ga0496114_0112126 Ga0496114_0112126_753_1907 372
485 3300050507 nmdc:mga05p37_100096_c1 nmdc:mga05p37_100096_c1_61_1200 372
486 3300050507 nmdc:mga05p37_1851_c1 nmdc:mga05p37_1851_c1_5805_6947 372
487 3300050507 nmdc:mga05p37_20592_c1 nmdc:mga05p37_20592_c1_2329_3468 372
488 3300050508 nmdc:mga09592_4532_c1 nmdc:mga09592_4532_c1_8810_9949 372
489 3300050508 nmdc:mga09592_53936_c1 nmdc:mga09592_53936_c1_472_1614 372
490 3300050509 nmdc:mga0qj67_387_c1 nmdc:mga0qj67_387_c1_14352_15491 372
491 3300050510 nmdc:mga06r32_56844_c1 nmdc:mga06r32_56844_c1_2059_3201 372
492 3300050511 nmdc:mga08y16_192317_c1 nmdc:mga08y16_192317_c1_623_1777 372
493 3300050511 nmdc:mga08y16_52323_c1 nmdc:mga08y16_52323_c1_3065_4204 372
494 3300050511 nmdc:mga08y16_794_c1 nmdc:mga08y16_794_c1_1597_2733 372
495 3300050512 nmdc:mga0n895_100746_c1 nmdc:mga0n895_100746_c1_1418_2557 372
496 3300050512 nmdc:mga0n895_16837_c1 nmdc:mga0n895_16837_c1_5440_6576 372
497 3300050512 nmdc:mga0n895_2920_c1 nmdc:mga0n895_2920_c1_4015_5157 372
498 3300050512 nmdc:mga0n895_4136_c1 nmdc:mga0n895_4136_c1_1366_2502 372
499 3300050512 nmdc:mga0n895_64822_c1 nmdc:mga0n895_64822_c1_89_1228 372
500 3300050513 nmdc:mga0rr50_1886_c1 nmdc:mga0rr50_1886_c1_9388_10530 372
501 3300050513 nmdc:mga0rr50_19263_c1 nmdc:mga0rr50_19263_c1_1558_2694 372
502 3300050513 nmdc:mga0rr50_37693_c1 nmdc:mga0rr50_37693_c1_2099_3235 372
503 3300050514 nmdc:mga08x19_638_c1 nmdc:mga08x19_638_c1_15582_16724 372
504 3300050515 nmdc:mga0a205_4196_c1 nmdc:mga0a205_4196_c1_3387_4529 372
505 3300050515 nmdc:mga0a205_51911_c1 nmdc:mga0a205_51911_c1_1742_2878 372
506 3300005329 Ga0070683_100037823 Ga0070683_1000378234 373
507 3300005334 Ga0068869_100192207 Ga0068869_1001922072 373
508 3300005336 Ga0070680_100034557 Ga0070680_1000345572 373
509 3300005339 Ga0070660_100034853 Ga0070660_1000348532 373
510 3300005344 Ga0070661_100023233 Ga0070661_1000232334 373
511 3300005364 Ga0070673_100068359 Ga0070673_1000683593 373
512 3300005440 Ga0070705_100007132 Ga0070705_1000071322 373
513 3300005455 Ga0070663_100007013 Ga0070663_1000070134 373
514 3300005456 Ga0070678_100032209 Ga0070678_1000322091 373
515 3300005535 Ga0070684_100233262 Ga0070684_1002332621 373
516 3300005543 Ga0070672_100217024 Ga0070672_1002170242 373
517 3300005545 Ga0070695_100025562 Ga0070695_1000255622 373
518 3300005546 Ga0070696_100088395 Ga0070696_1000883952 373
519 3300005577 Ga0068857_100081789 Ga0068857_1000817893 373
520 3300005617 Ga0068859_100120601 Ga0068859_1001206012 373
521 3300005618 Ga0068864_100160479 Ga0068864_1001604792 373
522 3300005843 Ga0068860_100028444 Ga0068860_1000284446 373
523 3300005844 Ga0068862_100173990 Ga0068862_1001739902 373
524 3300005983 Ga0081540_1000267 Ga0081540_100026711 373
525 3300006028 Ga0070717_10029598 Ga0070717_100295982 373
526 3300006844 Ga0075428_100015268 Ga0075428_1000152688 373
527 3300006844 Ga0075428_100254903 Ga0075428_1002549032 373
528 3300006931 Ga0097620_100120603 Ga0097620_1001206032 373
529 3300009098 Ga0105245_10340018 Ga0105245_103400181 373
530 3300009147 Ga0114129_10442659 Ga0114129_104426592 373
531 3300009148 Ga0105243_10017984 Ga0105243_100179843 373
532 3300009176 Ga0105242_10070835 Ga0105242_100708352 373
533 3300012515 Ga0157338_1000655 Ga0157338_10006551 373
534 3300020081 Ga0206354_11178749 Ga0206354_111787492 373
535 3300025901 Ga0207688_10008209 Ga0207688_100082094 373
536 3300025904 Ga0207647_10018615 Ga0207647_100186153 373
537 3300025905 Ga0207685_10062620 Ga0207685_100626202 373
538 3300025906 Ga0207699_10048136 Ga0207699_100481362 373
539 3300025906 Ga0207699_10065872 Ga0207699_100658722 373
540 3300025908 Ga0207643_10097013 Ga0207643_100970132 373
541 3300025913 Ga0207695_10135766 Ga0207695_101357662 373
542 3300025916 Ga0207663_10067454 Ga0207663_100674542 373
543 3300025919 Ga0207657_10069453 Ga0207657_100694532 373
544 3300025920 Ga0207649_10062402 Ga0207649_100624022 373
545 3300025921 Ga0207652_10076816 Ga0207652_100768162 373
546 3300025926 Ga0207659_10110111 Ga0207659_101101112 373
547 3300025928 Ga0207700_10126479 Ga0207700_101264792 373
548 3300025931 Ga0207644_10033644 Ga0207644_100336442 373
549 3300025933 Ga0207706_10026852 Ga0207706_100268524 373
550 3300025933 Ga0207706_10166825 Ga0207706_101668252 373
551 3300025940 Ga0207691_10045616 Ga0207691_100456164 373
552 3300025942 Ga0207689_10020853 Ga0207689_100208535 373
553 3300025944 Ga0207661_10042482 Ga0207661_100424822 373
554 3300025960 Ga0207651_10288273 Ga0207651_102882731 373
555 3300025961 Ga0207712_10109667 Ga0207712_101096672 373
556 3300025986 Ga0207658_10310334 Ga0207658_103103341 373
557 3300026067 Ga0207678_10001201 Ga0207678_1000120112 373
558 3300026078 Ga0207702_10098775 Ga0207702_100987752 373
559 3300026088 Ga0207641_10334448 Ga0207641_103344482 373
560 3300026095 Ga0207676_10193276 Ga0207676_101932762 373
561 3300026116 Ga0207674_10053822 Ga0207674_100538221 373
562 3300026121 Ga0207683_10018125 Ga0207683_100181254 373
563 3300031456 Ga0307513_10004704 Ga0307513_1000470414 373
564 3300034816 Ga0373930_0002595 Ga0373930_0002595_1285_2457 373
565 3300037853 Ga0436364_0699396 Ga0436364_0699396_494_1666 373
566 3300039062 Ga0400483_059098 Ga0400483_059098_49_1176 373
567 3300039062 Ga0400483_275305 Ga0400483_275305_6221_7348 373
568 3300046559 Ga0495667_0017454 Ga0495667_0017454_50_1222 373
569 3300046664 Ga0495659_0038210 Ga0495659_0038210_158_1297 373
570 3300047444 Ga0495675_0121614 Ga0495675_0121614_207_1379 373
571 3300048906 Ga0496103_0013368 Ga0496103_0013368_3023_4195 373
572 3300048909 Ga0496106_0063683 Ga0496106_0063683_961_2133 373
573 3300048910 Ga0496107_0028883 Ga0496107_0028883_1885_3057 373
574 3300048914 Ga0496111_0081682 Ga0496111_0081682_389_1561 373
575 3300049592 Ga0501076_0220506 Ga0501076_0220506_227_1366 373
576 3300050507 nmdc:mga05p37_276313_c1 nmdc:mga05p37_276313_c1_416_1558 373
577 3300054114 Ga0501084_0220078 Ga0501084_0220078_253_1392 373
578 iso_pu_bacteria 2558860112 2558913255 373
579 3300005467 Ga0070706_100149314 Ga0070706_1001493141 374
580 3300005468 Ga0070707_100231922 Ga0070707_1002319221 374
581 3300005546 Ga0070696_100045126 Ga0070696_1000451262 374
582 3300005983 Ga0081540_1036113 Ga0081540_10361132 374
583 3300006163 Ga0070715_10041093 Ga0070715_100410932 374
584 3300009147 Ga0114129_10156530 Ga0114129_101565303 374
585 3300021384 Ga0213876_10031741 Ga0213876_100317413 374
586 3300021388 Ga0213875_10000826 Ga0213875_1000082632 374
587 3300021388 Ga0213875_10032935 Ga0213875_100329353 374
588 3300035086 Ga0373934_0023998 Ga0373934_0023998_417_1595 374
589 3300035088 Ga0373940_0017428 Ga0373940_0017428_154_1299 374
590 3300035120 Ga0373957_0014317 Ga0373957_0014317_1043_2221 374
591 3300035172 Ga0373955_0024869 Ga0373955_0024869_1593_2771 374
592 3300035691 Ga0373931_0123003 Ga0373931_0123003_188_1333 374
593 3300035724 Ga0373933_0013928 Ga0373933_0013928_2429_3607 374
594 3300036401 Ga0373937_0019106 Ga0373937_0019106_1557_2735 374
595 3300037853 Ga0436364_0371684 Ga0436364_0371684_22893_24083 374
596 3300046462 Ga0495651_0027545 Ga0495651_0027545_3100_4278 374
597 3300046463 Ga0495653_0008043 Ga0495653_0008043_3975_5153 374
598 3300046511 Ga0495608_0010944 Ga0495608_0010944_1638_2816 374
599 3300046675 Ga0495657_0031845 Ga0495657_0031845_463_1641 374
600 3300047319 Ga0495674_0000477 Ga0495674_0000477_247_1425 374
601 3300047322 Ga0495680_0058629 Ga0495680_0058629_27_1205 374
602 3300047471 Ga0495684_0056526 Ga0495684_0056526_1592_2770 374
603 3300049588 Ga0501072_0002045 Ga0501072_0002045_11970_13118 374
604 3300049591 Ga0501075_0009407 Ga0501075_0009407_3387_4532 374
605 3300049743 Ga0501081_0087901 Ga0501081_0087901_976_2124 374
606 3300050507 nmdc:mga05p37_59454_c1 nmdc:mga05p37_59454_c1_1309_2454 374
607 3300050507 nmdc:mga05p37_71764_c1 nmdc:mga05p37_71764_c1_698_1840 374
608 3300050509 nmdc:mga0qj67_43190_c1 nmdc:mga0qj67_43190_c1_1309_2454 374
609 3300050510 nmdc:mga06r32_19944_c1 nmdc:mga06r32_19944_c1_4830_5975 374
610 3300050511 nmdc:mga08y16_542_c1 nmdc:mga08y16_542_c1_24835_25980 374
611 3300054114 Ga0501084_0107892 Ga0501084_0107892_289_1437 374
612 3300061734 Ga0530510_0141830 Ga0530510_0141830_586_1728 374
613 3300061734 Ga0530510_0207005 Ga0530510_0207005_82_1227 374
614 3300005331 Ga0070670_100178534 Ga0070670_1001785342 375
615 3300005334 Ga0068869_100004929 Ga0068869_1000049294 375
616 3300005353 Ga0070669_100075843 Ga0070669_1000758432 375
617 3300005444 Ga0070694_100031176 Ga0070694_1000311761 375
618 3300005468 Ga0070707_100114498 Ga0070707_1001144982 375
619 3300005471 Ga0070698_100014405 Ga0070698_1000144054 375
620 3300005471 Ga0070698_100082917 Ga0070698_1000829171 375
621 3300005471 Ga0070698_100185251 Ga0070698_1001852512 375
622 3300005985 Ga0081539_10000161 Ga0081539_10000161137 375
623 3300006175 Ga0070712_100007120 Ga0070712_1000071203 375
624 3300006844 Ga0075428_100139280 Ga0075428_1001392804 375
625 3300009147 Ga0114129_10035111 Ga0114129_100351113 375
626 3300025898 Ga0207692_10142026 Ga0207692_101420261 375
627 3300025915 Ga0207693_10003783 Ga0207693_100037837 375
628 3300025922 Ga0207646_10062072 Ga0207646_100620723 375
629 3300026067 Ga0207678_10117214 Ga0207678_101172142 375
630 3300037466 Ga0395898_0030125 Ga0395898_0030125_2891_4036 375
631 3300038443 Ga0395901_0004608 Ga0395901_0004608_11332_12477 375
632 3300048928 Ga0496125_0001945 Ga0496125_0001945_17648_18778 375
633 3300050507 nmdc:mga05p37_216052_c1 nmdc:mga05p37_216052_c1_488_1630 375
634 3300050514 nmdc:mga08x19_251611_c1 nmdc:mga08x19_251611_c1_20_1150 375
635 3300005434 Ga0070709_10059178 Ga0070709_100591782 376
636 3300005435 Ga0070714_100018622 Ga0070714_1000186221 376
637 3300005458 Ga0070681_10000570 Ga0070681_1000057016 376
638 3300006028 Ga0070717_10159849 Ga0070717_101598492 376
639 3300006175 Ga0070712_100017527 Ga0070712_1000175272 376
640 3300006844 Ga0075428_100086324 Ga0075428_1000863242 376
641 3300006846 Ga0075430_100067524 Ga0075430_1000675242 376
642 3300006846 Ga0075430_100165617 Ga0075430_1001656172 376
643 3300009094 Ga0111539_10007134 Ga0111539_100071344 376
644 3300013296 Ga0157374_10322100 Ga0157374_103221001 376
645 3300014325 Ga0163163_10162689 Ga0163163_101626892 376
646 3300025294 Ga0209025_1028927 Ga0209025_10289273 376
647 3300025905 Ga0207685_10055792 Ga0207685_100557921 376
648 3300025906 Ga0207699_10039819 Ga0207699_100398192 376
649 3300025909 Ga0207705_10071355 Ga0207705_100713552 376
650 3300025912 Ga0207707_10087089 Ga0207707_100870892 376
651 3300025915 Ga0207693_10015613 Ga0207693_100156134 376
652 3300025915 Ga0207693_10032674 Ga0207693_100326743 376
653 3300025916 Ga0207663_10205093 Ga0207663_102050931 376
654 3300025928 Ga0207700_10022083 Ga0207700_100220832 376
655 3300025929 Ga0207664_10019156 Ga0207664_100191564 376
656 3300025939 Ga0207665_10095719 Ga0207665_100957191 376
657 3300026078 Ga0207702_10124187 Ga0207702_101241872 376
658 3300026142 Ga0207698_10350905 Ga0207698_103509051 376
659 3300027907 Ga0207428_10018858 Ga0207428_100188583 376
660 3300031727 Ga0316576_10079672 Ga0316576_100796722 376
661 3300035088 Ga0373940_0004329 Ga0373940_0004329_431_1582 376
662 3300035090 Ga0373949_0011681 Ga0373949_0011681_103_1254 376
663 3300035119 Ga0373956_0040964 Ga0373956_0040964_328_1488 376
664 3300035171 Ga0373946_0042885 Ga0373946_0042885_71_1231 376
665 3300035242 Ga0373962_0007592 Ga0373962_0007592_730_1881 376
666 3300035691 Ga0373931_0115511 Ga0373931_0115511_349_1509 376
667 3300035695 Ga0373927_0047231 Ga0373927_0047231_1098_2291 376
668 3300035725 Ga0373947_0035108 Ga0373947_0035108_309_1502 376
669 3300035725 Ga0373947_0135713 Ga0373947_0135713_92_1252 376
670 3300036401 Ga0373937_0002383 Ga0373937_0002383_1940_3094 376
671 3300036401 Ga0373937_0004271 Ga0373937_0004271_337_1497 376
672 3300037068 Ga0373925_0011760 Ga0373925_0011760_1752_2918 376
673 3300037068 Ga0373925_0063888 Ga0373925_0063888_1117_2310 376
674 3300039438 Ga0436360_0897651 Ga0436360_0897651_39_1259 376
675 3300044712 Ga0453684_0313632 Ga0453684_0313632_574_1734 376
676 3300046454 Ga0495592_0142321 Ga0495592_0142321_79_1239 376
677 3300046462 Ga0495651_0019572 Ga0495651_0019572_331_1491 376
678 3300046477 Ga0495664_0003253 Ga0495664_0003253_7087_8241 376
679 3300046514 Ga0495618_0101675 Ga0495618_0101675_329_1483 376
680 3300046516 Ga0495628_0082523 Ga0495628_0082523_303_1457 376
681 3300046529 Ga0495652_0161740 Ga0495652_0161740_157_1311 376
682 3300046543 Ga0495645_0008561 Ga0495645_0008561_2011_3165 376
683 3300046559 Ga0495667_0056726 Ga0495667_0056726_196_1356 376
684 3300046663 Ga0495635_0067997 Ga0495635_0067997_1070_2224 376
685 3300046675 Ga0495657_0032282 Ga0495657_0032282_1092_2252 376
686 3300046680 Ga0495646_0030069 Ga0495646_0030069_2033_3187 376
687 3300046809 Ga0495600_0012987 Ga0495600_0012987_2475_3629 376
688 3300047317 Ga0495604_0004463 Ga0495604_0004463_7887_9041 376
689 3300047319 Ga0495674_0015244 Ga0495674_0015244_658_1812 376
690 3300047322 Ga0495680_0070681 Ga0495680_0070681_518_1672 376
691 3300047444 Ga0495675_0002915 Ga0495675_0002915_670_1824 376
692 3300048088 Ga0495602_0002111 Ga0495602_0002111_16861_18015 376
693 3300049823 Ga0501044_0224921 Ga0501044_0224921_558_1709 376
694 3300050509 nmdc:mga0qj67_25726_c1 nmdc:mga0qj67_25726_c1_471_1631 376
695 3300050509 nmdc:mga0qj67_85047_c1 nmdc:mga0qj67_85047_c1_563_1723 376
696 3300050511 nmdc:mga08y16_226680_c1 nmdc:mga08y16_226680_c1_276_1436 376
697 3300053077 Ga0495601_0010758 Ga0495601_0010758_1923_3083 376
698 3300053078 Ga0495612_0001008 Ga0495612_0001008_8494_9648 376
699 3300053085 Ga0495619_0014924 Ga0495619_0014924_3026_4180 376
700 3300053085 Ga0495619_0018357 Ga0495619_0018357_91_1413 376
701 3300005293 Ga0065715_10162750 Ga0065715_101627502 377
702 3300005336 Ga0070680_100024494 Ga0070680_1000244945 377
703 3300005336 Ga0070680_100167770 Ga0070680_1001677702 377
704 3300005336 Ga0070680_100257705 Ga0070680_1002577051 377
705 3300005339 Ga0070660_100043798 Ga0070660_1000437983 377
706 3300005341 Ga0070691_10034253 Ga0070691_100342533 377
707 3300005458 Ga0070681_10040095 Ga0070681_100400954 377
708 3300005530 Ga0070679_100010342 Ga0070679_1000103424 377
709 3300005530 Ga0070679_100017263 Ga0070679_1000172636 377
710 3300005530 Ga0070679_100087472 Ga0070679_1000874723 377
711 3300005535 Ga0070684_100371168 Ga0070684_1003711681 377
712 3300005563 Ga0068855_100029394 Ga0068855_1000293944 377
713 3300005563 Ga0068855_100328165 Ga0068855_1003281652 377
714 3300005614 Ga0068856_100133675 Ga0068856_1001336752 377
715 3300005614 Ga0068856_100169502 Ga0068856_1001695023 377
716 3300005841 Ga0068863_100182422 Ga0068863_1001824221 377
717 3300005842 Ga0068858_100099970 Ga0068858_1000999703 377
718 3300005844 Ga0068862_100036791 Ga0068862_1000367911 377
719 3300005937 Ga0081455_10083710 Ga0081455_100837104 377
720 3300005937 Ga0081455_10241278 Ga0081455_102412781 377
721 3300006358 Ga0068871_100089771 Ga0068871_1000897713 377
722 3300006844 Ga0075428_100011730 Ga0075428_1000117303 377
723 3300006846 Ga0075430_100021883 Ga0075430_1000218835 377
724 3300006847 Ga0075431_100029649 Ga0075431_1000296495 377
725 3300009093 Ga0105240_10003178 Ga0105240_1000317827 377
726 3300009093 Ga0105240_10041372 Ga0105240_100413724 377
727 3300009545 Ga0105237_10081198 Ga0105237_100811982 377
728 3300009551 Ga0105238_10012727 Ga0105238_100127272 377
729 3300013104 Ga0157370_10007251 Ga0157370_1000725111 377
730 3300013105 Ga0157369_10008533 Ga0157369_100085334 377
731 3300014325 Ga0163163_10024718 Ga0163163_100247184 377
732 3300014969 Ga0157376_10144481 Ga0157376_101444811 377
733 3300025912 Ga0207707_10000094 Ga0207707_1000009411 377
734 3300025912 Ga0207707_10014021 Ga0207707_100140212 377
735 3300025912 Ga0207707_10258417 Ga0207707_102584172 377
736 3300025912 Ga0207707_10323460 Ga0207707_103234601 377
737 3300025913 Ga0207695_10012536 Ga0207695_100125362 377
738 3300025917 Ga0207660_10015684 Ga0207660_100156842 377
739 3300025917 Ga0207660_10148113 Ga0207660_101481132 377
740 3300025919 Ga0207657_10070564 Ga0207657_100705643 377
741 3300025921 Ga0207652_10084714 Ga0207652_100847142 377
742 3300025924 Ga0207694_10048531 Ga0207694_100485312 377
743 3300025939 Ga0207665_10030366 Ga0207665_100303663 377
744 3300025944 Ga0207661_10111678 Ga0207661_101116781 377
745 3300025949 Ga0207667_10020143 Ga0207667_100201433 377
746 3300025949 Ga0207667_10251653 Ga0207667_102516532 377
747 3300026078 Ga0207702_10260763 Ga0207702_102607631 377
748 3300026078 Ga0207702_10297126 Ga0207702_102971261 377
749 3300026088 Ga0207641_10320359 Ga0207641_103203591 377
750 3300026116 Ga0207674_10280990 Ga0207674_102809901 377
751 3300031456 Ga0307513_10177897 Ga0307513_101778972 377
752 3300031727 Ga0316576_10219599 Ga0316576_102195992 377
753 3300031824 Ga0307413_10022345 Ga0307413_100223452 377
754 3300035120 Ga0373957_0055197 Ga0373957_0055197_256_1401 377
755 3300035398 Ga0316574_0015446 Ga0316574_0015446_776_1921 377
756 3300036401 Ga0373937_0008219 Ga0373937_0008219_23_1168 377
757 3300037418 Ga0395900_0049263 Ga0395900_0049263_751_1896 377
758 3300037853 Ga0436364_1434162 Ga0436364_1434162_154_1341 377
759 3300042132 Ga0450895_000659 Ga0450895_000659_43_1188 377
760 3300042876 Ga0451577_0047288 Ga0451577_0047288_764_1948 377
761 3300046454 Ga0495592_0011507 Ga0495592_0011507_2613_3758 377
762 3300046511 Ga0495608_0059514 Ga0495608_0059514_990_2135 377
763 3300046514 Ga0495618_0138624 Ga0495618_0138624_203_1348 377
764 3300046516 Ga0495628_0140141 Ga0495628_0140141_504_1649 377
765 3300046517 Ga0495630_0313243 Ga0495630_0313243_26_1171 377
766 3300046559 Ga0495667_0004364 Ga0495667_0004364_1352_2497 377
767 3300046675 Ga0495657_0004574 Ga0495657_0004574_3092_4237 377
768 3300047319 Ga0495674_0265181 Ga0495674_0265181_237_1382 377
769 3300048913 Ga0496110_0153558 Ga0496110_0153558_833_1981 377
770 3300049568 Ga0501031_0046233 Ga0501031_0046233_1642_2787 377
771 3300049569 Ga0501032_0085167 Ga0501032_0085167_346_1512 377
772 3300049570 Ga0501033_0006860 Ga0501033_0006860_5427_6593 377
773 3300049571 Ga0501034_0015032 Ga0501034_0015032_236_1402 377
774 3300049572 Ga0501036_0041617 Ga0501036_0041617_442_1608 377
775 3300049573 Ga0501037_0186355 Ga0501037_0186355_203_1369 377
776 3300049574 Ga0501038_0048744 Ga0501038_0048744_133_1299 377
777 3300049575 Ga0501039_0274841 Ga0501039_0274841_114_1280 377
778 3300049581 Ga0501047_0042303 Ga0501047_0042303_316_1482 377
779 3300049586 Ga0501070_0031397 Ga0501070_0031397_1517_2683 377
780 3300049586 Ga0501070_0080969 Ga0501070_0080969_251_1417 377
781 3300049823 Ga0501044_0049246 Ga0501044_0049246_2447_3613 377
782 3300049823 Ga0501044_0194755 Ga0501044_0194755_613_1779 377
783 3300050510 nmdc:mga06r32_116721_c1 nmdc:mga06r32_116721_c1_226_1371 377
784 3300053085 Ga0495619_0004096 Ga0495619_0004096_3794_4939 377
785 3300053096 Ga0500641_0020597 Ga0500641_0020597_365_1510 377
786 3300053124 Ga0500617_024133 Ga0500617_024133_902_2047 377
787 3300053134 Ga0500658_0025782 Ga0500658_0025782_483_1628 377
788 3300003214 JGI25165J46597_1003497 JGI25165J46597_10034974 378
789 3300005330 Ga0070690_100010201 Ga0070690_1000102012 378
790 3300005331 Ga0070670_100020562 Ga0070670_1000205623 378
791 3300005335 Ga0070666_10001637 Ga0070666_100016374 378
792 3300005338 Ga0068868_100003513 Ga0068868_1000035133 378
793 3300005338 Ga0068868_100071594 Ga0068868_1000715942 378
794 3300005339 Ga0070660_100162675 Ga0070660_1001626752 378
795 3300005343 Ga0070687_100094860 Ga0070687_1000948602 378
796 3300005344 Ga0070661_100025559 Ga0070661_1000255592 378
797 3300005355 Ga0070671_100016608 Ga0070671_1000166084 378
798 3300005364 Ga0070673_100037606 Ga0070673_1000376064 378
799 3300005364 Ga0070673_100196660 Ga0070673_1001966602 378
800 3300005366 Ga0070659_100130958 Ga0070659_1001309582 378
801 3300005367 Ga0070667_100032365 Ga0070667_1000323652 378
802 3300005456 Ga0070678_100269764 Ga0070678_1002697641 378
803 3300005457 Ga0070662_100080444 Ga0070662_1000804441 378
804 3300005458 Ga0070681_10002183 Ga0070681_1000218317 378
805 3300005535 Ga0070684_100038278 Ga0070684_1000382782 378
806 3300005543 Ga0070672_100000667 Ga0070672_10000066715 378
807 3300005547 Ga0070693_100119135 Ga0070693_1001191352 378
808 3300005548 Ga0070665_100124789 Ga0070665_1001247892 378
809 3300005564 Ga0070664_100009636 Ga0070664_1000096362 378
810 3300005577 Ga0068857_100196828 Ga0068857_1001968282 378
811 3300005578 Ga0068854_100025961 Ga0068854_1000259613 378
812 3300005614 Ga0068856_100032742 Ga0068856_1000327424 378
813 3300005617 Ga0068859_100544079 Ga0068859_1005440791 378
814 3300005618 Ga0068864_100006211 Ga0068864_1000062113 378
815 3300005841 Ga0068863_100015581 Ga0068863_1000155819 378
816 3300005841 Ga0068863_100140765 Ga0068863_1001407653 378
817 3300006178 Ga0075367_10019228 Ga0075367_100192284 378
818 3300006844 Ga0075428_100013841 Ga0075428_1000138417 378
819 3300006847 Ga0075431_100001810 Ga0075431_1000018105 378
820 3300006847 Ga0075431_100050012 Ga0075431_1000500122 378
821 3300006880 Ga0075429_100004783 Ga0075429_1000047832 378
822 3300006931 Ga0097620_100544042 Ga0097620_1005440421 378
823 3300009094 Ga0111539_10001898 Ga0111539_100018985 378
824 3300009147 Ga0114129_10000742 Ga0114129_1000074226 378
825 3300009148 Ga0105243_10099418 Ga0105243_100994182 378
826 3300009174 Ga0105241_10064937 Ga0105241_100649372 378
827 3300009177 Ga0105248_10002810 Ga0105248_1000281011 378
828 3300009177 Ga0105248_10466354 Ga0105248_104663542 378
829 3300010375 Ga0105239_10061616 Ga0105239_100616162 378
830 3300013102 Ga0157371_10235832 Ga0157371_102358322 378
831 3300013105 Ga0157369_10137994 Ga0157369_101379942 378
832 3300013296 Ga0157374_10007958 Ga0157374_100079582 378
833 3300013306 Ga0163162_10002246 Ga0163162_100022462 378
834 3300013307 Ga0157372_10090652 Ga0157372_100906523 378
835 3300013308 Ga0157375_10018373 Ga0157375_100183733 378
836 3300013308 Ga0157375_10212630 Ga0157375_102126302 378
837 3300013308 Ga0157375_10369997 Ga0157375_103699971 378
838 3300014325 Ga0163163_10080177 Ga0163163_100801772 378
839 3300025231 Ga0207427_103358 Ga0207427_1033583 378
840 3300025261 Ga0209233_1000371 Ga0209233_10003716 378
841 3300025321 Ga0207656_10052386 Ga0207656_100523862 378
842 3300025904 Ga0207647_10052839 Ga0207647_100528393 378
843 3300025907 Ga0207645_10014227 Ga0207645_100142275 378
844 3300025908 Ga0207643_10021033 Ga0207643_100210332 378
845 3300025912 Ga0207707_10005320 Ga0207707_100053208 378
846 3300025918 Ga0207662_10142463 Ga0207662_101424632 378
847 3300025919 Ga0207657_10074348 Ga0207657_100743482 378
848 3300025921 Ga0207652_10084878 Ga0207652_100848782 378
849 3300025925 Ga0207650_10057524 Ga0207650_100575243 378
850 3300025931 Ga0207644_10088675 Ga0207644_100886752 378
851 3300025932 Ga0207690_10216644 Ga0207690_102166441 378
852 3300025933 Ga0207706_10001683 Ga0207706_1000168317 378
853 3300025936 Ga0207670_10133230 Ga0207670_101332302 378
854 3300025936 Ga0207670_10252554 Ga0207670_102525541 378
855 3300025940 Ga0207691_10000550 Ga0207691_1000055025 378
856 3300025940 Ga0207691_10003308 Ga0207691_100033083 378
857 3300025941 Ga0207711_10105491 Ga0207711_101054913 378
858 3300026078 Ga0207702_10278141 Ga0207702_102781412 378
859 3300026089 Ga0207648_10112164 Ga0207648_101121642 378
860 3300026116 Ga0207674_10001978 Ga0207674_1000197810 378
861 3300026121 Ga0207683_10014351 Ga0207683_100143513 378
862 3300027665 Ga0209983_1001445 Ga0209983_10014453 378
863 3300027717 Ga0209998_10000168 Ga0209998_1000016822 378
864 3300027876 Ga0209974_10000232 Ga0209974_100002327 378
865 3300027907 Ga0207428_10005596 Ga0207428_100055965 378
866 3300028573 Ga0265334_10061114 Ga0265334_100611142 378
867 3300028794 Ga0307515_10027465 Ga0307515_100274658 378
868 3300028800 Ga0265338_10003183 Ga0265338_100031839 378
869 3300031241 Ga0265325_10000646 Ga0265325_1000064610 378
870 3300031247 Ga0265340_10019251 Ga0265340_100192513 378
871 3300031249 Ga0265339_10000347 Ga0265339_1000034723 378
872 3300031250 Ga0265331_10026150 Ga0265331_100261502 378
873 3300031595 Ga0265313_10000288 Ga0265313_1000028840 378
874 3300031711 Ga0265314_10056215 Ga0265314_100562152 378
875 3300031712 Ga0265342_10014881 Ga0265342_100148812 378
876 3300035117 Ga0373953_0007481 Ga0373953_0007481_1578_2726 378
877 3300035121 Ga0373960_0043500 Ga0373960_0043500_59_1198 378
878 3300036401 Ga0373937_0059231 Ga0373937_0059231_425_1591 378
879 3300036401 Ga0373937_0289182 Ga0373937_0289182_219_1367 378
880 3300037466 Ga0395898_0002265 Ga0395898_0002265_7119_8255 378
881 3300038443 Ga0395901_0043511 Ga0395901_0043511_254_1390 378
882 3300046472 Ga0495580_0136512 Ga0495580_0136512_424_1572 378
883 3300046499 Ga0495594_0027014 Ga0495594_0027014_1030_2190 378
884 3300046689 Ga0495613_0100039 Ga0495613_0100039_629_1777 378
885 3300047472 Ga0495686_0046870 Ga0495686_0046870_690_1826 378
886 3300048918 Ga0496115_0021283 Ga0496115_0021283_3552_4718 378
887 3300049568 Ga0501031_0000959 Ga0501031_0000959_7834_8970 378
888 3300049569 Ga0501032_0001789 Ga0501032_0001789_9728_10864 378
889 3300049570 Ga0501033_0081116 Ga0501033_0081116_535_1671 378
890 3300049571 Ga0501034_0007273 Ga0501034_0007273_7611_8747 378
891 3300049571 Ga0501034_0089211 Ga0501034_0089211_379_1515 378
892 3300049571 Ga0501034_0121996 Ga0501034_0121996_748_1884 378
893 3300049572 Ga0501036_0009528 Ga0501036_0009528_1288_2424 378
894 3300049573 Ga0501037_0009575 Ga0501037_0009575_5316_6452 378
895 3300049574 Ga0501038_0007063 Ga0501038_0007063_4940_6076 378
896 3300049575 Ga0501039_0011247 Ga0501039_0011247_5138_6274 378
897 3300049579 Ga0501043_0092662 Ga0501043_0092662_709_1845 378
898 3300049581 Ga0501047_0002914 Ga0501047_0002914_5776_6912 378
899 3300049586 Ga0501070_0007417 Ga0501070_0007417_2382_3518 378
900 3300049590 Ga0501074_0076995 Ga0501074_0076995_706_1842 378
901 3300049822 Ga0501035_0021703 Ga0501035_0021703_531_1667 378
902 3300049823 Ga0501044_0012955 Ga0501044_0012955_4958_6094 378
903 3300050494 nmdc:mga06z11_110070_c1 nmdc:mga06z11_110070_c1_41_1180 378
904 3300050507 nmdc:mga05p37_508_c1 nmdc:mga05p37_508_c1_29496_30668 378
905 3300050508 nmdc:mga09592_14119_c1 nmdc:mga09592_14119_c1_19_1191 378
906 3300050508 nmdc:mga09592_26976_c1 nmdc:mga09592_26976_c1_2145_3293 378
907 3300050509 nmdc:mga0qj67_22279_c1 nmdc:mga0qj67_22279_c1_2943_4091 378
908 3300050510 nmdc:mga06r32_161028_c1 nmdc:mga06r32_161028_c1_1045_2193 378
909 3300050510 nmdc:mga06r32_1960_c1 nmdc:mga06r32_1960_c1_14104_15276 378
910 3300050511 nmdc:mga08y16_2332_c1 nmdc:mga08y16_2332_c1_14103_15275 378
911 3300053130 Ga0500642_0083514 Ga0500642_0083514_175_1335 378

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01717

Meth_synt_2

Cobalamin-independent synthase, Catalytic domain

171

423

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xdj-assembly1.cif.gz_A crystal structure of t. maritima cobalamin-independent methionine synthase complexed with zn2+ and homocysteine 0.8681 1 374
1xr2-assembly2.cif.gz_B crystal structure of oxidized t. maritima cobalamin-independent methionine synthase complexed with methyltetrahydrofolate 0.8662 1 372
1xr2-assembly1.cif.gz_A crystal structure of oxidized t. maritima cobalamin-independent methionine synthase complexed with methyltetrahydrofolate 0.863 1 369
3bq6-assembly2.cif.gz_B crystal structure of t. maritima cobalamin-independent methionine synthase complexed with zn2+ (monoclinic) 0.8624 1 372
3bq6-assembly1.cif.gz_A crystal structure of t. maritima cobalamin-independent methionine synthase complexed with zn2+ (monoclinic) 0.862 1 371
ID Description Score Start End Superfamily
1xdjA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.8565 1 377 3.20.20.210
af_Q54X49_428_818_3.20.20.210 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.8514 1 369 3.20.20.210
2nq5A02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.8236 1 372 3.20.20.210
4l61A02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.8214 3 372 3.20.20.210
af_Q55G42_28_396_3.20.20.210 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.8193 1 377 3.20.20.210
ID Description Score Start End GO Terms
AF-A0A848U6Y3-F1-model_v4 Epoxyalkane--coenzyme M transferase 0.9931 74 370 GO:0003871
GO:0008270
GO:0009086
AF-A0A534A311-F1-model_v4 Cobalamin-independent methionine synthase MetE C-terminal/archaeal domain-containing protein 0.9927 3 371 GO:0003871
GO:0008270
GO:0009086
GO:0016491
AF-A0A3B8QQI7-F1-model_v4 Epoxyalkane--coenzyme M transferase 0.9918 1 287 GO:0016740
AF-A0A2W5Y9P4-F1-model_v4 Epoxyalkane--coenzyme M transferase 0.9916 3 370 GO:0003871
GO:0008270
GO:0009086
AF-A0A3R7WAH5-F1-model_v4 Epoxyalkane--coenzyme M transferase 0.9904 130 370 GO:0003871
GO:0008270
GO:0009086

Feature Viewer

pLDDT pTM Quality
93.7 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map