F485484
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 911 | 367 | 908 | 380 |
Family's Representative Sequence
| Representative Sequence | 3300053085|Ga0495619_0018357|Ga0495619_0018357_91_1413 |
| Length | 440 |
| Sequence | MSAPAAGFFSVSQSLGRPIIVVIIKVPACISHVPLLVGSGLLHDARRPTKQETPMLMSTDRILVSHVGSLPRPPTLSELLIRQEAGETVDAAELARQVEIATTHVIDKQVEAGVDVGNDGEQSRVGFQTYVSRCIGGFGGESRRPPSRDQIDFPSYARQTELRFPHSARVANAPAALSDVRYVDSAPINEDAARLKRMGSRFSECFMTAPSPGVVATTMLNQHYDSHEAYLTALAKALSNEYRAIHNAGMVLQIDAPDLAMERNRFFSHLGEAEFLRQLELHIVAINLGIEGIPRERVRLHVCWGNNDGPHVHDIAMTAILPELYRANVGALSIEFANPRHQHEYDALRKNPLPAHMLLMPGVLDSTTNFVEHPELVARRLEEAVSVVGDRERVVTGTDCGFGTFAGREYVAEEVVWVKLAAAAEGARIASLRLWGRAAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2558860112 | Pseudonocardia acaciae DSM 45401 | Isolate | Unclassified |
| 2 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 3 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 4 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 73 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 74 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 75 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 77 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 78 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 83 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 84 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 85 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 86 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 87 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 88 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 91 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 108 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 124 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 125 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 126 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 190 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 194 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 195 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 196 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 197 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 198 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 199 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 200 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 201 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 202 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 203 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 204 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 205 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 206 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 207 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 208 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 209 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 210 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 211 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 212 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 213 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 214 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 215 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 216 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 217 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 218 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 219 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 220 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 221 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 222 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 223 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 224 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 225 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 226 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 227 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 228 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 229 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 230 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 231 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 232 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 233 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 234 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 235 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 236 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 237 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 238 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 239 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 240 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 241 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 242 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 243 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 244 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 245 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 246 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 247 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 248 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 249 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 250 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 251 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 252 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 253 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 303 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 304 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 305 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 306 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 307 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 308 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 309 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 310 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 311 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 312 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 313 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 314 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 315 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 316 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 317 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 318 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 345 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 346 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 360 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 361 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 362 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 363 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 364 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 365 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.56 |
| Metatranscriptomes | 0.11 |
| Isolates | 0.33 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.54 |
| Nodule | 0 |
| Rhizoplane | 3.73 |
| Rhizosphere | 91.44 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25165J46597_1003497 | 3300003214 | Bacteria | 3869 |
| 2 | Ga0065715_10162750 | 3300005293 | Bacteria | 1614 |
| 3 | Ga0065707_10011490 | 3300005295 | Bacteria | 2155 |
| 4 | Ga0065707_10117557 | 3300005295 | Bacteria | 2203 |
| 5 | Ga0070683_100037823 | 3300005329 | Bacteria | 4419 |
| 6 | Ga0070683_100061805 | 3300005329 | Bacteria | 3482 |
| 7 | Ga0070683_100272743 | 3300005329 | Bacteria | 1609 |
| 8 | Ga0070690_100010201 | 3300005330 | Bacteria | 5459 |
| 9 | Ga0070670_100020562 | 3300005331 | Bacteria | 5676 |
| 10 | Ga0070670_100178534 | 3300005331 | Bacteria | 1843 |
| 11 | Ga0068869_100004929 | 3300005334 | Bacteria | 8348 |
| 12 | Ga0068869_100057295 | 3300005334 | Unclassified | 2844 |
| 13 | Ga0068869_100192207 | 3300005334 | Bacteria | 1605 |
| 14 | Ga0070666_10001637 | 3300005335 | Bacteria | 13641 |
| 15 | Ga0070680_100007542 | 3300005336 | Bacteria | 8294 |
| 16 | Ga0070680_100024494 | 3300005336 | Bacteria | 4822 |
| 17 | Ga0070680_100034557 | 3300005336 | Bacteria | 4075 |
| 18 | Ga0070680_100090001 | 3300005336 | Bacteria | 2540 |
| 19 | Ga0070680_100167770 | 3300005336 | Bacteria | 1846 |
| 20 | Ga0070680_100257705 | 3300005336 | Bacteria | 1475 |
| 21 | Ga0070682_100137193 | 3300005337 | Bacteria | 1663 |
| 22 | Ga0068868_100003513 | 3300005338 | Bacteria | 10917 |
| 23 | Ga0068868_100023719 | 3300005338 | Bacteria | 4647 |
| 24 | Ga0068868_100071594 | 3300005338 | Bacteria | 2765 |
| 25 | Ga0068868_100156789 | 3300005338 | Bacteria | 1878 |
| 26 | Ga0070660_100034853 | 3300005339 | Bacteria | 3806 |
| 27 | Ga0070660_100043798 | 3300005339 | Bacteria | 3421 |
| 28 | Ga0070660_100069740 | 3300005339 | Bacteria | 2742 |
| 29 | Ga0070660_100162675 | 3300005339 | Bacteria | 1799 |
| 30 | Ga0070689_100002549 | 3300005340 | Bacteria | 11942 |
| 31 | Ga0070689_100041208 | 3300005340 | Bacteria | 3544 |
| 32 | Ga0070691_10034253 | 3300005341 | Bacteria | 2390 |
| 33 | Ga0070687_100003797 | 3300005343 | Bacteria | 5928 |
| 34 | Ga0070687_100094860 | 3300005343 | Bacteria | 1658 |
| 35 | Ga0070661_100023233 | 3300005344 | Bacteria | 4443 |
| 36 | Ga0070661_100025559 | 3300005344 | Bacteria | 4245 |
| 37 | Ga0070692_10025198 | 3300005345 | Bacteria | 2931 |
| 38 | Ga0070668_100080017 | 3300005347 | Bacteria | 2559 |
| 39 | Ga0070669_100075843 | 3300005353 | Bacteria | 2495 |
| 40 | Ga0070671_100016608 | 3300005355 | Bacteria | 5950 |
| 41 | Ga0070673_100037606 | 3300005364 | Unclassified | 3689 |
| 42 | Ga0070673_100068359 | 3300005364 | Bacteria | 2844 |
| 43 | Ga0070673_100196660 | 3300005364 | Bacteria | 1735 |
| 44 | Ga0070688_100088610 | 3300005365 | Bacteria | 2018 |
| 45 | Ga0070659_100043687 | 3300005366 | Bacteria | 3505 |
| 46 | Ga0070659_100130958 | 3300005366 | Bacteria | 2037 |
| 47 | Ga0070659_100148235 | 3300005366 | Bacteria | 1913 |
| 48 | Ga0070667_100032365 | 3300005367 | Bacteria | 4361 |
| 49 | Ga0070709_10059178 | 3300005434 | Unclassified | 2432 |
| 50 | Ga0070709_10065148 | 3300005434 | Bacteria | 2332 |
| 51 | Ga0070714_100018622 | 3300005435 | Bacteria | 5645 |
| 52 | Ga0070713_100107619 | 3300005436 | Bacteria | 2426 |
| 53 | Ga0070701_10001046 | 3300005438 | Bacteria | 10103 |
| 54 | Ga0070711_100350758 | 3300005439 | Bacteria | 1186 |
| 55 | Ga0070705_100007132 | 3300005440 | Bacteria | 5500 |
| 56 | Ga0070700_100256734 | 3300005441 | Bacteria | 1257 |
| 57 | Ga0070694_100031176 | 3300005444 | Bacteria | 3494 |
| 58 | Ga0070708_100066600 | 3300005445 | Bacteria | 3233 |
| 59 | Ga0070708_100118153 | 3300005445 | Bacteria | 2443 |
| 60 | Ga0070708_100134142 | 3300005445 | Bacteria | 2293 |
| 61 | Ga0070708_100231245 | 3300005445 | Bacteria | 1735 |
| 62 | Ga0070708_100326435 | 3300005445 | Bacteria | 1446 |
| 63 | Ga0070663_100007013 | 3300005455 | Bacteria | 6826 |
| 64 | Ga0070663_100026339 | 3300005455 | Bacteria | 3938 |
| 65 | Ga0070678_100032209 | 3300005456 | Bacteria | 3626 |
| 66 | Ga0070678_100269764 | 3300005456 | Bacteria | 1435 |
| 67 | Ga0070662_100080444 | 3300005457 | Bacteria | 2425 |
| 68 | Ga0070681_10000570 | 3300005458 | Bacteria | 30413 |
| 69 | Ga0070681_10002183 | 3300005458 | Bacteria | 17813 |
| 70 | Ga0070681_10040095 | 3300005458 | Bacteria | 4695 |
| 71 | Ga0068867_100028571 | 3300005459 | Bacteria | 4016 |
| 72 | Ga0070685_10092530 | 3300005466 | Bacteria | 1833 |
| 73 | Ga0070706_100007777 | 3300005467 | Bacteria | 10018 |
| 74 | Ga0070706_100016382 | 3300005467 | Bacteria | 6849 |
| 75 | Ga0070706_100102260 | 3300005467 | Unclassified | 2664 |
| 76 | Ga0070706_100116252 | 3300005467 | Bacteria | 2491 |
| 77 | Ga0070706_100149314 | 3300005467 | Bacteria | 2182 |
| 78 | Ga0070706_100167321 | 3300005467 | Bacteria | 2053 |
| 79 | Ga0070706_100175155 | 3300005467 | Bacteria | 2003 |
| 80 | Ga0070706_100313078 | 3300005467 | Bacteria | 1464 |
| 81 | Ga0070707_100023686 | 3300005468 | Bacteria | 5807 |
| 82 | Ga0070707_100024323 | 3300005468 | Bacteria | 5736 |
| 83 | Ga0070707_100114498 | 3300005468 | Bacteria | 2617 |
| 84 | Ga0070707_100231922 | 3300005468 | Bacteria | 1797 |
| 85 | Ga0070698_100014405 | 3300005471 | Bacteria | 8353 |
| 86 | Ga0070698_100070742 | 3300005471 | Bacteria | 3500 |
| 87 | Ga0070698_100082917 | 3300005471 | Bacteria | 3197 |
| 88 | Ga0070698_100115579 | 3300005471 | Bacteria | 2647 |
| 89 | Ga0070698_100173455 | 3300005471 | Unclassified | 2096 |
| 90 | Ga0070698_100185251 | 3300005471 | Bacteria | 2020 |
| 91 | Ga0070699_100007625 | 3300005518 | Bacteria | 9409 |
| 92 | Ga0070699_100101785 | 3300005518 | Bacteria | 2518 |
| 93 | Ga0070679_100000922 | 3300005530 | Bacteria | 25584 |
| 94 | Ga0070679_100010342 | 3300005530 | Bacteria | 8848 |
| 95 | Ga0070679_100017263 | 3300005530 | Bacteria | 6982 |
| 96 | Ga0070679_100087472 | 3300005530 | Bacteria | 3103 |
| 97 | Ga0070679_100217002 | 3300005530 | Bacteria | 1875 |
| 98 | Ga0070684_100038278 | 3300005535 | Bacteria | 4119 |
| 99 | Ga0070684_100233262 | 3300005535 | Bacteria | 1680 |
| 100 | Ga0070684_100371168 | 3300005535 | Unclassified | 1317 |
| 101 | Ga0070697_100006825 | 3300005536 | Bacteria | 8860 |
| 102 | Ga0070697_100021341 | 3300005536 | Bacteria | 5131 |
| 103 | Ga0070672_100000667 | 3300005543 | Bacteria | 20169 |
| 104 | Ga0070672_100093193 | 3300005543 | Bacteria | 2433 |
| 105 | Ga0070672_100217024 | 3300005543 | Bacteria | 1603 |
| 106 | Ga0070686_100016963 | 3300005544 | Bacteria | 4245 |
| 107 | Ga0070695_100025562 | 3300005545 | Bacteria | 3647 |
| 108 | Ga0070696_100027041 | 3300005546 | Bacteria | 3906 |
| 109 | Ga0070696_100045126 | 3300005546 | Bacteria | 3053 |
| 110 | Ga0070696_100067363 | 3300005546 | Bacteria | 2512 |
| 111 | Ga0070696_100088395 | 3300005546 | Bacteria | 2202 |
| 112 | Ga0070693_100119135 | 3300005547 | Bacteria | 1635 |
| 113 | Ga0070665_100082394 | 3300005548 | Bacteria | 3222 |
| 114 | Ga0070665_100124789 | 3300005548 | Bacteria | 2577 |
| 115 | Ga0070704_100029435 | 3300005549 | Bacteria | 3667 |
| 116 | Ga0070704_100341524 | 3300005549 | Bacteria | 1261 |
| 117 | Ga0068855_100029394 | 3300005563 | Bacteria | 6571 |
| 118 | Ga0068855_100328165 | 3300005563 | Bacteria | 1690 |
| 119 | Ga0070664_100009636 | 3300005564 | Bacteria | 7835 |
| 120 | Ga0068857_100081789 | 3300005577 | Bacteria | 2884 |
| 121 | Ga0068857_100109764 | 3300005577 | Bacteria | 2479 |
| 122 | Ga0068857_100196828 | 3300005577 | Bacteria | 1836 |
| 123 | Ga0068854_100025961 | 3300005578 | Bacteria | 4021 |
| 124 | Ga0068856_100032742 | 3300005614 | Bacteria | 5091 |
| 125 | Ga0068856_100133675 | 3300005614 | Bacteria | 2486 |
| 126 | Ga0068856_100169502 | 3300005614 | Bacteria | 2195 |
| 127 | Ga0070702_100002299 | 3300005615 | Bacteria | 8191 |
| 128 | Ga0070702_100057912 | 3300005615 | Bacteria | 2242 |
| 129 | Ga0070702_100082236 | 3300005615 | Bacteria | 1932 |
| 130 | Ga0068852_100039260 | 3300005616 | Bacteria | 3985 |
| 131 | Ga0068859_100011958 | 3300005617 | Bacteria | 8717 |
| 132 | Ga0068859_100065503 | 3300005617 | Bacteria | 3667 |
| 133 | Ga0068859_100083668 | 3300005617 | Bacteria | 3234 |
| 134 | Ga0068859_100120601 | 3300005617 | Bacteria | 2689 |
| 135 | Ga0068859_100406562 | 3300005617 | Bacteria | 1457 |
| 136 | Ga0068859_100480495 | 3300005617 | Bacteria | 1338 |
| 137 | Ga0068859_100544079 | 3300005617 | Bacteria | 1256 |
| 138 | Ga0068864_100006211 | 3300005618 | Bacteria | 9795 |
| 139 | Ga0068864_100046531 | 3300005618 | Bacteria | 3723 |
| 140 | Ga0068864_100160479 | 3300005618 | Bacteria | 2043 |
| 141 | Ga0068866_10019605 | 3300005718 | Bacteria | 3084 |
| 142 | Ga0068866_10148749 | 3300005718 | Bacteria | 1353 |
| 143 | Ga0068863_100015581 | 3300005841 | Bacteria | 7304 |
| 144 | Ga0068863_100140765 | 3300005841 | Bacteria | 2306 |
| 145 | Ga0068863_100182422 | 3300005841 | Unclassified | 2015 |
| 146 | Ga0068858_100023083 | 3300005842 | Bacteria | 5803 |
| 147 | Ga0068858_100099970 | 3300005842 | Bacteria | 2705 |
| 148 | Ga0068858_100243051 | 3300005842 | Bacteria | 1708 |
| 149 | Ga0068860_100028444 | 3300005843 | Bacteria | 5380 |
| 150 | Ga0068860_100344067 | 3300005843 | Bacteria | 1467 |
| 151 | Ga0068862_100029396 | 3300005844 | Bacteria | 4631 |
| 152 | Ga0068862_100031243 | 3300005844 | Bacteria | 4493 |
| 153 | Ga0068862_100036791 | 3300005844 | Bacteria | 4149 |
| 154 | Ga0068862_100058122 | 3300005844 | Bacteria | 3317 |
| 155 | Ga0068862_100173990 | 3300005844 | Bacteria | 1929 |
| 156 | Ga0068862_100225575 | 3300005844 | Bacteria | 1698 |
| 157 | Ga0081455_10005146 | 3300005937 | Bacteria | 14408 |
| 158 | Ga0081455_10083710 | 3300005937 | Bacteria | 2606 |
| 159 | Ga0081455_10241278 | 3300005937 | Bacteria | 1328 |
| 160 | Ga0081538_10002331 | 3300005981 | Bacteria | 18723 |
| 161 | Ga0081538_10008822 | 3300005981 | Bacteria | 8492 |
| 162 | Ga0081538_10009571 | 3300005981 | Bacteria | 8066 |
| 163 | Ga0081538_10084555 | 3300005981 | Bacteria | 1671 |
| 164 | Ga0081540_1000027 | 3300005983 | Bacteria | 151880 |
| 165 | Ga0081540_1000267 | 3300005983 | Bacteria | 54407 |
| 166 | Ga0081540_1018211 | 3300005983 | Unclassified | 4317 |
| 167 | Ga0081540_1036113 | 3300005983 | Bacteria | 2640 |
| 168 | Ga0081539_10000161 | 3300005985 | Bacteria | 156560 |
| 169 | Ga0081539_10003167 | 3300005985 | Bacteria | 20845 |
| 170 | Ga0081539_10041662 | 3300005985 | Bacteria | 2682 |
| 171 | Ga0070717_10029598 | 3300006028 | Unclassified | 4394 |
| 172 | Ga0070717_10159849 | 3300006028 | Bacteria | 1954 |
| 173 | Ga0075365_10000277 | 3300006038 | Bacteria | 17577 |
| 174 | Ga0075432_10054592 | 3300006058 | Bacteria | 1415 |
| 175 | Ga0070715_10041093 | 3300006163 | Bacteria | 1936 |
| 176 | Ga0070712_100007120 | 3300006175 | Bacteria | 6978 |
| 177 | Ga0070712_100017527 | 3300006175 | Bacteria | 4637 |
| 178 | Ga0075367_10019228 | 3300006178 | Bacteria | 3785 |
| 179 | Ga0068871_100089771 | 3300006358 | Unclassified | 2558 |
| 180 | Ga0075428_100011730 | 3300006844 | Bacteria | 9756 |
| 181 | Ga0075428_100013841 | 3300006844 | Bacteria | 8984 |
| 182 | Ga0075428_100015268 | 3300006844 | Bacteria | 8517 |
| 183 | Ga0075428_100024635 | 3300006844 | Bacteria | 6660 |
| 184 | Ga0075428_100037393 | 3300006844 | Bacteria | 5344 |
| 185 | Ga0075428_100038810 | 3300006844 | Bacteria | 5240 |
| 186 | Ga0075428_100050845 | 3300006844 | Bacteria | 4544 |
| 187 | Ga0075428_100056716 | 3300006844 | Bacteria | 4290 |
| 188 | Ga0075428_100086324 | 3300006844 | Bacteria | 3423 |
| 189 | Ga0075428_100106570 | 3300006844 | Bacteria | 3055 |
| 190 | Ga0075428_100139221 | 3300006844 | Bacteria | 2638 |
| 191 | Ga0075428_100139280 | 3300006844 | Bacteria | 2638 |
| 192 | Ga0075428_100254903 | 3300006844 | Bacteria | 1890 |
| 193 | Ga0075430_100001115 | 3300006846 | Bacteria | 21384 |
| 194 | Ga0075430_100021883 | 3300006846 | Bacteria | 5433 |
| 195 | Ga0075430_100067524 | 3300006846 | Bacteria | 3001 |
| 196 | Ga0075430_100165617 | 3300006846 | Bacteria | 1839 |
| 197 | Ga0075431_100001427 | 3300006847 | Bacteria | 21965 |
| 198 | Ga0075431_100001810 | 3300006847 | Bacteria | 20184 |
| 199 | Ga0075431_100012050 | 3300006847 | Bacteria | 8725 |
| 200 | Ga0075431_100029649 | 3300006847 | Bacteria | 5633 |
| 201 | Ga0075431_100050012 | 3300006847 | Bacteria | 4310 |
| 202 | Ga0075431_100234926 | 3300006847 | Unclassified | 1867 |
| 203 | Ga0075433_10003975 | 3300006852 | Bacteria | 11441 |
| 204 | Ga0075433_10021970 | 3300006852 | Bacteria | 5354 |
| 205 | Ga0075433_10029368 | 3300006852 | Bacteria | 4683 |
| 206 | Ga0075433_10078201 | 3300006852 | Bacteria | 2915 |
| 207 | Ga0075433_10079461 | 3300006852 | Bacteria | 2890 |
| 208 | Ga0075434_100022950 | 3300006871 | Bacteria | 6074 |
| 209 | Ga0075434_100034862 | 3300006871 | Bacteria | 4973 |
| 210 | Ga0075434_100047260 | 3300006871 | Bacteria | 4271 |
| 211 | Ga0075434_100052150 | 3300006871 | Bacteria | 4064 |
| 212 | Ga0075434_100067074 | 3300006871 | Bacteria | 3575 |
| 213 | Ga0075434_100158582 | 3300006871 | Bacteria | 2282 |
| 214 | Ga0075434_100303287 | 3300006871 | Bacteria | 1618 |
| 215 | Ga0075434_100356032 | 3300006871 | Bacteria | 1485 |
| 216 | Ga0075429_100004783 | 3300006880 | Bacteria | 11659 |
| 217 | Ga0075429_100008882 | 3300006880 | Bacteria | 8735 |
| 218 | Ga0075429_100019368 | 3300006880 | Bacteria | 5894 |
| 219 | Ga0075429_100022165 | 3300006880 | Bacteria | 5510 |
| 220 | Ga0075429_100042166 | 3300006880 | Bacteria | 3972 |
| 221 | Ga0075429_100104516 | 3300006880 | Bacteria | 2474 |
| 222 | Ga0075436_100017898 | 3300006914 | Bacteria | 4852 |
| 223 | Ga0097620_100011958 | 3300006931 | Bacteria | 8717 |
| 224 | Ga0097620_100065502 | 3300006931 | Bacteria | 3667 |
| 225 | Ga0097620_100083665 | 3300006931 | Bacteria | 3234 |
| 226 | Ga0097620_100120603 | 3300006931 | Bacteria | 2689 |
| 227 | Ga0097620_100406597 | 3300006931 | Bacteria | 1457 |
| 228 | Ga0097620_100480523 | 3300006931 | Bacteria | 1338 |
| 229 | Ga0097620_100544042 | 3300006931 | Bacteria | 1256 |
| 230 | Ga0075435_100005780 | 3300007076 | Bacteria | 8688 |
| 231 | Ga0075435_100011847 | 3300007076 | Bacteria | 6437 |
| 232 | Ga0075435_100019257 | 3300007076 | Bacteria | 5208 |
| 233 | Ga0075435_100024060 | 3300007076 | Bacteria | 4721 |
| 234 | Ga0075435_100032924 | 3300007076 | Bacteria | 4096 |
| 235 | Ga0075435_100038327 | 3300007076 | Bacteria | 3820 |
| 236 | Ga0075435_100076539 | 3300007076 | Bacteria | 2742 |
| 237 | Ga0075435_100154789 | 3300007076 | Bacteria | 1928 |
| 238 | Ga0099794_10018357 | 3300007265 | Bacteria | 3135 |
| 239 | Ga0105240_10003178 | 3300009093 | Bacteria | 25815 |
| 240 | Ga0105240_10041372 | 3300009093 | Bacteria | 5882 |
| 241 | Ga0111539_10001898 | 3300009094 | Bacteria | 27828 |
| 242 | Ga0111539_10007134 | 3300009094 | Bacteria | 14323 |
| 243 | Ga0111539_10008663 | 3300009094 | Bacteria | 12913 |
| 244 | Ga0111539_10012036 | 3300009094 | Bacteria | 10851 |
| 245 | Ga0111539_10051364 | 3300009094 | Bacteria | 4911 |
| 246 | Ga0111539_10056895 | 3300009094 | Bacteria | 4647 |
| 247 | Ga0111539_10078138 | 3300009094 | Bacteria | 3894 |
| 248 | Ga0111539_10225445 | 3300009094 | Bacteria | 2183 |
| 249 | Ga0105245_10019082 | 3300009098 | Bacteria | 6002 |
| 250 | Ga0105245_10097990 | 3300009098 | Bacteria | 2709 |
| 251 | Ga0105245_10199494 | 3300009098 | Bacteria | 1921 |
| 252 | Ga0105245_10340018 | 3300009098 | Bacteria | 1484 |
| 253 | Ga0105247_10021235 | 3300009101 | Bacteria | 3907 |
| 254 | Ga0105247_10030105 | 3300009101 | Bacteria | 3290 |
| 255 | Ga0114129_10000742 | 3300009147 | Bacteria | 41451 |
| 256 | Ga0114129_10003520 | 3300009147 | Bacteria | 22037 |
| 257 | Ga0114129_10006595 | 3300009147 | Bacteria | 16474 |
| 258 | Ga0114129_10014293 | 3300009147 | Bacteria | 11312 |
| 259 | Ga0114129_10015551 | 3300009147 | Bacteria | 10819 |
| 260 | Ga0114129_10017185 | 3300009147 | Bacteria | 10304 |
| 261 | Ga0114129_10035111 | 3300009147 | Bacteria | 7084 |
| 262 | Ga0114129_10156530 | 3300009147 | Bacteria | 3115 |
| 263 | Ga0114129_10163315 | 3300009147 | Bacteria | 3041 |
| 264 | Ga0114129_10442659 | 3300009147 | Bacteria | 1706 |
| 265 | Ga0114129_10660947 | 3300009147 | Bacteria | 1348 |
| 266 | Ga0105243_10006161 | 3300009148 | Bacteria | 9274 |
| 267 | Ga0105243_10017984 | 3300009148 | Bacteria | 5347 |
| 268 | Ga0105243_10099418 | 3300009148 | Bacteria | 2411 |
| 269 | Ga0105241_10064937 | 3300009174 | Bacteria | 2819 |
| 270 | Ga0105242_10070835 | 3300009176 | Bacteria | 2892 |
| 271 | Ga0105242_10115546 | 3300009176 | Bacteria | 2294 |
| 272 | Ga0105242_10119233 | 3300009176 | Bacteria | 2261 |
| 273 | Ga0105248_10002810 | 3300009177 | Bacteria | 19331 |
| 274 | Ga0105248_10117043 | 3300009177 | Bacteria | 3006 |
| 275 | Ga0105248_10140793 | 3300009177 | Bacteria | 2721 |
| 276 | Ga0105248_10170786 | 3300009177 | Bacteria | 2450 |
| 277 | Ga0105248_10466354 | 3300009177 | Bacteria | 1424 |
| 278 | Ga0105237_10081198 | 3300009545 | Bacteria | 3233 |
| 279 | Ga0105237_10081636 | 3300009545 | Bacteria | 3224 |
| 280 | Ga0105238_10012727 | 3300009551 | Bacteria | 8492 |
| 281 | Ga0105249_10008299 | 3300009553 | Bacteria | 9044 |
| 282 | Ga0105249_10022576 | 3300009553 | Bacteria | 5637 |
| 283 | Ga0105249_10037491 | 3300009553 | Bacteria | 4400 |
| 284 | Ga0105249_10056486 | 3300009553 | Bacteria | 3594 |
| 285 | Ga0105249_10157992 | 3300009553 | Bacteria | 2188 |
| 286 | Ga0105249_10177569 | 3300009553 | Bacteria | 2069 |
| 287 | Ga0105249_10341598 | 3300009553 | Unclassified | 1514 |
| 288 | Ga0099796_10018590 | 3300010159 | Bacteria | 2091 |
| 289 | Ga0105239_10061616 | 3300010375 | Bacteria | 4117 |
| 290 | Ga0105239_10068804 | 3300010375 | Bacteria | 3891 |
| 291 | Ga0105246_10068715 | 3300011119 | Bacteria | 2486 |
| 292 | Ga0105246_10124617 | 3300011119 | Unclassified | 1915 |
| 293 | Ga0157338_1000655 | 3300012515 | Bacteria | 2148 |
| 294 | Ga0157371_10177034 | 3300013102 | Bacteria | 1525 |
| 295 | Ga0157371_10235832 | 3300013102 | Bacteria | 1315 |
| 296 | Ga0157370_10007251 | 3300013104 | Bacteria | 12097 |
| 297 | Ga0157369_10008533 | 3300013105 | Bacteria | 11752 |
| 298 | Ga0157369_10137994 | 3300013105 | Bacteria | 2581 |
| 299 | Ga0157374_10007958 | 3300013296 | Bacteria | 9056 |
| 300 | Ga0157374_10303963 | 3300013296 | Bacteria | 1578 |
| 301 | Ga0157374_10322100 | 3300013296 | Bacteria | 1532 |
| 302 | Ga0157378_10520481 | 3300013297 | Bacteria | 1191 |
| 303 | Ga0163162_10002246 | 3300013306 | Bacteria | 18142 |
| 304 | Ga0163162_10020095 | 3300013306 | Bacteria | 6557 |
| 305 | Ga0163162_10136180 | 3300013306 | Bacteria | 2567 |
| 306 | Ga0163162_10149765 | 3300013306 | Bacteria | 2450 |
| 307 | Ga0163162_10159984 | 3300013306 | Bacteria | 2373 |
| 308 | Ga0163162_10534287 | 3300013306 | Bacteria | 1302 |
| 309 | Ga0157372_10090652 | 3300013307 | Bacteria | 3476 |
| 310 | Ga0157375_10018373 | 3300013308 | Bacteria | 6340 |
| 311 | Ga0157375_10032173 | 3300013308 | Bacteria | 4972 |
| 312 | Ga0157375_10172837 | 3300013308 | Bacteria | 2309 |
| 313 | Ga0157375_10212630 | 3300013308 | Bacteria | 2092 |
| 314 | Ga0157375_10325398 | 3300013308 | Bacteria | 1702 |
| 315 | Ga0157375_10338243 | 3300013308 | Bacteria | 1670 |
| 316 | Ga0157375_10369997 | 3300013308 | Bacteria | 1599 |
| 317 | Ga0163163_10024718 | 3300014325 | Bacteria | 5720 |
| 318 | Ga0163163_10080177 | 3300014325 | Bacteria | 3264 |
| 319 | Ga0163163_10162689 | 3300014325 | Bacteria | 2277 |
| 320 | Ga0157380_10035984 | 3300014326 | Bacteria | 3828 |
| 321 | Ga0157380_10045592 | 3300014326 | Bacteria | 3442 |
| 322 | Ga0157380_10348064 | 3300014326 | Bacteria | 1385 |
| 323 | Ga0157377_10031207 | 3300014745 | Bacteria | 2894 |
| 324 | Ga0157379_10028668 | 3300014968 | Unclassified | 4951 |
| 325 | Ga0157379_10408074 | 3300014968 | Bacteria | 1250 |
| 326 | Ga0157376_10144481 | 3300014969 | Bacteria | 2138 |
| 327 | Ga0163161_10145439 | 3300017792 | Bacteria | 1798 |
| 328 | Ga0206354_11178749 | 3300020081 | Bacteria | 3699 |
| 329 | Ga0213876_10002947 | 3300021384 | Bacteria | 9859 |
| 330 | Ga0213876_10009634 | 3300021384 | Bacteria | 5197 |
| 331 | Ga0213876_10031741 | 3300021384 | Bacteria | 2786 |
| 332 | Ga0213876_10040035 | 3300021384 | Bacteria | 2476 |
| 333 | Ga0213876_10075032 | 3300021384 | Bacteria | 1786 |
| 334 | Ga0213875_10000826 | 3300021388 | Bacteria | 23045 |
| 335 | Ga0213875_10032935 | 3300021388 | Bacteria | 2448 |
| 336 | Ga0224572_1005549 | 3300024225 | Bacteria | 2252 |
| 337 | Ga0207427_103358 | 3300025231 | Bacteria | 3427 |
| 338 | Ga0209233_1000371 | 3300025261 | Bacteria | 39670 |
| 339 | Ga0209025_1028927 | 3300025294 | Bacteria | 2698 |
| 340 | Ga0207656_10052386 | 3300025321 | Bacteria | 1767 |
| 341 | Ga0207653_10022210 | 3300025885 | Bacteria | 2015 |
| 342 | Ga0207692_10142026 | 3300025898 | Bacteria | 1366 |
| 343 | Ga0207642_10021185 | 3300025899 | Bacteria | 2555 |
| 344 | Ga0207688_10006766 | 3300025901 | Bacteria | 6240 |
| 345 | Ga0207688_10008209 | 3300025901 | Bacteria | 5674 |
| 346 | Ga0207688_10017499 | 3300025901 | Bacteria | 3895 |
| 347 | Ga0207688_10021184 | 3300025901 | Bacteria | 3551 |
| 348 | Ga0207688_10045783 | 3300025901 | Bacteria | 2441 |
| 349 | Ga0207647_10018615 | 3300025904 | Bacteria | 4690 |
| 350 | Ga0207647_10052839 | 3300025904 | Bacteria | 2506 |
| 351 | Ga0207685_10008994 | 3300025905 | Bacteria | 2880 |
| 352 | Ga0207685_10055792 | 3300025905 | Bacteria | 1543 |
| 353 | Ga0207685_10062620 | 3300025905 | Bacteria | 1479 |
| 354 | Ga0207699_10039819 | 3300025906 | Bacteria | 2703 |
| 355 | Ga0207699_10043999 | 3300025906 | Bacteria | 2597 |
| 356 | Ga0207699_10048136 | 3300025906 | Bacteria | 2503 |
| 357 | Ga0207699_10065872 | 3300025906 | Bacteria | 2198 |
| 358 | Ga0207699_10080705 | 3300025906 | Bacteria | 2016 |
| 359 | Ga0207699_10096867 | 3300025906 | Bacteria | 1863 |
| 360 | Ga0207645_10014227 | 3300025907 | Bacteria | 5330 |
| 361 | Ga0207643_10004374 | 3300025908 | Bacteria | 7594 |
| 362 | Ga0207643_10021033 | 3300025908 | Bacteria | 3583 |
| 363 | Ga0207643_10023320 | 3300025908 | Bacteria | 3411 |
| 364 | Ga0207643_10097013 | 3300025908 | Bacteria | 1724 |
| 365 | Ga0207705_10071355 | 3300025909 | Bacteria | 2518 |
| 366 | Ga0207684_10013282 | 3300025910 | Bacteria | 7125 |
| 367 | Ga0207684_10013816 | 3300025910 | Bacteria | 6973 |
| 368 | Ga0207684_10026292 | 3300025910 | Bacteria | 4962 |
| 369 | Ga0207684_10030715 | 3300025910 | Unclassified | 4573 |
| 370 | Ga0207684_10064503 | 3300025910 | Bacteria | 3109 |
| 371 | Ga0207684_10117729 | 3300025910 | Bacteria | 2276 |
| 372 | Ga0207707_10000094 | 3300025912 | Bacteria | 89818 |
| 373 | Ga0207707_10005320 | 3300025912 | Bacteria | 11245 |
| 374 | Ga0207707_10014021 | 3300025912 | Bacteria | 6987 |
| 375 | Ga0207707_10070136 | 3300025912 | Bacteria | 3054 |
| 376 | Ga0207707_10087089 | 3300025912 | Bacteria | 2729 |
| 377 | Ga0207707_10258417 | 3300025912 | Bacteria | 1512 |
| 378 | Ga0207707_10323460 | 3300025912 | Unclassified | 1331 |
| 379 | Ga0207695_10012536 | 3300025913 | Bacteria | 10164 |
| 380 | Ga0207695_10135766 | 3300025913 | Bacteria | 2413 |
| 381 | Ga0207671_10177077 | 3300025914 | Bacteria | 1658 |
| 382 | Ga0207693_10003783 | 3300025915 | Bacteria | 12887 |
| 383 | Ga0207693_10015613 | 3300025915 | Bacteria | 6089 |
| 384 | Ga0207693_10032674 | 3300025915 | Bacteria | 4106 |
| 385 | Ga0207693_10131577 | 3300025915 | Bacteria | 1967 |
| 386 | Ga0207663_10067454 | 3300025916 | Bacteria | 2294 |
| 387 | Ga0207663_10205093 | 3300025916 | Bacteria | 1425 |
| 388 | Ga0207660_10015684 | 3300025917 | Bacteria | 5005 |
| 389 | Ga0207660_10035783 | 3300025917 | Bacteria | 3449 |
| 390 | Ga0207660_10148113 | 3300025917 | Bacteria | 1801 |
| 391 | Ga0207662_10006040 | 3300025918 | Bacteria | 6509 |
| 392 | Ga0207662_10018084 | 3300025918 | Bacteria | 3993 |
| 393 | Ga0207662_10142463 | 3300025918 | Bacteria | 1519 |
| 394 | Ga0207657_10069453 | 3300025919 | Bacteria | 2989 |
| 395 | Ga0207657_10070564 | 3300025919 | Bacteria | 2960 |
| 396 | Ga0207657_10074348 | 3300025919 | Bacteria | 2870 |
| 397 | Ga0207657_10076357 | 3300025919 | Bacteria | 2826 |
| 398 | Ga0207657_10163011 | 3300025919 | Bacteria | 1810 |
| 399 | Ga0207657_10220757 | 3300025919 | Bacteria | 1519 |
| 400 | Ga0207649_10062402 | 3300025920 | Bacteria | 2349 |
| 401 | Ga0207652_10076816 | 3300025921 | Bacteria | 2913 |
| 402 | Ga0207652_10084714 | 3300025921 | Bacteria | 2777 |
| 403 | Ga0207652_10084878 | 3300025921 | Bacteria | 2774 |
| 404 | Ga0207652_10154643 | 3300025921 | Bacteria | 2054 |
| 405 | Ga0207646_10019819 | 3300025922 | Bacteria | 6243 |
| 406 | Ga0207646_10062072 | 3300025922 | Bacteria | 3336 |
| 407 | Ga0207646_10123364 | 3300025922 | Bacteria | 2329 |
| 408 | Ga0207694_10048531 | 3300025924 | Bacteria | 3285 |
| 409 | Ga0207694_10325279 | 3300025924 | Bacteria | 1269 |
| 410 | Ga0207650_10057524 | 3300025925 | Bacteria | 2892 |
| 411 | Ga0207659_10098493 | 3300025926 | Bacteria | 2199 |
| 412 | Ga0207659_10110111 | 3300025926 | Bacteria | 2092 |
| 413 | Ga0207687_10062146 | 3300025927 | Bacteria | 2640 |
| 414 | Ga0207687_10190224 | 3300025927 | Bacteria | 1597 |
| 415 | Ga0207700_10022083 | 3300025928 | Unclassified | 4359 |
| 416 | Ga0207700_10126479 | 3300025928 | Bacteria | 2080 |
| 417 | Ga0207700_10134500 | 3300025928 | Bacteria | 2023 |
| 418 | Ga0207664_10019156 | 3300025929 | Bacteria | 5052 |
| 419 | Ga0207664_10110234 | 3300025929 | Bacteria | 2288 |
| 420 | Ga0207644_10033644 | 3300025931 | Bacteria | 3584 |
| 421 | Ga0207644_10088675 | 3300025931 | Bacteria | 2301 |
| 422 | Ga0207690_10037072 | 3300025932 | Bacteria | 3163 |
| 423 | Ga0207690_10106763 | 3300025932 | Bacteria | 2010 |
| 424 | Ga0207690_10216644 | 3300025932 | Bacteria | 1463 |
| 425 | Ga0207706_10001683 | 3300025933 | Bacteria | 21818 |
| 426 | Ga0207706_10026852 | 3300025933 | Bacteria | 5154 |
| 427 | Ga0207706_10166825 | 3300025933 | Bacteria | 1935 |
| 428 | Ga0207706_10187882 | 3300025933 | Bacteria | 1814 |
| 429 | Ga0207709_10026655 | 3300025935 | Bacteria | 3322 |
| 430 | Ga0207709_10026813 | 3300025935 | Bacteria | 3313 |
| 431 | Ga0207709_10031139 | 3300025935 | Bacteria | 3112 |
| 432 | Ga0207709_10145516 | 3300025935 | Bacteria | 1635 |
| 433 | Ga0207670_10014123 | 3300025936 | Bacteria | 4730 |
| 434 | Ga0207670_10133230 | 3300025936 | Bacteria | 1824 |
| 435 | Ga0207670_10199374 | 3300025936 | Bacteria | 1520 |
| 436 | Ga0207670_10252554 | 3300025936 | Bacteria | 1363 |
| 437 | Ga0207665_10030366 | 3300025939 | Bacteria | 3570 |
| 438 | Ga0207665_10095719 | 3300025939 | Bacteria | 2064 |
| 439 | Ga0207665_10190954 | 3300025939 | Bacteria | 1488 |
| 440 | Ga0207691_10000550 | 3300025940 | Bacteria | 37583 |
| 441 | Ga0207691_10003308 | 3300025940 | Bacteria | 15702 |
| 442 | Ga0207691_10045616 | 3300025940 | Bacteria | 4028 |
| 443 | Ga0207691_10076248 | 3300025940 | Bacteria | 3022 |
| 444 | Ga0207691_10079660 | 3300025940 | Bacteria | 2947 |
| 445 | Ga0207711_10105491 | 3300025941 | Bacteria | 2499 |
| 446 | Ga0207689_10020853 | 3300025942 | Bacteria | 5512 |
| 447 | Ga0207689_10126764 | 3300025942 | Unclassified | 2100 |
| 448 | Ga0207661_10042482 | 3300025944 | Bacteria | 3584 |
| 449 | Ga0207661_10111678 | 3300025944 | Bacteria | 2313 |
| 450 | Ga0207667_10020143 | 3300025949 | Bacteria | 7427 |
| 451 | Ga0207667_10251653 | 3300025949 | Bacteria | 1807 |
| 452 | Ga0207651_10288273 | 3300025960 | Bacteria | 1360 |
| 453 | Ga0207712_10003656 | 3300025961 | Bacteria | 9696 |
| 454 | Ga0207712_10109667 | 3300025961 | Bacteria | 2068 |
| 455 | Ga0207640_10089116 | 3300025981 | Bacteria | 2132 |
| 456 | Ga0207658_10310334 | 3300025986 | Bacteria | 1362 |
| 457 | Ga0207677_10007594 | 3300026023 | Bacteria | 6014 |
| 458 | Ga0207703_10006779 | 3300026035 | Bacteria | 9133 |
| 459 | Ga0207639_10295406 | 3300026041 | Bacteria | 1430 |
| 460 | Ga0207678_10001201 | 3300026067 | Bacteria | 23769 |
| 461 | Ga0207678_10117214 | 3300026067 | Bacteria | 2272 |
| 462 | Ga0207678_10127482 | 3300026067 | Bacteria | 2171 |
| 463 | Ga0207708_10003878 | 3300026075 | Bacteria | 11004 |
| 464 | Ga0207702_10081848 | 3300026078 | Bacteria | 2805 |
| 465 | Ga0207702_10098775 | 3300026078 | Bacteria | 2572 |
| 466 | Ga0207702_10124187 | 3300026078 | Bacteria | 2314 |
| 467 | Ga0207702_10260763 | 3300026078 | Unclassified | 1632 |
| 468 | Ga0207702_10278141 | 3300026078 | Bacteria | 1581 |
| 469 | Ga0207702_10297126 | 3300026078 | Bacteria | 1532 |
| 470 | Ga0207641_10320359 | 3300026088 | Unclassified | 1470 |
| 471 | Ga0207641_10334448 | 3300026088 | Bacteria | 1439 |
| 472 | Ga0207648_10036025 | 3300026089 | Bacteria | 4359 |
| 473 | Ga0207648_10040563 | 3300026089 | Bacteria | 4090 |
| 474 | Ga0207648_10076413 | 3300026089 | Bacteria | 2919 |
| 475 | Ga0207648_10112164 | 3300026089 | Bacteria | 2394 |
| 476 | Ga0207648_10142287 | 3300026089 | Bacteria | 2114 |
| 477 | Ga0207676_10193276 | 3300026095 | Bacteria | 1792 |
| 478 | Ga0207676_10274765 | 3300026095 | Bacteria | 1527 |
| 479 | Ga0207674_10001978 | 3300026116 | Bacteria | 25950 |
| 480 | Ga0207674_10033113 | 3300026116 | Bacteria | 5412 |
| 481 | Ga0207674_10053822 | 3300026116 | Bacteria | 4101 |
| 482 | Ga0207674_10148097 | 3300026116 | Bacteria | 2305 |
| 483 | Ga0207674_10204447 | 3300026116 | Bacteria | 1924 |
| 484 | Ga0207674_10280990 | 3300026116 | Bacteria | 1612 |
| 485 | Ga0207675_100011869 | 3300026118 | Bacteria | 8139 |
| 486 | Ga0207675_100026881 | 3300026118 | Bacteria | 5356 |
| 487 | Ga0207675_100048901 | 3300026118 | Bacteria | 3947 |
| 488 | Ga0207675_100060125 | 3300026118 | Bacteria | 3547 |
| 489 | Ga0207675_100115555 | 3300026118 | Bacteria | 2536 |
| 490 | Ga0207683_10014351 | 3300026121 | Bacteria | 6748 |
| 491 | Ga0207683_10018125 | 3300026121 | Bacteria | 6005 |
| 492 | Ga0207683_10022343 | 3300026121 | Bacteria | 5429 |
| 493 | Ga0207683_10339943 | 3300026121 | Bacteria | 1377 |
| 494 | Ga0207698_10163513 | 3300026142 | Bacteria | 1950 |
| 495 | Ga0207698_10212310 | 3300026142 | Bacteria | 1742 |
| 496 | Ga0207698_10225169 | 3300026142 | Bacteria | 1698 |
| 497 | Ga0207698_10350905 | 3300026142 | Bacteria | 1393 |
| 498 | Ga0209983_1001445 | 3300027665 | Bacteria | 5278 |
| 499 | Ga0209998_10000168 | 3300027717 | Bacteria | 24295 |
| 500 | Ga0209974_10000232 | 3300027876 | Bacteria | 18009 |
| 501 | Ga0207428_10005490 | 3300027907 | Bacteria | 11818 |
| 502 | Ga0207428_10005596 | 3300027907 | Bacteria | 11682 |
| 503 | Ga0207428_10018858 | 3300027907 | Bacteria | 5886 |
| 504 | Ga0207428_10034266 | 3300027907 | Bacteria | 4163 |
| 505 | Ga0207428_10046063 | 3300027907 | Bacteria | 3509 |
| 506 | Ga0207428_10176378 | 3300027907 | Bacteria | 1616 |
| 507 | Ga0268266_10158452 | 3300028379 | Bacteria | 2046 |
| 508 | Ga0268265_10031164 | 3300028380 | Bacteria | 3849 |
| 509 | Ga0268265_10037736 | 3300028380 | Bacteria | 3548 |
| 510 | Ga0268264_10099355 | 3300028381 | Bacteria | 2525 |
| 511 | Ga0268264_10111841 | 3300028381 | Bacteria | 2393 |
| 512 | Ga0265334_10061114 | 3300028573 | Bacteria | 1420 |
| 513 | Ga0307515_10027465 | 3300028794 | Bacteria | 9728 |
| 514 | Ga0265338_10003183 | 3300028800 | Bacteria | 23421 |
| 515 | Ga0265325_10000646 | 3300031241 | Bacteria | 25305 |
| 516 | Ga0265340_10019251 | 3300031247 | Bacteria | 3515 |
| 517 | Ga0265339_10000347 | 3300031249 | Bacteria | 36868 |
| 518 | Ga0265331_10026150 | 3300031250 | Bacteria | 2938 |
| 519 | Ga0307513_10004704 | 3300031456 | Bacteria | 18152 |
| 520 | Ga0307513_10177897 | 3300031456 | Unclassified | 1995 |
| 521 | Ga0265313_10000288 | 3300031595 | Bacteria | 55189 |
| 522 | Ga0265314_10056215 | 3300031711 | Bacteria | 2710 |
| 523 | Ga0265342_10014881 | 3300031712 | Bacteria | 5145 |
| 524 | Ga0316576_10079672 | 3300031727 | Bacteria | 2428 |
| 525 | Ga0316576_10219599 | 3300031727 | Bacteria | 1430 |
| 526 | Ga0307413_10022345 | 3300031824 | Bacteria | 3408 |
| 527 | Ga0307406_10030661 | 3300031901 | Unclassified | 3267 |
| 528 | Ga0307406_10145001 | 3300031901 | Unclassified | 1686 |
| 529 | Ga0307412_10321830 | 3300031911 | Bacteria | 1231 |
| 530 | Ga0373930_0002595 | 3300034816 | Bacteria | 2807 |
| 531 | Ga0373959_0023875 | 3300034820 | Bacteria | 1192 |
| 532 | Ga0373926_0008055 | 3300035083 | Bacteria | 3510 |
| 533 | Ga0373926_0015763 | 3300035083 | Bacteria | 2578 |
| 534 | Ga0373928_0000388 | 3300035084 | Bacteria | 8754 |
| 535 | Ga0373929_0006391 | 3300035085 | Bacteria | 2130 |
| 536 | Ga0373934_0023998 | 3300035086 | Bacteria | 2358 |
| 537 | Ga0373940_0004329 | 3300035088 | Bacteria | 2995 |
| 538 | Ga0373940_0017428 | 3300035088 | Bacteria | 1791 |
| 539 | Ga0373949_0011681 | 3300035090 | Bacteria | 1937 |
| 540 | Ga0373923_0005254 | 3300035111 | Bacteria | 4386 |
| 541 | Ga0373945_0000070 | 3300035116 | Bacteria | 23249 |
| 542 | Ga0373953_0007481 | 3300035117 | Bacteria | 3661 |
| 543 | Ga0373956_0009708 | 3300035119 | Bacteria | 3918 |
| 544 | Ga0373956_0040964 | 3300035119 | Unclassified | 2056 |
| 545 | Ga0373957_0014317 | 3300035120 | Bacteria | 2709 |
| 546 | Ga0373957_0055197 | 3300035120 | Bacteria | 1527 |
| 547 | Ga0373960_0043500 | 3300035121 | Bacteria | 1308 |
| 548 | Ga0373943_0000087 | 3300035170 | Bacteria | 33416 |
| 549 | Ga0373943_0015586 | 3300035170 | Bacteria | 3455 |
| 550 | Ga0373946_0000186 | 3300035171 | Bacteria | 19207 |
| 551 | Ga0373946_0001168 | 3300035171 | Bacteria | 9091 |
| 552 | Ga0373946_0042885 | 3300035171 | Unclassified | 1862 |
| 553 | Ga0373955_0003588 | 3300035172 | Bacteria | 6825 |
| 554 | Ga0373955_0024869 | 3300035172 | Bacteria | 3067 |
| 555 | Ga0373955_0217071 | 3300035172 | Bacteria | 1141 |
| 556 | Ga0373962_0007592 | 3300035242 | Bacteria | 2659 |
| 557 | Ga0316574_0015446 | 3300035398 | Bacteria | 4430 |
| 558 | Ga0373931_0000001 | 3300035691 | Bacteria | 634029 |
| 559 | Ga0373931_0000038 | 3300035691 | Bacteria | 74311 |
| 560 | Ga0373931_0014145 | 3300035691 | Bacteria | 3897 |
| 561 | Ga0373931_0115511 | 3300035691 | Bacteria | 1528 |
| 562 | Ga0373931_0123003 | 3300035691 | Bacteria | 1485 |
| 563 | Ga0373935_0000270 | 3300035692 | Bacteria | 25587 |
| 564 | Ga0373927_0002157 | 3300035695 | Bacteria | 14460 |
| 565 | Ga0373927_0047231 | 3300035695 | Bacteria | 2785 |
| 566 | Ga0373927_0050211 | 3300035695 | Bacteria | 2697 |
| 567 | Ga0373927_0084187 | 3300035695 | Bacteria | 2062 |
| 568 | Ga0373933_0013928 | 3300035724 | Bacteria | 4461 |
| 569 | Ga0373933_0050558 | 3300035724 | Bacteria | 2482 |
| 570 | Ga0373947_0003066 | 3300035725 | Bacteria | 9946 |
| 571 | Ga0373947_0014593 | 3300035725 | Bacteria | 4505 |
| 572 | Ga0373947_0035108 | 3300035725 | Bacteria | 2968 |
| 573 | Ga0373947_0135713 | 3300035725 | Bacteria | 1574 |
| 574 | Ga0373937_0002383 | 3300036401 | Bacteria | 15644 |
| 575 | Ga0373937_0004271 | 3300036401 | Bacteria | 12100 |
| 576 | Ga0373937_0008219 | 3300036401 | Bacteria | 9062 |
| 577 | Ga0373937_0019106 | 3300036401 | Bacteria | 6132 |
| 578 | Ga0373937_0059231 | 3300036401 | Bacteria | 3519 |
| 579 | Ga0373937_0268671 | 3300036401 | Bacteria | 1609 |
| 580 | Ga0373937_0289182 | 3300036401 | Bacteria | 1548 |
| 581 | Ga0373925_0002000 | 3300037068 | Bacteria | 16895 |
| 582 | Ga0373925_0011760 | 3300037068 | Bacteria | 6333 |
| 583 | Ga0373925_0063888 | 3300037068 | Bacteria | 2770 |
| 584 | Ga0373925_0065677 | 3300037068 | Bacteria | 2733 |
| 585 | Ga0395899_0223337 | 3300037312 | Bacteria | 1304 |
| 586 | Ga0395900_0049263 | 3300037418 | Bacteria | 4340 |
| 587 | Ga0395898_0002265 | 3300037466 | Bacteria | 23319 |
| 588 | Ga0395898_0030125 | 3300037466 | Bacteria | 5432 |
| 589 | Ga0436364_0371684 | 3300037853 | Bacteria | 24141 |
| 590 | Ga0436364_0699396 | 3300037853 | Bacteria | 5304 |
| 591 | Ga0436364_1016419 | 3300037853 | Bacteria | 19962 |
| 592 | Ga0436364_1096538 | 3300037853 | Bacteria | 3291 |
| 593 | Ga0436364_1424456 | 3300037853 | Bacteria | 5815 |
| 594 | Ga0436364_1434162 | 3300037853 | Bacteria | 3592 |
| 595 | Ga0395901_0004608 | 3300038443 | Bacteria | 13909 |
| 596 | Ga0395901_0043511 | 3300038443 | Bacteria | 4658 |
| 597 | Ga0242420_001892 | 3300038996 | Bacteria | 2901 |
| 598 | Ga0400483_059098 | 3300039062 | Bacteria | 3328 |
| 599 | Ga0400483_266747 | 3300039062 | Bacteria | 1326 |
| 600 | Ga0400483_275305 | 3300039062 | Bacteria | 8007 |
| 601 | Ga0400483_286861 | 3300039062 | Bacteria | 2869 |
| 602 | Ga0436365_0142943 | 3300039437 | Bacteria | 1786 |
| 603 | Ga0436365_0443006 | 3300039437 | Unclassified | 1262 |
| 604 | Ga0436365_1475458 | 3300039437 | Bacteria | 25190 |
| 605 | Ga0436365_1670297 | 3300039437 | Bacteria | 5562 |
| 606 | Ga0436360_0897651 | 3300039438 | Unclassified | 1470 |
| 607 | Ga0436360_1038104 | 3300039438 | Bacteria | 3053 |
| 608 | Ga0436361_0781316 | 3300039447 | Bacteria | 1328 |
| 609 | Ga0436362_0251003 | 3300039453 | Bacteria | 3176 |
| 610 | Ga0436362_1255597 | 3300039453 | Bacteria | 1938 |
| 611 | Ga0451853_0689240 | 3300041512 | Bacteria | 2258 |
| 612 | Ga0450895_000659 | 3300042132 | Bacteria | 2101 |
| 613 | Ga0451577_0003484 | 3300042876 | Bacteria | 17506 |
| 614 | Ga0451577_0047288 | 3300042876 | Bacteria | 3848 |
| 615 | Ga0466963_0026252 | 3300044694 | Bacteria | 3724 |
| 616 | Ga0453684_0077520 | 3300044712 | Bacteria | 4164 |
| 617 | Ga0453684_0313632 | 3300044712 | Unclassified | 1779 |
| 618 | Ga0466960_0097851 | 3300044901 | Bacteria | 1506 |
| 619 | Ga0451576_0025862 | 3300045051 | Bacteria | 6321 |
| 620 | Ga0466967_0026297 | 3300045976 | Bacteria | 4818 |
| 621 | Ga0466967_0247447 | 3300045976 | Bacteria | 1702 |
| 622 | Ga0495592_0011507 | 3300046454 | Bacteria | 6697 |
| 623 | Ga0495592_0056767 | 3300046454 | Bacteria | 2891 |
| 624 | Ga0495592_0142321 | 3300046454 | Bacteria | 1667 |
| 625 | Ga0495603_0010187 | 3300046455 | Bacteria | 5689 |
| 626 | Ga0495629_0054470 | 3300046459 | Bacteria | 2797 |
| 627 | Ga0495651_0019572 | 3300046462 | Bacteria | 5250 |
| 628 | Ga0495651_0027545 | 3300046462 | Bacteria | 4427 |
| 629 | Ga0495651_0074424 | 3300046462 | Bacteria | 2576 |
| 630 | Ga0495653_0000347 | 3300046463 | Bacteria | 37809 |
| 631 | Ga0495653_0008043 | 3300046463 | Bacteria | 8637 |
| 632 | Ga0495653_0079924 | 3300046463 | Bacteria | 2420 |
| 633 | Ga0495580_0008722 | 3300046472 | Bacteria | 8037 |
| 634 | Ga0495580_0136512 | 3300046472 | Bacteria | 1701 |
| 635 | Ga0495582_0002355 | 3300046473 | Bacteria | 10575 |
| 636 | Ga0495582_0095384 | 3300046473 | Bacteria | 1661 |
| 637 | Ga0495639_0000749 | 3300046475 | Bacteria | 14836 |
| 638 | Ga0495664_0000408 | 3300046477 | Bacteria | 21027 |
| 639 | Ga0495664_0003253 | 3300046477 | Bacteria | 8825 |
| 640 | Ga0495594_0007204 | 3300046499 | Bacteria | 5720 |
| 641 | Ga0495594_0027014 | 3300046499 | Bacteria | 3092 |
| 642 | Ga0495608_0010944 | 3300046511 | Bacteria | 6323 |
| 643 | Ga0495608_0059514 | 3300046511 | Bacteria | 2516 |
| 644 | Ga0495618_0019598 | 3300046514 | Bacteria | 4163 |
| 645 | Ga0495618_0049994 | 3300046514 | Bacteria | 2640 |
| 646 | Ga0495618_0101675 | 3300046514 | Bacteria | 1840 |
| 647 | Ga0495618_0138624 | 3300046514 | Bacteria | 1556 |
| 648 | Ga0495618_0142552 | 3300046514 | Bacteria | 1532 |
| 649 | Ga0495628_0078052 | 3300046516 | Bacteria | 2575 |
| 650 | Ga0495628_0082523 | 3300046516 | Bacteria | 2497 |
| 651 | Ga0495628_0140141 | 3300046516 | Bacteria | 1846 |
| 652 | Ga0495630_0009036 | 3300046517 | Bacteria | 7162 |
| 653 | Ga0495630_0022767 | 3300046517 | Bacteria | 4628 |
| 654 | Ga0495630_0313243 | 3300046517 | Unclassified | 1200 |
| 655 | Ga0495666_0004171 | 3300046526 | Bacteria | 7289 |
| 656 | Ga0495652_0043556 | 3300046529 | Bacteria | 3865 |
| 657 | Ga0495652_0096174 | 3300046529 | Bacteria | 2412 |
| 658 | Ga0495652_0161740 | 3300046529 | Bacteria | 1737 |
| 659 | Ga0495665_0013826 | 3300046531 | Bacteria | 4359 |
| 660 | Ga0495665_0021712 | 3300046531 | Bacteria | 3451 |
| 661 | Ga0495640_0040636 | 3300046533 | Bacteria | 3255 |
| 662 | Ga0495586_0007549 | 3300046535 | Bacteria | 5801 |
| 663 | Ga0495587_0030463 | 3300046536 | Bacteria | 3271 |
| 664 | Ga0495645_0008561 | 3300046543 | Bacteria | 7145 |
| 665 | Ga0495645_0027708 | 3300046543 | Bacteria | 4115 |
| 666 | Ga0495645_0105856 | 3300046543 | Bacteria | 1995 |
| 667 | Ga0495667_0004364 | 3300046559 | Bacteria | 9549 |
| 668 | Ga0495667_0017454 | 3300046559 | Bacteria | 4846 |
| 669 | Ga0495667_0038592 | 3300046559 | Bacteria | 3179 |
| 670 | Ga0495667_0055381 | 3300046559 | Bacteria | 2608 |
| 671 | Ga0495667_0056726 | 3300046559 | Unclassified | 2575 |
| 672 | Ga0495667_0066494 | 3300046559 | Bacteria | 2356 |
| 673 | Ga0495656_0015156 | 3300046615 | Bacteria | 2905 |
| 674 | Ga0495634_0027057 | 3300046642 | Bacteria | 3994 |
| 675 | Ga0495635_0003702 | 3300046663 | Bacteria | 10597 |
| 676 | Ga0495635_0019395 | 3300046663 | Bacteria | 4741 |
| 677 | Ga0495635_0067997 | 3300046663 | Bacteria | 2443 |
| 678 | Ga0495635_0133766 | 3300046663 | Bacteria | 1690 |
| 679 | Ga0495659_0038210 | 3300046664 | Bacteria | 1704 |
| 680 | Ga0495588_0011421 | 3300046674 | Bacteria | 4167 |
| 681 | Ga0495657_0004574 | 3300046675 | Bacteria | 11048 |
| 682 | Ga0495657_0031845 | 3300046675 | Bacteria | 3683 |
| 683 | Ga0495657_0032282 | 3300046675 | Bacteria | 3656 |
| 684 | Ga0495657_0073456 | 3300046675 | Bacteria | 2227 |
| 685 | Ga0495657_0131624 | 3300046675 | Bacteria | 1566 |
| 686 | Ga0495599_0026497 | 3300046678 | Bacteria | 3633 |
| 687 | Ga0495623_0014444 | 3300046679 | Bacteria | 5110 |
| 688 | Ga0495646_0030069 | 3300046680 | Bacteria | 3393 |
| 689 | Ga0495646_0046981 | 3300046680 | Bacteria | 2629 |
| 690 | Ga0495658_0027295 | 3300046683 | Bacteria | 3070 |
| 691 | Ga0495669_0011629 | 3300046684 | Bacteria | 3741 |
| 692 | Ga0495613_0011279 | 3300046689 | Bacteria | 6637 |
| 693 | Ga0495613_0100039 | 3300046689 | Bacteria | 2094 |
| 694 | Ga0495624_0003374 | 3300046690 | Bacteria | 11854 |
| 695 | Ga0495624_0014171 | 3300046690 | Bacteria | 5418 |
| 696 | Ga0495600_0012987 | 3300046809 | Bacteria | 5222 |
| 697 | Ga0495600_0023375 | 3300046809 | Bacteria | 3976 |
| 698 | Ga0495600_0204443 | 3300046809 | Bacteria | 1267 |
| 699 | Ga0495581_0003281 | 3300047315 | Bacteria | 9283 |
| 700 | Ga0495604_0004463 | 3300047317 | Bacteria | 11084 |
| 701 | Ga0495604_0025245 | 3300047317 | Bacteria | 4736 |
| 702 | Ga0495636_0016336 | 3300047318 | Bacteria | 2964 |
| 703 | Ga0495674_0000477 | 3300047319 | Bacteria | 36402 |
| 704 | Ga0495674_0015244 | 3300047319 | Bacteria | 7189 |
| 705 | Ga0495674_0265181 | 3300047319 | Bacteria | 1410 |
| 706 | Ga0495676_0000213 | 3300047321 | Bacteria | 46318 |
| 707 | Ga0495676_0011576 | 3300047321 | Bacteria | 7958 |
| 708 | Ga0495680_0003820 | 3300047322 | Bacteria | 14619 |
| 709 | Ga0495680_0023632 | 3300047322 | Bacteria | 5108 |
| 710 | Ga0495680_0024929 | 3300047322 | Bacteria | 4953 |
| 711 | Ga0495680_0058629 | 3300047322 | Bacteria | 2974 |
| 712 | Ga0495680_0070681 | 3300047322 | Bacteria | 2660 |
| 713 | Ga0495675_0002915 | 3300047444 | Bacteria | 10276 |
| 714 | Ga0495675_0121614 | 3300047444 | Bacteria | 1625 |
| 715 | Ga0495684_0001287 | 3300047471 | Bacteria | 20139 |
| 716 | Ga0495684_0044512 | 3300047471 | Bacteria | 3398 |
| 717 | Ga0495684_0056526 | 3300047471 | Bacteria | 2992 |
| 718 | Ga0495686_0046870 | 3300047472 | Bacteria | 2731 |
| 719 | Ga0495593_0024105 | 3300047673 | Bacteria | 3375 |
| 720 | Ga0495602_0002111 | 3300048088 | Bacteria | 20026 |
| 721 | Ga0495602_0069239 | 3300048088 | Bacteria | 3025 |
| 722 | Ga0495614_0038178 | 3300048089 | Bacteria | 2061 |
| 723 | Ga0496101_0050514 | 3300048904 | Bacteria | 2994 |
| 724 | Ga0496102_0135989 | 3300048905 | Bacteria | 2303 |
| 725 | Ga0496102_0248358 | 3300048905 | Bacteria | 1677 |
| 726 | Ga0496102_0398304 | 3300048905 | Bacteria | 1294 |
| 727 | Ga0496103_0013368 | 3300048906 | Bacteria | 4865 |
| 728 | Ga0496103_0028211 | 3300048906 | Bacteria | 3405 |
| 729 | Ga0496104_0062614 | 3300048907 | Bacteria | 3527 |
| 730 | Ga0496104_0137267 | 3300048907 | Bacteria | 2349 |
| 731 | Ga0496105_0188736 | 3300048908 | Bacteria | 1686 |
| 732 | Ga0496106_0003244 | 3300048909 | Bacteria | 12170 |
| 733 | Ga0496106_0063683 | 3300048909 | Bacteria | 2803 |
| 734 | Ga0496106_0086571 | 3300048909 | Bacteria | 2413 |
| 735 | Ga0496106_0150526 | 3300048909 | Bacteria | 1835 |
| 736 | Ga0496107_0001966 | 3300048910 | Bacteria | 13066 |
| 737 | Ga0496107_0028883 | 3300048910 | Bacteria | 3943 |
| 738 | Ga0496107_0069434 | 3300048910 | Bacteria | 2557 |
| 739 | Ga0496108_0001455 | 3300048911 | Bacteria | 18720 |
| 740 | Ga0496108_0029145 | 3300048911 | Bacteria | 4569 |
| 741 | Ga0496108_0185184 | 3300048911 | Bacteria | 1803 |
| 742 | Ga0496109_0154853 | 3300048912 | Bacteria | 2146 |
| 743 | Ga0496109_0290843 | 3300048912 | Bacteria | 1540 |
| 744 | Ga0496110_0008677 | 3300048913 | Bacteria | 8187 |
| 745 | Ga0496110_0053833 | 3300048913 | Bacteria | 3539 |
| 746 | Ga0496110_0153558 | 3300048913 | Bacteria | 2085 |
| 747 | Ga0496110_0226221 | 3300048913 | Bacteria | 1701 |
| 748 | Ga0496111_0081682 | 3300048914 | Bacteria | 2359 |
| 749 | Ga0496111_0081711 | 3300048914 | Bacteria | 2359 |
| 750 | Ga0496111_0214125 | 3300048914 | Bacteria | 1431 |
| 751 | Ga0496112_0116968 | 3300048915 | Bacteria | 2636 |
| 752 | Ga0496113_0027105 | 3300048916 | Bacteria | 4103 |
| 753 | Ga0496113_0155478 | 3300048916 | Bacteria | 1806 |
| 754 | Ga0496113_0209825 | 3300048916 | Bacteria | 1550 |
| 755 | Ga0496114_0112126 | 3300048917 | Bacteria | 2338 |
| 756 | Ga0496115_0021283 | 3300048918 | Bacteria | 5009 |
| 757 | Ga0496119_0005142 | 3300048922 | Bacteria | 12671 |
| 758 | Ga0496125_0001945 | 3300048928 | Bacteria | 28207 |
| 759 | Ga0501031_0000959 | 3300049568 | Bacteria | 17470 |
| 760 | Ga0501031_0024122 | 3300049568 | Bacteria | 3965 |
| 761 | Ga0501031_0046233 | 3300049568 | Bacteria | 2839 |
| 762 | Ga0501032_0000336 | 3300049569 | Bacteria | 39319 |
| 763 | Ga0501032_0001789 | 3300049569 | Bacteria | 16961 |
| 764 | Ga0501032_0085167 | 3300049569 | Bacteria | 2101 |
| 765 | Ga0501033_0000090 | 3300049570 | Bacteria | 86596 |
| 766 | Ga0501033_0006860 | 3300049570 | Bacteria | 8891 |
| 767 | Ga0501033_0081116 | 3300049570 | Bacteria | 2379 |
| 768 | Ga0501034_0000140 | 3300049571 | Bacteria | 134996 |
| 769 | Ga0501034_0007273 | 3300049571 | Bacteria | 11804 |
| 770 | Ga0501034_0015032 | 3300049571 | Bacteria | 7960 |
| 771 | Ga0501034_0089211 | 3300049571 | Bacteria | 3081 |
| 772 | Ga0501034_0121996 | 3300049571 | Bacteria | 2592 |
| 773 | Ga0501036_0000048 | 3300049572 | Bacteria | 75517 |
| 774 | Ga0501036_0009528 | 3300049572 | Bacteria | 7989 |
| 775 | Ga0501036_0041617 | 3300049572 | Bacteria | 3886 |
| 776 | Ga0501037_0000024 | 3300049573 | Bacteria | 146046 |
| 777 | Ga0501037_0009575 | 3300049573 | Bacteria | 7110 |
| 778 | Ga0501037_0186355 | 3300049573 | Bacteria | 1470 |
| 779 | Ga0501038_0000247 | 3300049574 | Bacteria | 45720 |
| 780 | Ga0501038_0007063 | 3300049574 | Bacteria | 10368 |
| 781 | Ga0501038_0048744 | 3300049574 | Bacteria | 3664 |
| 782 | Ga0501039_0000017 | 3300049575 | Bacteria | 189412 |
| 783 | Ga0501039_0011247 | 3300049575 | Bacteria | 6821 |
| 784 | Ga0501039_0274841 | 3300049575 | Bacteria | 1324 |
| 785 | Ga0501040_0029353 | 3300049576 | Bacteria | 3712 |
| 786 | Ga0501041_0152611 | 3300049577 | Bacteria | 1443 |
| 787 | Ga0501042_0077176 | 3300049578 | Bacteria | 2385 |
| 788 | Ga0501043_0000146 | 3300049579 | Bacteria | 65887 |
| 789 | Ga0501043_0092662 | 3300049579 | Bacteria | 2375 |
| 790 | Ga0501046_0079592 | 3300049580 | Bacteria | 2533 |
| 791 | Ga0501047_0002914 | 3300049581 | Bacteria | 16250 |
| 792 | Ga0501047_0042303 | 3300049581 | Bacteria | 4403 |
| 793 | Ga0501070_0007417 | 3300049586 | Bacteria | 9316 |
| 794 | Ga0501070_0031397 | 3300049586 | Bacteria | 4451 |
| 795 | Ga0501070_0080969 | 3300049586 | Bacteria | 2686 |
| 796 | Ga0501072_0002045 | 3300049588 | Bacteria | 15003 |
| 797 | Ga0501072_0012743 | 3300049588 | Bacteria | 6429 |
| 798 | Ga0501074_0076995 | 3300049590 | Bacteria | 2394 |
| 799 | Ga0501075_0009407 | 3300049591 | Bacteria | 6835 |
| 800 | Ga0501075_0024630 | 3300049591 | Bacteria | 4417 |
| 801 | Ga0501076_0000486 | 3300049592 | Bacteria | 25056 |
| 802 | Ga0501076_0220506 | 3300049592 | Bacteria | 1550 |
| 803 | Ga0501077_0031041 | 3300049593 | Unclassified | 3399 |
| 804 | Ga0501079_0013152 | 3300049741 | Bacteria | 6308 |
| 805 | Ga0501079_0037082 | 3300049741 | Bacteria | 3756 |
| 806 | Ga0501080_0107400 | 3300049742 | Bacteria | 2587 |
| 807 | Ga0501081_0011103 | 3300049743 | Bacteria | 5890 |
| 808 | Ga0501081_0022985 | 3300049743 | Bacteria | 4175 |
| 809 | Ga0501081_0034429 | 3300049743 | Bacteria | 3446 |
| 810 | Ga0501081_0087901 | 3300049743 | Bacteria | 2183 |
| 811 | Ga0501035_0000021 | 3300049822 | Bacteria | 209085 |
| 812 | Ga0501035_0021703 | 3300049822 | Bacteria | 5903 |
| 813 | Ga0501044_0012955 | 3300049823 | Bacteria | 9028 |
| 814 | Ga0501044_0044902 | 3300049823 | Bacteria | 4582 |
| 815 | Ga0501044_0049246 | 3300049823 | Bacteria | 4349 |
| 816 | Ga0501044_0194755 | 3300049823 | Bacteria | 1987 |
| 817 | Ga0501044_0224921 | 3300049823 | Bacteria | 1826 |
| 818 | Ga0501045_0046010 | 3300049824 | Bacteria | 3178 |
| 819 | Ga0501045_0209800 | 3300049824 | Bacteria | 1451 |
| 820 | Ga0501045_0333277 | 3300049824 | Unclassified | 1129 |
| 821 | nmdc:mga0yw44_112_c1 | 3300050492 | Bacteria | 28571 |
| 822 | nmdc:mga06z11_110070_c1 | 3300050494 | Bacteria | 1524 |
| 823 | nmdc:mga05p37_100096_c1 | 3300050507 | Bacteria | 3570 |
| 824 | nmdc:mga05p37_1851_c1 | 3300050507 | Bacteria | 24645 |
| 825 | nmdc:mga05p37_202676_c1 | 3300050507 | Bacteria | 2402 |
| 826 | nmdc:mga05p37_20592_c1 | 3300050507 | Bacteria | 7320 |
| 827 | nmdc:mga05p37_216052_c1 | 3300050507 | Bacteria | 2316 |
| 828 | nmdc:mga05p37_220724_c1 | 3300050507 | Bacteria | 2288 |
| 829 | nmdc:mga05p37_276313_c1 | 3300050507 | Bacteria | 2005 |
| 830 | nmdc:mga05p37_350383_c1 | 3300050507 | Bacteria | 1739 |
| 831 | nmdc:mga05p37_508_c1 | 3300050507 | Bacteria | 34964 |
| 832 | nmdc:mga05p37_59454_c1 | 3300050507 | Bacteria | 4707 |
| 833 | nmdc:mga05p37_71764_c1 | 3300050507 | Bacteria | 4260 |
| 834 | nmdc:mga05p37_7394_c1 | 3300050507 | Bacteria | 12957 |
| 835 | nmdc:mga05p37_88618_c1 | 3300050507 | Bacteria | 3814 |
| 836 | nmdc:mga09592_14119_c1 | 3300050508 | Bacteria | 6519 |
| 837 | nmdc:mga09592_26976_c1 | 3300050508 | Bacteria | 4763 |
| 838 | nmdc:mga09592_4532_c1 | 3300050508 | Bacteria | 11235 |
| 839 | nmdc:mga09592_49665_c1 | 3300050508 | Bacteria | 3537 |
| 840 | nmdc:mga09592_52794_c1 | 3300050508 | Bacteria | 3431 |
| 841 | nmdc:mga09592_5379_c1 | 3300050508 | Bacteria | 10412 |
| 842 | nmdc:mga09592_53936_c1 | 3300050508 | Bacteria | 3396 |
| 843 | nmdc:mga0qj67_22279_c1 | 3300050509 | Bacteria | 4866 |
| 844 | nmdc:mga0qj67_25726_c1 | 3300050509 | Bacteria | 4551 |
| 845 | nmdc:mga0qj67_387_c1 | 3300050509 | Bacteria | 30412 |
| 846 | nmdc:mga0qj67_43190_c1 | 3300050509 | Bacteria | 3550 |
| 847 | nmdc:mga0qj67_85047_c1 | 3300050509 | Bacteria | 2537 |
| 848 | nmdc:mga06r32_116721_c1 | 3300050510 | Bacteria | 2630 |
| 849 | nmdc:mga06r32_12420_c1 | 3300050510 | Bacteria | 7685 |
| 850 | nmdc:mga06r32_161028_c1 | 3300050510 | Bacteria | 2227 |
| 851 | nmdc:mga06r32_184246_c1 | 3300050510 | Bacteria | 2074 |
| 852 | nmdc:mga06r32_193613_c1 | 3300050510 | Bacteria | 2020 |
| 853 | nmdc:mga06r32_1960_c1 | 3300050510 | Bacteria | 18367 |
| 854 | nmdc:mga06r32_19944_c1 | 3300050510 | Bacteria | 6164 |
| 855 | nmdc:mga06r32_45638_c1 | 3300050510 | Bacteria | 4178 |
| 856 | nmdc:mga06r32_56844_c1 | 3300050510 | Bacteria | 3757 |
| 857 | nmdc:mga08y16_115302_c1 | 3300050511 | Bacteria | 2797 |
| 858 | nmdc:mga08y16_147487_c1 | 3300050511 | Bacteria | 2446 |
| 859 | nmdc:mga08y16_192317_c1 | 3300050511 | Bacteria | 2116 |
| 860 | nmdc:mga08y16_226680_c1 | 3300050511 | Bacteria | 1934 |
| 861 | nmdc:mga08y16_2332_c1 | 3300050511 | Bacteria | 19466 |
| 862 | nmdc:mga08y16_27870_c1 | 3300050511 | Bacteria | 5955 |
| 863 | nmdc:mga08y16_52323_c1 | 3300050511 | Bacteria | 4273 |
| 864 | nmdc:mga08y16_542_c1 | 3300050511 | Bacteria | 34971 |
| 865 | nmdc:mga08y16_64038_c1 | 3300050511 | Bacteria | 3840 |
| 866 | nmdc:mga08y16_794_c1 | 3300050511 | Bacteria | 30179 |
| 867 | nmdc:mga0n895_100746_c1 | 3300050512 | Bacteria | 2898 |
| 868 | nmdc:mga0n895_16837_c1 | 3300050512 | Bacteria | 6719 |
| 869 | nmdc:mga0n895_2920_c1 | 3300050512 | Bacteria | 13550 |
| 870 | nmdc:mga0n895_297603_c1 | 3300050512 | Bacteria | 1636 |
| 871 | nmdc:mga0n895_4136_c1 | 3300050512 | Bacteria | 11832 |
| 872 | nmdc:mga0n895_64822_c1 | 3300050512 | Bacteria | 3615 |
| 873 | nmdc:mga0rr50_1886_c1 | 3300050513 | Bacteria | 11635 |
| 874 | nmdc:mga0rr50_19263_c1 | 3300050513 | Bacteria | 4601 |
| 875 | nmdc:mga0rr50_22223_c1 | 3300050513 | Bacteria | 4350 |
| 876 | nmdc:mga0rr50_37693_c1 | 3300050513 | Bacteria | 3492 |
| 877 | nmdc:mga0rr50_46073_c1 | 3300050513 | Bacteria | 3209 |
| 878 | nmdc:mga08x19_251611_c1 | 3300050514 | Bacteria | 1220 |
| 879 | nmdc:mga08x19_53009_c1 | 3300050514 | Bacteria | 2609 |
| 880 | nmdc:mga08x19_638_c1 | 3300050514 | Bacteria | 22652 |
| 881 | nmdc:mga0a205_118100_c1 | 3300050515 | Bacteria | 2551 |
| 882 | nmdc:mga0a205_4196_c1 | 3300050515 | Bacteria | 12922 |
| 883 | nmdc:mga0a205_51911_c1 | 3300050515 | Bacteria | 3958 |
| 884 | nmdc:mga0a205_73375_c1 | 3300050515 | Bacteria | 3306 |
| 885 | Ga0495601_0010758 | 3300053077 | Bacteria | 5459 |
| 886 | Ga0495612_0001008 | 3300053078 | Bacteria | 11600 |
| 887 | Ga0495595_0019099 | 3300053084 | Bacteria | 2970 |
| 888 | Ga0495595_0028611 | 3300053084 | Bacteria | 2489 |
| 889 | Ga0495619_0001832 | 3300053085 | Bacteria | 14130 |
| 890 | Ga0495619_0004096 | 3300053085 | Bacteria | 9330 |
| 891 | Ga0495619_0014924 | 3300053085 | Bacteria | 4906 |
| 892 | Ga0495619_0018357 | 3300053085 | Bacteria | 4439 |
| 893 | Ga0500641_0020597 | 3300053096 | Bacteria | 2505 |
| 894 | Ga0500595_026204 | 3300053119 | Bacteria | 2011 |
| 895 | Ga0500617_024133 | 3300053124 | Bacteria | 2692 |
| 896 | Ga0500642_0083514 | 3300053130 | Bacteria | 1470 |
| 897 | Ga0500658_0025782 | 3300053134 | Bacteria | 2261 |
| 898 | Ga0500616_0000856 | 3300053153 | Bacteria | 33765 |
| 899 | Ga0501084_0107892 | 3300054114 | Bacteria | 2339 |
| 900 | Ga0501084_0220078 | 3300054114 | Bacteria | 1602 |
| 901 | Ga0501082_0185295 | 3300060353 | Bacteria | 1811 |
| 902 | Ga0530510_0000079 | 3300061734 | Bacteria | 50366 |
| 903 | Ga0530510_0011724 | 3300061734 | Bacteria | 6152 |
| 904 | Ga0530510_0022724 | 3300061734 | Bacteria | 4468 |
| 905 | Ga0530510_0042960 | 3300061734 | Bacteria | 3265 |
| 906 | Ga0530510_0046953 | 3300061734 | Bacteria | 3120 |
| 907 | Ga0530510_0141830 | 3300061734 | Bacteria | 1771 |
| 908 | Ga0530510_0207005 | 3300061734 | Bacteria | 1458 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026089 | Ga0207648_10036025 | Ga0207648_100360251 | 304 |
| 2 | 3300014326 | Ga0157380_10348064 | Ga0157380_103480641 | 309 |
| 3 | 3300009176 | Ga0105242_10119233 | Ga0105242_101192333 | 310 |
| 4 | 3300025901 | Ga0207688_10017499 | Ga0207688_100174992 | 310 |
| 5 | 3300037312 | Ga0395899_0223337 | Ga0395899_0223337_316_1263 | 315 |
| 6 | 3300025906 | Ga0207699_10080705 | Ga0207699_100807052 | 317 |
| 7 | 3300039437 | Ga0436365_0443006 | Ga0436365_0443006_72_1073 | 317 |
| 8 | 3300013306 | Ga0163162_10149765 | Ga0163162_101497652 | 318 |
| 9 | 3300050510 | nmdc:mga06r32_193613_c1 | nmdc:mga06r32_193613_c1_987_1997 | 328 |
| 10 | 3300050514 | nmdc:mga08x19_53009_c1 | nmdc:mga08x19_53009_c1_107_1102 | 328 |
| 11 | 3300035695 | Ga0373927_0084187 | Ga0373927_0084187_18_1052 | 332 |
| 12 | 3300036401 | Ga0373937_0268671 | Ga0373937_0268671_37_1071 | 332 |
| 13 | 3300048089 | Ga0495614_0038178 | Ga0495614_0038178_1011_2045 | 332 |
| 14 | 3300061734 | Ga0530510_0046953 | Ga0530510_0046953_342_1409 | 347 |
| 15 | 3300005329 | Ga0070683_100061805 | Ga0070683_1000618053 | 348 |
| 16 | 3300005577 | Ga0068857_100109764 | Ga0068857_1001097643 | 348 |
| 17 | 3300026116 | Ga0207674_10033113 | Ga0207674_100331135 | 348 |
| 18 | 3300039447 | Ga0436361_0781316 | Ga0436361_0781316_134_1204 | 348 |
| 19 | 3300039453 | Ga0436362_0251003 | Ga0436362_0251003_1082_2152 | 348 |
| 20 | 3300048916 | Ga0496113_0155478 | Ga0496113_0155478_20_1135 | 348 |
| 21 | 3300005439 | Ga0070711_100350758 | Ga0070711_1003507581 | 349 |
| 22 | 3300013308 | Ga0157375_10338243 | Ga0157375_103382431 | 349 |
| 23 | 3300014968 | Ga0157379_10408074 | Ga0157379_104080741 | 349 |
| 24 | 3300035172 | Ga0373955_0217071 | Ga0373955_0217071_13_1098 | 349 |
| 25 | 3300044694 | Ga0466963_0026252 | Ga0466963_0026252_2524_3585 | 349 |
| 26 | 3300005338 | Ga0068868_100156789 | Ga0068868_1001567892 | 350 |
| 27 | 3300005366 | Ga0070659_100043687 | Ga0070659_1000436872 | 350 |
| 28 | 3300009553 | Ga0105249_10008299 | Ga0105249_100082997 | 350 |
| 29 | 3300013306 | Ga0163162_10136180 | Ga0163162_101361802 | 350 |
| 30 | 3300014745 | Ga0157377_10031207 | Ga0157377_100312072 | 350 |
| 31 | 3300025901 | Ga0207688_10006766 | Ga0207688_100067662 | 350 |
| 32 | 3300025919 | Ga0207657_10220757 | Ga0207657_102207571 | 350 |
| 33 | 3300025932 | Ga0207690_10037072 | Ga0207690_100370723 | 350 |
| 34 | 3300025935 | Ga0207709_10031139 | Ga0207709_100311391 | 350 |
| 35 | 3300025961 | Ga0207712_10003656 | Ga0207712_100036563 | 350 |
| 36 | 3300026041 | Ga0207639_10295406 | Ga0207639_102954061 | 350 |
| 37 | 3300049742 | Ga0501080_0107400 | Ga0501080_0107400_779_1918 | 350 |
| 38 | 3300009147 | Ga0114129_10017185 | Ga0114129_100171856 | 351 |
| 39 | 3300007076 | Ga0075435_100024060 | Ga0075435_1000240602 | 354 |
| 40 | 3300026118 | Ga0207675_100060125 | Ga0207675_1000601253 | 354 |
| 41 | 3300050510 | nmdc:mga06r32_12420_c1 | nmdc:mga06r32_12420_c1_4468_5547 | 354 |
| 42 | 3300009553 | Ga0105249_10341598 | Ga0105249_103415981 | 355 |
| 43 | 3300025924 | Ga0207694_10325279 | Ga0207694_103252791 | 355 |
| 44 | 3300025935 | Ga0207709_10026655 | Ga0207709_100266553 | 355 |
| 45 | 3300026142 | Ga0207698_10225169 | Ga0207698_102251692 | 355 |
| 46 | 3300031901 | Ga0307406_10145001 | Ga0307406_101450011 | 355 |
| 47 | 3300049593 | Ga0501077_0031041 | Ga0501077_0031041_13_1083 | 355 |
| 48 | 3300049824 | Ga0501045_0333277 | Ga0501045_0333277_43_1113 | 355 |
| 49 | 3300005336 | Ga0070680_100007542 | Ga0070680_1000075426 | 356 |
| 50 | 3300005530 | Ga0070679_100000922 | Ga0070679_1000009222 | 356 |
| 51 | 3300025912 | Ga0207707_10070136 | Ga0207707_100701362 | 356 |
| 52 | 3300049568 | Ga0501031_0024122 | Ga0501031_0024122_1825_2961 | 356 |
| 53 | 3300049569 | Ga0501032_0000336 | Ga0501032_0000336_18768_19904 | 356 |
| 54 | 3300049570 | Ga0501033_0000090 | Ga0501033_0000090_74616_75752 | 356 |
| 55 | 3300049571 | Ga0501034_0000140 | Ga0501034_0000140_112503_113639 | 356 |
| 56 | 3300049572 | Ga0501036_0000048 | Ga0501036_0000048_35333_36469 | 356 |
| 57 | 3300049573 | Ga0501037_0000024 | Ga0501037_0000024_40824_41960 | 356 |
| 58 | 3300049574 | Ga0501038_0000247 | Ga0501038_0000247_25817_26953 | 356 |
| 59 | 3300049575 | Ga0501039_0000017 | Ga0501039_0000017_162460_163596 | 356 |
| 60 | 3300049579 | Ga0501043_0000146 | Ga0501043_0000146_19416_20552 | 356 |
| 61 | 3300049822 | Ga0501035_0000021 | Ga0501035_0000021_45502_46638 | 356 |
| 62 | 3300049823 | Ga0501044_0044902 | Ga0501044_0044902_219_1355 | 356 |
| 63 | 3300005985 | Ga0081539_10003167 | Ga0081539_1000316711 | 357 |
| 64 | 3300021384 | Ga0213876_10009634 | Ga0213876_100096344 | 359 |
| 65 | 3300021384 | Ga0213876_10075032 | Ga0213876_100750322 | 360 |
| 66 | 3300037853 | Ga0436364_1424456 | Ga0436364_1424456_168_1277 | 360 |
| 67 | 3300039437 | Ga0436365_0142943 | Ga0436365_0142943_218_1327 | 360 |
| 68 | 3300049588 | Ga0501072_0012743 | Ga0501072_0012743_4965_6104 | 360 |
| 69 | 3300049591 | Ga0501075_0024630 | Ga0501075_0024630_2741_3880 | 360 |
| 70 | 3300049741 | Ga0501079_0013152 | Ga0501079_0013152_176_1315 | 360 |
| 71 | 3300049743 | Ga0501081_0022985 | Ga0501081_0022985_2989_4128 | 360 |
| 72 | 3300049824 | Ga0501045_0209800 | Ga0501045_0209800_78_1217 | 360 |
| 73 | 3300060353 | Ga0501082_0185295 | Ga0501082_0185295_589_1728 | 360 |
| 74 | 3300061734 | Ga0530510_0011724 | Ga0530510_0011724_4740_5879 | 360 |
| 75 | 3300005334 | Ga0068869_100057295 | Ga0068869_1000572953 | 361 |
| 76 | 3300014968 | Ga0157379_10028668 | Ga0157379_100286685 | 361 |
| 77 | 3300025942 | Ga0207689_10126764 | Ga0207689_101267642 | 361 |
| 78 | 3300049577 | Ga0501041_0152611 | Ga0501041_0152611_160_1269 | 361 |
| 79 | iso_pu_bacteria | 2816332139 | 2816511457 | 362 |
| 80 | 3300005340 | Ga0070689_100041208 | Ga0070689_1000412083 | 363 |
| 81 | 3300005365 | Ga0070688_100088610 | Ga0070688_1000886102 | 363 |
| 82 | 3300017792 | Ga0163161_10145439 | Ga0163161_101454392 | 363 |
| 83 | 3300025936 | Ga0207670_10199374 | Ga0207670_101993741 | 363 |
| 84 | 3300048922 | Ga0496119_0005142 | Ga0496119_0005142_10723_11835 | 363 |
| 85 | 3300005546 | Ga0070696_100067363 | Ga0070696_1000673632 | 364 |
| 86 | 3300049743 | Ga0501081_0034429 | Ga0501081_0034429_2213_3322 | 364 |
| 87 | 3300011119 | Ga0105246_10068715 | Ga0105246_100687152 | 365 |
| 88 | 3300025908 | Ga0207643_10023320 | Ga0207643_100233203 | 365 |
| 89 | 3300026075 | Ga0207708_10003878 | Ga0207708_100038787 | 365 |
| 90 | 3300048905 | Ga0496102_0248358 | Ga0496102_0248358_112_1242 | 365 |
| 91 | 3300048906 | Ga0496103_0028211 | Ga0496103_0028211_760_1890 | 365 |
| 92 | 3300048907 | Ga0496104_0062614 | Ga0496104_0062614_1569_2699 | 365 |
| 93 | 3300048909 | Ga0496106_0150526 | Ga0496106_0150526_89_1219 | 365 |
| 94 | 3300048910 | Ga0496107_0069434 | Ga0496107_0069434_1135_2265 | 365 |
| 95 | 3300048911 | Ga0496108_0029145 | Ga0496108_0029145_810_1940 | 365 |
| 96 | 3300005445 | Ga0070708_100231245 | Ga0070708_1002312452 | 366 |
| 97 | 3300006871 | Ga0075434_100356032 | Ga0075434_1003560321 | 366 |
| 98 | 3300007076 | Ga0075435_100076539 | Ga0075435_1000765392 | 366 |
| 99 | 3300039438 | Ga0436360_1038104 | Ga0436360_1038104_1909_3030 | 366 |
| 100 | 3300050512 | nmdc:mga0n895_297603_c1 | nmdc:mga0n895_297603_c1_203_1348 | 366 |
| 101 | 3300050513 | nmdc:mga0rr50_46073_c1 | nmdc:mga0rr50_46073_c1_318_1463 | 366 |
| 102 | 3300005467 | Ga0070706_100175155 | Ga0070706_1001751552 | 367 |
| 103 | 3300005937 | Ga0081455_10005146 | Ga0081455_100051463 | 367 |
| 104 | 3300005981 | Ga0081538_10084555 | Ga0081538_100845551 | 367 |
| 105 | 3300005983 | Ga0081540_1018211 | Ga0081540_10182112 | 367 |
| 106 | 3300005985 | Ga0081539_10041662 | Ga0081539_100416624 | 367 |
| 107 | 3300006844 | Ga0075428_100024635 | Ga0075428_1000246352 | 367 |
| 108 | 3300006844 | Ga0075428_100106570 | Ga0075428_1001065702 | 367 |
| 109 | 3300006847 | Ga0075431_100234926 | Ga0075431_1002349262 | 367 |
| 110 | 3300006880 | Ga0075429_100019368 | Ga0075429_1000193684 | 367 |
| 111 | 3300009094 | Ga0111539_10008663 | Ga0111539_100086634 | 367 |
| 112 | 3300009147 | Ga0114129_10014293 | Ga0114129_100142934 | 367 |
| 113 | 3300011119 | Ga0105246_10124617 | Ga0105246_101246171 | 367 |
| 114 | 3300021384 | Ga0213876_10002947 | Ga0213876_100029473 | 367 |
| 115 | 3300025905 | Ga0207685_10008994 | Ga0207685_100089941 | 367 |
| 116 | 3300025939 | Ga0207665_10190954 | Ga0207665_101909542 | 367 |
| 117 | 3300037853 | Ga0436364_1016419 | Ga0436364_1016419_10531_11700 | 367 |
| 118 | 3300039437 | Ga0436365_1475458 | Ga0436365_1475458_6563_7732 | 367 |
| 119 | 3300039453 | Ga0436362_1255597 | Ga0436362_1255597_132_1271 | 367 |
| 120 | 3300049576 | Ga0501040_0029353 | Ga0501040_0029353_2534_3658 | 367 |
| 121 | 3300050507 | nmdc:mga05p37_202676_c1 | nmdc:mga05p37_202676_c1_450_1589 | 367 |
| 122 | 3300050507 | nmdc:mga05p37_7394_c1 | nmdc:mga05p37_7394_c1_8090_9253 | 367 |
| 123 | 3300050507 | nmdc:mga05p37_88618_c1 | nmdc:mga05p37_88618_c1_2176_3315 | 367 |
| 124 | 3300050508 | nmdc:mga09592_49665_c1 | nmdc:mga09592_49665_c1_516_1655 | 367 |
| 125 | 3300050508 | nmdc:mga09592_52794_c1 | nmdc:mga09592_52794_c1_1460_2623 | 367 |
| 126 | 3300050510 | nmdc:mga06r32_184246_c1 | nmdc:mga06r32_184246_c1_228_1367 | 367 |
| 127 | 3300050510 | nmdc:mga06r32_45638_c1 | nmdc:mga06r32_45638_c1_2997_4136 | 367 |
| 128 | 3300050511 | nmdc:mga08y16_147487_c1 | nmdc:mga08y16_147487_c1_1271_2410 | 367 |
| 129 | 3300050515 | nmdc:mga0a205_73375_c1 | nmdc:mga0a205_73375_c1_363_1502 | 367 |
| 130 | 3300006844 | Ga0075428_100050845 | Ga0075428_1000508455 | 368 |
| 131 | 3300006880 | Ga0075429_100042166 | Ga0075429_1000421663 | 368 |
| 132 | iso_pu_bacteria | 2990088156 | 2990090202 | 368 |
| 133 | 3300005329 | Ga0070683_100272743 | Ga0070683_1002727431 | 369 |
| 134 | 3300005337 | Ga0070682_100137193 | Ga0070682_1001371931 | 369 |
| 135 | 3300005338 | Ga0068868_100023719 | Ga0068868_1000237192 | 369 |
| 136 | 3300005340 | Ga0070689_100002549 | Ga0070689_1000025495 | 369 |
| 137 | 3300005343 | Ga0070687_100003797 | Ga0070687_1000037972 | 369 |
| 138 | 3300005366 | Ga0070659_100148235 | Ga0070659_1001482351 | 369 |
| 139 | 3300005438 | Ga0070701_10001046 | Ga0070701_100010464 | 369 |
| 140 | 3300005441 | Ga0070700_100256734 | Ga0070700_1002567341 | 369 |
| 141 | 3300005459 | Ga0068867_100028571 | Ga0068867_1000285711 | 369 |
| 142 | 3300005466 | Ga0070685_10092530 | Ga0070685_100925302 | 369 |
| 143 | 3300005543 | Ga0070672_100093193 | Ga0070672_1000931932 | 369 |
| 144 | 3300005544 | Ga0070686_100016963 | Ga0070686_1000169631 | 369 |
| 145 | 3300005549 | Ga0070704_100341524 | Ga0070704_1003415241 | 369 |
| 146 | 3300005615 | Ga0070702_100002299 | Ga0070702_1000022993 | 369 |
| 147 | 3300005615 | Ga0070702_100057912 | Ga0070702_1000579122 | 369 |
| 148 | 3300005616 | Ga0068852_100039260 | Ga0068852_1000392602 | 369 |
| 149 | 3300005617 | Ga0068859_100011958 | Ga0068859_1000119585 | 369 |
| 150 | 3300005618 | Ga0068864_100046531 | Ga0068864_1000465312 | 369 |
| 151 | 3300005718 | Ga0068866_10019605 | Ga0068866_100196052 | 369 |
| 152 | 3300005842 | Ga0068858_100023083 | Ga0068858_1000230832 | 369 |
| 153 | 3300005981 | Ga0081538_10002331 | Ga0081538_100023317 | 369 |
| 154 | 3300006931 | Ga0097620_100011958 | Ga0097620_1000119585 | 369 |
| 155 | 3300009094 | Ga0111539_10078138 | Ga0111539_100781383 | 369 |
| 156 | 3300009094 | Ga0111539_10225445 | Ga0111539_102254451 | 369 |
| 157 | 3300009098 | Ga0105245_10019082 | Ga0105245_100190824 | 369 |
| 158 | 3300009098 | Ga0105245_10097990 | Ga0105245_100979903 | 369 |
| 159 | 3300009101 | Ga0105247_10030105 | Ga0105247_100301053 | 369 |
| 160 | 3300009148 | Ga0105243_10006161 | Ga0105243_100061613 | 369 |
| 161 | 3300009176 | Ga0105242_10115546 | Ga0105242_101155462 | 369 |
| 162 | 3300009177 | Ga0105248_10117043 | Ga0105248_101170431 | 369 |
| 163 | 3300009553 | Ga0105249_10022576 | Ga0105249_100225762 | 369 |
| 164 | 3300009553 | Ga0105249_10037491 | Ga0105249_100374913 | 369 |
| 165 | 3300009553 | Ga0105249_10157992 | Ga0105249_101579922 | 369 |
| 166 | 3300010375 | Ga0105239_10068804 | Ga0105239_100688041 | 369 |
| 167 | 3300013308 | Ga0157375_10032173 | Ga0157375_100321732 | 369 |
| 168 | 3300013308 | Ga0157375_10172837 | Ga0157375_101728372 | 369 |
| 169 | 3300014326 | Ga0157380_10045592 | Ga0157380_100455922 | 369 |
| 170 | 3300021384 | Ga0213876_10040035 | Ga0213876_100400353 | 369 |
| 171 | 3300025899 | Ga0207642_10021185 | Ga0207642_100211852 | 369 |
| 172 | 3300025901 | Ga0207688_10045783 | Ga0207688_100457832 | 369 |
| 173 | 3300025914 | Ga0207671_10177077 | Ga0207671_101770771 | 369 |
| 174 | 3300025918 | Ga0207662_10006040 | Ga0207662_100060402 | 369 |
| 175 | 3300025919 | Ga0207657_10163011 | Ga0207657_101630112 | 369 |
| 176 | 3300025927 | Ga0207687_10190224 | Ga0207687_101902242 | 369 |
| 177 | 3300025932 | Ga0207690_10106763 | Ga0207690_101067632 | 369 |
| 178 | 3300025935 | Ga0207709_10026813 | Ga0207709_100268131 | 369 |
| 179 | 3300025935 | Ga0207709_10145516 | Ga0207709_101455162 | 369 |
| 180 | 3300025936 | Ga0207670_10014123 | Ga0207670_100141234 | 369 |
| 181 | 3300026023 | Ga0207677_10007594 | Ga0207677_100075942 | 369 |
| 182 | 3300026035 | Ga0207703_10006779 | Ga0207703_100067794 | 369 |
| 183 | 3300026089 | Ga0207648_10142287 | Ga0207648_101422871 | 369 |
| 184 | 3300026095 | Ga0207676_10274765 | Ga0207676_102747652 | 369 |
| 185 | 3300026121 | Ga0207683_10339943 | Ga0207683_103399432 | 369 |
| 186 | 3300026142 | Ga0207698_10163513 | Ga0207698_101635131 | 369 |
| 187 | 3300027907 | Ga0207428_10176378 | Ga0207428_101763782 | 369 |
| 188 | 3300028381 | Ga0268264_10111841 | Ga0268264_101118412 | 369 |
| 189 | 3300039437 | Ga0436365_1670297 | Ga0436365_1670297_2711_3838 | 369 |
| 190 | 3300044901 | Ga0466960_0097851 | Ga0466960_0097851_139_1266 | 369 |
| 191 | 3300045976 | Ga0466967_0026297 | Ga0466967_0026297_3597_4724 | 369 |
| 192 | 3300048904 | Ga0496101_0050514 | Ga0496101_0050514_19_1146 | 369 |
| 193 | 3300048905 | Ga0496102_0398304 | Ga0496102_0398304_34_1161 | 369 |
| 194 | 3300048907 | Ga0496104_0137267 | Ga0496104_0137267_1207_2334 | 369 |
| 195 | 3300048908 | Ga0496105_0188736 | Ga0496105_0188736_310_1437 | 369 |
| 196 | 3300048909 | Ga0496106_0003244 | Ga0496106_0003244_5600_6727 | 369 |
| 197 | 3300048909 | Ga0496106_0086571 | Ga0496106_0086571_285_1412 | 369 |
| 198 | 3300048910 | Ga0496107_0001966 | Ga0496107_0001966_7202_8329 | 369 |
| 199 | 3300048911 | Ga0496108_0001455 | Ga0496108_0001455_16990_18117 | 369 |
| 200 | 3300048912 | Ga0496109_0154853 | Ga0496109_0154853_243_1370 | 369 |
| 201 | 3300048912 | Ga0496109_0290843 | Ga0496109_0290843_344_1471 | 369 |
| 202 | 3300048913 | Ga0496110_0008677 | Ga0496110_0008677_395_1522 | 369 |
| 203 | 3300048913 | Ga0496110_0226221 | Ga0496110_0226221_113_1240 | 369 |
| 204 | 3300048914 | Ga0496111_0081711 | Ga0496111_0081711_1165_2292 | 369 |
| 205 | 3300048914 | Ga0496111_0214125 | Ga0496111_0214125_85_1212 | 369 |
| 206 | 3300048915 | Ga0496112_0116968 | Ga0496112_0116968_141_1268 | 369 |
| 207 | 3300048916 | Ga0496113_0027105 | Ga0496113_0027105_1884_3011 | 369 |
| 208 | 3300048916 | Ga0496113_0209825 | Ga0496113_0209825_185_1312 | 369 |
| 209 | 3300049580 | Ga0501046_0079592 | Ga0501046_0079592_1047_2165 | 369 |
| 210 | 3300049592 | Ga0501076_0000486 | Ga0501076_0000486_6243_7361 | 369 |
| 211 | 3300049741 | Ga0501079_0037082 | Ga0501079_0037082_904_2022 | 369 |
| 212 | 3300049743 | Ga0501081_0011103 | Ga0501081_0011103_3860_4978 | 369 |
| 213 | 3300050511 | nmdc:mga08y16_115302_c1 | nmdc:mga08y16_115302_c1_859_1986 | 369 |
| 214 | 3300061734 | Ga0530510_0022724 | Ga0530510_0022724_2206_3324 | 369 |
| 215 | 3300005434 | Ga0070709_10065148 | Ga0070709_100651482 | 370 |
| 216 | 3300005844 | Ga0068862_100225575 | Ga0068862_1002255752 | 370 |
| 217 | 3300025885 | Ga0207653_10022210 | Ga0207653_100222102 | 370 |
| 218 | 3300025906 | Ga0207699_10043999 | Ga0207699_100439993 | 370 |
| 219 | 3300025906 | Ga0207699_10096867 | Ga0207699_100968672 | 370 |
| 220 | 3300025915 | Ga0207693_10131577 | Ga0207693_101315772 | 370 |
| 221 | 3300025928 | Ga0207700_10134500 | Ga0207700_101345002 | 370 |
| 222 | 3300025929 | Ga0207664_10110234 | Ga0207664_101102342 | 370 |
| 223 | 3300026078 | Ga0207702_10081848 | Ga0207702_100818482 | 370 |
| 224 | 3300026118 | Ga0207675_100011869 | Ga0207675_1000118692 | 370 |
| 225 | 3300034820 | Ga0373959_0023875 | Ga0373959_0023875_67_1182 | 370 |
| 226 | 3300035083 | Ga0373926_0008055 | Ga0373926_0008055_1914_3074 | 370 |
| 227 | 3300035083 | Ga0373926_0015763 | Ga0373926_0015763_1116_2288 | 370 |
| 228 | 3300035111 | Ga0373923_0005254 | Ga0373923_0005254_767_1939 | 370 |
| 229 | 3300035116 | Ga0373945_0000070 | Ga0373945_0000070_10029_11189 | 370 |
| 230 | 3300035119 | Ga0373956_0009708 | Ga0373956_0009708_977_2149 | 370 |
| 231 | 3300035170 | Ga0373943_0000087 | Ga0373943_0000087_21407_22567 | 370 |
| 232 | 3300035170 | Ga0373943_0015586 | Ga0373943_0015586_1202_2374 | 370 |
| 233 | 3300035171 | Ga0373946_0000186 | Ga0373946_0000186_7950_9110 | 370 |
| 234 | 3300035171 | Ga0373946_0001168 | Ga0373946_0001168_3052_4224 | 370 |
| 235 | 3300035172 | Ga0373955_0003588 | Ga0373955_0003588_3051_4223 | 370 |
| 236 | 3300035692 | Ga0373935_0000270 | Ga0373935_0000270_8669_9829 | 370 |
| 237 | 3300035695 | Ga0373927_0002157 | Ga0373927_0002157_11105_12265 | 370 |
| 238 | 3300035725 | Ga0373947_0003066 | Ga0373947_0003066_3543_4703 | 370 |
| 239 | 3300035725 | Ga0373947_0014593 | Ga0373947_0014593_868_2040 | 370 |
| 240 | 3300037068 | Ga0373925_0002000 | Ga0373925_0002000_104_1264 | 370 |
| 241 | 3300037068 | Ga0373925_0065677 | Ga0373925_0065677_372_1544 | 370 |
| 242 | 3300039062 | Ga0400483_266747 | Ga0400483_266747_118_1236 | 370 |
| 243 | 3300041512 | Ga0451853_0689240 | Ga0451853_0689240_805_1965 | 370 |
| 244 | 3300045976 | Ga0466967_0247447 | Ga0466967_0247447_131_1261 | 370 |
| 245 | 3300046454 | Ga0495592_0056767 | Ga0495592_0056767_872_2044 | 370 |
| 246 | 3300046455 | Ga0495603_0010187 | Ga0495603_0010187_2616_3788 | 370 |
| 247 | 3300046459 | Ga0495629_0054470 | Ga0495629_0054470_586_1758 | 370 |
| 248 | 3300046462 | Ga0495651_0074424 | Ga0495651_0074424_1193_2353 | 370 |
| 249 | 3300046463 | Ga0495653_0000347 | Ga0495653_0000347_19422_20582 | 370 |
| 250 | 3300046463 | Ga0495653_0079924 | Ga0495653_0079924_199_1359 | 370 |
| 251 | 3300046472 | Ga0495580_0008722 | Ga0495580_0008722_5877_7049 | 370 |
| 252 | 3300046473 | Ga0495582_0002355 | Ga0495582_0002355_7966_9138 | 370 |
| 253 | 3300046473 | Ga0495582_0095384 | Ga0495582_0095384_115_1275 | 370 |
| 254 | 3300046475 | Ga0495639_0000749 | Ga0495639_0000749_9922_11094 | 370 |
| 255 | 3300046477 | Ga0495664_0000408 | Ga0495664_0000408_14775_15935 | 370 |
| 256 | 3300046499 | Ga0495594_0007204 | Ga0495594_0007204_4436_5608 | 370 |
| 257 | 3300046514 | Ga0495618_0019598 | Ga0495618_0019598_1748_2920 | 370 |
| 258 | 3300046514 | Ga0495618_0049994 | Ga0495618_0049994_231_1391 | 370 |
| 259 | 3300046516 | Ga0495628_0078052 | Ga0495628_0078052_69_1229 | 370 |
| 260 | 3300046517 | Ga0495630_0009036 | Ga0495630_0009036_2532_3704 | 370 |
| 261 | 3300046517 | Ga0495630_0022767 | Ga0495630_0022767_3114_4274 | 370 |
| 262 | 3300046526 | Ga0495666_0004171 | Ga0495666_0004171_856_2028 | 370 |
| 263 | 3300046529 | Ga0495652_0043556 | Ga0495652_0043556_588_1748 | 370 |
| 264 | 3300046529 | Ga0495652_0096174 | Ga0495652_0096174_1044_2204 | 370 |
| 265 | 3300046531 | Ga0495665_0013826 | Ga0495665_0013826_3007_4167 | 370 |
| 266 | 3300046531 | Ga0495665_0021712 | Ga0495665_0021712_1405_2577 | 370 |
| 267 | 3300046533 | Ga0495640_0040636 | Ga0495640_0040636_1214_2386 | 370 |
| 268 | 3300046535 | Ga0495586_0007549 | Ga0495586_0007549_3369_4541 | 370 |
| 269 | 3300046536 | Ga0495587_0030463 | Ga0495587_0030463_539_1711 | 370 |
| 270 | 3300046543 | Ga0495645_0027708 | Ga0495645_0027708_1912_3084 | 370 |
| 271 | 3300046559 | Ga0495667_0038592 | Ga0495667_0038592_1463_2635 | 370 |
| 272 | 3300046559 | Ga0495667_0066494 | Ga0495667_0066494_521_1681 | 370 |
| 273 | 3300046642 | Ga0495634_0027057 | Ga0495634_0027057_1494_2666 | 370 |
| 274 | 3300046663 | Ga0495635_0003702 | Ga0495635_0003702_7454_8614 | 370 |
| 275 | 3300046663 | Ga0495635_0019395 | Ga0495635_0019395_39_1199 | 370 |
| 276 | 3300046674 | Ga0495588_0011421 | Ga0495588_0011421_926_2098 | 370 |
| 277 | 3300046675 | Ga0495657_0073456 | Ga0495657_0073456_475_1635 | 370 |
| 278 | 3300046678 | Ga0495599_0026497 | Ga0495599_0026497_901_2073 | 370 |
| 279 | 3300046679 | Ga0495623_0014444 | Ga0495623_0014444_1136_2308 | 370 |
| 280 | 3300046680 | Ga0495646_0046981 | Ga0495646_0046981_1214_2386 | 370 |
| 281 | 3300046683 | Ga0495658_0027295 | Ga0495658_0027295_495_1667 | 370 |
| 282 | 3300046689 | Ga0495613_0011279 | Ga0495613_0011279_1341_2513 | 370 |
| 283 | 3300046690 | Ga0495624_0003374 | Ga0495624_0003374_1695_2855 | 370 |
| 284 | 3300046690 | Ga0495624_0014171 | Ga0495624_0014171_328_1500 | 370 |
| 285 | 3300046809 | Ga0495600_0023375 | Ga0495600_0023375_1561_2733 | 370 |
| 286 | 3300046809 | Ga0495600_0204443 | Ga0495600_0204443_15_1175 | 370 |
| 287 | 3300047315 | Ga0495581_0003281 | Ga0495581_0003281_3987_5159 | 370 |
| 288 | 3300047317 | Ga0495604_0025245 | Ga0495604_0025245_2321_3493 | 370 |
| 289 | 3300047321 | Ga0495676_0000213 | Ga0495676_0000213_9018_10178 | 370 |
| 290 | 3300047321 | Ga0495676_0011576 | Ga0495676_0011576_5325_6497 | 370 |
| 291 | 3300047322 | Ga0495680_0003820 | Ga0495680_0003820_9002_10162 | 370 |
| 292 | 3300047322 | Ga0495680_0023632 | Ga0495680_0023632_1829_2989 | 370 |
| 293 | 3300047322 | Ga0495680_0024929 | Ga0495680_0024929_2377_3549 | 370 |
| 294 | 3300047471 | Ga0495684_0001287 | Ga0495684_0001287_18969_20129 | 370 |
| 295 | 3300047471 | Ga0495684_0044512 | Ga0495684_0044512_1226_2386 | 370 |
| 296 | 3300047673 | Ga0495593_0024105 | Ga0495593_0024105_244_1416 | 370 |
| 297 | 3300048088 | Ga0495602_0069239 | Ga0495602_0069239_752_1912 | 370 |
| 298 | 3300053084 | Ga0495595_0019099 | Ga0495595_0019099_78_1238 | 370 |
| 299 | 3300053084 | Ga0495595_0028611 | Ga0495595_0028611_1011_2183 | 370 |
| 300 | 3300053085 | Ga0495619_0001832 | Ga0495619_0001832_4632_5804 | 370 |
| 301 | 3300005295 | Ga0065707_10011490 | Ga0065707_100114902 | 371 |
| 302 | 3300005295 | Ga0065707_10117557 | Ga0065707_101175572 | 371 |
| 303 | 3300005467 | Ga0070706_100016382 | Ga0070706_1000163822 | 371 |
| 304 | 3300005467 | Ga0070706_100116252 | Ga0070706_1001162522 | 371 |
| 305 | 3300005471 | Ga0070698_100070742 | Ga0070698_1000707423 | 371 |
| 306 | 3300005518 | Ga0070699_100007625 | Ga0070699_1000076251 | 371 |
| 307 | 3300005536 | Ga0070697_100006825 | Ga0070697_1000068255 | 371 |
| 308 | 3300006038 | Ga0075365_10000277 | Ga0075365_100002774 | 371 |
| 309 | 3300006844 | Ga0075428_100139221 | Ga0075428_1001392213 | 371 |
| 310 | 3300006852 | Ga0075433_10021970 | Ga0075433_100219702 | 371 |
| 311 | 3300006852 | Ga0075433_10029368 | Ga0075433_100293683 | 371 |
| 312 | 3300006871 | Ga0075434_100052150 | Ga0075434_1000521502 | 371 |
| 313 | 3300006871 | Ga0075434_100067074 | Ga0075434_1000670742 | 371 |
| 314 | 3300006871 | Ga0075434_100303287 | Ga0075434_1003032872 | 371 |
| 315 | 3300006880 | Ga0075429_100104516 | Ga0075429_1001045162 | 371 |
| 316 | 3300007076 | Ga0075435_100019257 | Ga0075435_1000192572 | 371 |
| 317 | 3300007265 | Ga0099794_10018357 | Ga0099794_100183572 | 371 |
| 318 | 3300009094 | Ga0111539_10051364 | Ga0111539_100513645 | 371 |
| 319 | 3300009147 | Ga0114129_10015551 | Ga0114129_100155516 | 371 |
| 320 | 3300010159 | Ga0099796_10018590 | Ga0099796_100185902 | 371 |
| 321 | 3300014326 | Ga0157380_10035984 | Ga0157380_100359843 | 371 |
| 322 | 3300025910 | Ga0207684_10013282 | Ga0207684_100132822 | 371 |
| 323 | 3300025910 | Ga0207684_10117729 | Ga0207684_101177293 | 371 |
| 324 | 3300027907 | Ga0207428_10034266 | Ga0207428_100342662 | 371 |
| 325 | 3300027907 | Ga0207428_10046063 | Ga0207428_100460633 | 371 |
| 326 | 3300035084 | Ga0373928_0000388 | Ga0373928_0000388_3494_4636 | 371 |
| 327 | 3300035085 | Ga0373929_0006391 | Ga0373929_0006391_727_1869 | 371 |
| 328 | 3300035691 | Ga0373931_0000001 | Ga0373931_0000001_544741_545883 | 371 |
| 329 | 3300035691 | Ga0373931_0000038 | Ga0373931_0000038_59551_60693 | 371 |
| 330 | 3300035695 | Ga0373927_0050211 | Ga0373927_0050211_469_1683 | 371 |
| 331 | 3300037853 | Ga0436364_1096538 | Ga0436364_1096538_1148_2335 | 371 |
| 332 | 3300039062 | Ga0400483_286861 | Ga0400483_286861_1566_2687 | 371 |
| 333 | 3300046514 | Ga0495618_0142552 | Ga0495618_0142552_57_1223 | 371 |
| 334 | 3300046543 | Ga0495645_0105856 | Ga0495645_0105856_351_1517 | 371 |
| 335 | 3300046559 | Ga0495667_0055381 | Ga0495667_0055381_213_1379 | 371 |
| 336 | 3300046663 | Ga0495635_0133766 | Ga0495635_0133766_34_1200 | 371 |
| 337 | 3300046675 | Ga0495657_0131624 | Ga0495657_0131624_170_1336 | 371 |
| 338 | 3300047318 | Ga0495636_0016336 | Ga0495636_0016336_1560_2678 | 371 |
| 339 | 3300049578 | Ga0501042_0077176 | Ga0501042_0077176_1053_2189 | 371 |
| 340 | 3300049824 | Ga0501045_0046010 | Ga0501045_0046010_189_1325 | 371 |
| 341 | 3300050492 | nmdc:mga0yw44_112_c1 | nmdc:mga0yw44_112_c1_7415_8557 | 371 |
| 342 | 3300050507 | nmdc:mga05p37_220724_c1 | nmdc:mga05p37_220724_c1_903_2039 | 371 |
| 343 | 3300050507 | nmdc:mga05p37_350383_c1 | nmdc:mga05p37_350383_c1_552_1688 | 371 |
| 344 | 3300050508 | nmdc:mga09592_5379_c1 | nmdc:mga09592_5379_c1_4854_6050 | 371 |
| 345 | 3300050511 | nmdc:mga08y16_27870_c1 | nmdc:mga08y16_27870_c1_1053_2249 | 371 |
| 346 | 3300050511 | nmdc:mga08y16_64038_c1 | nmdc:mga08y16_64038_c1_2112_3248 | 371 |
| 347 | 3300050513 | nmdc:mga0rr50_22223_c1 | nmdc:mga0rr50_22223_c1_3080_4216 | 371 |
| 348 | 3300050515 | nmdc:mga0a205_118100_c1 | nmdc:mga0a205_118100_c1_507_1703 | 371 |
| 349 | 3300053119 | Ga0500595_026204 | Ga0500595_026204_108_1247 | 371 |
| 350 | 3300053153 | Ga0500616_0000856 | Ga0500616_0000856_7444_8607 | 371 |
| 351 | 3300061734 | Ga0530510_0000079 | Ga0530510_0000079_8869_10005 | 371 |
| 352 | 3300061734 | Ga0530510_0042960 | Ga0530510_0042960_1825_2961 | 371 |
| 353 | 3300005336 | Ga0070680_100090001 | Ga0070680_1000900012 | 372 |
| 354 | 3300005339 | Ga0070660_100069740 | Ga0070660_1000697402 | 372 |
| 355 | 3300005345 | Ga0070692_10025198 | Ga0070692_100251983 | 372 |
| 356 | 3300005347 | Ga0070668_100080017 | Ga0070668_1000800172 | 372 |
| 357 | 3300005436 | Ga0070713_100107619 | Ga0070713_1001076192 | 372 |
| 358 | 3300005445 | Ga0070708_100066600 | Ga0070708_1000666002 | 372 |
| 359 | 3300005445 | Ga0070708_100118153 | Ga0070708_1001181532 | 372 |
| 360 | 3300005445 | Ga0070708_100134142 | Ga0070708_1001341422 | 372 |
| 361 | 3300005445 | Ga0070708_100326435 | Ga0070708_1003264351 | 372 |
| 362 | 3300005455 | Ga0070663_100026339 | Ga0070663_1000263392 | 372 |
| 363 | 3300005467 | Ga0070706_100007777 | Ga0070706_10000777711 | 372 |
| 364 | 3300005467 | Ga0070706_100102260 | Ga0070706_1001022602 | 372 |
| 365 | 3300005467 | Ga0070706_100167321 | Ga0070706_1001673212 | 372 |
| 366 | 3300005467 | Ga0070706_100313078 | Ga0070706_1003130782 | 372 |
| 367 | 3300005468 | Ga0070707_100023686 | Ga0070707_1000236863 | 372 |
| 368 | 3300005468 | Ga0070707_100024323 | Ga0070707_1000243235 | 372 |
| 369 | 3300005471 | Ga0070698_100115579 | Ga0070698_1001155792 | 372 |
| 370 | 3300005471 | Ga0070698_100173455 | Ga0070698_1001734552 | 372 |
| 371 | 3300005518 | Ga0070699_100101785 | Ga0070699_1001017852 | 372 |
| 372 | 3300005530 | Ga0070679_100217002 | Ga0070679_1002170022 | 372 |
| 373 | 3300005536 | Ga0070697_100021341 | Ga0070697_1000213416 | 372 |
| 374 | 3300005546 | Ga0070696_100027041 | Ga0070696_1000270414 | 372 |
| 375 | 3300005548 | Ga0070665_100082394 | Ga0070665_1000823943 | 372 |
| 376 | 3300005549 | Ga0070704_100029435 | Ga0070704_1000294352 | 372 |
| 377 | 3300005615 | Ga0070702_100082236 | Ga0070702_1000822361 | 372 |
| 378 | 3300005617 | Ga0068859_100065503 | Ga0068859_1000655034 | 372 |
| 379 | 3300005617 | Ga0068859_100083668 | Ga0068859_1000836684 | 372 |
| 380 | 3300005617 | Ga0068859_100406562 | Ga0068859_1004065622 | 372 |
| 381 | 3300005617 | Ga0068859_100480495 | Ga0068859_1004804951 | 372 |
| 382 | 3300005718 | Ga0068866_10148749 | Ga0068866_101487491 | 372 |
| 383 | 3300005842 | Ga0068858_100243051 | Ga0068858_1002430512 | 372 |
| 384 | 3300005843 | Ga0068860_100344067 | Ga0068860_1003440672 | 372 |
| 385 | 3300005844 | Ga0068862_100029396 | Ga0068862_1000293963 | 372 |
| 386 | 3300005844 | Ga0068862_100031243 | Ga0068862_1000312432 | 372 |
| 387 | 3300005844 | Ga0068862_100058122 | Ga0068862_1000581224 | 372 |
| 388 | 3300005981 | Ga0081538_10008822 | Ga0081538_100088226 | 372 |
| 389 | 3300005981 | Ga0081538_10009571 | Ga0081538_100095714 | 372 |
| 390 | 3300005983 | Ga0081540_1000027 | Ga0081540_1000027122 | 372 |
| 391 | 3300006058 | Ga0075432_10054592 | Ga0075432_100545921 | 372 |
| 392 | 3300006844 | Ga0075428_100037393 | Ga0075428_1000373934 | 372 |
| 393 | 3300006844 | Ga0075428_100038810 | Ga0075428_1000388102 | 372 |
| 394 | 3300006844 | Ga0075428_100056716 | Ga0075428_1000567164 | 372 |
| 395 | 3300006846 | Ga0075430_100001115 | Ga0075430_1000011153 | 372 |
| 396 | 3300006847 | Ga0075431_100001427 | Ga0075431_10000142718 | 372 |
| 397 | 3300006847 | Ga0075431_100012050 | Ga0075431_1000120505 | 372 |
| 398 | 3300006852 | Ga0075433_10003975 | Ga0075433_100039755 | 372 |
| 399 | 3300006852 | Ga0075433_10078201 | Ga0075433_100782012 | 372 |
| 400 | 3300006852 | Ga0075433_10079461 | Ga0075433_100794613 | 372 |
| 401 | 3300006871 | Ga0075434_100022950 | Ga0075434_1000229502 | 372 |
| 402 | 3300006871 | Ga0075434_100034862 | Ga0075434_1000348622 | 372 |
| 403 | 3300006871 | Ga0075434_100047260 | Ga0075434_1000472602 | 372 |
| 404 | 3300006871 | Ga0075434_100158582 | Ga0075434_1001585823 | 372 |
| 405 | 3300006880 | Ga0075429_100008882 | Ga0075429_1000088822 | 372 |
| 406 | 3300006880 | Ga0075429_100022165 | Ga0075429_1000221653 | 372 |
| 407 | 3300006914 | Ga0075436_100017898 | Ga0075436_1000178985 | 372 |
| 408 | 3300006931 | Ga0097620_100065502 | Ga0097620_1000655024 | 372 |
| 409 | 3300006931 | Ga0097620_100083665 | Ga0097620_1000836652 | 372 |
| 410 | 3300006931 | Ga0097620_100406597 | Ga0097620_1004065972 | 372 |
| 411 | 3300006931 | Ga0097620_100480523 | Ga0097620_1004805231 | 372 |
| 412 | 3300007076 | Ga0075435_100005780 | Ga0075435_1000057806 | 372 |
| 413 | 3300007076 | Ga0075435_100011847 | Ga0075435_1000118476 | 372 |
| 414 | 3300007076 | Ga0075435_100032924 | Ga0075435_1000329242 | 372 |
| 415 | 3300007076 | Ga0075435_100038327 | Ga0075435_1000383274 | 372 |
| 416 | 3300007076 | Ga0075435_100154789 | Ga0075435_1001547892 | 372 |
| 417 | 3300009094 | Ga0111539_10012036 | Ga0111539_100120369 | 372 |
| 418 | 3300009094 | Ga0111539_10056895 | Ga0111539_100568953 | 372 |
| 419 | 3300009098 | Ga0105245_10199494 | Ga0105245_101994942 | 372 |
| 420 | 3300009101 | Ga0105247_10021235 | Ga0105247_100212352 | 372 |
| 421 | 3300009147 | Ga0114129_10003520 | Ga0114129_1000352010 | 372 |
| 422 | 3300009147 | Ga0114129_10006595 | Ga0114129_100065956 | 372 |
| 423 | 3300009147 | Ga0114129_10163315 | Ga0114129_101633152 | 372 |
| 424 | 3300009147 | Ga0114129_10660947 | Ga0114129_106609472 | 372 |
| 425 | 3300009177 | Ga0105248_10140793 | Ga0105248_101407933 | 372 |
| 426 | 3300009177 | Ga0105248_10170786 | Ga0105248_101707864 | 372 |
| 427 | 3300009545 | Ga0105237_10081636 | Ga0105237_100816361 | 372 |
| 428 | 3300009553 | Ga0105249_10056486 | Ga0105249_100564862 | 372 |
| 429 | 3300009553 | Ga0105249_10177569 | Ga0105249_101775692 | 372 |
| 430 | 3300013102 | Ga0157371_10177034 | Ga0157371_101770341 | 372 |
| 431 | 3300013296 | Ga0157374_10303963 | Ga0157374_103039631 | 372 |
| 432 | 3300013297 | Ga0157378_10520481 | Ga0157378_105204811 | 372 |
| 433 | 3300013306 | Ga0163162_10020095 | Ga0163162_100200955 | 372 |
| 434 | 3300013306 | Ga0163162_10159984 | Ga0163162_101599842 | 372 |
| 435 | 3300013306 | Ga0163162_10534287 | Ga0163162_105342871 | 372 |
| 436 | 3300013308 | Ga0157375_10325398 | Ga0157375_103253982 | 372 |
| 437 | 3300024225 | Ga0224572_1005549 | Ga0224572_10055492 | 372 |
| 438 | 3300025901 | Ga0207688_10021184 | Ga0207688_100211841 | 372 |
| 439 | 3300025908 | Ga0207643_10004374 | Ga0207643_100043742 | 372 |
| 440 | 3300025910 | Ga0207684_10013816 | Ga0207684_100138166 | 372 |
| 441 | 3300025910 | Ga0207684_10026292 | Ga0207684_100262922 | 372 |
| 442 | 3300025910 | Ga0207684_10030715 | Ga0207684_100307156 | 372 |
| 443 | 3300025910 | Ga0207684_10064503 | Ga0207684_100645034 | 372 |
| 444 | 3300025917 | Ga0207660_10035783 | Ga0207660_100357831 | 372 |
| 445 | 3300025918 | Ga0207662_10018084 | Ga0207662_100180843 | 372 |
| 446 | 3300025919 | Ga0207657_10076357 | Ga0207657_100763573 | 372 |
| 447 | 3300025921 | Ga0207652_10154643 | Ga0207652_101546432 | 372 |
| 448 | 3300025922 | Ga0207646_10019819 | Ga0207646_100198191 | 372 |
| 449 | 3300025922 | Ga0207646_10123364 | Ga0207646_101233642 | 372 |
| 450 | 3300025926 | Ga0207659_10098493 | Ga0207659_100984932 | 372 |
| 451 | 3300025927 | Ga0207687_10062146 | Ga0207687_100621462 | 372 |
| 452 | 3300025933 | Ga0207706_10187882 | Ga0207706_101878822 | 372 |
| 453 | 3300025940 | Ga0207691_10076248 | Ga0207691_100762482 | 372 |
| 454 | 3300025940 | Ga0207691_10079660 | Ga0207691_100796602 | 372 |
| 455 | 3300025981 | Ga0207640_10089116 | Ga0207640_100891162 | 372 |
| 456 | 3300026067 | Ga0207678_10127482 | Ga0207678_101274823 | 372 |
| 457 | 3300026089 | Ga0207648_10040563 | Ga0207648_100405632 | 372 |
| 458 | 3300026089 | Ga0207648_10076413 | Ga0207648_100764132 | 372 |
| 459 | 3300026116 | Ga0207674_10148097 | Ga0207674_101480972 | 372 |
| 460 | 3300026116 | Ga0207674_10204447 | Ga0207674_102044472 | 372 |
| 461 | 3300026118 | Ga0207675_100026881 | Ga0207675_1000268814 | 372 |
| 462 | 3300026118 | Ga0207675_100048901 | Ga0207675_1000489012 | 372 |
| 463 | 3300026118 | Ga0207675_100115555 | Ga0207675_1001155552 | 372 |
| 464 | 3300026121 | Ga0207683_10022343 | Ga0207683_100223433 | 372 |
| 465 | 3300026142 | Ga0207698_10212310 | Ga0207698_102123101 | 372 |
| 466 | 3300027907 | Ga0207428_10005490 | Ga0207428_1000549010 | 372 |
| 467 | 3300028379 | Ga0268266_10158452 | Ga0268266_101584522 | 372 |
| 468 | 3300028380 | Ga0268265_10031164 | Ga0268265_100311642 | 372 |
| 469 | 3300028380 | Ga0268265_10037736 | Ga0268265_100377363 | 372 |
| 470 | 3300028381 | Ga0268264_10099355 | Ga0268264_100993552 | 372 |
| 471 | 3300031901 | Ga0307406_10030661 | Ga0307406_100306612 | 372 |
| 472 | 3300031911 | Ga0307412_10321830 | Ga0307412_103218301 | 372 |
| 473 | 3300035691 | Ga0373931_0014145 | Ga0373931_0014145_2448_3587 | 372 |
| 474 | 3300035724 | Ga0373933_0050558 | Ga0373933_0050558_631_1782 | 372 |
| 475 | 3300038996 | Ga0242420_001892 | Ga0242420_001892_785_1921 | 372 |
| 476 | 3300042876 | Ga0451577_0003484 | Ga0451577_0003484_1612_2748 | 372 |
| 477 | 3300044712 | Ga0453684_0077520 | Ga0453684_0077520_1643_2779 | 372 |
| 478 | 3300045051 | Ga0451576_0025862 | Ga0451576_0025862_659_1795 | 372 |
| 479 | 3300046615 | Ga0495656_0015156 | Ga0495656_0015156_1336_2475 | 372 |
| 480 | 3300046684 | Ga0495669_0011629 | Ga0495669_0011629_2008_3147 | 372 |
| 481 | 3300048905 | Ga0496102_0135989 | Ga0496102_0135989_948_2087 | 372 |
| 482 | 3300048911 | Ga0496108_0185184 | Ga0496108_0185184_363_1517 | 372 |
| 483 | 3300048913 | Ga0496110_0053833 | Ga0496110_0053833_2116_3270 | 372 |
| 484 | 3300048917 | Ga0496114_0112126 | Ga0496114_0112126_753_1907 | 372 |
| 485 | 3300050507 | nmdc:mga05p37_100096_c1 | nmdc:mga05p37_100096_c1_61_1200 | 372 |
| 486 | 3300050507 | nmdc:mga05p37_1851_c1 | nmdc:mga05p37_1851_c1_5805_6947 | 372 |
| 487 | 3300050507 | nmdc:mga05p37_20592_c1 | nmdc:mga05p37_20592_c1_2329_3468 | 372 |
| 488 | 3300050508 | nmdc:mga09592_4532_c1 | nmdc:mga09592_4532_c1_8810_9949 | 372 |
| 489 | 3300050508 | nmdc:mga09592_53936_c1 | nmdc:mga09592_53936_c1_472_1614 | 372 |
| 490 | 3300050509 | nmdc:mga0qj67_387_c1 | nmdc:mga0qj67_387_c1_14352_15491 | 372 |
| 491 | 3300050510 | nmdc:mga06r32_56844_c1 | nmdc:mga06r32_56844_c1_2059_3201 | 372 |
| 492 | 3300050511 | nmdc:mga08y16_192317_c1 | nmdc:mga08y16_192317_c1_623_1777 | 372 |
| 493 | 3300050511 | nmdc:mga08y16_52323_c1 | nmdc:mga08y16_52323_c1_3065_4204 | 372 |
| 494 | 3300050511 | nmdc:mga08y16_794_c1 | nmdc:mga08y16_794_c1_1597_2733 | 372 |
| 495 | 3300050512 | nmdc:mga0n895_100746_c1 | nmdc:mga0n895_100746_c1_1418_2557 | 372 |
| 496 | 3300050512 | nmdc:mga0n895_16837_c1 | nmdc:mga0n895_16837_c1_5440_6576 | 372 |
| 497 | 3300050512 | nmdc:mga0n895_2920_c1 | nmdc:mga0n895_2920_c1_4015_5157 | 372 |
| 498 | 3300050512 | nmdc:mga0n895_4136_c1 | nmdc:mga0n895_4136_c1_1366_2502 | 372 |
| 499 | 3300050512 | nmdc:mga0n895_64822_c1 | nmdc:mga0n895_64822_c1_89_1228 | 372 |
| 500 | 3300050513 | nmdc:mga0rr50_1886_c1 | nmdc:mga0rr50_1886_c1_9388_10530 | 372 |
| 501 | 3300050513 | nmdc:mga0rr50_19263_c1 | nmdc:mga0rr50_19263_c1_1558_2694 | 372 |
| 502 | 3300050513 | nmdc:mga0rr50_37693_c1 | nmdc:mga0rr50_37693_c1_2099_3235 | 372 |
| 503 | 3300050514 | nmdc:mga08x19_638_c1 | nmdc:mga08x19_638_c1_15582_16724 | 372 |
| 504 | 3300050515 | nmdc:mga0a205_4196_c1 | nmdc:mga0a205_4196_c1_3387_4529 | 372 |
| 505 | 3300050515 | nmdc:mga0a205_51911_c1 | nmdc:mga0a205_51911_c1_1742_2878 | 372 |
| 506 | 3300005329 | Ga0070683_100037823 | Ga0070683_1000378234 | 373 |
| 507 | 3300005334 | Ga0068869_100192207 | Ga0068869_1001922072 | 373 |
| 508 | 3300005336 | Ga0070680_100034557 | Ga0070680_1000345572 | 373 |
| 509 | 3300005339 | Ga0070660_100034853 | Ga0070660_1000348532 | 373 |
| 510 | 3300005344 | Ga0070661_100023233 | Ga0070661_1000232334 | 373 |
| 511 | 3300005364 | Ga0070673_100068359 | Ga0070673_1000683593 | 373 |
| 512 | 3300005440 | Ga0070705_100007132 | Ga0070705_1000071322 | 373 |
| 513 | 3300005455 | Ga0070663_100007013 | Ga0070663_1000070134 | 373 |
| 514 | 3300005456 | Ga0070678_100032209 | Ga0070678_1000322091 | 373 |
| 515 | 3300005535 | Ga0070684_100233262 | Ga0070684_1002332621 | 373 |
| 516 | 3300005543 | Ga0070672_100217024 | Ga0070672_1002170242 | 373 |
| 517 | 3300005545 | Ga0070695_100025562 | Ga0070695_1000255622 | 373 |
| 518 | 3300005546 | Ga0070696_100088395 | Ga0070696_1000883952 | 373 |
| 519 | 3300005577 | Ga0068857_100081789 | Ga0068857_1000817893 | 373 |
| 520 | 3300005617 | Ga0068859_100120601 | Ga0068859_1001206012 | 373 |
| 521 | 3300005618 | Ga0068864_100160479 | Ga0068864_1001604792 | 373 |
| 522 | 3300005843 | Ga0068860_100028444 | Ga0068860_1000284446 | 373 |
| 523 | 3300005844 | Ga0068862_100173990 | Ga0068862_1001739902 | 373 |
| 524 | 3300005983 | Ga0081540_1000267 | Ga0081540_100026711 | 373 |
| 525 | 3300006028 | Ga0070717_10029598 | Ga0070717_100295982 | 373 |
| 526 | 3300006844 | Ga0075428_100015268 | Ga0075428_1000152688 | 373 |
| 527 | 3300006844 | Ga0075428_100254903 | Ga0075428_1002549032 | 373 |
| 528 | 3300006931 | Ga0097620_100120603 | Ga0097620_1001206032 | 373 |
| 529 | 3300009098 | Ga0105245_10340018 | Ga0105245_103400181 | 373 |
| 530 | 3300009147 | Ga0114129_10442659 | Ga0114129_104426592 | 373 |
| 531 | 3300009148 | Ga0105243_10017984 | Ga0105243_100179843 | 373 |
| 532 | 3300009176 | Ga0105242_10070835 | Ga0105242_100708352 | 373 |
| 533 | 3300012515 | Ga0157338_1000655 | Ga0157338_10006551 | 373 |
| 534 | 3300020081 | Ga0206354_11178749 | Ga0206354_111787492 | 373 |
| 535 | 3300025901 | Ga0207688_10008209 | Ga0207688_100082094 | 373 |
| 536 | 3300025904 | Ga0207647_10018615 | Ga0207647_100186153 | 373 |
| 537 | 3300025905 | Ga0207685_10062620 | Ga0207685_100626202 | 373 |
| 538 | 3300025906 | Ga0207699_10048136 | Ga0207699_100481362 | 373 |
| 539 | 3300025906 | Ga0207699_10065872 | Ga0207699_100658722 | 373 |
| 540 | 3300025908 | Ga0207643_10097013 | Ga0207643_100970132 | 373 |
| 541 | 3300025913 | Ga0207695_10135766 | Ga0207695_101357662 | 373 |
| 542 | 3300025916 | Ga0207663_10067454 | Ga0207663_100674542 | 373 |
| 543 | 3300025919 | Ga0207657_10069453 | Ga0207657_100694532 | 373 |
| 544 | 3300025920 | Ga0207649_10062402 | Ga0207649_100624022 | 373 |
| 545 | 3300025921 | Ga0207652_10076816 | Ga0207652_100768162 | 373 |
| 546 | 3300025926 | Ga0207659_10110111 | Ga0207659_101101112 | 373 |
| 547 | 3300025928 | Ga0207700_10126479 | Ga0207700_101264792 | 373 |
| 548 | 3300025931 | Ga0207644_10033644 | Ga0207644_100336442 | 373 |
| 549 | 3300025933 | Ga0207706_10026852 | Ga0207706_100268524 | 373 |
| 550 | 3300025933 | Ga0207706_10166825 | Ga0207706_101668252 | 373 |
| 551 | 3300025940 | Ga0207691_10045616 | Ga0207691_100456164 | 373 |
| 552 | 3300025942 | Ga0207689_10020853 | Ga0207689_100208535 | 373 |
| 553 | 3300025944 | Ga0207661_10042482 | Ga0207661_100424822 | 373 |
| 554 | 3300025960 | Ga0207651_10288273 | Ga0207651_102882731 | 373 |
| 555 | 3300025961 | Ga0207712_10109667 | Ga0207712_101096672 | 373 |
| 556 | 3300025986 | Ga0207658_10310334 | Ga0207658_103103341 | 373 |
| 557 | 3300026067 | Ga0207678_10001201 | Ga0207678_1000120112 | 373 |
| 558 | 3300026078 | Ga0207702_10098775 | Ga0207702_100987752 | 373 |
| 559 | 3300026088 | Ga0207641_10334448 | Ga0207641_103344482 | 373 |
| 560 | 3300026095 | Ga0207676_10193276 | Ga0207676_101932762 | 373 |
| 561 | 3300026116 | Ga0207674_10053822 | Ga0207674_100538221 | 373 |
| 562 | 3300026121 | Ga0207683_10018125 | Ga0207683_100181254 | 373 |
| 563 | 3300031456 | Ga0307513_10004704 | Ga0307513_1000470414 | 373 |
| 564 | 3300034816 | Ga0373930_0002595 | Ga0373930_0002595_1285_2457 | 373 |
| 565 | 3300037853 | Ga0436364_0699396 | Ga0436364_0699396_494_1666 | 373 |
| 566 | 3300039062 | Ga0400483_059098 | Ga0400483_059098_49_1176 | 373 |
| 567 | 3300039062 | Ga0400483_275305 | Ga0400483_275305_6221_7348 | 373 |
| 568 | 3300046559 | Ga0495667_0017454 | Ga0495667_0017454_50_1222 | 373 |
| 569 | 3300046664 | Ga0495659_0038210 | Ga0495659_0038210_158_1297 | 373 |
| 570 | 3300047444 | Ga0495675_0121614 | Ga0495675_0121614_207_1379 | 373 |
| 571 | 3300048906 | Ga0496103_0013368 | Ga0496103_0013368_3023_4195 | 373 |
| 572 | 3300048909 | Ga0496106_0063683 | Ga0496106_0063683_961_2133 | 373 |
| 573 | 3300048910 | Ga0496107_0028883 | Ga0496107_0028883_1885_3057 | 373 |
| 574 | 3300048914 | Ga0496111_0081682 | Ga0496111_0081682_389_1561 | 373 |
| 575 | 3300049592 | Ga0501076_0220506 | Ga0501076_0220506_227_1366 | 373 |
| 576 | 3300050507 | nmdc:mga05p37_276313_c1 | nmdc:mga05p37_276313_c1_416_1558 | 373 |
| 577 | 3300054114 | Ga0501084_0220078 | Ga0501084_0220078_253_1392 | 373 |
| 578 | iso_pu_bacteria | 2558860112 | 2558913255 | 373 |
| 579 | 3300005467 | Ga0070706_100149314 | Ga0070706_1001493141 | 374 |
| 580 | 3300005468 | Ga0070707_100231922 | Ga0070707_1002319221 | 374 |
| 581 | 3300005546 | Ga0070696_100045126 | Ga0070696_1000451262 | 374 |
| 582 | 3300005983 | Ga0081540_1036113 | Ga0081540_10361132 | 374 |
| 583 | 3300006163 | Ga0070715_10041093 | Ga0070715_100410932 | 374 |
| 584 | 3300009147 | Ga0114129_10156530 | Ga0114129_101565303 | 374 |
| 585 | 3300021384 | Ga0213876_10031741 | Ga0213876_100317413 | 374 |
| 586 | 3300021388 | Ga0213875_10000826 | Ga0213875_1000082632 | 374 |
| 587 | 3300021388 | Ga0213875_10032935 | Ga0213875_100329353 | 374 |
| 588 | 3300035086 | Ga0373934_0023998 | Ga0373934_0023998_417_1595 | 374 |
| 589 | 3300035088 | Ga0373940_0017428 | Ga0373940_0017428_154_1299 | 374 |
| 590 | 3300035120 | Ga0373957_0014317 | Ga0373957_0014317_1043_2221 | 374 |
| 591 | 3300035172 | Ga0373955_0024869 | Ga0373955_0024869_1593_2771 | 374 |
| 592 | 3300035691 | Ga0373931_0123003 | Ga0373931_0123003_188_1333 | 374 |
| 593 | 3300035724 | Ga0373933_0013928 | Ga0373933_0013928_2429_3607 | 374 |
| 594 | 3300036401 | Ga0373937_0019106 | Ga0373937_0019106_1557_2735 | 374 |
| 595 | 3300037853 | Ga0436364_0371684 | Ga0436364_0371684_22893_24083 | 374 |
| 596 | 3300046462 | Ga0495651_0027545 | Ga0495651_0027545_3100_4278 | 374 |
| 597 | 3300046463 | Ga0495653_0008043 | Ga0495653_0008043_3975_5153 | 374 |
| 598 | 3300046511 | Ga0495608_0010944 | Ga0495608_0010944_1638_2816 | 374 |
| 599 | 3300046675 | Ga0495657_0031845 | Ga0495657_0031845_463_1641 | 374 |
| 600 | 3300047319 | Ga0495674_0000477 | Ga0495674_0000477_247_1425 | 374 |
| 601 | 3300047322 | Ga0495680_0058629 | Ga0495680_0058629_27_1205 | 374 |
| 602 | 3300047471 | Ga0495684_0056526 | Ga0495684_0056526_1592_2770 | 374 |
| 603 | 3300049588 | Ga0501072_0002045 | Ga0501072_0002045_11970_13118 | 374 |
| 604 | 3300049591 | Ga0501075_0009407 | Ga0501075_0009407_3387_4532 | 374 |
| 605 | 3300049743 | Ga0501081_0087901 | Ga0501081_0087901_976_2124 | 374 |
| 606 | 3300050507 | nmdc:mga05p37_59454_c1 | nmdc:mga05p37_59454_c1_1309_2454 | 374 |
| 607 | 3300050507 | nmdc:mga05p37_71764_c1 | nmdc:mga05p37_71764_c1_698_1840 | 374 |
| 608 | 3300050509 | nmdc:mga0qj67_43190_c1 | nmdc:mga0qj67_43190_c1_1309_2454 | 374 |
| 609 | 3300050510 | nmdc:mga06r32_19944_c1 | nmdc:mga06r32_19944_c1_4830_5975 | 374 |
| 610 | 3300050511 | nmdc:mga08y16_542_c1 | nmdc:mga08y16_542_c1_24835_25980 | 374 |
| 611 | 3300054114 | Ga0501084_0107892 | Ga0501084_0107892_289_1437 | 374 |
| 612 | 3300061734 | Ga0530510_0141830 | Ga0530510_0141830_586_1728 | 374 |
| 613 | 3300061734 | Ga0530510_0207005 | Ga0530510_0207005_82_1227 | 374 |
| 614 | 3300005331 | Ga0070670_100178534 | Ga0070670_1001785342 | 375 |
| 615 | 3300005334 | Ga0068869_100004929 | Ga0068869_1000049294 | 375 |
| 616 | 3300005353 | Ga0070669_100075843 | Ga0070669_1000758432 | 375 |
| 617 | 3300005444 | Ga0070694_100031176 | Ga0070694_1000311761 | 375 |
| 618 | 3300005468 | Ga0070707_100114498 | Ga0070707_1001144982 | 375 |
| 619 | 3300005471 | Ga0070698_100014405 | Ga0070698_1000144054 | 375 |
| 620 | 3300005471 | Ga0070698_100082917 | Ga0070698_1000829171 | 375 |
| 621 | 3300005471 | Ga0070698_100185251 | Ga0070698_1001852512 | 375 |
| 622 | 3300005985 | Ga0081539_10000161 | Ga0081539_10000161137 | 375 |
| 623 | 3300006175 | Ga0070712_100007120 | Ga0070712_1000071203 | 375 |
| 624 | 3300006844 | Ga0075428_100139280 | Ga0075428_1001392804 | 375 |
| 625 | 3300009147 | Ga0114129_10035111 | Ga0114129_100351113 | 375 |
| 626 | 3300025898 | Ga0207692_10142026 | Ga0207692_101420261 | 375 |
| 627 | 3300025915 | Ga0207693_10003783 | Ga0207693_100037837 | 375 |
| 628 | 3300025922 | Ga0207646_10062072 | Ga0207646_100620723 | 375 |
| 629 | 3300026067 | Ga0207678_10117214 | Ga0207678_101172142 | 375 |
| 630 | 3300037466 | Ga0395898_0030125 | Ga0395898_0030125_2891_4036 | 375 |
| 631 | 3300038443 | Ga0395901_0004608 | Ga0395901_0004608_11332_12477 | 375 |
| 632 | 3300048928 | Ga0496125_0001945 | Ga0496125_0001945_17648_18778 | 375 |
| 633 | 3300050507 | nmdc:mga05p37_216052_c1 | nmdc:mga05p37_216052_c1_488_1630 | 375 |
| 634 | 3300050514 | nmdc:mga08x19_251611_c1 | nmdc:mga08x19_251611_c1_20_1150 | 375 |
| 635 | 3300005434 | Ga0070709_10059178 | Ga0070709_100591782 | 376 |
| 636 | 3300005435 | Ga0070714_100018622 | Ga0070714_1000186221 | 376 |
| 637 | 3300005458 | Ga0070681_10000570 | Ga0070681_1000057016 | 376 |
| 638 | 3300006028 | Ga0070717_10159849 | Ga0070717_101598492 | 376 |
| 639 | 3300006175 | Ga0070712_100017527 | Ga0070712_1000175272 | 376 |
| 640 | 3300006844 | Ga0075428_100086324 | Ga0075428_1000863242 | 376 |
| 641 | 3300006846 | Ga0075430_100067524 | Ga0075430_1000675242 | 376 |
| 642 | 3300006846 | Ga0075430_100165617 | Ga0075430_1001656172 | 376 |
| 643 | 3300009094 | Ga0111539_10007134 | Ga0111539_100071344 | 376 |
| 644 | 3300013296 | Ga0157374_10322100 | Ga0157374_103221001 | 376 |
| 645 | 3300014325 | Ga0163163_10162689 | Ga0163163_101626892 | 376 |
| 646 | 3300025294 | Ga0209025_1028927 | Ga0209025_10289273 | 376 |
| 647 | 3300025905 | Ga0207685_10055792 | Ga0207685_100557921 | 376 |
| 648 | 3300025906 | Ga0207699_10039819 | Ga0207699_100398192 | 376 |
| 649 | 3300025909 | Ga0207705_10071355 | Ga0207705_100713552 | 376 |
| 650 | 3300025912 | Ga0207707_10087089 | Ga0207707_100870892 | 376 |
| 651 | 3300025915 | Ga0207693_10015613 | Ga0207693_100156134 | 376 |
| 652 | 3300025915 | Ga0207693_10032674 | Ga0207693_100326743 | 376 |
| 653 | 3300025916 | Ga0207663_10205093 | Ga0207663_102050931 | 376 |
| 654 | 3300025928 | Ga0207700_10022083 | Ga0207700_100220832 | 376 |
| 655 | 3300025929 | Ga0207664_10019156 | Ga0207664_100191564 | 376 |
| 656 | 3300025939 | Ga0207665_10095719 | Ga0207665_100957191 | 376 |
| 657 | 3300026078 | Ga0207702_10124187 | Ga0207702_101241872 | 376 |
| 658 | 3300026142 | Ga0207698_10350905 | Ga0207698_103509051 | 376 |
| 659 | 3300027907 | Ga0207428_10018858 | Ga0207428_100188583 | 376 |
| 660 | 3300031727 | Ga0316576_10079672 | Ga0316576_100796722 | 376 |
| 661 | 3300035088 | Ga0373940_0004329 | Ga0373940_0004329_431_1582 | 376 |
| 662 | 3300035090 | Ga0373949_0011681 | Ga0373949_0011681_103_1254 | 376 |
| 663 | 3300035119 | Ga0373956_0040964 | Ga0373956_0040964_328_1488 | 376 |
| 664 | 3300035171 | Ga0373946_0042885 | Ga0373946_0042885_71_1231 | 376 |
| 665 | 3300035242 | Ga0373962_0007592 | Ga0373962_0007592_730_1881 | 376 |
| 666 | 3300035691 | Ga0373931_0115511 | Ga0373931_0115511_349_1509 | 376 |
| 667 | 3300035695 | Ga0373927_0047231 | Ga0373927_0047231_1098_2291 | 376 |
| 668 | 3300035725 | Ga0373947_0035108 | Ga0373947_0035108_309_1502 | 376 |
| 669 | 3300035725 | Ga0373947_0135713 | Ga0373947_0135713_92_1252 | 376 |
| 670 | 3300036401 | Ga0373937_0002383 | Ga0373937_0002383_1940_3094 | 376 |
| 671 | 3300036401 | Ga0373937_0004271 | Ga0373937_0004271_337_1497 | 376 |
| 672 | 3300037068 | Ga0373925_0011760 | Ga0373925_0011760_1752_2918 | 376 |
| 673 | 3300037068 | Ga0373925_0063888 | Ga0373925_0063888_1117_2310 | 376 |
| 674 | 3300039438 | Ga0436360_0897651 | Ga0436360_0897651_39_1259 | 376 |
| 675 | 3300044712 | Ga0453684_0313632 | Ga0453684_0313632_574_1734 | 376 |
| 676 | 3300046454 | Ga0495592_0142321 | Ga0495592_0142321_79_1239 | 376 |
| 677 | 3300046462 | Ga0495651_0019572 | Ga0495651_0019572_331_1491 | 376 |
| 678 | 3300046477 | Ga0495664_0003253 | Ga0495664_0003253_7087_8241 | 376 |
| 679 | 3300046514 | Ga0495618_0101675 | Ga0495618_0101675_329_1483 | 376 |
| 680 | 3300046516 | Ga0495628_0082523 | Ga0495628_0082523_303_1457 | 376 |
| 681 | 3300046529 | Ga0495652_0161740 | Ga0495652_0161740_157_1311 | 376 |
| 682 | 3300046543 | Ga0495645_0008561 | Ga0495645_0008561_2011_3165 | 376 |
| 683 | 3300046559 | Ga0495667_0056726 | Ga0495667_0056726_196_1356 | 376 |
| 684 | 3300046663 | Ga0495635_0067997 | Ga0495635_0067997_1070_2224 | 376 |
| 685 | 3300046675 | Ga0495657_0032282 | Ga0495657_0032282_1092_2252 | 376 |
| 686 | 3300046680 | Ga0495646_0030069 | Ga0495646_0030069_2033_3187 | 376 |
| 687 | 3300046809 | Ga0495600_0012987 | Ga0495600_0012987_2475_3629 | 376 |
| 688 | 3300047317 | Ga0495604_0004463 | Ga0495604_0004463_7887_9041 | 376 |
| 689 | 3300047319 | Ga0495674_0015244 | Ga0495674_0015244_658_1812 | 376 |
| 690 | 3300047322 | Ga0495680_0070681 | Ga0495680_0070681_518_1672 | 376 |
| 691 | 3300047444 | Ga0495675_0002915 | Ga0495675_0002915_670_1824 | 376 |
| 692 | 3300048088 | Ga0495602_0002111 | Ga0495602_0002111_16861_18015 | 376 |
| 693 | 3300049823 | Ga0501044_0224921 | Ga0501044_0224921_558_1709 | 376 |
| 694 | 3300050509 | nmdc:mga0qj67_25726_c1 | nmdc:mga0qj67_25726_c1_471_1631 | 376 |
| 695 | 3300050509 | nmdc:mga0qj67_85047_c1 | nmdc:mga0qj67_85047_c1_563_1723 | 376 |
| 696 | 3300050511 | nmdc:mga08y16_226680_c1 | nmdc:mga08y16_226680_c1_276_1436 | 376 |
| 697 | 3300053077 | Ga0495601_0010758 | Ga0495601_0010758_1923_3083 | 376 |
| 698 | 3300053078 | Ga0495612_0001008 | Ga0495612_0001008_8494_9648 | 376 |
| 699 | 3300053085 | Ga0495619_0014924 | Ga0495619_0014924_3026_4180 | 376 |
| 700 | 3300053085 | Ga0495619_0018357 | Ga0495619_0018357_91_1413 | 376 |
| 701 | 3300005293 | Ga0065715_10162750 | Ga0065715_101627502 | 377 |
| 702 | 3300005336 | Ga0070680_100024494 | Ga0070680_1000244945 | 377 |
| 703 | 3300005336 | Ga0070680_100167770 | Ga0070680_1001677702 | 377 |
| 704 | 3300005336 | Ga0070680_100257705 | Ga0070680_1002577051 | 377 |
| 705 | 3300005339 | Ga0070660_100043798 | Ga0070660_1000437983 | 377 |
| 706 | 3300005341 | Ga0070691_10034253 | Ga0070691_100342533 | 377 |
| 707 | 3300005458 | Ga0070681_10040095 | Ga0070681_100400954 | 377 |
| 708 | 3300005530 | Ga0070679_100010342 | Ga0070679_1000103424 | 377 |
| 709 | 3300005530 | Ga0070679_100017263 | Ga0070679_1000172636 | 377 |
| 710 | 3300005530 | Ga0070679_100087472 | Ga0070679_1000874723 | 377 |
| 711 | 3300005535 | Ga0070684_100371168 | Ga0070684_1003711681 | 377 |
| 712 | 3300005563 | Ga0068855_100029394 | Ga0068855_1000293944 | 377 |
| 713 | 3300005563 | Ga0068855_100328165 | Ga0068855_1003281652 | 377 |
| 714 | 3300005614 | Ga0068856_100133675 | Ga0068856_1001336752 | 377 |
| 715 | 3300005614 | Ga0068856_100169502 | Ga0068856_1001695023 | 377 |
| 716 | 3300005841 | Ga0068863_100182422 | Ga0068863_1001824221 | 377 |
| 717 | 3300005842 | Ga0068858_100099970 | Ga0068858_1000999703 | 377 |
| 718 | 3300005844 | Ga0068862_100036791 | Ga0068862_1000367911 | 377 |
| 719 | 3300005937 | Ga0081455_10083710 | Ga0081455_100837104 | 377 |
| 720 | 3300005937 | Ga0081455_10241278 | Ga0081455_102412781 | 377 |
| 721 | 3300006358 | Ga0068871_100089771 | Ga0068871_1000897713 | 377 |
| 722 | 3300006844 | Ga0075428_100011730 | Ga0075428_1000117303 | 377 |
| 723 | 3300006846 | Ga0075430_100021883 | Ga0075430_1000218835 | 377 |
| 724 | 3300006847 | Ga0075431_100029649 | Ga0075431_1000296495 | 377 |
| 725 | 3300009093 | Ga0105240_10003178 | Ga0105240_1000317827 | 377 |
| 726 | 3300009093 | Ga0105240_10041372 | Ga0105240_100413724 | 377 |
| 727 | 3300009545 | Ga0105237_10081198 | Ga0105237_100811982 | 377 |
| 728 | 3300009551 | Ga0105238_10012727 | Ga0105238_100127272 | 377 |
| 729 | 3300013104 | Ga0157370_10007251 | Ga0157370_1000725111 | 377 |
| 730 | 3300013105 | Ga0157369_10008533 | Ga0157369_100085334 | 377 |
| 731 | 3300014325 | Ga0163163_10024718 | Ga0163163_100247184 | 377 |
| 732 | 3300014969 | Ga0157376_10144481 | Ga0157376_101444811 | 377 |
| 733 | 3300025912 | Ga0207707_10000094 | Ga0207707_1000009411 | 377 |
| 734 | 3300025912 | Ga0207707_10014021 | Ga0207707_100140212 | 377 |
| 735 | 3300025912 | Ga0207707_10258417 | Ga0207707_102584172 | 377 |
| 736 | 3300025912 | Ga0207707_10323460 | Ga0207707_103234601 | 377 |
| 737 | 3300025913 | Ga0207695_10012536 | Ga0207695_100125362 | 377 |
| 738 | 3300025917 | Ga0207660_10015684 | Ga0207660_100156842 | 377 |
| 739 | 3300025917 | Ga0207660_10148113 | Ga0207660_101481132 | 377 |
| 740 | 3300025919 | Ga0207657_10070564 | Ga0207657_100705643 | 377 |
| 741 | 3300025921 | Ga0207652_10084714 | Ga0207652_100847142 | 377 |
| 742 | 3300025924 | Ga0207694_10048531 | Ga0207694_100485312 | 377 |
| 743 | 3300025939 | Ga0207665_10030366 | Ga0207665_100303663 | 377 |
| 744 | 3300025944 | Ga0207661_10111678 | Ga0207661_101116781 | 377 |
| 745 | 3300025949 | Ga0207667_10020143 | Ga0207667_100201433 | 377 |
| 746 | 3300025949 | Ga0207667_10251653 | Ga0207667_102516532 | 377 |
| 747 | 3300026078 | Ga0207702_10260763 | Ga0207702_102607631 | 377 |
| 748 | 3300026078 | Ga0207702_10297126 | Ga0207702_102971261 | 377 |
| 749 | 3300026088 | Ga0207641_10320359 | Ga0207641_103203591 | 377 |
| 750 | 3300026116 | Ga0207674_10280990 | Ga0207674_102809901 | 377 |
| 751 | 3300031456 | Ga0307513_10177897 | Ga0307513_101778972 | 377 |
| 752 | 3300031727 | Ga0316576_10219599 | Ga0316576_102195992 | 377 |
| 753 | 3300031824 | Ga0307413_10022345 | Ga0307413_100223452 | 377 |
| 754 | 3300035120 | Ga0373957_0055197 | Ga0373957_0055197_256_1401 | 377 |
| 755 | 3300035398 | Ga0316574_0015446 | Ga0316574_0015446_776_1921 | 377 |
| 756 | 3300036401 | Ga0373937_0008219 | Ga0373937_0008219_23_1168 | 377 |
| 757 | 3300037418 | Ga0395900_0049263 | Ga0395900_0049263_751_1896 | 377 |
| 758 | 3300037853 | Ga0436364_1434162 | Ga0436364_1434162_154_1341 | 377 |
| 759 | 3300042132 | Ga0450895_000659 | Ga0450895_000659_43_1188 | 377 |
| 760 | 3300042876 | Ga0451577_0047288 | Ga0451577_0047288_764_1948 | 377 |
| 761 | 3300046454 | Ga0495592_0011507 | Ga0495592_0011507_2613_3758 | 377 |
| 762 | 3300046511 | Ga0495608_0059514 | Ga0495608_0059514_990_2135 | 377 |
| 763 | 3300046514 | Ga0495618_0138624 | Ga0495618_0138624_203_1348 | 377 |
| 764 | 3300046516 | Ga0495628_0140141 | Ga0495628_0140141_504_1649 | 377 |
| 765 | 3300046517 | Ga0495630_0313243 | Ga0495630_0313243_26_1171 | 377 |
| 766 | 3300046559 | Ga0495667_0004364 | Ga0495667_0004364_1352_2497 | 377 |
| 767 | 3300046675 | Ga0495657_0004574 | Ga0495657_0004574_3092_4237 | 377 |
| 768 | 3300047319 | Ga0495674_0265181 | Ga0495674_0265181_237_1382 | 377 |
| 769 | 3300048913 | Ga0496110_0153558 | Ga0496110_0153558_833_1981 | 377 |
| 770 | 3300049568 | Ga0501031_0046233 | Ga0501031_0046233_1642_2787 | 377 |
| 771 | 3300049569 | Ga0501032_0085167 | Ga0501032_0085167_346_1512 | 377 |
| 772 | 3300049570 | Ga0501033_0006860 | Ga0501033_0006860_5427_6593 | 377 |
| 773 | 3300049571 | Ga0501034_0015032 | Ga0501034_0015032_236_1402 | 377 |
| 774 | 3300049572 | Ga0501036_0041617 | Ga0501036_0041617_442_1608 | 377 |
| 775 | 3300049573 | Ga0501037_0186355 | Ga0501037_0186355_203_1369 | 377 |
| 776 | 3300049574 | Ga0501038_0048744 | Ga0501038_0048744_133_1299 | 377 |
| 777 | 3300049575 | Ga0501039_0274841 | Ga0501039_0274841_114_1280 | 377 |
| 778 | 3300049581 | Ga0501047_0042303 | Ga0501047_0042303_316_1482 | 377 |
| 779 | 3300049586 | Ga0501070_0031397 | Ga0501070_0031397_1517_2683 | 377 |
| 780 | 3300049586 | Ga0501070_0080969 | Ga0501070_0080969_251_1417 | 377 |
| 781 | 3300049823 | Ga0501044_0049246 | Ga0501044_0049246_2447_3613 | 377 |
| 782 | 3300049823 | Ga0501044_0194755 | Ga0501044_0194755_613_1779 | 377 |
| 783 | 3300050510 | nmdc:mga06r32_116721_c1 | nmdc:mga06r32_116721_c1_226_1371 | 377 |
| 784 | 3300053085 | Ga0495619_0004096 | Ga0495619_0004096_3794_4939 | 377 |
| 785 | 3300053096 | Ga0500641_0020597 | Ga0500641_0020597_365_1510 | 377 |
| 786 | 3300053124 | Ga0500617_024133 | Ga0500617_024133_902_2047 | 377 |
| 787 | 3300053134 | Ga0500658_0025782 | Ga0500658_0025782_483_1628 | 377 |
| 788 | 3300003214 | JGI25165J46597_1003497 | JGI25165J46597_10034974 | 378 |
| 789 | 3300005330 | Ga0070690_100010201 | Ga0070690_1000102012 | 378 |
| 790 | 3300005331 | Ga0070670_100020562 | Ga0070670_1000205623 | 378 |
| 791 | 3300005335 | Ga0070666_10001637 | Ga0070666_100016374 | 378 |
| 792 | 3300005338 | Ga0068868_100003513 | Ga0068868_1000035133 | 378 |
| 793 | 3300005338 | Ga0068868_100071594 | Ga0068868_1000715942 | 378 |
| 794 | 3300005339 | Ga0070660_100162675 | Ga0070660_1001626752 | 378 |
| 795 | 3300005343 | Ga0070687_100094860 | Ga0070687_1000948602 | 378 |
| 796 | 3300005344 | Ga0070661_100025559 | Ga0070661_1000255592 | 378 |
| 797 | 3300005355 | Ga0070671_100016608 | Ga0070671_1000166084 | 378 |
| 798 | 3300005364 | Ga0070673_100037606 | Ga0070673_1000376064 | 378 |
| 799 | 3300005364 | Ga0070673_100196660 | Ga0070673_1001966602 | 378 |
| 800 | 3300005366 | Ga0070659_100130958 | Ga0070659_1001309582 | 378 |
| 801 | 3300005367 | Ga0070667_100032365 | Ga0070667_1000323652 | 378 |
| 802 | 3300005456 | Ga0070678_100269764 | Ga0070678_1002697641 | 378 |
| 803 | 3300005457 | Ga0070662_100080444 | Ga0070662_1000804441 | 378 |
| 804 | 3300005458 | Ga0070681_10002183 | Ga0070681_1000218317 | 378 |
| 805 | 3300005535 | Ga0070684_100038278 | Ga0070684_1000382782 | 378 |
| 806 | 3300005543 | Ga0070672_100000667 | Ga0070672_10000066715 | 378 |
| 807 | 3300005547 | Ga0070693_100119135 | Ga0070693_1001191352 | 378 |
| 808 | 3300005548 | Ga0070665_100124789 | Ga0070665_1001247892 | 378 |
| 809 | 3300005564 | Ga0070664_100009636 | Ga0070664_1000096362 | 378 |
| 810 | 3300005577 | Ga0068857_100196828 | Ga0068857_1001968282 | 378 |
| 811 | 3300005578 | Ga0068854_100025961 | Ga0068854_1000259613 | 378 |
| 812 | 3300005614 | Ga0068856_100032742 | Ga0068856_1000327424 | 378 |
| 813 | 3300005617 | Ga0068859_100544079 | Ga0068859_1005440791 | 378 |
| 814 | 3300005618 | Ga0068864_100006211 | Ga0068864_1000062113 | 378 |
| 815 | 3300005841 | Ga0068863_100015581 | Ga0068863_1000155819 | 378 |
| 816 | 3300005841 | Ga0068863_100140765 | Ga0068863_1001407653 | 378 |
| 817 | 3300006178 | Ga0075367_10019228 | Ga0075367_100192284 | 378 |
| 818 | 3300006844 | Ga0075428_100013841 | Ga0075428_1000138417 | 378 |
| 819 | 3300006847 | Ga0075431_100001810 | Ga0075431_1000018105 | 378 |
| 820 | 3300006847 | Ga0075431_100050012 | Ga0075431_1000500122 | 378 |
| 821 | 3300006880 | Ga0075429_100004783 | Ga0075429_1000047832 | 378 |
| 822 | 3300006931 | Ga0097620_100544042 | Ga0097620_1005440421 | 378 |
| 823 | 3300009094 | Ga0111539_10001898 | Ga0111539_100018985 | 378 |
| 824 | 3300009147 | Ga0114129_10000742 | Ga0114129_1000074226 | 378 |
| 825 | 3300009148 | Ga0105243_10099418 | Ga0105243_100994182 | 378 |
| 826 | 3300009174 | Ga0105241_10064937 | Ga0105241_100649372 | 378 |
| 827 | 3300009177 | Ga0105248_10002810 | Ga0105248_1000281011 | 378 |
| 828 | 3300009177 | Ga0105248_10466354 | Ga0105248_104663542 | 378 |
| 829 | 3300010375 | Ga0105239_10061616 | Ga0105239_100616162 | 378 |
| 830 | 3300013102 | Ga0157371_10235832 | Ga0157371_102358322 | 378 |
| 831 | 3300013105 | Ga0157369_10137994 | Ga0157369_101379942 | 378 |
| 832 | 3300013296 | Ga0157374_10007958 | Ga0157374_100079582 | 378 |
| 833 | 3300013306 | Ga0163162_10002246 | Ga0163162_100022462 | 378 |
| 834 | 3300013307 | Ga0157372_10090652 | Ga0157372_100906523 | 378 |
| 835 | 3300013308 | Ga0157375_10018373 | Ga0157375_100183733 | 378 |
| 836 | 3300013308 | Ga0157375_10212630 | Ga0157375_102126302 | 378 |
| 837 | 3300013308 | Ga0157375_10369997 | Ga0157375_103699971 | 378 |
| 838 | 3300014325 | Ga0163163_10080177 | Ga0163163_100801772 | 378 |
| 839 | 3300025231 | Ga0207427_103358 | Ga0207427_1033583 | 378 |
| 840 | 3300025261 | Ga0209233_1000371 | Ga0209233_10003716 | 378 |
| 841 | 3300025321 | Ga0207656_10052386 | Ga0207656_100523862 | 378 |
| 842 | 3300025904 | Ga0207647_10052839 | Ga0207647_100528393 | 378 |
| 843 | 3300025907 | Ga0207645_10014227 | Ga0207645_100142275 | 378 |
| 844 | 3300025908 | Ga0207643_10021033 | Ga0207643_100210332 | 378 |
| 845 | 3300025912 | Ga0207707_10005320 | Ga0207707_100053208 | 378 |
| 846 | 3300025918 | Ga0207662_10142463 | Ga0207662_101424632 | 378 |
| 847 | 3300025919 | Ga0207657_10074348 | Ga0207657_100743482 | 378 |
| 848 | 3300025921 | Ga0207652_10084878 | Ga0207652_100848782 | 378 |
| 849 | 3300025925 | Ga0207650_10057524 | Ga0207650_100575243 | 378 |
| 850 | 3300025931 | Ga0207644_10088675 | Ga0207644_100886752 | 378 |
| 851 | 3300025932 | Ga0207690_10216644 | Ga0207690_102166441 | 378 |
| 852 | 3300025933 | Ga0207706_10001683 | Ga0207706_1000168317 | 378 |
| 853 | 3300025936 | Ga0207670_10133230 | Ga0207670_101332302 | 378 |
| 854 | 3300025936 | Ga0207670_10252554 | Ga0207670_102525541 | 378 |
| 855 | 3300025940 | Ga0207691_10000550 | Ga0207691_1000055025 | 378 |
| 856 | 3300025940 | Ga0207691_10003308 | Ga0207691_100033083 | 378 |
| 857 | 3300025941 | Ga0207711_10105491 | Ga0207711_101054913 | 378 |
| 858 | 3300026078 | Ga0207702_10278141 | Ga0207702_102781412 | 378 |
| 859 | 3300026089 | Ga0207648_10112164 | Ga0207648_101121642 | 378 |
| 860 | 3300026116 | Ga0207674_10001978 | Ga0207674_1000197810 | 378 |
| 861 | 3300026121 | Ga0207683_10014351 | Ga0207683_100143513 | 378 |
| 862 | 3300027665 | Ga0209983_1001445 | Ga0209983_10014453 | 378 |
| 863 | 3300027717 | Ga0209998_10000168 | Ga0209998_1000016822 | 378 |
| 864 | 3300027876 | Ga0209974_10000232 | Ga0209974_100002327 | 378 |
| 865 | 3300027907 | Ga0207428_10005596 | Ga0207428_100055965 | 378 |
| 866 | 3300028573 | Ga0265334_10061114 | Ga0265334_100611142 | 378 |
| 867 | 3300028794 | Ga0307515_10027465 | Ga0307515_100274658 | 378 |
| 868 | 3300028800 | Ga0265338_10003183 | Ga0265338_100031839 | 378 |
| 869 | 3300031241 | Ga0265325_10000646 | Ga0265325_1000064610 | 378 |
| 870 | 3300031247 | Ga0265340_10019251 | Ga0265340_100192513 | 378 |
| 871 | 3300031249 | Ga0265339_10000347 | Ga0265339_1000034723 | 378 |
| 872 | 3300031250 | Ga0265331_10026150 | Ga0265331_100261502 | 378 |
| 873 | 3300031595 | Ga0265313_10000288 | Ga0265313_1000028840 | 378 |
| 874 | 3300031711 | Ga0265314_10056215 | Ga0265314_100562152 | 378 |
| 875 | 3300031712 | Ga0265342_10014881 | Ga0265342_100148812 | 378 |
| 876 | 3300035117 | Ga0373953_0007481 | Ga0373953_0007481_1578_2726 | 378 |
| 877 | 3300035121 | Ga0373960_0043500 | Ga0373960_0043500_59_1198 | 378 |
| 878 | 3300036401 | Ga0373937_0059231 | Ga0373937_0059231_425_1591 | 378 |
| 879 | 3300036401 | Ga0373937_0289182 | Ga0373937_0289182_219_1367 | 378 |
| 880 | 3300037466 | Ga0395898_0002265 | Ga0395898_0002265_7119_8255 | 378 |
| 881 | 3300038443 | Ga0395901_0043511 | Ga0395901_0043511_254_1390 | 378 |
| 882 | 3300046472 | Ga0495580_0136512 | Ga0495580_0136512_424_1572 | 378 |
| 883 | 3300046499 | Ga0495594_0027014 | Ga0495594_0027014_1030_2190 | 378 |
| 884 | 3300046689 | Ga0495613_0100039 | Ga0495613_0100039_629_1777 | 378 |
| 885 | 3300047472 | Ga0495686_0046870 | Ga0495686_0046870_690_1826 | 378 |
| 886 | 3300048918 | Ga0496115_0021283 | Ga0496115_0021283_3552_4718 | 378 |
| 887 | 3300049568 | Ga0501031_0000959 | Ga0501031_0000959_7834_8970 | 378 |
| 888 | 3300049569 | Ga0501032_0001789 | Ga0501032_0001789_9728_10864 | 378 |
| 889 | 3300049570 | Ga0501033_0081116 | Ga0501033_0081116_535_1671 | 378 |
| 890 | 3300049571 | Ga0501034_0007273 | Ga0501034_0007273_7611_8747 | 378 |
| 891 | 3300049571 | Ga0501034_0089211 | Ga0501034_0089211_379_1515 | 378 |
| 892 | 3300049571 | Ga0501034_0121996 | Ga0501034_0121996_748_1884 | 378 |
| 893 | 3300049572 | Ga0501036_0009528 | Ga0501036_0009528_1288_2424 | 378 |
| 894 | 3300049573 | Ga0501037_0009575 | Ga0501037_0009575_5316_6452 | 378 |
| 895 | 3300049574 | Ga0501038_0007063 | Ga0501038_0007063_4940_6076 | 378 |
| 896 | 3300049575 | Ga0501039_0011247 | Ga0501039_0011247_5138_6274 | 378 |
| 897 | 3300049579 | Ga0501043_0092662 | Ga0501043_0092662_709_1845 | 378 |
| 898 | 3300049581 | Ga0501047_0002914 | Ga0501047_0002914_5776_6912 | 378 |
| 899 | 3300049586 | Ga0501070_0007417 | Ga0501070_0007417_2382_3518 | 378 |
| 900 | 3300049590 | Ga0501074_0076995 | Ga0501074_0076995_706_1842 | 378 |
| 901 | 3300049822 | Ga0501035_0021703 | Ga0501035_0021703_531_1667 | 378 |
| 902 | 3300049823 | Ga0501044_0012955 | Ga0501044_0012955_4958_6094 | 378 |
| 903 | 3300050494 | nmdc:mga06z11_110070_c1 | nmdc:mga06z11_110070_c1_41_1180 | 378 |
| 904 | 3300050507 | nmdc:mga05p37_508_c1 | nmdc:mga05p37_508_c1_29496_30668 | 378 |
| 905 | 3300050508 | nmdc:mga09592_14119_c1 | nmdc:mga09592_14119_c1_19_1191 | 378 |
| 906 | 3300050508 | nmdc:mga09592_26976_c1 | nmdc:mga09592_26976_c1_2145_3293 | 378 |
| 907 | 3300050509 | nmdc:mga0qj67_22279_c1 | nmdc:mga0qj67_22279_c1_2943_4091 | 378 |
| 908 | 3300050510 | nmdc:mga06r32_161028_c1 | nmdc:mga06r32_161028_c1_1045_2193 | 378 |
| 909 | 3300050510 | nmdc:mga06r32_1960_c1 | nmdc:mga06r32_1960_c1_14104_15276 | 378 |
| 910 | 3300050511 | nmdc:mga08y16_2332_c1 | nmdc:mga08y16_2332_c1_14103_15275 | 378 |
| 911 | 3300053130 | Ga0500642_0083514 | Ga0500642_0083514_175_1335 | 378 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1xdj-assembly1.cif.gz_A | crystal structure of t. maritima cobalamin-independent methionine synthase complexed with zn2+ and homocysteine | 0.8681 | 1 | 374 |
| 1xr2-assembly2.cif.gz_B | crystal structure of oxidized t. maritima cobalamin-independent methionine synthase complexed with methyltetrahydrofolate | 0.8662 | 1 | 372 |
| 1xr2-assembly1.cif.gz_A | crystal structure of oxidized t. maritima cobalamin-independent methionine synthase complexed with methyltetrahydrofolate | 0.863 | 1 | 369 |
| 3bq6-assembly2.cif.gz_B | crystal structure of t. maritima cobalamin-independent methionine synthase complexed with zn2+ (monoclinic) | 0.8624 | 1 | 372 |
| 3bq6-assembly1.cif.gz_A | crystal structure of t. maritima cobalamin-independent methionine synthase complexed with zn2+ (monoclinic) | 0.862 | 1 | 371 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1xdjA02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel; | 0.8565 | 1 | 377 | 3.20.20.210 |
| af_Q54X49_428_818_3.20.20.210 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel; | 0.8514 | 1 | 369 | 3.20.20.210 |
| 2nq5A02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel; | 0.8236 | 1 | 372 | 3.20.20.210 |
| 4l61A02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel; | 0.8214 | 3 | 372 | 3.20.20.210 |
| af_Q55G42_28_396_3.20.20.210 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel; | 0.8193 | 1 | 377 | 3.20.20.210 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A848U6Y3-F1-model_v4 | Epoxyalkane--coenzyme M transferase | 0.9931 | 74 | 370 |
GO:0003871
GO:0008270 GO:0009086 |
| AF-A0A534A311-F1-model_v4 | Cobalamin-independent methionine synthase MetE C-terminal/archaeal domain-containing protein | 0.9927 | 3 | 371 |
GO:0003871
GO:0008270 GO:0009086 GO:0016491 |
| AF-A0A3B8QQI7-F1-model_v4 | Epoxyalkane--coenzyme M transferase | 0.9918 | 1 | 287 |
GO:0016740
|
| AF-A0A2W5Y9P4-F1-model_v4 | Epoxyalkane--coenzyme M transferase | 0.9916 | 3 | 370 |
GO:0003871
GO:0008270 GO:0009086 |
| AF-A0A3R7WAH5-F1-model_v4 | Epoxyalkane--coenzyme M transferase | 0.9904 | 130 | 370 |
GO:0003871
GO:0008270 GO:0009086 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar