F485253

General Info

Members Datasets Scaffolds Average Seq Length
903 337 1806 67

Family's Representative Sequence

Representative Sequence 3300048912|Ga0496109_0581741|Ga0496109_0581741_428_646
Length 72
Sequence VEVNNMATGTVKWFSDEKGFGFITPDDQGKDLFVHHTAIQADGYRSLAEGTKVSYDAEQGQKGPQAQNVRPV

Samples

Sample ID Description Type Environment
1 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300003611 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003613 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_31 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
19 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
20 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
21 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
22 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
35 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
46 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
47 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
48 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
49 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
50 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
51 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
63 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
78 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
84 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
85 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
86 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
87 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
88 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
91 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
92 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
93 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
94 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
95 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
96 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
97 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
100 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
101 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
102 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
104 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
105 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
107 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
115 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
124 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
125 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
136 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
137 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
138 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
189 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
193 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
194 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
195 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
196 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
197 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
198 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
199 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
200 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
201 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
202 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
203 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
204 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
205 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
206 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
207 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
209 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
210 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
211 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
212 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
213 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
214 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
215 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
216 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
217 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
218 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
219 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
220 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
221 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
222 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
223 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
224 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
225 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
226 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
227 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
228 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
229 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
230 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
231 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
232 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
233 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
234 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
235 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
236 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
237 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
238 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
239 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
240 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
241 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
242 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
243 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
244 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
245 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
246 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
247 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
248 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
249 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
250 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
251 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
252 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
253 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
254 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
255 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
256 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
257 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
258 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
259 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
260 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
261 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
262 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
263 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
264 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
265 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
266 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
267 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
268 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
269 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
270 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
271 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
272 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
297 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
298 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
299 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
300 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
301 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
302 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
303 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
304 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
305 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
306 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
307 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
308 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
309 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
310 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
311 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
312 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
313 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
314 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
315 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
316 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
317 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
318 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
319 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
325 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
326 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
327 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
328 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
329 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
330 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
331 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
332 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
335 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
336 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
337 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.94
Metatranscriptomes 14.95
Isolates 0.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1
Nodule 0
Rhizoplane 4.32
Rhizosphere 91.14
Stem 0
Stem Tuber 0
Unclassified 0.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496109_0581741 3300048912 Bacteria 1055
2 LJNas_1014707 3300000546 Bacteria 834
3 JGI24737J22298_10175223 3300001990 Bacteria 633
4 JGI24751J29686_10056317 3300002459 Bacteria 810
5 Ga0006778J45830_1006978 3300003162 Bacteria 573
6 Ga0006778J45830_1030066 3300003162 Bacteria 693
7 Ga0006759J45824_1007047 3300003163 Bacteria 1138
8 Ga0006759J45824_1024096 3300003163 Bacteria 700
9 Ga0006770J48903_1022477 3300003305 Bacteria 654
10 Ga0006770J48903_1051261 3300003305 Bacteria 504
11 Ga0006777J48905_1008271 3300003308 Bacteria 630
12 Ga0006777J48905_1013170 3300003308 Bacteria 535
13 Ga0006777J48905_1018613 3300003308 Bacteria 955
14 Ga0006777J48905_1058056 3300003308 Bacteria 520
15 Ga0007417J51691_1009758 3300003544 Bacteria 624
16 Ga0007417J51691_1010669 3300003544 Bacteria 618
17 Ga0007417J51691_1017034 3300003544 Bacteria 510
18 Ga0007427J51700_103879 3300003559 Bacteria 584
19 Ga0007427J51700_106380 3300003559 Bacteria 507
20 Ga0007427J51700_106768 3300003559 Bacteria 539
21 Ga0007427J51700_108616 3300003559 Bacteria 526
22 Ga0007427J51700_109703 3300003559 Bacteria 539
23 Ga0006781J51513_1004736 3300003568 Bacteria 555
24 Ga0006781J51513_1005144 3300003568 Bacteria 640
25 Ga0006781J51513_1008276 3300003568 Bacteria 565
26 Ga0006781J51513_1016207 3300003568 Bacteria 549
27 Ga0007410J51695_1003955 3300003574 Bacteria 652
28 Ga0007410J51695_1006052 3300003574 Bacteria 664
29 Ga0007410J51695_1008537 3300003574 Bacteria 532
30 Ga0007410J51695_1008650 3300003574 Bacteria 1241
31 Ga0007410J51695_1014560 3300003574 Bacteria 712
32 Ga0007410J51695_1021268 3300003574 Bacteria 689
33 Ga0007410J51695_1030058 3300003574 Bacteria 684
34 Ga0007409J51694_1005738 3300003575 Bacteria 623
35 Ga0007409J51694_1006510 3300003575 Bacteria 617
36 Ga0007409J51694_1009792 3300003575 Bacteria 1060
37 Ga0007409J51694_1042272 3300003575 Bacteria 587
38 Ga0007409J51694_1042830 3300003575 Bacteria 690
39 Ga0007416J51690_1010660 3300003577 Bacteria 651
40 Ga0007416J51690_1010812 3300003577 Bacteria 853
41 Ga0007416J51690_1014513 3300003577 Bacteria 573
42 Ga0007416J51690_1016516 3300003577 Bacteria 528
43 Ga0007429J51699_1005254 3300003579 Bacteria 672
44 Ga0007429J51699_1006457 3300003579 Bacteria 533
45 Ga0007429J51699_1006469 3300003579 Bacteria 651
46 Ga0007429J51699_1007768 3300003579 Bacteria 523
47 Ga0007429J51699_1009271 3300003579 Bacteria 1125
48 Ga0007429J51699_1012664 3300003579 Bacteria 713
49 Ga0007429J51699_1013322 3300003579 Bacteria 557
50 Ga0007429J51699_1015556 3300003579 Bacteria 577
51 Ga0007429J51699_1025858 3300003579 Bacteria 521
52 Ga0007429J51699_1072535 3300003579 Bacteria 571
53 Ga0007411J51799_105395 3300003611 Bacteria 522
54 Ga0007411J51799_105620 3300003611 Bacteria 906
55 Ga0007411J51799_105900 3300003611 Bacteria 533
56 Ga0007415J51800_109181 3300003613 Bacteria 613
57 Ga0032354_1003553 3300003693 Bacteria 1181
58 Ga0032354_1004672 3300003693 Bacteria 581
59 Ga0032354_1013360 3300003693 Bacteria 504
60 Ga0032354_1015829 3300003693 Bacteria 567
61 Ga0032354_1017283 3300003693 Bacteria 580
62 Ga0032354_1025268 3300003693 Bacteria 554
63 Ga0032354_1029546 3300003693 Bacteria 558
64 Ga0006780_1008661 3300003735 Bacteria 571
65 Ga0006780_1008926 3300003735 Bacteria 621
66 Ga0006780_1010216 3300003735 Bacteria 515
67 Ga0006780_1011636 3300003735 Bacteria 562
68 Ga0006780_1024020 3300003735 Bacteria 543
69 Ga0058863_11889079 3300004799 Bacteria 537
70 Ga0058863_11933179 3300004799 Bacteria 523
71 Ga0058861_12048937 3300004800 Bacteria 697
72 Ga0058862_10001504 3300004803 Bacteria 601
73 Ga0058862_10043888 3300004803 Bacteria 524
74 Ga0070658_10845196 3300005327 Bacteria 795
75 Ga0070658_11691364 3300005327 Bacteria 548
76 Ga0070676_10141356 3300005328 Bacteria 1533
77 Ga0070676_10456199 3300005328 Bacteria 900
78 Ga0070676_10706797 3300005328 Bacteria 736
79 Ga0070683_100103625 3300005329 Bacteria 2681
80 Ga0070683_100304003 3300005329 Bacteria 1518
81 Ga0070683_100379496 3300005329 Bacteria 1347
82 Ga0070683_100478274 3300005329 Bacteria 1189
83 Ga0070670_100176418 3300005331 Bacteria 1854
84 Ga0070670_101050758 3300005331 Bacteria 742
85 Ga0068869_100187444 3300005334 Bacteria 1625
86 Ga0068869_100531329 3300005334 Bacteria 986
87 Ga0068869_100769246 3300005334 Bacteria 826
88 Ga0068869_101073307 3300005334 Bacteria 704
89 Ga0068869_101747541 3300005334 Bacteria 556
90 Ga0070666_10314766 3300005335 Bacteria 1116
91 Ga0070680_100680583 3300005336 Bacteria 885
92 Ga0070680_101299364 3300005336 Bacteria 630
93 Ga0070682_100739860 3300005337 Bacteria 793
94 Ga0070682_100971856 3300005337 Bacteria 703
95 Ga0068868_100058570 3300005338 Bacteria 3045
96 Ga0068868_100120383 3300005338 Bacteria 2140
97 Ga0068868_100180193 3300005338 Bacteria 1752
98 Ga0068868_100763702 3300005338 Bacteria 869
99 Ga0068868_101477830 3300005338 Bacteria 636
100 Ga0070660_100158918 3300005339 Bacteria 1820
101 Ga0070660_100237223 3300005339 Bacteria 1485
102 Ga0070689_100685674 3300005340 Bacteria 893
103 Ga0070689_101124207 3300005340 Bacteria 703
104 Ga0070691_10305191 3300005341 Bacteria 871
105 Ga0070691_10482031 3300005341 Bacteria 714
106 Ga0070687_100025135 3300005343 Bacteria 2853
107 Ga0070661_100190329 3300005344 Bacteria 1565
108 Ga0070661_100985427 3300005344 Bacteria 699
109 Ga0070661_101143898 3300005344 Bacteria 650
110 Ga0070692_10262616 3300005345 Bacteria 1039
111 Ga0070692_10366379 3300005345 Bacteria 900
112 Ga0070692_10387205 3300005345 Bacteria 879
113 Ga0070692_10409934 3300005345 Bacteria 858
114 Ga0070692_11338221 3300005345 Bacteria 515
115 Ga0070668_100052468 3300005347 Bacteria 3143
116 Ga0070668_100059593 3300005347 Bacteria 2955
117 Ga0070668_100061176 3300005347 Bacteria 2917
118 Ga0070668_100305297 3300005347 Bacteria 1336
119 Ga0070668_100954065 3300005347 Bacteria 769
120 Ga0070668_101144411 3300005347 Bacteria 704
121 Ga0070669_100371550 3300005353 Bacteria 1165
122 Ga0070675_100573916 3300005354 Bacteria 1021
123 Ga0070675_101547743 3300005354 Bacteria 612
124 Ga0070674_100035917 3300005356 Bacteria 3323
125 Ga0070674_100194315 3300005356 Bacteria 1563
126 Ga0070674_100324863 3300005356 Bacteria 1235
127 Ga0070674_100459570 3300005356 Bacteria 1052
128 Ga0070674_100523755 3300005356 Bacteria 991
129 Ga0070674_100552909 3300005356 Bacteria 966
130 Ga0070674_101278746 3300005356 Bacteria 653
131 Ga0070673_101286586 3300005364 Bacteria 686
132 Ga0070673_101573208 3300005364 Bacteria 621
133 Ga0070659_100157258 3300005366 Bacteria 1857
134 Ga0070659_100172871 3300005366 Bacteria 1770
135 Ga0070659_100188874 3300005366 Bacteria 1693
136 Ga0070659_100822468 3300005366 Bacteria 809
137 Ga0070659_100828220 3300005366 Bacteria 806
138 Ga0070659_101355565 3300005366 Bacteria 632
139 Ga0070659_101395456 3300005366 Bacteria 623
140 Ga0070667_100003375 3300005367 Bacteria 13621
141 Ga0070667_101421852 3300005367 Bacteria 651
142 Ga0070713_100578062 3300005436 Bacteria 1066
143 Ga0070713_101379227 3300005436 Unclassified 683
144 Ga0070713_102443306 3300005436 Unclassified 505
145 Ga0070701_10036044 3300005438 Bacteria 2490
146 Ga0070701_10319866 3300005438 Bacteria 960
147 Ga0070701_10415569 3300005438 Bacteria 856
148 Ga0070701_11299374 3300005438 Bacteria 520
149 Ga0070711_100651519 3300005439 Bacteria 883
150 Ga0070705_100937206 3300005440 Bacteria 699
151 Ga0070700_100007498 3300005441 Bacteria 5898
152 Ga0070700_100041180 3300005441 Bacteria 2831
153 Ga0070700_100108756 3300005441 Bacteria 1839
154 Ga0070700_100143566 3300005441 Bacteria 1625
155 Ga0070700_100270407 3300005441 Bacteria 1228
156 Ga0070700_100295807 3300005441 Bacteria 1180
157 Ga0070694_100811127 3300005444 Bacteria 768
158 Ga0070694_101461185 3300005444 Bacteria 578
159 Ga0070708_101704180 3300005445 Bacteria 586
160 Ga0070663_100094249 3300005455 Bacteria 2223
161 Ga0070663_100341111 3300005455 Bacteria 1211
162 Ga0070663_100381094 3300005455 Bacteria 1149
163 Ga0070663_101184728 3300005455 Bacteria 671
164 Ga0070663_101338870 3300005455 Bacteria 633
165 Ga0070678_100113339 3300005456 Bacteria 2125
166 Ga0070678_100126513 3300005456 Bacteria 2024
167 Ga0070678_100498935 3300005456 Bacteria 1073
168 Ga0070678_100868703 3300005456 Bacteria 823
169 Ga0070678_101033123 3300005456 Bacteria 756
170 Ga0070678_102003771 3300005456 Bacteria 548
171 Ga0070662_100291849 3300005457 Bacteria 1322
172 Ga0070662_100636849 3300005457 Bacteria 899
173 Ga0070662_100753625 3300005457 Bacteria 826
174 Ga0070662_101911771 3300005457 Bacteria 513
175 Ga0068867_100287468 3300005459 Bacteria 1350
176 Ga0068867_100742623 3300005459 Bacteria 870
177 Ga0068867_100928843 3300005459 Bacteria 785
178 Ga0068867_101516242 3300005459 Bacteria 625
179 Ga0068867_101834662 3300005459 Bacteria 571
180 Ga0070685_10258036 3300005466 Bacteria 1158
181 Ga0070685_10382875 3300005466 Bacteria 970
182 Ga0070679_101646096 3300005530 Bacteria 590
183 Ga0070679_102025977 3300005530 Bacteria 525
184 Ga0070684_100145639 3300005535 Bacteria 2144
185 Ga0070684_100247567 3300005535 Bacteria 1629
186 Ga0070684_100708528 3300005535 Bacteria 939
187 Ga0070684_100864281 3300005535 Bacteria 847
188 Ga0070684_101466785 3300005535 Bacteria 643
189 Ga0068853_100264634 3300005539 Bacteria 1582
190 Ga0068853_100704089 3300005539 Bacteria 964
191 Ga0068853_102168666 3300005539 Bacteria 539
192 Ga0068853_102435851 3300005539 Bacteria 507
193 Ga0070672_100090629 3300005543 Bacteria 2466
194 Ga0070672_100525206 3300005543 Bacteria 1026
195 Ga0070672_101117783 3300005543 Bacteria 701
196 Ga0070672_101826615 3300005543 Bacteria 547
197 Ga0070695_101156954 3300005545 Bacteria 635
198 Ga0070696_100705633 3300005546 Bacteria 823
199 Ga0070696_100943712 3300005546 Bacteria 718
200 Ga0070693_100292546 3300005547 Bacteria 1095
201 Ga0070693_101394990 3300005547 Bacteria 544
202 Ga0070665_100346850 3300005548 Bacteria 1490
203 Ga0070665_101140825 3300005548 Bacteria 791
204 Ga0070665_101251310 3300005548 Bacteria 752
205 Ga0070704_100529554 3300005549 Bacteria 1027
206 Ga0070704_100990444 3300005549 Bacteria 760
207 Ga0068855_102459562 3300005563 Bacteria 519
208 Ga0070664_100029021 3300005564 Bacteria 4609
209 Ga0070664_100176802 3300005564 Bacteria 1895
210 Ga0070664_100471421 3300005564 Bacteria 1154
211 Ga0070664_100830363 3300005564 Bacteria 865
212 Ga0070664_100831908 3300005564 Bacteria 864
213 Ga0068857_100290287 3300005577 Bacteria 1506
214 Ga0068857_100567820 3300005577 Bacteria 1070
215 Ga0068857_102181745 3300005577 Bacteria 544
216 Ga0068854_100114604 3300005578 Bacteria 2038
217 Ga0068854_100307540 3300005578 Bacteria 1284
218 Ga0068854_100613935 3300005578 Bacteria 930
219 Ga0068854_100775398 3300005578 Bacteria 834
220 Ga0068854_100982004 3300005578 Bacteria 747
221 Ga0068854_101142576 3300005578 Bacteria 695
222 Ga0068856_100630194 3300005614 Bacteria 1093
223 Ga0068856_101441560 3300005614 Bacteria 703
224 Ga0070702_100065310 3300005615 Bacteria 2131
225 Ga0070702_100112980 3300005615 Bacteria 1688
226 Ga0070702_100370213 3300005615 Bacteria 1015
227 Ga0070702_100576098 3300005615 Bacteria 840
228 Ga0070702_100591037 3300005615 Bacteria 830
229 Ga0070702_101664008 3300005615 Bacteria 530
230 Ga0068852_100127091 3300005616 Bacteria 2342
231 Ga0068852_100230378 3300005616 Bacteria 1766
232 Ga0068852_100535875 3300005616 Bacteria 1169
233 Ga0068852_100571478 3300005616 Bacteria 1132
234 Ga0068852_101433512 3300005616 Bacteria 713
235 Ga0068852_102386417 3300005616 Bacteria 549
236 Ga0068859_100231937 3300005617 Bacteria 1934
237 Ga0068864_100513907 3300005618 Bacteria 1154
238 Ga0068864_101722611 3300005618 Bacteria 632
239 Ga0068864_101823990 3300005618 Bacteria 614
240 Ga0068864_102675502 3300005618 Bacteria 505
241 Ga0068866_10308644 3300005718 Bacteria 991
242 Ga0068866_10388871 3300005718 Bacteria 896
243 Ga0068866_10406927 3300005718 Bacteria 879
244 Ga0068866_10422821 3300005718 Bacteria 865
245 Ga0068861_100152183 3300005719 Bacteria 1899
246 Ga0068861_100781123 3300005719 Bacteria 895
247 Ga0068861_100828435 3300005719 Bacteria 871
248 Ga0068861_100969972 3300005719 Bacteria 809
249 Ga0068861_101037323 3300005719 Bacteria 785
250 Ga0068861_101155387 3300005719 Bacteria 746
251 Ga0068861_101423749 3300005719 Bacteria 678
252 Ga0068851_10082706 3300005834 Bacteria 1679
253 Ga0068851_10214643 3300005834 Bacteria 1079
254 Ga0068870_10411404 3300005840 Bacteria 883
255 Ga0068870_10539025 3300005840 Bacteria 784
256 Ga0068870_11407912 3300005840 Bacteria 511
257 Ga0068863_100578245 3300005841 Bacteria 1111
258 Ga0068863_100881202 3300005841 Bacteria 895
259 Ga0068863_101775086 3300005841 Bacteria 627
260 Ga0068858_100526244 3300005842 Bacteria 1144
261 Ga0068858_100545902 3300005842 Bacteria 1122
262 Ga0068858_100616835 3300005842 Bacteria 1053
263 Ga0068860_100175243 3300005843 Bacteria 2073
264 Ga0068860_100533207 3300005843 Bacteria 1175
265 Ga0068860_101825764 3300005843 Bacteria 630
266 Ga0068862_100012377 3300005844 Bacteria 7054
267 Ga0068862_100827718 3300005844 Bacteria 906
268 Ga0068862_101891264 3300005844 Bacteria 607
269 Ga0081455_10363817 3300005937 Bacteria 1016
270 Ga0081455_10514937 3300005937 Bacteria 800
271 Ga0081455_10618924 3300005937 Bacteria 703
272 Ga0081455_10734518 3300005937 Bacteria 625
273 Ga0081538_10002487 3300005981 Bacteria 17972
274 Ga0081538_10057017 3300005981 Bacteria 2282
275 Ga0081538_10083806 3300005981 Bacteria 1683
276 Ga0070717_10007823 3300006028 Bacteria 7953
277 Ga0070717_10175049 3300006028 Bacteria 1868
278 Ga0075365_10061565 3300006038 Bacteria 2507
279 Ga0075365_10650614 3300006038 Bacteria 745
280 Ga0075365_10980451 3300006038 Bacteria 596
281 Ga0075365_11255162 3300006038 Bacteria 521
282 Ga0075364_10065451 3300006051 Bacteria 2386
283 Ga0075432_10124679 3300006058 Bacteria 970
284 Ga0075432_10174073 3300006058 Bacteria 839
285 Ga0075432_10280244 3300006058 Bacteria 686
286 Ga0097621_101038544 3300006237 Bacteria 768
287 Ga0097621_101418646 3300006237 Bacteria 658
288 Ga0097621_101782716 3300006237 Bacteria 587
289 Ga0068871_100381637 3300006358 Bacteria 1252
290 Ga0075428_100138350 3300006844 Bacteria 2647
291 Ga0075428_100386864 3300006844 Bacteria 1499
292 Ga0075428_101632234 3300006844 Bacteria 674
293 Ga0075428_101850903 3300006844 Bacteria 628
294 Ga0075430_100004485 3300006846 Bacteria 11761
295 Ga0075430_100323950 3300006846 Bacteria 1274
296 Ga0075431_100357753 3300006847 Bacteria 1467
297 Ga0075431_100612754 3300006847 Bacteria 1072
298 Ga0075431_101327903 3300006847 Bacteria 680
299 Ga0075433_10926483 3300006852 Bacteria 760
300 Ga0075434_101909840 3300006871 Bacteria 600
301 Ga0075429_100478175 3300006880 Bacteria 1091
302 Ga0075429_101836067 3300006880 Bacteria 526
303 Ga0068865_100175672 3300006881 Bacteria 1646
304 Ga0068865_100501002 3300006881 Bacteria 1012
305 Ga0068865_100809875 3300006881 Bacteria 809
306 Ga0068865_101185046 3300006881 Bacteria 676
307 Ga0068865_101325058 3300006881 Bacteria 641
308 Ga0068865_101658826 3300006881 Bacteria 576
309 Ga0097620_100231925 3300006931 Bacteria 1934
310 Ga0105251_10367207 3300009011 Bacteria 658
311 Ga0105244_10367544 3300009036 Bacteria 663
312 Ga0105244_10515133 3300009036 Bacteria 551
313 Ga0105250_10369807 3300009092 Bacteria 631
314 Ga0111539_10023235 3300009094 Bacteria 7616
315 Ga0111539_10147349 3300009094 Bacteria 2756
316 Ga0111539_10383744 3300009094 Bacteria 1636
317 Ga0111539_10469196 3300009094 Bacteria 1466
318 Ga0111539_10782991 3300009094 Bacteria 1110
319 Ga0105245_10001268 3300009098 Bacteria 22811
320 Ga0105245_10083979 3300009098 Bacteria 2916
321 Ga0105245_10129568 3300009098 Bacteria 2365
322 Ga0105245_10365459 3300009098 Bacteria 1433
323 Ga0105245_10457807 3300009098 Bacteria 1285
324 Ga0105245_10552293 3300009098 Bacteria 1174
325 Ga0105245_10598992 3300009098 Bacteria 1128
326 Ga0105247_10862081 3300009101 Bacteria 696
327 Ga0114129_10112537 3300009147 Bacteria 3754
328 Ga0114129_11043402 3300009147 Bacteria 1027
329 Ga0114129_12278103 3300009147 Bacteria 650
330 Ga0105243_10136973 3300009148 Bacteria 2084
331 Ga0105243_10276094 3300009148 Bacteria 1511
332 Ga0105243_10279147 3300009148 Bacteria 1504
333 Ga0105243_10735887 3300009148 Bacteria 965
334 Ga0105243_10982979 3300009148 Bacteria 845
335 Ga0105243_11204168 3300009148 Bacteria 771
336 Ga0105243_12460158 3300009148 Bacteria 559
337 Ga0105241_10991080 3300009174 Bacteria 785
338 Ga0105242_10197829 3300009176 Bacteria 1783
339 Ga0105242_10877122 3300009176 Bacteria 895
340 Ga0105242_11331646 3300009176 Bacteria 743
341 Ga0105242_11484235 3300009176 Bacteria 708
342 Ga0105242_12819904 3300009176 Bacteria 536
343 Ga0105242_12949416 3300009176 Bacteria 526
344 Ga0105248_10758230 3300009177 Bacteria 1095
345 Ga0105248_10959924 3300009177 Bacteria 965
346 Ga0105248_11132324 3300009177 Bacteria 885
347 Ga0105237_10763446 3300009545 Bacteria 974
348 Ga0105249_10009622 3300009553 Bacteria 8469
349 Ga0105249_10223458 3300009553 Bacteria 1854
350 Ga0105249_10568944 3300009553 Bacteria 1185
351 Ga0105249_10663281 3300009553 Bacteria 1101
352 Ga0105249_10689889 3300009553 Bacteria 1081
353 Ga0105249_10802907 3300009553 Bacteria 1005
354 Ga0105249_10843462 3300009553 Bacteria 982
355 Ga0105249_12165586 3300009553 Bacteria 629
356 Ga0105249_12850636 3300009553 Bacteria 555
357 Ga0105239_10199104 3300010375 Bacteria 2244
358 Ga0105239_10493747 3300010375 Bacteria 1391
359 Ga0105239_10987439 3300010375 Bacteria 968
360 Ga0105239_11811714 3300010375 Bacteria 707
361 Ga0105239_12422641 3300010375 Bacteria 611
362 Ga0105239_12496343 3300010375 Bacteria 602
363 Ga0105246_10282283 3300011119 Bacteria 1333
364 Ga0105246_10656037 3300011119 Bacteria 914
365 Ga0105246_10841055 3300011119 Bacteria 818
366 Ga0105246_11317395 3300011119 Bacteria 670
367 Ga0105246_11361682 3300011119 Bacteria 660
368 Ga0157318_1032935 3300012482 Bacteria 521
369 Ga0157371_10986024 3300013102 Bacteria 642
370 Ga0157371_11175791 3300013102 Bacteria 590
371 Ga0157374_10976742 3300013296 Bacteria 866
372 Ga0157374_12042960 3300013296 Bacteria 600
373 Ga0157378_10833781 3300013297 Bacteria 949
374 Ga0157378_11331909 3300013297 Bacteria 760
375 Ga0157378_12690587 3300013297 Bacteria 550
376 Ga0157378_12755060 3300013297 Bacteria 544
377 Ga0163162_10327806 3300013306 Bacteria 1663
378 Ga0163162_10854626 3300013306 Bacteria 1025
379 Ga0163162_10900901 3300013306 Bacteria 998
380 Ga0163162_11336434 3300013306 Bacteria 815
381 Ga0157372_10510761 3300013307 Bacteria 1401
382 Ga0157372_10824247 3300013307 Bacteria 1077
383 Ga0157372_10969237 3300013307 Bacteria 985
384 Ga0157372_11071072 3300013307 Bacteria 933
385 Ga0157372_11104195 3300013307 Bacteria 917
386 Ga0157372_11575894 3300013307 Bacteria 756
387 Ga0157375_10795836 3300013308 Bacteria 1094
388 Ga0157375_10806450 3300013308 Bacteria 1087
389 Ga0157375_11142838 3300013308 Bacteria 912
390 Ga0157375_12682320 3300013308 Bacteria 596
391 Ga0157375_12906678 3300013308 Bacteria 572
392 Ga0163163_10227812 3300014325 Bacteria 1913
393 Ga0163163_10283497 3300014325 Bacteria 1708
394 Ga0163163_10650140 3300014325 Bacteria 1118
395 Ga0163163_10765408 3300014325 Bacteria 1029
396 Ga0163163_11159405 3300014325 Bacteria 835
397 Ga0163163_12111430 3300014325 Bacteria 623
398 Ga0157380_10051035 3300014326 Bacteria 3269
399 Ga0157380_10158015 3300014326 Bacteria 1967
400 Ga0157380_10435327 3300014326 Bacteria 1255
401 Ga0157380_10485627 3300014326 Bacteria 1196
402 Ga0157380_11016407 3300014326 Bacteria 863
403 Ga0157380_11384085 3300014326 Bacteria 753
404 Ga0182008_10351799 3300014497 Bacteria 781
405 Ga0182008_10563841 3300014497 Bacteria 634
406 Ga0157377_10070204 3300014745 Bacteria 2023
407 Ga0157377_10654734 3300014745 Bacteria 756
408 Ga0157379_10139136 3300014968 Bacteria 2188
409 Ga0157379_11200490 3300014968 Bacteria 730
410 Ga0157379_11773498 3300014968 Bacteria 606
411 Ga0157379_11791405 3300014968 Bacteria 603
412 Ga0157379_11806502 3300014968 Bacteria 601
413 Ga0163161_10326080 3300017792 Bacteria 1215
414 Ga0163161_10984699 3300017792 Bacteria 719
415 Ga0163161_11038649 3300017792 Bacteria 701
416 Ga0163161_11763464 3300017792 Bacteria 550
417 Ga0197907_10430016 3300020069 Bacteria 513
418 Ga0197907_10667705 3300020069 Bacteria 517
419 Ga0206356_10053793 3300020070 Bacteria 645
420 Ga0206356_11299228 3300020070 Bacteria 520
421 Ga0206349_1069091 3300020075 Bacteria 572
422 Ga0206349_1822211 3300020075 Bacteria 621
423 Ga0206351_10232741 3300020077 Bacteria 512
424 Ga0206351_10592516 3300020077 Bacteria 507
425 Ga0206352_10214145 3300020078 Bacteria 703
426 Ga0206352_10712691 3300020078 Bacteria 572
427 Ga0206350_11656942 3300020080 Bacteria 661
428 Ga0206354_10900142 3300020081 Bacteria 629
429 Ga0206354_11064614 3300020081 Bacteria 576
430 Ga0206354_11259038 3300020081 Bacteria 647
431 Ga0206354_11378764 3300020081 Bacteria 545
432 Ga0206354_11683722 3300020081 Bacteria 776
433 Ga0206353_10414632 3300020082 Bacteria 517
434 Ga0206353_11749501 3300020082 Bacteria 740
435 Ga0213874_10002171 3300021377 Bacteria 4161
436 Ga0213874_10016883 3300021377 Bacteria 1951
437 Ga0213876_10087479 3300021384 Bacteria 1649
438 Ga0213875_10014948 3300021388 Bacteria 3781
439 Ga0213875_10240072 3300021388 Bacteria 854
440 Ga0207656_10320598 3300025321 Bacteria 770
441 Ga0207642_10296036 3300025899 Bacteria 936
442 Ga0207642_10304661 3300025899 Bacteria 925
443 Ga0207642_10966280 3300025899 Bacteria 548
444 Ga0207688_10077309 3300025901 Bacteria 1896
445 Ga0207688_10146875 3300025901 Bacteria 1390
446 Ga0207688_10162834 3300025901 Bacteria 1323
447 Ga0207688_10183866 3300025901 Bacteria 1247
448 Ga0207688_10819227 3300025901 Bacteria 590
449 Ga0207680_10686399 3300025903 Bacteria 734
450 Ga0207645_10505379 3300025907 Bacteria 819
451 Ga0207643_10268873 3300025908 Bacteria 1054
452 Ga0207643_10562216 3300025908 Bacteria 732
453 Ga0207643_10756554 3300025908 Bacteria 629
454 Ga0207643_11091211 3300025908 Bacteria 515
455 Ga0207705_10877352 3300025909 Bacteria 695
456 Ga0207654_11054567 3300025911 Bacteria 592
457 Ga0207654_11371907 3300025911 Bacteria 515
458 Ga0207671_10713054 3300025914 Bacteria 798
459 Ga0207663_10603098 3300025916 Bacteria 863
460 Ga0207662_10045169 3300025918 Bacteria 2604
461 Ga0207662_10384196 3300025918 Bacteria 949
462 Ga0207662_10603439 3300025918 Bacteria 764
463 Ga0207657_10195323 3300025919 Bacteria 1630
464 Ga0207657_10255481 3300025919 Bacteria 1396
465 Ga0207657_10265601 3300025919 Bacteria 1365
466 Ga0207657_10395716 3300025919 Bacteria 1087
467 Ga0207649_10110288 3300025920 Bacteria 1837
468 Ga0207649_11562504 3300025920 Bacteria 522
469 Ga0207652_10800431 3300025921 Bacteria 837
470 Ga0207652_11654562 3300025921 Bacteria 545
471 Ga0207681_10915253 3300025923 Bacteria 735
472 Ga0207650_10593442 3300025925 Bacteria 931
473 Ga0207659_10156492 3300025926 Bacteria 1785
474 Ga0207687_10007771 3300025927 Bacteria 7034
475 Ga0207687_10133473 3300025927 Bacteria 1875
476 Ga0207687_10335173 3300025927 Bacteria 1228
477 Ga0207687_11591001 3300025927 Bacteria 561
478 Ga0207700_11179307 3300025928 Unclassified 684
479 Ga0207664_11626994 3300025929 Bacteria 568
480 Ga0207644_11231889 3300025931 Bacteria 629
481 Ga0207690_11181353 3300025932 Bacteria 639
482 Ga0207690_11825682 3300025932 Bacteria 507
483 Ga0207706_10040158 3300025933 Bacteria 4147
484 Ga0207706_10166500 3300025933 Bacteria 1937
485 Ga0207706_10293102 3300025933 Bacteria 1418
486 Ga0207706_11046828 3300025933 Bacteria 684
487 Ga0207686_10860944 3300025934 Bacteria 729
488 Ga0207686_11271596 3300025934 Bacteria 603
489 Ga0207686_11285928 3300025934 Bacteria 600
490 Ga0207709_10058061 3300025935 Bacteria 2403
491 Ga0207709_10344063 3300025935 Bacteria 1123
492 Ga0207709_10367730 3300025935 Bacteria 1091
493 Ga0207669_10037104 3300025937 Bacteria 2793
494 Ga0207669_10037110 3300025937 Bacteria 2792
495 Ga0207669_10160669 3300025937 Bacteria 1587
496 Ga0207669_10217997 3300025937 Bacteria 1398
497 Ga0207669_10485676 3300025937 Bacteria 985
498 Ga0207669_10550847 3300025937 Bacteria 931
499 Ga0207704_10112293 3300025938 Bacteria 1845
500 Ga0207704_11089308 3300025938 Bacteria 678
501 Ga0207665_10245243 3300025939 Unclassified 1322
502 Ga0207691_10077035 3300025940 Bacteria 3005
503 Ga0207691_10375406 3300025940 Bacteria 1214
504 Ga0207691_11600823 3300025940 Bacteria 530
505 Ga0207689_10107897 3300025942 Bacteria 2288
506 Ga0207689_10211022 3300025942 Bacteria 1604
507 Ga0207689_10426045 3300025942 Bacteria 1108
508 Ga0207689_11458917 3300025942 Bacteria 572
509 Ga0207661_10430724 3300025944 Bacteria 1199
510 Ga0207661_10455337 3300025944 Bacteria 1166
511 Ga0207661_10981120 3300025944 Bacteria 778
512 Ga0207661_11488549 3300025944 Bacteria 620
513 Ga0207661_11928336 3300025944 Bacteria 536
514 Ga0207679_10517285 3300025945 Bacteria 1067
515 Ga0207679_10653117 3300025945 Bacteria 951
516 Ga0207679_10672193 3300025945 Bacteria 938
517 Ga0207679_10673982 3300025945 Bacteria 937
518 Ga0207679_10755434 3300025945 Bacteria 885
519 Ga0207651_11272291 3300025960 Bacteria 661
520 Ga0207712_10027758 3300025961 Bacteria 3782
521 Ga0207712_10064484 3300025961 Bacteria 2612
522 Ga0207712_10282031 3300025961 Bacteria 1356
523 Ga0207712_10382122 3300025961 Bacteria 1179
524 Ga0207712_10665495 3300025961 Bacteria 906
525 Ga0207712_10918509 3300025961 Bacteria 774
526 Ga0207668_10040939 3300025972 Bacteria 3129
527 Ga0207668_10185303 3300025972 Bacteria 1645
528 Ga0207668_10563795 3300025972 Bacteria 988
529 Ga0207668_10941796 3300025972 Bacteria 770
530 Ga0207668_10983884 3300025972 Bacteria 753
531 Ga0207640_10089619 3300025981 Bacteria 2126
532 Ga0207640_10152125 3300025981 Bacteria 1701
533 Ga0207640_10204332 3300025981 Bacteria 1500
534 Ga0207640_11616217 3300025981 Bacteria 584
535 Ga0207640_11687811 3300025981 Bacteria 572
536 Ga0207640_11890384 3300025981 Bacteria 540
537 Ga0207658_10012783 3300025986 Bacteria 5732
538 Ga0207658_11154517 3300025986 Bacteria 708
539 Ga0207677_10084126 3300026023 Bacteria 2292
540 Ga0207677_10517047 3300026023 Bacteria 1035
541 Ga0207677_10689124 3300026023 Bacteria 905
542 Ga0207677_11568556 3300026023 Bacteria 609
543 Ga0207677_11783437 3300026023 Bacteria 571
544 Ga0207703_11949059 3300026035 Bacteria 564
545 Ga0207703_12370930 3300026035 Bacteria 506
546 Ga0207639_12011224 3300026041 Bacteria 539
547 Ga0207678_10147083 3300026067 Bacteria 2011
548 Ga0207678_10380550 3300026067 Bacteria 1220
549 Ga0207678_10543594 3300026067 Bacteria 1015
550 Ga0207708_10003244 3300026075 Bacteria 11979
551 Ga0207708_10003676 3300026075 Bacteria 11329
552 Ga0207708_10309313 3300026075 Bacteria 1287
553 Ga0207708_10415709 3300026075 Bacteria 1114
554 Ga0207708_11022640 3300026075 Bacteria 719
555 Ga0207702_11448447 3300026078 Bacteria 680
556 Ga0207641_10674117 3300026088 Bacteria 1017
557 Ga0207641_11872480 3300026088 Bacteria 601
558 Ga0207641_12461375 3300026088 Bacteria 519
559 Ga0207648_10119133 3300026089 Bacteria 2320
560 Ga0207648_10161739 3300026089 Bacteria 1977
561 Ga0207648_10287272 3300026089 Bacteria 1472
562 Ga0207648_10313729 3300026089 Bacteria 1408
563 Ga0207648_10920021 3300026089 Bacteria 817
564 Ga0207648_10982815 3300026089 Bacteria 790
565 Ga0207676_10317459 3300026095 Bacteria 1429
566 Ga0207676_12287865 3300026095 Bacteria 538
567 Ga0207674_10093451 3300026116 Bacteria 2996
568 Ga0207674_10588304 3300026116 Bacteria 1075
569 Ga0207675_100073660 3300026118 Bacteria 3195
570 Ga0207675_100084343 3300026118 Bacteria 2981
571 Ga0207675_100170794 3300026118 Bacteria 2078
572 Ga0207675_100320673 3300026118 Bacteria 1513
573 Ga0207675_100635623 3300026118 Bacteria 1072
574 Ga0207675_101069062 3300026118 Bacteria 826
575 Ga0207675_101921352 3300026118 Bacteria 610
576 Ga0207683_10108519 3300026121 Bacteria 2484
577 Ga0207683_10401389 3300026121 Bacteria 1261
578 Ga0207683_10580676 3300026121 Bacteria 1037
579 Ga0207683_10856757 3300026121 Bacteria 844
580 Ga0207683_11575432 3300026121 Bacteria 606
581 Ga0207698_10119275 3300026142 Bacteria 2229
582 Ga0207698_10145570 3300026142 Bacteria 2049
583 Ga0207698_10556867 3300026142 Bacteria 1125
584 Ga0207698_11117857 3300026142 Bacteria 801
585 Ga0207698_11160599 3300026142 Bacteria 786
586 Ga0207428_10104135 3300027907 Bacteria 2190
587 Ga0207428_10705500 3300027907 Bacteria 721
588 Ga0207428_10944523 3300027907 Bacteria 608
589 Ga0268266_10018867 3300028379 Bacteria 5877
590 Ga0268266_10508342 3300028379 Bacteria 1151
591 Ga0268265_10010076 3300028380 Bacteria 6380
592 Ga0268265_10410357 3300028380 Bacteria 1255
593 Ga0268265_10625047 3300028380 Bacteria 1032
594 Ga0268265_11511869 3300028380 Bacteria 675
595 Ga0268265_11984312 3300028380 Bacteria 589
596 Ga0268264_10125832 3300028381 Bacteria 2265
597 Ga0268264_10135441 3300028381 Bacteria 2189
598 Ga0268264_10308775 3300028381 Bacteria 1492
599 Ga0307408_100146500 3300031548 Bacteria 1859
600 Ga0307408_101522163 3300031548 Bacteria 633
601 Ga0307408_101762638 3300031548 Bacteria 591
602 Ga0307405_10689194 3300031731 Bacteria 845
603 Ga0307405_11250886 3300031731 Bacteria 644
604 Ga0307405_11293970 3300031731 Bacteria 634
605 Ga0307405_11856042 3300031731 Bacteria 537
606 Ga0307405_12111464 3300031731 Bacteria 506
607 Ga0307413_10043107 3300031824 Bacteria 2657
608 Ga0307413_10046343 3300031824 Bacteria 2584
609 Ga0307413_10242154 3300031824 Bacteria 1332
610 Ga0307413_10358426 3300031824 Bacteria 1128
611 Ga0307413_11294614 3300031824 Bacteria 637
612 Ga0307413_11654849 3300031824 Bacteria 570
613 Ga0307410_10314792 3300031852 Bacteria 1240
614 Ga0307410_10646791 3300031852 Bacteria 886
615 Ga0307410_10867060 3300031852 Bacteria 772
616 Ga0307410_11137057 3300031852 Bacteria 678
617 Ga0307410_11951623 3300031852 Bacteria 523
618 Ga0326468_10021136 3300031889 Bacteria 779
619 Ga0307406_10050349 3300031901 Bacteria 2640
620 Ga0307406_10068045 3300031901 Bacteria 2324
621 Ga0307406_10192545 3300031901 Bacteria 1494
622 Ga0307406_10928605 3300031901 Bacteria 742
623 Ga0307406_11099126 3300031901 Bacteria 686
624 Ga0307406_11403931 3300031901 Bacteria 612
625 Ga0307406_12089912 3300031901 Bacteria 507
626 Ga0307407_10488373 3300031903 Bacteria 901
627 Ga0307407_10541572 3300031903 Bacteria 859
628 Ga0307407_10580014 3300031903 Bacteria 833
629 Ga0307407_10624613 3300031903 Bacteria 804
630 Ga0307407_10794213 3300031903 Bacteria 720
631 Ga0307407_10905567 3300031903 Bacteria 677
632 Ga0307407_10918307 3300031903 Bacteria 673
633 Ga0307407_11634579 3300031903 Bacteria 512
634 Ga0307412_10535091 3300031911 Bacteria 981
635 Ga0307412_11463692 3300031911 Bacteria 620
636 Ga0307412_11702237 3300031911 Bacteria 578
637 Ga0307409_100051857 3300031995 Bacteria 3142
638 Ga0307409_100053271 3300031995 Bacteria 3108
639 Ga0307409_100108405 3300031995 Bacteria 2322
640 Ga0307409_100205340 3300031995 Bacteria 1766
641 Ga0307409_100351939 3300031995 Bacteria 1390
642 Ga0307409_100362987 3300031995 Bacteria 1371
643 Ga0307409_100381643 3300031995 Bacteria 1340
644 Ga0307409_100493419 3300031995 Bacteria 1191
645 Ga0307409_100500427 3300031995 Bacteria 1183
646 Ga0307409_100529411 3300031995 Bacteria 1153
647 Ga0307409_102925617 3300031995 Bacteria 504
648 Ga0307416_100134797 3300032002 Bacteria 2231
649 Ga0307416_100265450 3300032002 Bacteria 1681
650 Ga0307416_100281210 3300032002 Bacteria 1641
651 Ga0307416_100482871 3300032002 Bacteria 1299
652 Ga0307416_100668311 3300032002 Bacteria 1125
653 Ga0307416_100802726 3300032002 Bacteria 1037
654 Ga0307416_102507035 3300032002 Bacteria 614
655 Ga0307416_103133369 3300032002 Bacteria 553
656 Ga0307416_103873472 3300032002 Bacteria 501
657 Ga0307414_10028131 3300032004 Bacteria 3642
658 Ga0307414_10698354 3300032004 Bacteria 918
659 Ga0307411_10014958 3300032005 Bacteria 4337
660 Ga0307411_11058383 3300032005 Bacteria 729
661 Ga0307411_11571789 3300032005 Bacteria 606
662 Ga0307415_100001128 3300032126 Bacteria 12471
663 Ga0307415_100053053 3300032126 Bacteria 2760
664 Ga0307415_100130211 3300032126 Bacteria 1903
665 Ga0307415_100144434 3300032126 Bacteria 1822
666 Ga0307415_100490266 3300032126 Bacteria 1072
667 Ga0307415_101669301 3300032126 Bacteria 614
668 Ga0307415_102073185 3300032126 Bacteria 555
669 Ga0307415_102221332 3300032126 Bacteria 537
670 Ga0373948_0081498 3300034817 Bacteria 739
671 Ga0373960_0107882 3300035121 Bacteria 910
672 Ga0265778_061862 3300036457 Bacteria 524
673 Ga0395899_0035319 3300037312 Bacteria 3753
674 Ga0395900_0048124 3300037418 Bacteria 4392
675 Ga0395900_0100325 3300037418 Bacteria 2974
676 Ga0395900_1288612 3300037418 Bacteria 645
677 Ga0395898_0007212 3300037466 Bacteria 11795
678 Ga0395898_0393762 3300037466 Bacteria 1321
679 Ga0395905_1185960 3300037471 Bacteria 667
680 Ga0395905_1260175 3300037471 Bacteria 643
681 Ga0436364_0022195 3300037853 Bacteria 519
682 Ga0436364_0614425 3300037853 Bacteria 1117
683 Ga0436364_1183959 3300037853 Bacteria 1386
684 Ga0436364_1247614 3300037853 Bacteria 6672
685 Ga0436364_1314373 3300037853 Bacteria 527
686 Ga0395901_0034679 3300038443 Bacteria 5212
687 Ga0395901_0104557 3300038443 Bacteria 2972
688 Ga0395901_0318806 3300038443 Bacteria 1609
689 Ga0395901_0812702 3300038443 Bacteria 923
690 Ga0395901_1953991 3300038443 Bacteria 533
691 Ga0436365_0450750 3300039437 Bacteria 901
692 Ga0436365_0587755 3300039437 Bacteria 524
693 Ga0436365_0765495 3300039437 Bacteria 4523
694 Ga0436365_0829535 3300039437 Bacteria 5344
695 Ga0436365_1155741 3300039437 Bacteria 2613
696 Ga0436365_1930528 3300039437 Bacteria 1867
697 Ga0436361_0283654 3300039447 Unclassified 710
698 Ga0436363_0359451 3300039450 Bacteria 2029
699 Ga0436363_0792821 3300039450 Bacteria 1092
700 Ga0436363_0996006 3300039450 Bacteria 1951
701 Ga0436363_1022758 3300039450 Bacteria 564
702 Ga0436363_1380086 3300039450 Unclassified 1752
703 Ga0436363_1561831 3300039450 Bacteria 614
704 Ga0436362_0291370 3300039453 Bacteria 1823
705 Ga0436362_0473346 3300039453 Bacteria 991
706 Ga0436362_0568001 3300039453 Bacteria 546
707 Ga0436362_1094366 3300039453 Bacteria 545
708 Ga0451789_1100807 3300041443 Bacteria 571
709 Ga0451807_2365518 3300041486 Bacteria 755
710 Ga0451845_0403861 3300041501 Bacteria 648
711 Ga0451847_0619045 3300041503 Bacteria 518
712 Ga0451849_0716166 3300041505 Bacteria 889
713 Ga0451855_0525654 3300041511 Bacteria 560
714 Ga0451855_1120017 3300041511 Bacteria 544
715 Ga0451853_0893288 3300041512 Bacteria 710
716 Ga0451853_1984273 3300041512 Bacteria 612
717 Ga0451853_2949496 3300041512 Bacteria 513
718 Ga0439448_0378851 3300042005 Bacteria 506
719 Ga0466969_0015113 3300044656 Bacteria 4049
720 Ga0466969_0199705 3300044656 Bacteria 912
721 Ga0466972_0331279 3300044658 Bacteria 712
722 Ga0466965_0058317 3300044683 Bacteria 1925
723 Ga0466966_0098377 3300044684 Bacteria 1812
724 Ga0466966_0644865 3300044684 Bacteria 638
725 Ga0466963_0024178 3300044694 Bacteria 3867
726 Ga0466963_0098620 3300044694 Bacteria 1997
727 Ga0466963_0821587 3300044694 Bacteria 655
728 Ga0466964_0002044 3300044706 Bacteria 7097
729 Ga0466971_0017795 3300044719 Bacteria 3148
730 Ga0466971_0448029 3300044719 Bacteria 633
731 Ga0466968_0024880 3300044735 Bacteria 2450
732 Ga0466957_0119283 3300044842 Bacteria 1680
733 Ga0466957_0407433 3300044842 Bacteria 931
734 Ga0466960_0010846 3300044901 Bacteria 3794
735 Ga0466960_0173178 3300044901 Bacteria 1166
736 Ga0466960_0370730 3300044901 Bacteria 820
737 Ga0466960_0627663 3300044901 Bacteria 640
738 Ga0466959_0008212 3300045049 Bacteria 7366
739 Ga0466959_0015755 3300045049 Bacteria 5514
740 Ga0466959_1026851 3300045049 Bacteria 549
741 Ga0466958_0071689 3300045836 Bacteria 2121
742 Ga0466958_0161196 3300045836 Bacteria 1417
743 Ga0466958_0208641 3300045836 Bacteria 1244
744 Ga0466958_0352755 3300045836 Bacteria 947
745 Ga0466958_0798925 3300045836 Bacteria 615
746 Ga0466967_0001552 3300045976 Bacteria 13460
747 Ga0466967_0524110 3300045976 Bacteria 1165
748 Ga0466967_0591338 3300045976 Bacteria 1095
749 Ga0466967_1061692 3300045976 Bacteria 807
750 Ga0466967_1390374 3300045976 Bacteria 699
751 Ga0495603_0115552 3300046455 Bacteria 1565
752 Ga0495653_0880318 3300046463 Bacteria 534
753 Ga0495582_0343033 3300046473 Bacteria 860
754 Ga0495605_0336477 3300046474 Bacteria 635
755 Ga0495584_0292350 3300046491 Bacteria 828
756 Ga0495584_0693759 3300046491 Bacteria 519
757 Ga0495596_0158197 3300046500 Bacteria 880
758 Ga0495596_0339483 3300046500 Bacteria 585
759 Ga0495596_0445684 3300046500 Bacteria 505
760 Ga0495644_0191235 3300046523 Bacteria 788
761 Ga0495652_0896309 3300046529 Bacteria 585
762 Ga0495609_0138868 3300046538 Bacteria 1038
763 Ga0495667_0344367 3300046559 Bacteria 942
764 Ga0495656_0268228 3300046615 Bacteria 867
765 Ga0495656_0594480 3300046615 Bacteria 592
766 Ga0495668_0600712 3300046616 Bacteria 608
767 Ga0495657_0409561 3300046675 Bacteria 797
768 Ga0495671_0453263 3300046692 Bacteria 613
769 Ga0495649_0279222 3300046694 Bacteria 854
770 Ga0495604_0691828 3300047317 Bacteria 648
771 Ga0495674_0539207 3300047319 Bacteria 930
772 Ga0495677_0389803 3300047445 Bacteria 551
773 Ga0495615_0107074 3300048090 Bacteria 796
774 Ga0496100_1294503 3300048903 Bacteria 575
775 Ga0496102_0065115 3300048905 Bacteria 3340
776 Ga0496102_1295001 3300048905 Bacteria 648
777 Ga0496102_1878599 3300048905 Bacteria 516
778 Ga0496103_0695045 3300048906 Bacteria 645
779 Ga0496106_0031885 3300048909 Bacteria 3927
780 Ga0496106_0147259 3300048909 Bacteria 1856
781 Ga0496107_0483890 3300048910 Bacteria 918
782 Ga0496107_0537994 3300048910 Bacteria 866
783 Ga0496107_0876523 3300048910 Bacteria 655
784 Ga0496108_0590559 3300048911 Bacteria 968
785 Ga0496108_0611654 3300048911 Bacteria 949
786 Ga0496108_0915942 3300048911 Bacteria 752
787 Ga0496109_0003104 3300048912 Bacteria 13851
788 Ga0496109_0938048 3300048912 Bacteria 803
789 Ga0496109_1221880 3300048912 Bacteria 688
790 Ga0496109_1569690 3300048912 Bacteria 593
791 Ga0496110_0079495 3300048913 Bacteria 2920
792 Ga0496110_0119454 3300048913 Bacteria 2374
793 Ga0496110_0157940 3300048913 Bacteria 2055
794 Ga0496110_1123071 3300048913 Bacteria 694
795 Ga0496110_1885224 3300048913 Bacteria 508
796 Ga0496111_0470839 3300048914 Bacteria 926
797 Ga0496111_1095717 3300048914 Bacteria 568
798 Ga0496112_0256953 3300048915 Bacteria 1697
799 Ga0496112_0489402 3300048915 Bacteria 1166
800 Ga0496112_0675278 3300048915 Bacteria 962
801 Ga0496112_1870205 3300048915 Bacteria 512
802 Ga0496113_0303613 3300048916 Bacteria 1278
803 Ga0496113_0767730 3300048916 Bacteria 767
804 Ga0496113_0982864 3300048916 Bacteria 665
805 Ga0496113_1548381 3300048916 Bacteria 511
806 Ga0496114_0444200 3300048917 Bacteria 1149
807 Ga0496114_1184940 3300048917 Bacteria 650
808 Ga0496114_1485523 3300048917 Bacteria 565
809 Ga0496115_0494400 3300048918 Bacteria 984
810 Ga0496121_0317054 3300048924 Bacteria 1051
811 Ga0496126_0743246 3300048929 Bacteria 758
812 Ga0501308_055509 3300049128 Bacteria 588
813 Ga0501309_049254 3300049129 Bacteria 659
814 Ga0501310_081167 3300049130 Bacteria 509
815 Ga0501304_027984 3300049160 Bacteria 588
816 Ga0501307_069819 3300049162 Bacteria 558
817 Ga0501313_045655 3300049529 Bacteria 597
818 Ga0501313_056225 3300049529 Bacteria 552
819 Ga0501315_049679 3300049531 Bacteria 656
820 Ga0501315_102693 3300049531 Bacteria 507
821 Ga0501316_029632 3300049532 Bacteria 727
822 Ga0501316_080659 3300049532 Bacteria 503
823 Ga0501317_016518 3300049533 Bacteria 958
824 Ga0501317_043808 3300049533 Bacteria 692
825 Ga0501317_045482 3300049533 Bacteria 683
826 Ga0501317_057988 3300049533 Bacteria 630
827 Ga0501317_068811 3300049533 Bacteria 594
828 Ga0501317_076140 3300049533 Bacteria 574
829 Ga0501317_081868 3300049533 Bacteria 560
830 Ga0501317_103566 3300049533 Bacteria 516
831 Ga0501318_025897 3300049534 Bacteria 771
832 Ga0501318_033523 3300049534 Bacteria 708
833 Ga0501318_033982 3300049534 Bacteria 705
834 Ga0501318_043113 3300049534 Bacteria 651
835 Ga0501318_055151 3300049534 Bacteria 599
836 Ga0501318_059551 3300049534 Bacteria 583
837 Ga0501320_058526 3300049536 Bacteria 538
838 Ga0501323_073227 3300049539 Bacteria 551
839 Ga0501325_020324 3300049541 Bacteria 695
840 Ga0501031_0686253 3300049568 Bacteria 658
841 Ga0501034_0240016 3300049571 Bacteria 1759
842 Ga0501036_0177048 3300049572 Bacteria 1796
843 Ga0501036_1014542 3300049572 Bacteria 679
844 Ga0501037_0548903 3300049573 Bacteria 780
845 Ga0501038_1380485 3300049574 Bacteria 507
846 Ga0501039_0046148 3300049575 Bacteria 3366
847 Ga0501040_0108316 3300049576 Bacteria 1942
848 Ga0501041_0139412 3300049577 Bacteria 1512
849 Ga0501042_0099456 3300049578 Bacteria 2091
850 Ga0501042_0306894 3300049578 Bacteria 1146
851 Ga0501046_0709344 3300049580 Bacteria 708
852 Ga0501048_0461748 3300049582 Bacteria 910
853 Ga0501071_0132718 3300049587 Bacteria 1851
854 Ga0501072_0126779 3300049588 Bacteria 2034
855 Ga0501075_0507332 3300049591 Bacteria 920
856 Ga0501076_1040714 3300049592 Bacteria 674
857 Ga0501077_0082380 3300049593 Bacteria 2039
858 Ga0501227_155856 3300049665 Bacteria 633
859 Ga0501079_0112476 3300049741 Bacteria 2116
860 Ga0501081_1528721 3300049743 Bacteria 507
861 Ga0501083_0835939 3300049744 Bacteria 599
862 Ga0501045_0215027 3300049824 Bacteria 1431
863 nmdc:mga0yw44_68430_c1 3300050492 Bacteria 2196
864 nmdc:mga05p37_1866655_c1 3300050507 Bacteria 576
865 nmdc:mga09592_447360_c1 3300050508 Bacteria 1115
866 nmdc:mga0qj67_2448_c1 3300050509 Bacteria 13215
867 nmdc:mga0qj67_270430_c1 3300050509 Bacteria 1378
868 nmdc:mga06r32_115607_c1 3300050510 Bacteria 2642
869 nmdc:mga06r32_37408_c1 3300050510 Bacteria 4590
870 nmdc:mga08y16_198583_c1 3300050511 Bacteria 2079
871 nmdc:mga08y16_248659_c1 3300050511 Bacteria 1837
872 nmdc:mga08y16_431757_c1 3300050511 Bacteria 1345
873 nmdc:mga08y16_496161_c1 3300050511 Bacteria 1241
874 nmdc:mga08y16_59973_c1 3300050511 Bacteria 3974
875 nmdc:mga08y16_849111_c1 3300050511 Bacteria 902
876 Ga0495601_0286121 3300053077 Bacteria 1075
877 Ga0495655_0334601 3300053083 Bacteria 527
878 Ga0500641_0002406 3300053096 Bacteria 6637
879 Ga0500568_0158481 3300053139 Bacteria 836
880 Ga0500588_0086334 3300053146 Bacteria 1059
881 Ga0501084_0236452 3300054114 Bacteria 1542
882 Ga0587084_119765 3300059477 Bacteria 552
883 Ga0587093_113575 3300059478 Bacteria 500
884 Ga0587073_0128564 3300059492 Bacteria 693
885 Ga0587073_0178198 3300059492 Bacteria 622
886 Ga0587073_0242167 3300059492 Bacteria 561
887 Ga0587080_068634 3300059503 Bacteria 705
888 Ga0587082_158627 3300059504 Bacteria 540
889 Ga0587083_0222246 3300059505 Bacteria 550
890 Ga0587085_164081 3300059506 Bacteria 521
891 Ga0587090_139243 3300059510 Bacteria 541
892 Ga0587106_155365 3300059605 Bacteria 512
893 Ga0587099_029098 3300059622 Bacteria 663
894 Ga0587101_099568 3300059623 Bacteria 576
895 Ga0587128_141711 3300059630 Bacteria 540
896 Ga0587075_056367 3300059644 Bacteria 698
897 Ga0587079_249122 3300059647 Bacteria 505
898 Ga0587107_085491 3300059652 Bacteria 600
899 Ga0587119_085587 3300059658 Bacteria 519
900 Ga0587111_0231563 3300060346 Bacteria 538
901 Ga0501082_0554026 3300060353 Bacteria 1006
902 Ga0466962_0206828 3300061719 Bacteria 960
903 2964379860 2964375228 Bacteria 4909004
904 Ga0496109_0581741
905 LJNas_1014707
906 JGI24737J22298_10175223
907 JGI24751J29686_10056317
908 Ga0006778J45830_1006978
909 Ga0006778J45830_1030066
910 Ga0006759J45824_1007047
911 Ga0006759J45824_1024096
912 Ga0006770J48903_1022477
913 Ga0006770J48903_1051261
914 Ga0006777J48905_1008271
915 Ga0006777J48905_1013170
916 Ga0006777J48905_1018613
917 Ga0006777J48905_1058056
918 Ga0007417J51691_1009758
919 Ga0007417J51691_1010669
920 Ga0007417J51691_1017034
921 Ga0007427J51700_103879
922 Ga0007427J51700_106380
923 Ga0007427J51700_106768
924 Ga0007427J51700_108616
925 Ga0007427J51700_109703
926 Ga0006781J51513_1004736
927 Ga0006781J51513_1005144
928 Ga0006781J51513_1008276
929 Ga0006781J51513_1016207
930 Ga0007410J51695_1003955
931 Ga0007410J51695_1006052
932 Ga0007410J51695_1008537
933 Ga0007410J51695_1008650
934 Ga0007410J51695_1014560
935 Ga0007410J51695_1021268
936 Ga0007410J51695_1030058
937 Ga0007409J51694_1005738
938 Ga0007409J51694_1006510
939 Ga0007409J51694_1009792
940 Ga0007409J51694_1042272
941 Ga0007409J51694_1042830
942 Ga0007416J51690_1010660
943 Ga0007416J51690_1010812
944 Ga0007416J51690_1014513
945 Ga0007416J51690_1016516
946 Ga0007429J51699_1005254
947 Ga0007429J51699_1006457
948 Ga0007429J51699_1006469
949 Ga0007429J51699_1007768
950 Ga0007429J51699_1009271
951 Ga0007429J51699_1012664
952 Ga0007429J51699_1013322
953 Ga0007429J51699_1015556
954 Ga0007429J51699_1025858
955 Ga0007429J51699_1072535
956 Ga0007411J51799_105395
957 Ga0007411J51799_105620
958 Ga0007411J51799_105900
959 Ga0007415J51800_109181
960 Ga0032354_1003553
961 Ga0032354_1004672
962 Ga0032354_1013360
963 Ga0032354_1015829
964 Ga0032354_1017283
965 Ga0032354_1025268
966 Ga0032354_1029546
967 Ga0006780_1008661
968 Ga0006780_1008926
969 Ga0006780_1010216
970 Ga0006780_1011636
971 Ga0006780_1024020
972 Ga0058863_11889079
973 Ga0058863_11933179
974 Ga0058861_12048937
975 Ga0058862_10001504
976 Ga0058862_10043888
977 Ga0070658_10845196
978 Ga0070658_11691364
979 Ga0070676_10141356
980 Ga0070676_10456199
981 Ga0070676_10706797
982 Ga0070683_100103625
983 Ga0070683_100304003
984 Ga0070683_100379496
985 Ga0070683_100478274
986 Ga0070670_100176418
987 Ga0070670_101050758
988 Ga0068869_100187444
989 Ga0068869_100531329
990 Ga0068869_100769246
991 Ga0068869_101073307
992 Ga0068869_101747541
993 Ga0070666_10314766
994 Ga0070680_100680583
995 Ga0070680_101299364
996 Ga0070682_100739860
997 Ga0070682_100971856
998 Ga0068868_100058570
999 Ga0068868_100120383
1000 Ga0068868_100180193
1001 Ga0068868_100763702
1002 Ga0068868_101477830
1003 Ga0070660_100158918
1004 Ga0070660_100237223
1005 Ga0070689_100685674
1006 Ga0070689_101124207
1007 Ga0070691_10305191
1008 Ga0070691_10482031
1009 Ga0070687_100025135
1010 Ga0070661_100190329
1011 Ga0070661_100985427
1012 Ga0070661_101143898
1013 Ga0070692_10262616
1014 Ga0070692_10366379
1015 Ga0070692_10387205
1016 Ga0070692_10409934
1017 Ga0070692_11338221
1018 Ga0070668_100052468
1019 Ga0070668_100059593
1020 Ga0070668_100061176
1021 Ga0070668_100305297
1022 Ga0070668_100954065
1023 Ga0070668_101144411
1024 Ga0070669_100371550
1025 Ga0070675_100573916
1026 Ga0070675_101547743
1027 Ga0070674_100035917
1028 Ga0070674_100194315
1029 Ga0070674_100324863
1030 Ga0070674_100459570
1031 Ga0070674_100523755
1032 Ga0070674_100552909
1033 Ga0070674_101278746
1034 Ga0070673_101286586
1035 Ga0070673_101573208
1036 Ga0070659_100157258
1037 Ga0070659_100172871
1038 Ga0070659_100188874
1039 Ga0070659_100822468
1040 Ga0070659_100828220
1041 Ga0070659_101355565
1042 Ga0070659_101395456
1043 Ga0070667_100003375
1044 Ga0070667_101421852
1045 Ga0070713_100578062
1046 Ga0070713_101379227
1047 Ga0070713_102443306
1048 Ga0070701_10036044
1049 Ga0070701_10319866
1050 Ga0070701_10415569
1051 Ga0070701_11299374
1052 Ga0070711_100651519
1053 Ga0070705_100937206
1054 Ga0070700_100007498
1055 Ga0070700_100041180
1056 Ga0070700_100108756
1057 Ga0070700_100143566
1058 Ga0070700_100270407
1059 Ga0070700_100295807
1060 Ga0070694_100811127
1061 Ga0070694_101461185
1062 Ga0070708_101704180
1063 Ga0070663_100094249
1064 Ga0070663_100341111
1065 Ga0070663_100381094
1066 Ga0070663_101184728
1067 Ga0070663_101338870
1068 Ga0070678_100113339
1069 Ga0070678_100126513
1070 Ga0070678_100498935
1071 Ga0070678_100868703
1072 Ga0070678_101033123
1073 Ga0070678_102003771
1074 Ga0070662_100291849
1075 Ga0070662_100636849
1076 Ga0070662_100753625
1077 Ga0070662_101911771
1078 Ga0068867_100287468
1079 Ga0068867_100742623
1080 Ga0068867_100928843
1081 Ga0068867_101516242
1082 Ga0068867_101834662
1083 Ga0070685_10258036
1084 Ga0070685_10382875
1085 Ga0070679_101646096
1086 Ga0070679_102025977
1087 Ga0070684_100145639
1088 Ga0070684_100247567
1089 Ga0070684_100708528
1090 Ga0070684_100864281
1091 Ga0070684_101466785
1092 Ga0068853_100264634
1093 Ga0068853_100704089
1094 Ga0068853_102168666
1095 Ga0068853_102435851
1096 Ga0070672_100090629
1097 Ga0070672_100525206
1098 Ga0070672_101117783
1099 Ga0070672_101826615
1100 Ga0070695_101156954
1101 Ga0070696_100705633
1102 Ga0070696_100943712
1103 Ga0070693_100292546
1104 Ga0070693_101394990
1105 Ga0070665_100346850
1106 Ga0070665_101140825
1107 Ga0070665_101251310
1108 Ga0070704_100529554
1109 Ga0070704_100990444
1110 Ga0068855_102459562
1111 Ga0070664_100029021
1112 Ga0070664_100176802
1113 Ga0070664_100471421
1114 Ga0070664_100830363
1115 Ga0070664_100831908
1116 Ga0068857_100290287
1117 Ga0068857_100567820
1118 Ga0068857_102181745
1119 Ga0068854_100114604
1120 Ga0068854_100307540
1121 Ga0068854_100613935
1122 Ga0068854_100775398
1123 Ga0068854_100982004
1124 Ga0068854_101142576
1125 Ga0068856_100630194
1126 Ga0068856_101441560
1127 Ga0070702_100065310
1128 Ga0070702_100112980
1129 Ga0070702_100370213
1130 Ga0070702_100576098
1131 Ga0070702_100591037
1132 Ga0070702_101664008
1133 Ga0068852_100127091
1134 Ga0068852_100230378
1135 Ga0068852_100535875
1136 Ga0068852_100571478
1137 Ga0068852_101433512
1138 Ga0068852_102386417
1139 Ga0068859_100231937
1140 Ga0068864_100513907
1141 Ga0068864_101722611
1142 Ga0068864_101823990
1143 Ga0068864_102675502
1144 Ga0068866_10308644
1145 Ga0068866_10388871
1146 Ga0068866_10406927
1147 Ga0068866_10422821
1148 Ga0068861_100152183
1149 Ga0068861_100781123
1150 Ga0068861_100828435
1151 Ga0068861_100969972
1152 Ga0068861_101037323
1153 Ga0068861_101155387
1154 Ga0068861_101423749
1155 Ga0068851_10082706
1156 Ga0068851_10214643
1157 Ga0068870_10411404
1158 Ga0068870_10539025
1159 Ga0068870_11407912
1160 Ga0068863_100578245
1161 Ga0068863_100881202
1162 Ga0068863_101775086
1163 Ga0068858_100526244
1164 Ga0068858_100545902
1165 Ga0068858_100616835
1166 Ga0068860_100175243
1167 Ga0068860_100533207
1168 Ga0068860_101825764
1169 Ga0068862_100012377
1170 Ga0068862_100827718
1171 Ga0068862_101891264
1172 Ga0081455_10363817
1173 Ga0081455_10514937
1174 Ga0081455_10618924
1175 Ga0081455_10734518
1176 Ga0081538_10002487
1177 Ga0081538_10057017
1178 Ga0081538_10083806
1179 Ga0070717_10007823
1180 Ga0070717_10175049
1181 Ga0075365_10061565
1182 Ga0075365_10650614
1183 Ga0075365_10980451
1184 Ga0075365_11255162
1185 Ga0075364_10065451
1186 Ga0075432_10124679
1187 Ga0075432_10174073
1188 Ga0075432_10280244
1189 Ga0097621_101038544
1190 Ga0097621_101418646
1191 Ga0097621_101782716
1192 Ga0068871_100381637
1193 Ga0075428_100138350
1194 Ga0075428_100386864
1195 Ga0075428_101632234
1196 Ga0075428_101850903
1197 Ga0075430_100004485
1198 Ga0075430_100323950
1199 Ga0075431_100357753
1200 Ga0075431_100612754
1201 Ga0075431_101327903
1202 Ga0075433_10926483
1203 Ga0075434_101909840
1204 Ga0075429_100478175
1205 Ga0075429_101836067
1206 Ga0068865_100175672
1207 Ga0068865_100501002
1208 Ga0068865_100809875
1209 Ga0068865_101185046
1210 Ga0068865_101325058
1211 Ga0068865_101658826
1212 Ga0097620_100231925
1213 Ga0105251_10367207
1214 Ga0105244_10367544
1215 Ga0105244_10515133
1216 Ga0105250_10369807
1217 Ga0111539_10023235
1218 Ga0111539_10147349
1219 Ga0111539_10383744
1220 Ga0111539_10469196
1221 Ga0111539_10782991
1222 Ga0105245_10001268
1223 Ga0105245_10083979
1224 Ga0105245_10129568
1225 Ga0105245_10365459
1226 Ga0105245_10457807
1227 Ga0105245_10552293
1228 Ga0105245_10598992
1229 Ga0105247_10862081
1230 Ga0114129_10112537
1231 Ga0114129_11043402
1232 Ga0114129_12278103
1233 Ga0105243_10136973
1234 Ga0105243_10276094
1235 Ga0105243_10279147
1236 Ga0105243_10735887
1237 Ga0105243_10982979
1238 Ga0105243_11204168
1239 Ga0105243_12460158
1240 Ga0105241_10991080
1241 Ga0105242_10197829
1242 Ga0105242_10877122
1243 Ga0105242_11331646
1244 Ga0105242_11484235
1245 Ga0105242_12819904
1246 Ga0105242_12949416
1247 Ga0105248_10758230
1248 Ga0105248_10959924
1249 Ga0105248_11132324
1250 Ga0105237_10763446
1251 Ga0105249_10009622
1252 Ga0105249_10223458
1253 Ga0105249_10568944
1254 Ga0105249_10663281
1255 Ga0105249_10689889
1256 Ga0105249_10802907
1257 Ga0105249_10843462
1258 Ga0105249_12165586
1259 Ga0105249_12850636
1260 Ga0105239_10199104
1261 Ga0105239_10493747
1262 Ga0105239_10987439
1263 Ga0105239_11811714
1264 Ga0105239_12422641
1265 Ga0105239_12496343
1266 Ga0105246_10282283
1267 Ga0105246_10656037
1268 Ga0105246_10841055
1269 Ga0105246_11317395
1270 Ga0105246_11361682
1271 Ga0157318_1032935
1272 Ga0157371_10986024
1273 Ga0157371_11175791
1274 Ga0157374_10976742
1275 Ga0157374_12042960
1276 Ga0157378_10833781
1277 Ga0157378_11331909
1278 Ga0157378_12690587
1279 Ga0157378_12755060
1280 Ga0163162_10327806
1281 Ga0163162_10854626
1282 Ga0163162_10900901
1283 Ga0163162_11336434
1284 Ga0157372_10510761
1285 Ga0157372_10824247
1286 Ga0157372_10969237
1287 Ga0157372_11071072
1288 Ga0157372_11104195
1289 Ga0157372_11575894
1290 Ga0157375_10795836
1291 Ga0157375_10806450
1292 Ga0157375_11142838
1293 Ga0157375_12682320
1294 Ga0157375_12906678
1295 Ga0163163_10227812
1296 Ga0163163_10283497
1297 Ga0163163_10650140
1298 Ga0163163_10765408
1299 Ga0163163_11159405
1300 Ga0163163_12111430
1301 Ga0157380_10051035
1302 Ga0157380_10158015
1303 Ga0157380_10435327
1304 Ga0157380_10485627
1305 Ga0157380_11016407
1306 Ga0157380_11384085
1307 Ga0182008_10351799
1308 Ga0182008_10563841
1309 Ga0157377_10070204
1310 Ga0157377_10654734
1311 Ga0157379_10139136
1312 Ga0157379_11200490
1313 Ga0157379_11773498
1314 Ga0157379_11791405
1315 Ga0157379_11806502
1316 Ga0163161_10326080
1317 Ga0163161_10984699
1318 Ga0163161_11038649
1319 Ga0163161_11763464
1320 Ga0197907_10430016
1321 Ga0197907_10667705
1322 Ga0206356_10053793
1323 Ga0206356_11299228
1324 Ga0206349_1069091
1325 Ga0206349_1822211
1326 Ga0206351_10232741
1327 Ga0206351_10592516
1328 Ga0206352_10214145
1329 Ga0206352_10712691
1330 Ga0206350_11656942
1331 Ga0206354_10900142
1332 Ga0206354_11064614
1333 Ga0206354_11259038
1334 Ga0206354_11378764
1335 Ga0206354_11683722
1336 Ga0206353_10414632
1337 Ga0206353_11749501
1338 Ga0213874_10002171
1339 Ga0213874_10016883
1340 Ga0213876_10087479
1341 Ga0213875_10014948
1342 Ga0213875_10240072
1343 Ga0207656_10320598
1344 Ga0207642_10296036
1345 Ga0207642_10304661
1346 Ga0207642_10966280
1347 Ga0207688_10077309
1348 Ga0207688_10146875
1349 Ga0207688_10162834
1350 Ga0207688_10183866
1351 Ga0207688_10819227
1352 Ga0207680_10686399
1353 Ga0207645_10505379
1354 Ga0207643_10268873
1355 Ga0207643_10562216
1356 Ga0207643_10756554
1357 Ga0207643_11091211
1358 Ga0207705_10877352
1359 Ga0207654_11054567
1360 Ga0207654_11371907
1361 Ga0207671_10713054
1362 Ga0207663_10603098
1363 Ga0207662_10045169
1364 Ga0207662_10384196
1365 Ga0207662_10603439
1366 Ga0207657_10195323
1367 Ga0207657_10255481
1368 Ga0207657_10265601
1369 Ga0207657_10395716
1370 Ga0207649_10110288
1371 Ga0207649_11562504
1372 Ga0207652_10800431
1373 Ga0207652_11654562
1374 Ga0207681_10915253
1375 Ga0207650_10593442
1376 Ga0207659_10156492
1377 Ga0207687_10007771
1378 Ga0207687_10133473
1379 Ga0207687_10335173
1380 Ga0207687_11591001
1381 Ga0207700_11179307
1382 Ga0207664_11626994
1383 Ga0207644_11231889
1384 Ga0207690_11181353
1385 Ga0207690_11825682
1386 Ga0207706_10040158
1387 Ga0207706_10166500
1388 Ga0207706_10293102
1389 Ga0207706_11046828
1390 Ga0207686_10860944
1391 Ga0207686_11271596
1392 Ga0207686_11285928
1393 Ga0207709_10058061
1394 Ga0207709_10344063
1395 Ga0207709_10367730
1396 Ga0207669_10037104
1397 Ga0207669_10037110
1398 Ga0207669_10160669
1399 Ga0207669_10217997
1400 Ga0207669_10485676
1401 Ga0207669_10550847
1402 Ga0207704_10112293
1403 Ga0207704_11089308
1404 Ga0207665_10245243
1405 Ga0207691_10077035
1406 Ga0207691_10375406
1407 Ga0207691_11600823
1408 Ga0207689_10107897
1409 Ga0207689_10211022
1410 Ga0207689_10426045
1411 Ga0207689_11458917
1412 Ga0207661_10430724
1413 Ga0207661_10455337
1414 Ga0207661_10981120
1415 Ga0207661_11488549
1416 Ga0207661_11928336
1417 Ga0207679_10517285
1418 Ga0207679_10653117
1419 Ga0207679_10672193
1420 Ga0207679_10673982
1421 Ga0207679_10755434
1422 Ga0207651_11272291
1423 Ga0207712_10027758
1424 Ga0207712_10064484
1425 Ga0207712_10282031
1426 Ga0207712_10382122
1427 Ga0207712_10665495
1428 Ga0207712_10918509
1429 Ga0207668_10040939
1430 Ga0207668_10185303
1431 Ga0207668_10563795
1432 Ga0207668_10941796
1433 Ga0207668_10983884
1434 Ga0207640_10089619
1435 Ga0207640_10152125
1436 Ga0207640_10204332
1437 Ga0207640_11616217
1438 Ga0207640_11687811
1439 Ga0207640_11890384
1440 Ga0207658_10012783
1441 Ga0207658_11154517
1442 Ga0207677_10084126
1443 Ga0207677_10517047
1444 Ga0207677_10689124
1445 Ga0207677_11568556
1446 Ga0207677_11783437
1447 Ga0207703_11949059
1448 Ga0207703_12370930
1449 Ga0207639_12011224
1450 Ga0207678_10147083
1451 Ga0207678_10380550
1452 Ga0207678_10543594
1453 Ga0207708_10003244
1454 Ga0207708_10003676
1455 Ga0207708_10309313
1456 Ga0207708_10415709
1457 Ga0207708_11022640
1458 Ga0207702_11448447
1459 Ga0207641_10674117
1460 Ga0207641_11872480
1461 Ga0207641_12461375
1462 Ga0207648_10119133
1463 Ga0207648_10161739
1464 Ga0207648_10287272
1465 Ga0207648_10313729
1466 Ga0207648_10920021
1467 Ga0207648_10982815
1468 Ga0207676_10317459
1469 Ga0207676_12287865
1470 Ga0207674_10093451
1471 Ga0207674_10588304
1472 Ga0207675_100073660
1473 Ga0207675_100084343
1474 Ga0207675_100170794
1475 Ga0207675_100320673
1476 Ga0207675_100635623
1477 Ga0207675_101069062
1478 Ga0207675_101921352
1479 Ga0207683_10108519
1480 Ga0207683_10401389
1481 Ga0207683_10580676
1482 Ga0207683_10856757
1483 Ga0207683_11575432
1484 Ga0207698_10119275
1485 Ga0207698_10145570
1486 Ga0207698_10556867
1487 Ga0207698_11117857
1488 Ga0207698_11160599
1489 Ga0207428_10104135
1490 Ga0207428_10705500
1491 Ga0207428_10944523
1492 Ga0268266_10018867
1493 Ga0268266_10508342
1494 Ga0268265_10010076
1495 Ga0268265_10410357
1496 Ga0268265_10625047
1497 Ga0268265_11511869
1498 Ga0268265_11984312
1499 Ga0268264_10125832
1500 Ga0268264_10135441
1501 Ga0268264_10308775
1502 Ga0307408_100146500
1503 Ga0307408_101522163
1504 Ga0307408_101762638
1505 Ga0307405_10689194
1506 Ga0307405_11250886
1507 Ga0307405_11293970
1508 Ga0307405_11856042
1509 Ga0307405_12111464
1510 Ga0307413_10043107
1511 Ga0307413_10046343
1512 Ga0307413_10242154
1513 Ga0307413_10358426
1514 Ga0307413_11294614
1515 Ga0307413_11654849
1516 Ga0307410_10314792
1517 Ga0307410_10646791
1518 Ga0307410_10867060
1519 Ga0307410_11137057
1520 Ga0307410_11951623
1521 Ga0326468_10021136
1522 Ga0307406_10050349
1523 Ga0307406_10068045
1524 Ga0307406_10192545
1525 Ga0307406_10928605
1526 Ga0307406_11099126
1527 Ga0307406_11403931
1528 Ga0307406_12089912
1529 Ga0307407_10488373
1530 Ga0307407_10541572
1531 Ga0307407_10580014
1532 Ga0307407_10624613
1533 Ga0307407_10794213
1534 Ga0307407_10905567
1535 Ga0307407_10918307
1536 Ga0307407_11634579
1537 Ga0307412_10535091
1538 Ga0307412_11463692
1539 Ga0307412_11702237
1540 Ga0307409_100051857
1541 Ga0307409_100053271
1542 Ga0307409_100108405
1543 Ga0307409_100205340
1544 Ga0307409_100351939
1545 Ga0307409_100362987
1546 Ga0307409_100381643
1547 Ga0307409_100493419
1548 Ga0307409_100500427
1549 Ga0307409_100529411
1550 Ga0307409_102925617
1551 Ga0307416_100134797
1552 Ga0307416_100265450
1553 Ga0307416_100281210
1554 Ga0307416_100482871
1555 Ga0307416_100668311
1556 Ga0307416_100802726
1557 Ga0307416_102507035
1558 Ga0307416_103133369
1559 Ga0307416_103873472
1560 Ga0307414_10028131
1561 Ga0307414_10698354
1562 Ga0307411_10014958
1563 Ga0307411_11058383
1564 Ga0307411_11571789
1565 Ga0307415_100001128
1566 Ga0307415_100053053
1567 Ga0307415_100130211
1568 Ga0307415_100144434
1569 Ga0307415_100490266
1570 Ga0307415_101669301
1571 Ga0307415_102073185
1572 Ga0307415_102221332
1573 Ga0373948_0081498
1574 Ga0373960_0107882
1575 Ga0265778_061862
1576 Ga0395899_0035319
1577 Ga0395900_0048124
1578 Ga0395900_0100325
1579 Ga0395900_1288612
1580 Ga0395898_0007212
1581 Ga0395898_0393762
1582 Ga0395905_1185960
1583 Ga0395905_1260175
1584 Ga0436364_0022195
1585 Ga0436364_0614425
1586 Ga0436364_1183959
1587 Ga0436364_1247614
1588 Ga0436364_1314373
1589 Ga0395901_0034679
1590 Ga0395901_0104557
1591 Ga0395901_0318806
1592 Ga0395901_0812702
1593 Ga0395901_1953991
1594 Ga0436365_0450750
1595 Ga0436365_0587755
1596 Ga0436365_0765495
1597 Ga0436365_0829535
1598 Ga0436365_1155741
1599 Ga0436365_1930528
1600 Ga0436361_0283654
1601 Ga0436363_0359451
1602 Ga0436363_0792821
1603 Ga0436363_0996006
1604 Ga0436363_1022758
1605 Ga0436363_1380086
1606 Ga0436363_1561831
1607 Ga0436362_0291370
1608 Ga0436362_0473346
1609 Ga0436362_0568001
1610 Ga0436362_1094366
1611 Ga0451789_1100807
1612 Ga0451807_2365518
1613 Ga0451845_0403861
1614 Ga0451847_0619045
1615 Ga0451849_0716166
1616 Ga0451855_0525654
1617 Ga0451855_1120017
1618 Ga0451853_0893288
1619 Ga0451853_1984273
1620 Ga0451853_2949496
1621 Ga0439448_0378851
1622 Ga0466969_0015113
1623 Ga0466969_0199705
1624 Ga0466972_0331279
1625 Ga0466965_0058317
1626 Ga0466966_0098377
1627 Ga0466966_0644865
1628 Ga0466963_0024178
1629 Ga0466963_0098620
1630 Ga0466963_0821587
1631 Ga0466964_0002044
1632 Ga0466971_0017795
1633 Ga0466971_0448029
1634 Ga0466968_0024880
1635 Ga0466957_0119283
1636 Ga0466957_0407433
1637 Ga0466960_0010846
1638 Ga0466960_0173178
1639 Ga0466960_0370730
1640 Ga0466960_0627663
1641 Ga0466959_0008212
1642 Ga0466959_0015755
1643 Ga0466959_1026851
1644 Ga0466958_0071689
1645 Ga0466958_0161196
1646 Ga0466958_0208641
1647 Ga0466958_0352755
1648 Ga0466958_0798925
1649 Ga0466967_0001552
1650 Ga0466967_0524110
1651 Ga0466967_0591338
1652 Ga0466967_1061692
1653 Ga0466967_1390374
1654 Ga0495603_0115552
1655 Ga0495653_0880318
1656 Ga0495582_0343033
1657 Ga0495605_0336477
1658 Ga0495584_0292350
1659 Ga0495584_0693759
1660 Ga0495596_0158197
1661 Ga0495596_0339483
1662 Ga0495596_0445684
1663 Ga0495644_0191235
1664 Ga0495652_0896309
1665 Ga0495609_0138868
1666 Ga0495667_0344367
1667 Ga0495656_0268228
1668 Ga0495656_0594480
1669 Ga0495668_0600712
1670 Ga0495657_0409561
1671 Ga0495671_0453263
1672 Ga0495649_0279222
1673 Ga0495604_0691828
1674 Ga0495674_0539207
1675 Ga0495677_0389803
1676 Ga0495615_0107074
1677 Ga0496100_1294503
1678 Ga0496102_0065115
1679 Ga0496102_1295001
1680 Ga0496102_1878599
1681 Ga0496103_0695045
1682 Ga0496106_0031885
1683 Ga0496106_0147259
1684 Ga0496107_0483890
1685 Ga0496107_0537994
1686 Ga0496107_0876523
1687 Ga0496108_0590559
1688 Ga0496108_0611654
1689 Ga0496108_0915942
1690 Ga0496109_0003104
1691 Ga0496109_0938048
1692 Ga0496109_1221880
1693 Ga0496109_1569690
1694 Ga0496110_0079495
1695 Ga0496110_0119454
1696 Ga0496110_0157940
1697 Ga0496110_1123071
1698 Ga0496110_1885224
1699 Ga0496111_0470839
1700 Ga0496111_1095717
1701 Ga0496112_0256953
1702 Ga0496112_0489402
1703 Ga0496112_0675278
1704 Ga0496112_1870205
1705 Ga0496113_0303613
1706 Ga0496113_0767730
1707 Ga0496113_0982864
1708 Ga0496113_1548381
1709 Ga0496114_0444200
1710 Ga0496114_1184940
1711 Ga0496114_1485523
1712 Ga0496115_0494400
1713 Ga0496121_0317054
1714 Ga0496126_0743246
1715 Ga0501308_055509
1716 Ga0501309_049254
1717 Ga0501310_081167
1718 Ga0501304_027984
1719 Ga0501307_069819
1720 Ga0501313_045655
1721 Ga0501313_056225
1722 Ga0501315_049679
1723 Ga0501315_102693
1724 Ga0501316_029632
1725 Ga0501316_080659
1726 Ga0501317_016518
1727 Ga0501317_043808
1728 Ga0501317_045482
1729 Ga0501317_057988
1730 Ga0501317_068811
1731 Ga0501317_076140
1732 Ga0501317_081868
1733 Ga0501317_103566
1734 Ga0501318_025897
1735 Ga0501318_033523
1736 Ga0501318_033982
1737 Ga0501318_043113
1738 Ga0501318_055151
1739 Ga0501318_059551
1740 Ga0501320_058526
1741 Ga0501323_073227
1742 Ga0501325_020324
1743 Ga0501031_0686253
1744 Ga0501034_0240016
1745 Ga0501036_0177048
1746 Ga0501036_1014542
1747 Ga0501037_0548903
1748 Ga0501038_1380485
1749 Ga0501039_0046148
1750 Ga0501040_0108316
1751 Ga0501041_0139412
1752 Ga0501042_0099456
1753 Ga0501042_0306894
1754 Ga0501046_0709344
1755 Ga0501048_0461748
1756 Ga0501071_0132718
1757 Ga0501072_0126779
1758 Ga0501075_0507332
1759 Ga0501076_1040714
1760 Ga0501077_0082380
1761 Ga0501227_155856
1762 Ga0501079_0112476
1763 Ga0501081_1528721
1764 Ga0501083_0835939
1765 Ga0501045_0215027
1766 nmdc:mga0yw44_68430_c1
1767 nmdc:mga05p37_1866655_c1
1768 nmdc:mga09592_447360_c1
1769 nmdc:mga0qj67_2448_c1
1770 nmdc:mga0qj67_270430_c1
1771 nmdc:mga06r32_115607_c1
1772 nmdc:mga06r32_37408_c1
1773 nmdc:mga08y16_198583_c1
1774 nmdc:mga08y16_248659_c1
1775 nmdc:mga08y16_431757_c1
1776 nmdc:mga08y16_496161_c1
1777 nmdc:mga08y16_59973_c1
1778 nmdc:mga08y16_849111_c1
1779 Ga0495601_0286121
1780 Ga0495655_0334601
1781 Ga0500641_0002406
1782 Ga0500568_0158481
1783 Ga0500588_0086334
1784 Ga0501084_0236452
1785 Ga0587084_119765
1786 Ga0587093_113575
1787 Ga0587073_0128564
1788 Ga0587073_0178198
1789 Ga0587073_0242167
1790 Ga0587080_068634
1791 Ga0587082_158627
1792 Ga0587083_0222246
1793 Ga0587085_164081
1794 Ga0587090_139243
1795 Ga0587106_155365
1796 Ga0587099_029098
1797 Ga0587101_099568
1798 Ga0587128_141711
1799 Ga0587075_056367
1800 Ga0587079_249122
1801 Ga0587107_085491
1802 Ga0587119_085587
1803 Ga0587111_0231563
1804 Ga0501082_0554026
1805 Ga0466962_0206828
1806 2964379860

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00313

CSD

'Cold-shock' DNA-binding domain

7

72

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mjc-assembly1.cif.gz_A crystal structure of cspa, the major cold shock protein of escherichia coli 0.9731 2 67
8h1i-assembly1.cif.gz_B crystal structure of plygrcs, a bacteriophage endolysin in complex with cold shock protein c 0.9676 2 67
3i2z-assembly2.cif.gz_B structure of cold shock protein e from salmonella typhimurium 0.9608 1 67
1hza-assembly1.cif.gz_B bacillus caldolyticus cold-shock protein mutants to study determinants of protein stability 0.958 1 67
1c9o-assembly1.cif.gz_B crystal structure analysis of the bacillus caldolyticus cold shock protein bc-csp 0.9555 1 67
ID Description Score Start End Superfamily
af_Q94C69_1_75_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9694 2 65 2.40.50.140
af_P91306_55_138_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9595 2 66 2.40.50.140
af_P92186_48_133_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9577 2 66 2.40.50.140
af_I1LPN7_1_82_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9562 2 66 2.40.50.140
af_P91398_61_146_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9553 2 66 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A6J4Q4L7-F1-model_v4 Cold shock protein of CSP family 1.007 1 67 GO:0003676
GO:0005737
AF-A0A510HJU9-F1-model_v4 Cold-shock protein 1.006 1 67 GO:0003676
GO:0005737
AF-A0A7W1BUD7-F1-model_v4 Cold shock domain-containing protein 1.005 1 67 GO:0003676
GO:0005737
AF-A0A0S9QVD0-F1-model_v4 Cold-shock protein 1.004 1 67 GO:0003676
GO:0005737
AF-A0A6J7D5N6-F1-model_v4 Unannotated protein 1.004 1 67 GO:0003676

Map