F485251
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 903 | 437 | 819 | 339 |
Family's Representative Sequence
| Representative Sequence | 3300046524|Ga0495648_0012243|Ga0495648_0012243_1598_3043 |
| Length | 383 |
| Sequence | MDDTDTDAARGLDGGPRPRTATTGLDIGVVLQTNPPACRVVELARQAETMGFSHVWTFDSHLLWEEPFVIYSQILAATRKVLVGPMVTNPATRDWTVTASLFATLNEMFGNRTICGIGRGDSAVRVLNGRPTTLATLRECVGVVRELANGREADVGGTRLRLPWGGDSRLDVWVAGYGPRALALAGEIGDGYILQLADPAVVAWTIDAVRAAAAAAGRDPAAVKICVAAPAYVGGADEASMAHQRDQCRWFGGMVGNHVADLVARYGQAVSAAVADADGAGGGIPPALTAYVAGRTAYDYNEHGRPGNIHADFVPDEIIDRFCLLGPAQEHVRRLTELADLGVDQFAVYLQHDAKSATLEAYGETVIPTIAARTLAITAPSRG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501039 | Frankia saprophytica CN3 | Isolate | Nodule |
| 2 | 2517572101 | Frankia sp. DC12 | Isolate | Nodule |
| 3 | 2537561592 | Arthrobacter crystallopoietes BAB-32 | Isolate | Rhizosphere |
| 4 | 2551306166 | Nocardia tenerifensis NBRC 101015 | Isolate | Rhizosphere |
| 5 | 2579778521 | Frankia torreyi CpI1-S | Isolate | Unclassified |
| 6 | 2585428157 | Microbacterium sp. CF335 | Isolate | Rhizosphere |
| 7 | 2619618881 | Frankia sp. ACN1ag | Isolate | Unclassified |
| 8 | 2619619003 | Frankia sp. CpI1-P | Isolate | Nodule |
| 9 | 2626541554 | Frankia sp. AvcI.1 | Isolate | Nodule |
| 10 | 2643221566 | Microbacterium sp. Root166 | Isolate | Unclassified |
| 11 | 2643221572 | Leifsonia sp. Root60 | Isolate | Unclassified |
| 12 | 2643221575 | Microbacterium sp. Root61 | Isolate | Unclassified |
| 13 | 2643221649 | Leifsonia sp. Root4 | Isolate | Unclassified |
| 14 | 2643221669 | Leifsonia sp. Root1293 | Isolate | Unclassified |
| 15 | 2643221690 | Cellulomonas sp. Root485 | Isolate | Unclassified |
| 16 | 2671180195 | Frankia sp. CcI49 | Isolate | Nodule |
| 17 | 2675902999 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 18 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 19 | 2684623035 | Frankia sp. NRRL B-16219 | Isolate | Rhizosphere |
| 20 | 2687453737 | Frankia sp. BMG5.36 | Isolate | Nodule |
| 21 | 2721755702 | Agromyces sp. AR33 | Isolate | Rhizosphere |
| 22 | 2728369276 | Kineococcus rhizosphaerae DSM 19711 | Isolate | Rhizosphere |
| 23 | 2738543034 | Rhodococcus sp. OK269 | Isolate | Unclassified |
| 24 | 2751185725 | Microbispora sp. NRRL B-24597 | Isolate | Unclassified |
| 25 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 26 | 2751185792 | Kitasatospora arboriphila NRRL B-24581 | Isolate | Unclassified |
| 27 | 2757320536 | Microbacterium sp. NFIX05 | Isolate | Unclassified |
| 28 | 2773857758 | Microbacterium chocolatum 1320 | Isolate | Unclassified |
| 29 | 2773857763 | Microbacterium sp. SAI-030 | Isolate | Unclassified |
| 30 | 2773857921 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 31 | 2773857922 | Frankia sp. CcI49 | Isolate | Nodule |
| 32 | 2775506925 | Saccharopolyspora phatthalungensis NRRL B-24798 | Isolate | Rhizosphere |
| 33 | 2799112218 | Motilibacter rhizosphaerae DSM 45622 | Isolate | Rhizosphere |
| 34 | 2808606306 | Microbacterium sp. SLBN-146 | Isolate | Unclassified |
| 35 | 2808606372 | Agromyces sp. 23-23 | Isolate | Unclassified |
| 36 | 2808606447 | Microbacterium sp. HAR-UPW-R2A-48 | Isolate | Unclassified |
| 37 | 2811994872 | Microbacterium sp. MU4Y-5-1 | Isolate | Unclassified |
| 38 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 39 | 2821268502 | Microbacterium sp. YT0620BN | Isolate | Unclassified |
| 40 | 2844852863 | Herbiconiux flava DSM 26474 | Isolate | Rhizosphere |
| 41 | 2852632344 | Microbacterium sp. AK009 | Isolate | Rhizosphere |
| 42 | 2852643534 | Leifsonia sp. AK011 | Isolate | Rhizosphere |
| 43 | 2857733635 | Salinibacterium sp. R-73062 | Isolate | Unclassified |
| 44 | 2863067949 | Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) | Isolate | Rhizosphere |
| 45 | 2866552031 | Saccharopolyspora rhizosphaerae H219 | Isolate | Unclassified |
| 46 | 2870622029 | Conyzicola lurida DSM 105784 | Isolate | Unclassified |
| 47 | 2870628048 | Microbacterium thalassium DSM 12511 | Isolate | Rhizosphere |
| 48 | 2887478801 | Catellatospora paridis NEAU-CL2 | Isolate | Rhizosphere |
| 49 | 2895660088 | Leifsonia flava SYP-B2174 | Isolate | Rhizosphere |
| 50 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 51 | 2904509784 | Microbacterium sp. 1676 | Isolate | Rhizosphere |
| 52 | 2904765812 | Rhodococcus fascians 1590 | Isolate | Rhizosphere |
| 53 | 2904770941 | Rhodococcus fascians 1339 | Isolate | Rhizosphere |
| 54 | 2906799679 | Microbacterium karelineae TRM80801 | Isolate | Unclassified |
| 55 | 2908678064 | Microbacterium sp. 1518 | Isolate | Rhizosphere |
| 56 | 2908811453 | Rhodococcus sp. 1R11 | Isolate | Unclassified |
| 57 | 2915358134 | Pseudonocardia pini CAP47R | Isolate | Unclassified |
| 58 | 2919069694 | Microbacterium sp. 1154 | Isolate | Unclassified |
| 59 | 2919420072 | Rhodococcus fascians 3241 | Isolate | Rhizosphere |
| 60 | 2919432681 | Rhodococcus sp. 3258 | Isolate | Rhizosphere |
| 61 | 2935409751 | Agromyces sp. PvR057 | Isolate | Rhizosphere |
| 62 | 2939660829 | Mycetocola sp. 2940 | Isolate | Rhizosphere |
| 63 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 64 | 2966921586 | Rathayibacter agropyri 617 | Isolate | Rhizosphere |
| 65 | 2974294766 | Microbacterium proteolyticum SORGH_AS 209 | Isolate | Unclassified |
| 66 | 2974324384 | Microbacterium sp. SORGH_AS 344 | Isolate | Unclassified |
| 67 | 2977228692 | Microbacterium sp. SORGH_AS 421 | Isolate | Unclassified |
| 68 | 2977236895 | Microbacterium testaceum SORGH_AS 426 | Isolate | Unclassified |
| 69 | 2977264416 | Microbacterium testaceum SORGH_AS 594 | Isolate | Unclassified |
| 70 | 2984542743 | Microbacterium sp. SORGH_AS454 | Isolate | Aerial Root |
| 71 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 72 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 73 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 74 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 75 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 76 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 78 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 80 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 81 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 82 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 86 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 91 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 92 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 95 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 96 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 97 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 98 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 99 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 101 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 102 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 103 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 104 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 107 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 108 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 110 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 111 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 112 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 114 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 115 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 116 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 117 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 118 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 119 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 120 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 121 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 122 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 123 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 124 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 125 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 126 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 127 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 128 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 129 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 130 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 131 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 132 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 134 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 135 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 136 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 137 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 138 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 139 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 140 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 141 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 142 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 144 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300009979 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG | Metagenome | Rhizosphere |
| 158 | 3300009988 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG | Metagenome | Rhizosphere |
| 159 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 160 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 161 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 162 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 176 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 178 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 179 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 180 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 181 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 182 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 183 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 184 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 185 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 238 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 242 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 243 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 244 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 245 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 246 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 247 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 248 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 249 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 250 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 251 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 252 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 253 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 254 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 255 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 256 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 257 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 258 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 259 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 260 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 261 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 262 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 263 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 264 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 265 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 266 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 267 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 268 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 269 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 270 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 271 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 272 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 273 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 274 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 275 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 276 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 277 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 278 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 279 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 280 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 281 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 282 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 283 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 284 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 285 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 286 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 287 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 288 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 289 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 290 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 291 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 292 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 293 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 294 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 295 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 296 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 297 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 298 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 299 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 300 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 301 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 302 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 303 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 304 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 305 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 306 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 307 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 308 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 309 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 310 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 311 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 312 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 313 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 314 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 315 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 316 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 317 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 318 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 319 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 320 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 321 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 322 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 323 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 343 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 344 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 345 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 346 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 347 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 348 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 349 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 350 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 351 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 352 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 353 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 354 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 355 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 356 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 357 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 358 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 359 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 360 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 361 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 362 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 363 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 364 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 365 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 366 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 367 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 368 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 391 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 398 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 399 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 400 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 401 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 402 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 403 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 404 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 408 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 409 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 410 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 411 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 413 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 414 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 415 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 416 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 417 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 418 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 419 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 420 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 421 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 422 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 423 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 424 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 425 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 426 | 8001781756 | Catellatospora tritici NEAU-YM18 | Isolate | Rhizosphere |
| 427 | 8002775197 | Frankia nepalensis CN7 | Isolate | Nodule |
| 428 | 8002784119 | Frankia sp. AgB1.9 | Isolate | Nodule |
| 429 | 8004025490 | Arthrobacter wenxiniae AETb3-4 | Isolate | Rhizosphere |
| 430 | 8016254467 | Microbacterium sp. SLBN-111 (version 3) | Isolate | Rhizosphere |
| 431 | 8045830549 | Microbacterium yannicii DSM 23203 | Isolate | Unclassified |
| 432 | 8046352972 | Agromyces mangrovi NBRC 112812 | Isolate | Rhizosphere |
| 433 | 8054913762 | Frankia gtarii Agncl-10 | Isolate | Nodule |
| 434 | 8054920844 | Frankia tisae Agncl-8 | Isolate | Nodule |
| 435 | 8056037122 | Herbiconiux gentiana CPCC 205716 | Isolate | Rhizosphere |
| 436 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
| 437 | 8057345674 | Herbiconiux aconitum CPCC 205763 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.92 |
| Metatranscriptomes | 0.78 |
| Isolates | 9.3 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.11 |
| Bulb | 0 |
| Endosphere | 4.21 |
| Nodule | 1.44 |
| Rhizoplane | 8.53 |
| Rhizosphere | 74.42 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24752J21851_1001068 | 3300001976 | Bacteria | 3734 |
| 2 | JGI24752J21851_1002035 | 3300001976 | Bacteria | 2700 |
| 3 | JGI24752J21851_1002296 | 3300001976 | Bacteria | 2550 |
| 4 | JGI24751J29686_10000424 | 3300002459 | Bacteria | 13157 |
| 5 | JGI24751J29686_10003910 | 3300002459 | Bacteria | 3009 |
| 6 | JGI25406J46586_10001099 | 3300003203 | Bacteria | 12668 |
| 7 | JGI25406J46586_10033705 | 3300003203 | Bacteria | 1888 |
| 8 | JGI25405J52794_10007179 | 3300003911 | Bacteria | 2050 |
| 9 | Ga0065714_10065905 | 3300005288 | Bacteria | 8127 |
| 10 | Ga0070658_10000516 | 3300005327 | Bacteria | 33519 |
| 11 | Ga0070658_10018666 | 3300005327 | Bacteria | 5554 |
| 12 | Ga0070658_10036380 | 3300005327 | Bacteria | 3968 |
| 13 | Ga0070690_100129436 | 3300005330 | Bacteria | 1703 |
| 14 | Ga0070670_100054425 | 3300005331 | Bacteria | 3435 |
| 15 | Ga0068869_100005134 | 3300005334 | Bacteria | 8210 |
| 16 | Ga0068869_100163759 | 3300005334 | Bacteria | 1733 |
| 17 | Ga0070680_100012976 | 3300005336 | Bacteria | 6481 |
| 18 | Ga0070680_100237299 | 3300005336 | Bacteria | 1541 |
| 19 | Ga0070680_100367309 | 3300005336 | Bacteria | 1224 |
| 20 | Ga0070682_100007230 | 3300005337 | Bacteria | 6255 |
| 21 | Ga0070682_100078320 | 3300005337 | Bacteria | 2132 |
| 22 | Ga0070692_10002768 | 3300005345 | Bacteria | 6906 |
| 23 | Ga0070675_100017195 | 3300005354 | Bacteria | 5747 |
| 24 | Ga0070675_100025157 | 3300005354 | Bacteria | 4771 |
| 25 | Ga0070671_100005657 | 3300005355 | Bacteria | 9948 |
| 26 | Ga0070688_100046743 | 3300005365 | Bacteria | 2682 |
| 27 | Ga0070659_100012289 | 3300005366 | Bacteria | 6348 |
| 28 | Ga0070659_100058228 | 3300005366 | Bacteria | 3049 |
| 29 | Ga0070659_100282133 | 3300005366 | Bacteria | 1382 |
| 30 | Ga0070703_10011057 | 3300005406 | Bacteria | 2548 |
| 31 | Ga0070709_10007107 | 3300005434 | Bacteria | 6125 |
| 32 | Ga0070709_10150960 | 3300005434 | Bacteria | 1606 |
| 33 | Ga0070714_100041568 | 3300005435 | Bacteria | 3880 |
| 34 | Ga0070714_100084338 | 3300005435 | Bacteria | 2772 |
| 35 | Ga0070714_100100492 | 3300005435 | Bacteria | 2548 |
| 36 | Ga0070713_100075079 | 3300005436 | Bacteria | 2866 |
| 37 | Ga0070701_10099806 | 3300005438 | Bacteria | 1606 |
| 38 | Ga0070701_10167902 | 3300005438 | Bacteria | 1276 |
| 39 | Ga0070700_100009088 | 3300005441 | Bacteria | 5447 |
| 40 | Ga0070663_100015507 | 3300005455 | Bacteria | 4923 |
| 41 | Ga0070681_10018792 | 3300005458 | Bacteria | 6917 |
| 42 | Ga0070685_10150575 | 3300005466 | Bacteria | 1474 |
| 43 | Ga0070685_10191337 | 3300005466 | Bacteria | 1324 |
| 44 | Ga0070706_100045762 | 3300005467 | Bacteria | 4040 |
| 45 | Ga0070706_100100092 | 3300005467 | Unclassified | 2693 |
| 46 | Ga0070706_100233944 | 3300005467 | Unclassified | 1715 |
| 47 | Ga0070707_100017861 | 3300005468 | Bacteria | 6670 |
| 48 | Ga0070707_100155044 | 3300005468 | Unclassified | 2231 |
| 49 | Ga0070707_100289997 | 3300005468 | Unclassified | 1590 |
| 50 | Ga0070698_100001406 | 3300005471 | Bacteria | 26671 |
| 51 | Ga0070698_100006165 | 3300005471 | Bacteria | 13057 |
| 52 | Ga0070698_100051129 | 3300005471 | Bacteria | 4210 |
| 53 | Ga0070699_100022651 | 3300005518 | Bacteria | 5415 |
| 54 | Ga0070699_100078843 | 3300005518 | Bacteria | 2868 |
| 55 | Ga0070679_100051719 | 3300005530 | Bacteria | 4092 |
| 56 | Ga0070684_100001918 | 3300005535 | Bacteria | 15253 |
| 57 | Ga0070684_100008570 | 3300005535 | Bacteria | 8006 |
| 58 | Ga0068853_100064029 | 3300005539 | Bacteria | 3186 |
| 59 | Ga0070686_100070590 | 3300005544 | Bacteria | 2284 |
| 60 | Ga0070693_100000347 | 3300005547 | Bacteria | 21059 |
| 61 | Ga0070665_100000791 | 3300005548 | Bacteria | 41601 |
| 62 | Ga0070665_100007578 | 3300005548 | Bacteria | 11036 |
| 63 | Ga0070665_100011326 | 3300005548 | Bacteria | 9020 |
| 64 | Ga0070665_100091726 | 3300005548 | Bacteria | 3043 |
| 65 | Ga0070665_100102824 | 3300005548 | Bacteria | 2861 |
| 66 | Ga0070665_100121113 | 3300005548 | Bacteria | 2618 |
| 67 | Ga0070704_100001943 | 3300005549 | Bacteria | 11442 |
| 68 | Ga0068855_100019945 | 3300005563 | Bacteria | 8051 |
| 69 | Ga0068855_100097904 | 3300005563 | Bacteria | 3379 |
| 70 | Ga0068855_100106798 | 3300005563 | Bacteria | 3217 |
| 71 | Ga0068855_100179482 | 3300005563 | Bacteria | 2394 |
| 72 | Ga0068855_100271021 | 3300005563 | Bacteria | 1887 |
| 73 | Ga0068855_100315157 | 3300005563 | Bacteria | 1730 |
| 74 | Ga0070664_100008359 | 3300005564 | Bacteria | 8367 |
| 75 | Ga0070664_100146236 | 3300005564 | Bacteria | 2085 |
| 76 | Ga0068857_100031944 | 3300005577 | Bacteria | 4653 |
| 77 | Ga0068857_100142844 | 3300005577 | Bacteria | 2164 |
| 78 | Ga0068854_100073625 | 3300005578 | Bacteria | 2504 |
| 79 | Ga0068856_100009168 | 3300005614 | Bacteria | 9621 |
| 80 | Ga0068856_100033521 | 3300005614 | Bacteria | 5029 |
| 81 | Ga0068856_100118962 | 3300005614 | Bacteria | 2643 |
| 82 | Ga0068856_100149510 | 3300005614 | Bacteria | 2344 |
| 83 | Ga0070702_100002009 | 3300005615 | Bacteria | 8578 |
| 84 | Ga0070702_100192261 | 3300005615 | Bacteria | 1344 |
| 85 | Ga0068852_100033719 | 3300005616 | Bacteria | 4254 |
| 86 | Ga0068852_100282047 | 3300005616 | Bacteria | 1602 |
| 87 | Ga0068852_100344019 | 3300005616 | Bacteria | 1454 |
| 88 | Ga0068859_100002957 | 3300005617 | Bacteria | 17235 |
| 89 | Ga0068859_100007129 | 3300005617 | Bacteria | 11345 |
| 90 | Ga0068859_100041923 | 3300005617 | Bacteria | 4598 |
| 91 | Ga0068864_100008495 | 3300005618 | Bacteria | 8473 |
| 92 | Ga0068864_100265931 | 3300005618 | Bacteria | 1596 |
| 93 | Ga0068861_100007184 | 3300005719 | Bacteria | 7626 |
| 94 | Ga0068861_100023686 | 3300005719 | Bacteria | 4431 |
| 95 | Ga0068861_100069499 | 3300005719 | Bacteria | 2725 |
| 96 | Ga0068861_100151077 | 3300005719 | Bacteria | 1906 |
| 97 | Ga0068861_100193103 | 3300005719 | Bacteria | 1704 |
| 98 | Ga0068870_10000390 | 3300005840 | Bacteria | 16496 |
| 99 | Ga0068870_10001611 | 3300005840 | Bacteria | 9183 |
| 100 | Ga0068863_100000274 | 3300005841 | Bacteria | 53564 |
| 101 | Ga0068863_100003122 | 3300005841 | Bacteria | 16358 |
| 102 | Ga0068863_100008129 | 3300005841 | Bacteria | 10242 |
| 103 | Ga0068863_100013760 | 3300005841 | Bacteria | 7798 |
| 104 | Ga0068863_100055915 | 3300005841 | Bacteria | 3736 |
| 105 | Ga0068863_100208619 | 3300005841 | Bacteria | 1881 |
| 106 | Ga0068863_100220203 | 3300005841 | Bacteria | 1828 |
| 107 | Ga0068858_100019804 | 3300005842 | Bacteria | 6289 |
| 108 | Ga0068858_100136130 | 3300005842 | Bacteria | 2305 |
| 109 | Ga0068860_100035775 | 3300005843 | Bacteria | 4762 |
| 110 | Ga0068860_100054272 | 3300005843 | Bacteria | 3809 |
| 111 | Ga0068860_100078365 | 3300005843 | Bacteria | 3142 |
| 112 | Ga0068860_100113550 | 3300005843 | Bacteria | 2590 |
| 113 | Ga0068860_100217048 | 3300005843 | Bacteria | 1856 |
| 114 | Ga0068862_100000237 | 3300005844 | Bacteria | 61270 |
| 115 | Ga0081455_10001004 | 3300005937 | Bacteria | 35765 |
| 116 | Ga0081455_10003346 | 3300005937 | Bacteria | 18489 |
| 117 | Ga0081455_10014805 | 3300005937 | Bacteria | 7611 |
| 118 | Ga0081455_10033413 | 3300005937 | Bacteria | 4623 |
| 119 | Ga0081455_10083784 | 3300005937 | Bacteria | 2604 |
| 120 | Ga0081455_10141516 | 3300005937 | Bacteria | 1868 |
| 121 | Ga0081538_10000359 | 3300005981 | Bacteria | 51874 |
| 122 | Ga0081539_10000135 | 3300005985 | Bacteria | 172789 |
| 123 | Ga0081539_10000352 | 3300005985 | Bacteria | 100942 |
| 124 | Ga0081539_10003711 | 3300005985 | Bacteria | 18198 |
| 125 | Ga0081539_10004612 | 3300005985 | Bacteria | 15017 |
| 126 | Ga0081539_10022554 | 3300005985 | Bacteria | 4161 |
| 127 | Ga0081539_10072935 | 3300005985 | Bacteria | 1833 |
| 128 | Ga0075365_10000350 | 3300006038 | Bacteria | 16540 |
| 129 | Ga0075365_10095649 | 3300006038 | Bacteria | 2029 |
| 130 | Ga0075368_10027906 | 3300006042 | Bacteria | 2180 |
| 131 | Ga0075364_10003412 | 3300006051 | Bacteria | 9029 |
| 132 | Ga0075364_10038095 | 3300006051 | Bacteria | 3115 |
| 133 | Ga0075364_10081214 | 3300006051 | Bacteria | 2143 |
| 134 | Ga0075364_10093575 | 3300006051 | Bacteria | 1996 |
| 135 | Ga0075432_10007868 | 3300006058 | Bacteria | 3634 |
| 136 | Ga0070716_100039526 | 3300006173 | Bacteria | 2619 |
| 137 | Ga0075362_10020696 | 3300006177 | Bacteria | 2751 |
| 138 | Ga0075367_10189460 | 3300006178 | Bacteria | 1283 |
| 139 | Ga0097621_100011172 | 3300006237 | Bacteria | 6609 |
| 140 | Ga0068871_100042170 | 3300006358 | Bacteria | 3662 |
| 141 | Ga0075428_100000474 | 3300006844 | Bacteria | 40339 |
| 142 | Ga0075428_100022805 | 3300006844 | Bacteria | 6927 |
| 143 | Ga0075428_100191729 | 3300006844 | Bacteria | 2210 |
| 144 | Ga0075428_100281049 | 3300006844 | Bacteria | 1791 |
| 145 | Ga0075428_100289571 | 3300006844 | Bacteria | 1762 |
| 146 | Ga0075430_100000935 | 3300006846 | Bacteria | 22920 |
| 147 | Ga0075430_100002201 | 3300006846 | Bacteria | 16155 |
| 148 | Ga0075430_100021522 | 3300006846 | Bacteria | 5481 |
| 149 | Ga0075430_100024879 | 3300006846 | Bacteria | 5093 |
| 150 | Ga0075431_100001764 | 3300006847 | Bacteria | 20381 |
| 151 | Ga0075431_100003722 | 3300006847 | Bacteria | 14818 |
| 152 | Ga0075431_100012785 | 3300006847 | Bacteria | 8475 |
| 153 | Ga0075431_100017699 | 3300006847 | Bacteria | 7246 |
| 154 | Ga0075431_100085475 | 3300006847 | Bacteria | 3256 |
| 155 | Ga0075431_100117121 | 3300006847 | Bacteria | 2749 |
| 156 | Ga0075431_100365494 | 3300006847 | Bacteria | 1449 |
| 157 | Ga0075431_100520878 | 3300006847 | Bacteria | 1178 |
| 158 | Ga0075433_10075156 | 3300006852 | Bacteria | 2973 |
| 159 | Ga0075433_10302904 | 3300006852 | Bacteria | 1415 |
| 160 | Ga0075434_100006513 | 3300006871 | Bacteria | 10708 |
| 161 | Ga0075434_100089702 | 3300006871 | Bacteria | 3075 |
| 162 | Ga0075434_100233336 | 3300006871 | Bacteria | 1860 |
| 163 | Ga0075434_100360379 | 3300006871 | Bacteria | 1475 |
| 164 | Ga0075429_100001303 | 3300006880 | Bacteria | 20326 |
| 165 | Ga0075429_100001981 | 3300006880 | Bacteria | 17025 |
| 166 | Ga0075429_100007859 | 3300006880 | Bacteria | 9262 |
| 167 | Ga0075429_100151300 | 3300006880 | Bacteria | 2032 |
| 168 | Ga0075429_100219883 | 3300006880 | Bacteria | 1664 |
| 169 | Ga0068865_100221036 | 3300006881 | Bacteria | 1481 |
| 170 | Ga0075436_100001698 | 3300006914 | Bacteria | 15076 |
| 171 | Ga0097620_100002957 | 3300006931 | Bacteria | 17235 |
| 172 | Ga0097620_100006662 | 3300006931 | Bacteria | 11728 |
| 173 | Ga0097620_100007129 | 3300006931 | Bacteria | 11345 |
| 174 | Ga0097620_100041922 | 3300006931 | Bacteria | 4598 |
| 175 | Ga0075435_100027739 | 3300007076 | Bacteria | 4433 |
| 176 | Ga0105251_10040011 | 3300009011 | Bacteria | 2287 |
| 177 | Ga0105244_10063886 | 3300009036 | Bacteria | 1848 |
| 178 | Ga0105244_10073842 | 3300009036 | Bacteria | 1697 |
| 179 | Ga0105240_10008219 | 3300009093 | Bacteria | 14957 |
| 180 | Ga0105240_10019078 | 3300009093 | Bacteria | 9171 |
| 181 | Ga0105240_10094668 | 3300009093 | Bacteria | 3642 |
| 182 | Ga0105240_10117763 | 3300009093 | Bacteria | 3202 |
| 183 | Ga0111539_10031182 | 3300009094 | Bacteria | 6479 |
| 184 | Ga0111539_10434264 | 3300009094 | Bacteria | 1529 |
| 185 | Ga0111539_10668257 | 3300009094 | Bacteria | 1210 |
| 186 | Ga0111539_10684867 | 3300009094 | Bacteria | 1193 |
| 187 | Ga0105245_10036774 | 3300009098 | Bacteria | 4351 |
| 188 | Ga0105245_10180691 | 3300009098 | Bacteria | 2015 |
| 189 | Ga0105245_10367390 | 3300009098 | Bacteria | 1429 |
| 190 | Ga0105247_10000971 | 3300009101 | Bacteria | 21642 |
| 191 | Ga0105247_10014730 | 3300009101 | Bacteria | 4687 |
| 192 | Ga0114129_10000048 | 3300009147 | Bacteria | 103451 |
| 193 | Ga0114129_10000128 | 3300009147 | Bacteria | 77291 |
| 194 | Ga0114129_10001279 | 3300009147 | Bacteria | 33592 |
| 195 | Ga0114129_10001574 | 3300009147 | Bacteria | 30996 |
| 196 | Ga0114129_10020234 | 3300009147 | Bacteria | 9470 |
| 197 | Ga0114129_10052270 | 3300009147 | Bacteria | 5734 |
| 198 | Ga0114129_10722981 | 3300009147 | Unclassified | 1277 |
| 199 | Ga0105243_10008507 | 3300009148 | Bacteria | 7874 |
| 200 | Ga0105243_10027614 | 3300009148 | Bacteria | 4350 |
| 201 | Ga0105243_10079731 | 3300009148 | Bacteria | 2669 |
| 202 | Ga0105243_10399345 | 3300009148 | Bacteria | 1276 |
| 203 | Ga0105241_10064837 | 3300009174 | Bacteria | 2822 |
| 204 | Ga0105248_10000034 | 3300009177 | Bacteria | 192324 |
| 205 | Ga0105248_10240009 | 3300009177 | Bacteria | 2040 |
| 206 | Ga0105248_10437199 | 3300009177 | Bacteria | 1474 |
| 207 | Ga0105248_10686916 | 3300009177 | Bacteria | 1155 |
| 208 | Ga0105237_10005381 | 3300009545 | Bacteria | 14471 |
| 209 | Ga0105238_10267490 | 3300009551 | Bacteria | 1690 |
| 210 | Ga0105238_10470603 | 3300009551 | Bacteria | 1255 |
| 211 | Ga0105249_10075684 | 3300009553 | Bacteria | 3118 |
| 212 | Ga0105249_10351755 | 3300009553 | Bacteria | 1493 |
| 213 | Ga0105249_10365682 | 3300009553 | Bacteria | 1465 |
| 214 | Ga0105249_10668185 | 3300009553 | Bacteria | 1097 |
| 215 | Ga0105032_104382 | 3300009979 | Bacteria | 1205 |
| 216 | Ga0105035_100234 | 3300009988 | Bacteria | 3730 |
| 217 | Ga0105239_10013363 | 3300010375 | Bacteria | 9121 |
| 218 | Ga0105239_10054716 | 3300010375 | Bacteria | 4378 |
| 219 | Ga0105239_10394606 | 3300010375 | Bacteria | 1565 |
| 220 | Ga0105239_10396797 | 3300010375 | Bacteria | 1561 |
| 221 | Ga0105246_10031106 | 3300011119 | Bacteria | 3530 |
| 222 | Ga0105246_10066499 | 3300011119 | Bacteria | 2524 |
| 223 | Ga0157338_1002637 | 3300012515 | Bacteria | 1424 |
| 224 | Ga0157373_10124402 | 3300013100 | Bacteria | 1813 |
| 225 | Ga0157371_10000794 | 3300013102 | Bacteria | 36216 |
| 226 | Ga0157370_10032665 | 3300013104 | Bacteria | 5081 |
| 227 | Ga0157370_10050894 | 3300013104 | Bacteria | 3958 |
| 228 | Ga0157369_10006194 | 3300013105 | Bacteria | 13880 |
| 229 | Ga0157369_10239923 | 3300013105 | Bacteria | 1893 |
| 230 | Ga0157374_10018863 | 3300013296 | Bacteria | 6097 |
| 231 | Ga0157378_10208617 | 3300013297 | Bacteria | 1851 |
| 232 | Ga0157378_10389138 | 3300013297 | Bacteria | 1371 |
| 233 | Ga0163162_10021945 | 3300013306 | Bacteria | 6290 |
| 234 | Ga0163162_10257411 | 3300013306 | Bacteria | 1877 |
| 235 | Ga0157372_10019524 | 3300013307 | Bacteria | 7306 |
| 236 | Ga0157372_10040927 | 3300013307 | Bacteria | 5122 |
| 237 | Ga0157372_10597684 | 3300013307 | Bacteria | 1286 |
| 238 | Ga0157375_10107580 | 3300013308 | Bacteria | 2882 |
| 239 | Ga0157375_10234003 | 3300013308 | Bacteria | 1996 |
| 240 | Ga0157375_10322717 | 3300013308 | Bacteria | 1709 |
| 241 | Ga0163163_10013199 | 3300014325 | Bacteria | 7550 |
| 242 | Ga0163163_10068093 | 3300014325 | Bacteria | 3542 |
| 243 | Ga0163163_10114254 | 3300014325 | Bacteria | 2730 |
| 244 | Ga0163163_10307592 | 3300014325 | Bacteria | 1637 |
| 245 | Ga0157380_10023569 | 3300014326 | Bacteria | 4645 |
| 246 | Ga0157377_10041322 | 3300014745 | Bacteria | 2558 |
| 247 | Ga0157379_10006923 | 3300014968 | Bacteria | 9804 |
| 248 | Ga0157379_10016266 | 3300014968 | Bacteria | 6545 |
| 249 | Ga0157379_10461186 | 3300014968 | Bacteria | 1174 |
| 250 | Ga0157376_10277777 | 3300014969 | Bacteria | 1576 |
| 251 | Ga0163161_10180061 | 3300017792 | Bacteria | 1620 |
| 252 | Ga0206356_10758018 | 3300020070 | Bacteria | 2444 |
| 253 | Ga0206351_10658466 | 3300020077 | Bacteria | 8249 |
| 254 | Ga0206352_10915400 | 3300020078 | Bacteria | 2013 |
| 255 | Ga0206350_10122299 | 3300020080 | Bacteria | 2456 |
| 256 | Ga0206354_11650881 | 3300020081 | Bacteria | 1521 |
| 257 | Ga0206353_10109164 | 3300020082 | Bacteria | 5678 |
| 258 | Ga0213876_10149661 | 3300021384 | Bacteria | 1241 |
| 259 | Ga0224712_10001135 | 3300022467 | Bacteria | 5928 |
| 260 | Ga0207655_1050447 | 3300025728 | Bacteria | 1691 |
| 261 | Ga0207682_10094629 | 3300025893 | Bacteria | 1300 |
| 262 | Ga0207692_10009035 | 3300025898 | Bacteria | 4150 |
| 263 | Ga0207710_10000682 | 3300025900 | Bacteria | 19100 |
| 264 | Ga0207710_10017307 | 3300025900 | Bacteria | 3058 |
| 265 | Ga0207688_10000765 | 3300025901 | Bacteria | 15989 |
| 266 | Ga0207688_10099785 | 3300025901 | Bacteria | 1675 |
| 267 | Ga0207688_10135586 | 3300025901 | Bacteria | 1446 |
| 268 | Ga0207688_10161509 | 3300025901 | Bacteria | 1328 |
| 269 | Ga0207647_10004472 | 3300025904 | Bacteria | 10359 |
| 270 | Ga0207647_10018243 | 3300025904 | Bacteria | 4753 |
| 271 | Ga0207647_10024270 | 3300025904 | Bacteria | 4000 |
| 272 | Ga0207647_10029797 | 3300025904 | Bacteria | 3526 |
| 273 | Ga0207647_10046375 | 3300025904 | Bacteria | 2709 |
| 274 | Ga0207645_10070843 | 3300025907 | Bacteria | 2231 |
| 275 | Ga0207645_10077104 | 3300025907 | Bacteria | 2135 |
| 276 | Ga0207643_10000049 | 3300025908 | Bacteria | 78784 |
| 277 | Ga0207643_10000517 | 3300025908 | Bacteria | 24731 |
| 278 | Ga0207705_10000001 | 3300025909 | Bacteria | 2061880 |
| 279 | Ga0207684_10028199 | 3300025910 | Bacteria | 4782 |
| 280 | Ga0207684_10088247 | 3300025910 | Bacteria | 2642 |
| 281 | Ga0207684_10423780 | 3300025910 | Unclassified | 1143 |
| 282 | Ga0207654_10028648 | 3300025911 | Bacteria | 3038 |
| 283 | Ga0207654_10191320 | 3300025911 | Bacteria | 1341 |
| 284 | Ga0207654_10265164 | 3300025911 | Bacteria | 1156 |
| 285 | Ga0207707_10040010 | 3300025912 | Bacteria | 4097 |
| 286 | Ga0207695_10104876 | 3300025913 | Bacteria | 2815 |
| 287 | Ga0207695_10184877 | 3300025913 | Bacteria | 2004 |
| 288 | Ga0207671_10008858 | 3300025914 | Bacteria | 8473 |
| 289 | Ga0207671_10063600 | 3300025914 | Bacteria | 2742 |
| 290 | Ga0207663_10040137 | 3300025916 | Bacteria | 2843 |
| 291 | Ga0207660_10010527 | 3300025917 | Bacteria | 6006 |
| 292 | Ga0207657_10011572 | 3300025919 | Bacteria | 8752 |
| 293 | Ga0207657_10118487 | 3300025919 | Bacteria | 2179 |
| 294 | Ga0207649_10021347 | 3300025920 | Bacteria | 3726 |
| 295 | Ga0207649_10027450 | 3300025920 | Bacteria | 3340 |
| 296 | Ga0207652_10084788 | 3300025921 | Bacteria | 2776 |
| 297 | Ga0207646_10011964 | 3300025922 | Bacteria | 8366 |
| 298 | Ga0207646_10015271 | 3300025922 | Bacteria | 7262 |
| 299 | Ga0207646_10343606 | 3300025922 | Bacteria | 1348 |
| 300 | Ga0207694_10105685 | 3300025924 | Bacteria | 2235 |
| 301 | Ga0207650_10000713 | 3300025925 | Bacteria | 25899 |
| 302 | Ga0207650_10006096 | 3300025925 | Bacteria | 8217 |
| 303 | Ga0207650_10009466 | 3300025925 | Bacteria | 6655 |
| 304 | Ga0207650_10249138 | 3300025925 | Bacteria | 1438 |
| 305 | Ga0207659_10011241 | 3300025926 | Bacteria | 5651 |
| 306 | Ga0207687_10025387 | 3300025927 | Bacteria | 3966 |
| 307 | Ga0207687_10046559 | 3300025927 | Bacteria | 3003 |
| 308 | Ga0207700_10057631 | 3300025928 | Bacteria | 2930 |
| 309 | Ga0207664_10002478 | 3300025929 | Bacteria | 12223 |
| 310 | Ga0207664_10386220 | 3300025929 | Bacteria | 1243 |
| 311 | Ga0207644_10024574 | 3300025931 | Bacteria | 4137 |
| 312 | Ga0207690_10034873 | 3300025932 | Bacteria | 3245 |
| 313 | Ga0207690_10094929 | 3300025932 | Bacteria | 2117 |
| 314 | Ga0207706_10050638 | 3300025933 | Bacteria | 3670 |
| 315 | Ga0207709_10064095 | 3300025935 | Bacteria | 2306 |
| 316 | Ga0207669_10144720 | 3300025937 | Bacteria | 1656 |
| 317 | Ga0207704_10250281 | 3300025938 | Bacteria | 1330 |
| 318 | Ga0207665_10002648 | 3300025939 | Bacteria | 12030 |
| 319 | Ga0207665_10029257 | 3300025939 | Bacteria | 3642 |
| 320 | Ga0207711_10000203 | 3300025941 | Bacteria | 63383 |
| 321 | Ga0207711_10095568 | 3300025941 | Bacteria | 2621 |
| 322 | Ga0207689_10000355 | 3300025942 | Bacteria | 42965 |
| 323 | Ga0207679_10003632 | 3300025945 | Bacteria | 9567 |
| 324 | Ga0207679_10041816 | 3300025945 | Bacteria | 3290 |
| 325 | Ga0207667_10024050 | 3300025949 | Bacteria | 6699 |
| 326 | Ga0207667_10072433 | 3300025949 | Bacteria | 3581 |
| 327 | Ga0207667_10226613 | 3300025949 | Bacteria | 1915 |
| 328 | Ga0207712_10014587 | 3300025961 | Bacteria | 5059 |
| 329 | Ga0207668_10029077 | 3300025972 | Bacteria | 3620 |
| 330 | Ga0207640_10194095 | 3300025981 | Bacteria | 1533 |
| 331 | Ga0207658_10099400 | 3300025986 | Bacteria | 2276 |
| 332 | Ga0207703_10071146 | 3300026035 | Bacteria | 2873 |
| 333 | Ga0207703_10159842 | 3300026035 | Bacteria | 1972 |
| 334 | Ga0207639_10010005 | 3300026041 | Bacteria | 6555 |
| 335 | Ga0207678_10000705 | 3300026067 | Bacteria | 30524 |
| 336 | Ga0207678_10011578 | 3300026067 | Bacteria | 7747 |
| 337 | Ga0207708_10016932 | 3300026075 | Bacteria | 5488 |
| 338 | Ga0207702_10001520 | 3300026078 | Bacteria | 22948 |
| 339 | Ga0207702_10026927 | 3300026078 | Bacteria | 4774 |
| 340 | Ga0207702_10128040 | 3300026078 | Bacteria | 2282 |
| 341 | Ga0207641_10000772 | 3300026088 | Bacteria | 34278 |
| 342 | Ga0207641_10004202 | 3300026088 | Bacteria | 12555 |
| 343 | Ga0207641_10009478 | 3300026088 | Bacteria | 8024 |
| 344 | Ga0207641_10016724 | 3300026088 | Bacteria | 6007 |
| 345 | Ga0207641_10048886 | 3300026088 | Bacteria | 3572 |
| 346 | Ga0207641_10069942 | 3300026088 | Bacteria | 3015 |
| 347 | Ga0207676_10001048 | 3300026095 | Bacteria | 21049 |
| 348 | Ga0207676_10003132 | 3300026095 | Bacteria | 11807 |
| 349 | Ga0207674_10000186 | 3300026116 | Bacteria | 75904 |
| 350 | Ga0207674_10058473 | 3300026116 | Bacteria | 3905 |
| 351 | Ga0207674_10192127 | 3300026116 | Bacteria | 1991 |
| 352 | Ga0207675_100001392 | 3300026118 | Bacteria | 24245 |
| 353 | Ga0207675_100005123 | 3300026118 | Bacteria | 12618 |
| 354 | Ga0207683_10000155 | 3300026121 | Bacteria | 57375 |
| 355 | Ga0207683_10080966 | 3300026121 | Bacteria | 2881 |
| 356 | Ga0207698_10017059 | 3300026142 | Bacteria | 4916 |
| 357 | Ga0207428_10001815 | 3300027907 | Bacteria | 21876 |
| 358 | Ga0207428_10003991 | 3300027907 | Bacteria | 14165 |
| 359 | Ga0207428_10006198 | 3300027907 | Bacteria | 11050 |
| 360 | Ga0207428_10199753 | 3300027907 | Bacteria | 1505 |
| 361 | Ga0207428_10225530 | 3300027907 | Bacteria | 1403 |
| 362 | Ga0268266_10004003 | 3300028379 | Bacteria | 14257 |
| 363 | Ga0268266_10012018 | 3300028379 | Bacteria | 7493 |
| 364 | Ga0268266_10023513 | 3300028379 | Bacteria | 5245 |
| 365 | Ga0268266_10109028 | 3300028379 | Bacteria | 2451 |
| 366 | Ga0268266_10192776 | 3300028379 | Bacteria | 1861 |
| 367 | Ga0268265_10000015 | 3300028380 | Bacteria | 322854 |
| 368 | Ga0268264_10010704 | 3300028381 | Bacteria | 7576 |
| 369 | Ga0268264_10041774 | 3300028381 | Bacteria | 3794 |
| 370 | Ga0268264_10070550 | 3300028381 | Bacteria | 2958 |
| 371 | Ga0268264_10134787 | 3300028381 | Bacteria | 2194 |
| 372 | Ga0268264_10213519 | 3300028381 | Bacteria | 1773 |
| 373 | Ga0265337_1000399 | 3300028556 | Bacteria | 23359 |
| 374 | Ga0265319_1014567 | 3300028563 | Bacteria | 3081 |
| 375 | Ga0265334_10000641 | 3300028573 | Bacteria | 17614 |
| 376 | Ga0265318_10005884 | 3300028577 | Bacteria | 5708 |
| 377 | Ga0265336_10010947 | 3300028666 | Bacteria | 3092 |
| 378 | Ga0307515_10000315 | 3300028794 | Bacteria | 119286 |
| 379 | Ga0265338_10001050 | 3300028800 | Bacteria | 46114 |
| 380 | Ga0265338_10023116 | 3300028800 | Bacteria | 6402 |
| 381 | Ga0265338_10197611 | 3300028800 | Bacteria | 1519 |
| 382 | Ga0265332_10009593 | 3300031238 | Bacteria | 4319 |
| 383 | Ga0265325_10014158 | 3300031241 | Bacteria | 4516 |
| 384 | Ga0265340_10005983 | 3300031247 | Bacteria | 6723 |
| 385 | Ga0265339_10017534 | 3300031249 | Bacteria | 4238 |
| 386 | Ga0265339_10021423 | 3300031249 | Bacteria | 3761 |
| 387 | Ga0265339_10052790 | 3300031249 | Bacteria | 2213 |
| 388 | Ga0265316_10061518 | 3300031344 | Bacteria | 2916 |
| 389 | Ga0265316_10063605 | 3300031344 | Bacteria | 2861 |
| 390 | Ga0307513_10001518 | 3300031456 | Bacteria | 33342 |
| 391 | Ga0307513_10089507 | 3300031456 | Bacteria | 3142 |
| 392 | Ga0307408_100214775 | 3300031548 | Bacteria | 1566 |
| 393 | Ga0307408_100250692 | 3300031548 | Bacteria | 1460 |
| 394 | Ga0265313_10040040 | 3300031595 | Bacteria | 2320 |
| 395 | Ga0307508_10000095 | 3300031616 | Bacteria | 103944 |
| 396 | Ga0307508_10107869 | 3300031616 | Bacteria | 2384 |
| 397 | Ga0307514_10018106 | 3300031649 | Bacteria | 5786 |
| 398 | Ga0316579_10029736 | 3300031691 | Bacteria | 2494 |
| 399 | Ga0265314_10052926 | 3300031711 | Bacteria | 2819 |
| 400 | Ga0265342_10061845 | 3300031712 | Bacteria | 2205 |
| 401 | Ga0316576_10002490 | 3300031727 | Bacteria | 10488 |
| 402 | Ga0316576_10018856 | 3300031727 | Bacteria | 4719 |
| 403 | Ga0316576_10029254 | 3300031727 | Bacteria | 3892 |
| 404 | Ga0316578_10008648 | 3300031728 | Bacteria | 5192 |
| 405 | Ga0307516_10008029 | 3300031730 | Bacteria | 12008 |
| 406 | Ga0307516_10122908 | 3300031730 | Bacteria | 2383 |
| 407 | Ga0307405_10240444 | 3300031731 | Bacteria | 1341 |
| 408 | Ga0316577_10037966 | 3300031733 | Bacteria | 2693 |
| 409 | Ga0307413_10000248 | 3300031824 | Bacteria | 16228 |
| 410 | Ga0307413_10007349 | 3300031824 | Bacteria | 5109 |
| 411 | Ga0307410_10000654 | 3300031852 | Bacteria | 14294 |
| 412 | Ga0307410_10036772 | 3300031852 | Bacteria | 3192 |
| 413 | Ga0307410_10072912 | 3300031852 | Bacteria | 2386 |
| 414 | Ga0307406_10015705 | 3300031901 | Bacteria | 4388 |
| 415 | Ga0307406_10053901 | 3300031901 | Bacteria | 2564 |
| 416 | Ga0307406_10150519 | 3300031901 | Bacteria | 1659 |
| 417 | Ga0307407_10000164 | 3300031903 | Bacteria | 20509 |
| 418 | Ga0307412_10165960 | 3300031911 | Bacteria | 1646 |
| 419 | Ga0307409_100001551 | 3300031995 | Bacteria | 11405 |
| 420 | Ga0307409_100016948 | 3300031995 | Bacteria | 4840 |
| 421 | Ga0307409_100161046 | 3300031995 | Bacteria | 1962 |
| 422 | Ga0307409_100328082 | 3300031995 | Bacteria | 1435 |
| 423 | Ga0307416_100036062 | 3300032002 | Bacteria | 3787 |
| 424 | Ga0307416_100039541 | 3300032002 | Bacteria | 3653 |
| 425 | Ga0307416_100051682 | 3300032002 | Bacteria | 3285 |
| 426 | Ga0307416_100192867 | 3300032002 | Bacteria | 1924 |
| 427 | Ga0307414_10003245 | 3300032004 | Bacteria | 8662 |
| 428 | Ga0307414_10299403 | 3300032004 | Bacteria | 1360 |
| 429 | Ga0307411_10021291 | 3300032005 | Bacteria | 3790 |
| 430 | Ga0307415_100100172 | 3300032126 | Bacteria | 2122 |
| 431 | Ga0307510_10227630 | 3300033180 | Bacteria | 1370 |
| 432 | Ga0373938_0030442 | 3300034957 | Bacteria | 1152 |
| 433 | Ga0373928_0014121 | 3300035084 | Bacteria | 1611 |
| 434 | Ga0373949_0023095 | 3300035090 | Bacteria | 1438 |
| 435 | Ga0373939_0004331 | 3300035114 | Bacteria | 3352 |
| 436 | Ga0373962_0002589 | 3300035242 | Bacteria | 4296 |
| 437 | Ga0316574_0013787 | 3300035398 | Bacteria | 4655 |
| 438 | Ga0316574_0016958 | 3300035398 | Bacteria | 4253 |
| 439 | Ga0316574_0094733 | 3300035398 | Bacteria | 1907 |
| 440 | Ga0373947_0127363 | 3300035725 | Unclassified | 1623 |
| 441 | Ga0316582_0034085 | 3300036647 | Bacteria | 3133 |
| 442 | Ga0316584_0168362 | 3300036712 | Bacteria | 1626 |
| 443 | Ga0373925_0000098 | 3300037068 | Bacteria | 94011 |
| 444 | Ga0373925_0279757 | 3300037068 | Bacteria | 1344 |
| 445 | Ga0395899_0005205 | 3300037312 | Bacteria | 10117 |
| 446 | Ga0395900_0005413 | 3300037418 | Bacteria | 13375 |
| 447 | Ga0395900_0078043 | 3300037418 | Bacteria | 3403 |
| 448 | Ga0395900_0109929 | 3300037418 | Bacteria | 2832 |
| 449 | Ga0395900_0112583 | 3300037418 | Bacteria | 2794 |
| 450 | Ga0395898_0003440 | 3300037466 | Bacteria | 17697 |
| 451 | Ga0395898_0128350 | 3300037466 | Bacteria | 2429 |
| 452 | Ga0395905_0015563 | 3300037471 | Bacteria | 7227 |
| 453 | Ga0395905_0073922 | 3300037471 | Bacteria | 3195 |
| 454 | Ga0436364_1050884 | 3300037853 | Bacteria | 2055 |
| 455 | Ga0395901_0003919 | 3300038443 | Bacteria | 14972 |
| 456 | Ga0395901_0016954 | 3300038443 | Bacteria | 7424 |
| 457 | Ga0395901_0023959 | 3300038443 | Bacteria | 6262 |
| 458 | Ga0395901_0114566 | 3300038443 | Bacteria | 2832 |
| 459 | Ga0395901_0247406 | 3300038443 | Bacteria | 1858 |
| 460 | Ga0400483_076985 | 3300039062 | Bacteria | 4585 |
| 461 | Ga0400483_215983 | 3300039062 | Bacteria | 44583 |
| 462 | Ga0436365_0681063 | 3300039437 | Bacteria | 33078 |
| 463 | Ga0436365_1655282 | 3300039437 | Bacteria | 1338 |
| 464 | Ga0451791_0903131 | 3300041451 | Bacteria | 2854 |
| 465 | Ga0451791_1281809 | 3300041451 | Bacteria | 1728 |
| 466 | Ga0451793_0187550 | 3300041452 | Bacteria | 2596 |
| 467 | Ga0451793_1426489 | 3300041452 | Bacteria | 2159 |
| 468 | Ga0451839_0463024 | 3300041496 | Bacteria | 1475 |
| 469 | Ga0451841_0327528 | 3300041498 | Bacteria | 1675 |
| 470 | Ga0451843_0083459 | 3300041509 | Bacteria | 2074 |
| 471 | Ga0451853_1726224 | 3300041512 | Bacteria | 4112 |
| 472 | Ga0439449_0066171 | 3300042007 | Bacteria | 1333 |
| 473 | Ga0439463_001486 | 3300042016 | Bacteria | 6193 |
| 474 | Ga0450914_001537 | 3300042118 | Bacteria | 1472 |
| 475 | Ga0439435_0009784 | 3300042436 | Bacteria | 2258 |
| 476 | Ga0439459_0002988 | 3300042438 | Bacteria | 2652 |
| 477 | Ga0439464_0021944 | 3300042439 | Bacteria | 1755 |
| 478 | Ga0439464_0047518 | 3300042439 | Bacteria | 1235 |
| 479 | Ga0451577_0015881 | 3300042876 | Bacteria | 6984 |
| 480 | Ga0439440_0012566 | 3300042993 | Bacteria | 1802 |
| 481 | Ga0466969_0042390 | 3300044656 | Bacteria | 2273 |
| 482 | Ga0466972_0081751 | 3300044658 | Bacteria | 1538 |
| 483 | Ga0466965_0046094 | 3300044683 | Bacteria | 2157 |
| 484 | Ga0466965_0173887 | 3300044683 | Bacteria | 1134 |
| 485 | Ga0466966_0021447 | 3300044684 | Bacteria | 4242 |
| 486 | Ga0466966_0030407 | 3300044684 | Bacteria | 3507 |
| 487 | Ga0466966_0059515 | 3300044684 | Bacteria | 2412 |
| 488 | Ga0466961_0014589 | 3300044693 | Bacteria | 5048 |
| 489 | Ga0466961_0018181 | 3300044693 | Bacteria | 4519 |
| 490 | Ga0466961_0060019 | 3300044693 | Bacteria | 2418 |
| 491 | Ga0466961_0095519 | 3300044693 | Bacteria | 1874 |
| 492 | Ga0466961_0113988 | 3300044693 | Bacteria | 1699 |
| 493 | Ga0466961_0163337 | 3300044693 | Bacteria | 1388 |
| 494 | Ga0466963_0008210 | 3300044694 | Bacteria | 6256 |
| 495 | Ga0466963_0014074 | 3300044694 | Bacteria | 4928 |
| 496 | Ga0466963_0038573 | 3300044694 | Bacteria | 3125 |
| 497 | Ga0466963_0118935 | 3300044694 | Bacteria | 1817 |
| 498 | Ga0466963_0208443 | 3300044694 | Bacteria | 1367 |
| 499 | Ga0466964_0001285 | 3300044706 | Bacteria | 8567 |
| 500 | Ga0453684_0015821 | 3300044712 | Bacteria | 11862 |
| 501 | Ga0466971_0004116 | 3300044719 | Bacteria | 6261 |
| 502 | Ga0466971_0023279 | 3300044719 | Bacteria | 2760 |
| 503 | Ga0466957_0001021 | 3300044842 | Bacteria | 14441 |
| 504 | Ga0466957_0057846 | 3300044842 | Bacteria | 2374 |
| 505 | Ga0466957_0146900 | 3300044842 | Bacteria | 1522 |
| 506 | Ga0466960_0000045 | 3300044901 | Bacteria | 40693 |
| 507 | Ga0466960_0011211 | 3300044901 | Bacteria | 3742 |
| 508 | Ga0466959_0001609 | 3300045049 | Bacteria | 13911 |
| 509 | Ga0466959_0010490 | 3300045049 | Bacteria | 6626 |
| 510 | Ga0466959_0058764 | 3300045049 | Bacteria | 2801 |
| 511 | Ga0466959_0066849 | 3300045049 | Bacteria | 2607 |
| 512 | Ga0466959_0070910 | 3300045049 | Bacteria | 2524 |
| 513 | Ga0466958_0006072 | 3300045836 | Bacteria | 6548 |
| 514 | Ga0466958_0006804 | 3300045836 | Bacteria | 6249 |
| 515 | Ga0466958_0013868 | 3300045836 | Bacteria | 4595 |
| 516 | Ga0466958_0025466 | 3300045836 | Bacteria | 3489 |
| 517 | Ga0466967_0006548 | 3300045976 | Bacteria | 8261 |
| 518 | Ga0466967_0017392 | 3300045976 | Bacteria | 5706 |
| 519 | Ga0466967_0017602 | 3300045976 | Bacteria | 5681 |
| 520 | Ga0466967_0112910 | 3300045976 | Bacteria | 2499 |
| 521 | Ga0466967_0115371 | 3300045976 | Bacteria | 2473 |
| 522 | Ga0466967_0143197 | 3300045976 | Bacteria | 2228 |
| 523 | Ga0466967_0204392 | 3300045976 | Bacteria | 1871 |
| 524 | Ga0466967_0318102 | 3300045976 | Bacteria | 1500 |
| 525 | Ga0495603_0048879 | 3300046455 | Bacteria | 2518 |
| 526 | Ga0495641_0006967 | 3300046461 | Bacteria | 7192 |
| 527 | Ga0495641_0016086 | 3300046461 | Bacteria | 3954 |
| 528 | Ga0495653_0019082 | 3300046463 | Bacteria | 5563 |
| 529 | Ga0495650_0000331 | 3300046471 | Bacteria | 84807 |
| 530 | Ga0495596_0058302 | 3300046500 | Bacteria | 1506 |
| 531 | Ga0495606_0011511 | 3300046507 | Bacteria | 7208 |
| 532 | Ga0495631_0042914 | 3300046518 | Bacteria | 1997 |
| 533 | Ga0495648_0012243 | 3300046524 | Bacteria | 6409 |
| 534 | Ga0495642_0027420 | 3300046528 | Bacteria | 2267 |
| 535 | Ga0495621_0044804 | 3300046539 | Bacteria | 1565 |
| 536 | Ga0495656_0070133 | 3300046615 | Bacteria | 1554 |
| 537 | Ga0495668_0002329 | 3300046616 | Bacteria | 15819 |
| 538 | Ga0495661_0101635 | 3300046665 | Bacteria | 1617 |
| 539 | Ga0495672_0005993 | 3300047320 | Bacteria | 9522 |
| 540 | Ga0495676_0040163 | 3300047321 | Bacteria | 3865 |
| 541 | Ga0495683_0080074 | 3300047323 | Bacteria | 1595 |
| 542 | Ga0495681_0079489 | 3300047470 | Bacteria | 1467 |
| 543 | Ga0495686_0107764 | 3300047472 | Bacteria | 1674 |
| 544 | Ga0495626_0000237 | 3300048091 | Bacteria | 63826 |
| 545 | Ga0495626_0003948 | 3300048091 | Bacteria | 9273 |
| 546 | Ga0496100_0008751 | 3300048903 | Bacteria | 5658 |
| 547 | Ga0496100_0053581 | 3300048903 | Bacteria | 2627 |
| 548 | Ga0496101_0002427 | 3300048904 | Bacteria | 11450 |
| 549 | Ga0496101_0020991 | 3300048904 | Bacteria | 4482 |
| 550 | Ga0496101_0110037 | 3300048904 | Bacteria | 2073 |
| 551 | Ga0496102_0000059 | 3300048905 | Bacteria | 168633 |
| 552 | Ga0496102_0000089 | 3300048905 | Bacteria | 128594 |
| 553 | Ga0496102_0004742 | 3300048905 | Bacteria | 11512 |
| 554 | Ga0496102_0025051 | 3300048905 | Bacteria | 5307 |
| 555 | Ga0496102_0046024 | 3300048905 | Bacteria | 3962 |
| 556 | Ga0496102_0091914 | 3300048905 | Bacteria | 2810 |
| 557 | Ga0496102_0119850 | 3300048905 | Bacteria | 2457 |
| 558 | Ga0496102_0275129 | 3300048905 | Bacteria | 1587 |
| 559 | Ga0496103_0000063 | 3300048906 | Bacteria | 128503 |
| 560 | Ga0496103_0000065 | 3300048906 | Bacteria | 128496 |
| 561 | Ga0496103_0018471 | 3300048906 | Bacteria | 4182 |
| 562 | Ga0496103_0127463 | 3300048906 | Bacteria | 1624 |
| 563 | Ga0496103_0171703 | 3300048906 | Bacteria | 1392 |
| 564 | Ga0496104_0047487 | 3300048907 | Bacteria | 4046 |
| 565 | Ga0496104_0065948 | 3300048907 | Bacteria | 3437 |
| 566 | Ga0496104_0148867 | 3300048907 | Bacteria | 2247 |
| 567 | Ga0496104_0180076 | 3300048907 | Bacteria | 2024 |
| 568 | Ga0496104_0193989 | 3300048907 | Bacteria | 1943 |
| 569 | Ga0496104_0208139 | 3300048907 | Bacteria | 1868 |
| 570 | Ga0496104_0376413 | 3300048907 | Bacteria | 1332 |
| 571 | Ga0496105_0006741 | 3300048908 | Bacteria | 8830 |
| 572 | Ga0496105_0036330 | 3300048908 | Bacteria | 4058 |
| 573 | Ga0496105_0105937 | 3300048908 | Bacteria | 2321 |
| 574 | Ga0496105_0129634 | 3300048908 | Bacteria | 2080 |
| 575 | Ga0496105_0176165 | 3300048908 | Bacteria | 1752 |
| 576 | Ga0496107_0221371 | 3300048910 | Bacteria | 1408 |
| 577 | Ga0496107_0240950 | 3300048910 | Bacteria | 1346 |
| 578 | Ga0496107_0339772 | 3300048910 | Bacteria | 1117 |
| 579 | Ga0496108_0000168 | 3300048911 | Bacteria | 61503 |
| 580 | Ga0496108_0026484 | 3300048911 | Bacteria | 4782 |
| 581 | Ga0496108_0035825 | 3300048911 | Bacteria | 4127 |
| 582 | Ga0496108_0065104 | 3300048911 | Bacteria | 3072 |
| 583 | Ga0496108_0079922 | 3300048911 | Bacteria | 2769 |
| 584 | Ga0496108_0180445 | 3300048911 | Bacteria | 1828 |
| 585 | Ga0496109_0004796 | 3300048912 | Bacteria | 11290 |
| 586 | Ga0496109_0034074 | 3300048912 | Bacteria | 4583 |
| 587 | Ga0496109_0038731 | 3300048912 | Bacteria | 4311 |
| 588 | Ga0496109_0045518 | 3300048912 | Bacteria | 3983 |
| 589 | Ga0496109_0052740 | 3300048912 | Bacteria | 3708 |
| 590 | Ga0496109_0066056 | 3300048912 | Bacteria | 3311 |
| 591 | Ga0496109_0259678 | 3300048912 | Bacteria | 1636 |
| 592 | Ga0496110_0001456 | 3300048913 | Bacteria | 17158 |
| 593 | Ga0496110_0011966 | 3300048913 | Bacteria | 7125 |
| 594 | Ga0496110_0017590 | 3300048913 | Bacteria | 5978 |
| 595 | Ga0496110_0032641 | 3300048913 | Bacteria | 4499 |
| 596 | Ga0496110_0072706 | 3300048913 | Bacteria | 3052 |
| 597 | Ga0496110_0175779 | 3300048913 | Bacteria | 1943 |
| 598 | Ga0496110_0387049 | 3300048913 | Bacteria | 1274 |
| 599 | Ga0496111_0020992 | 3300048914 | Bacteria | 4553 |
| 600 | Ga0496111_0026821 | 3300048914 | Bacteria | 4070 |
| 601 | Ga0496111_0053217 | 3300048914 | Bacteria | 2924 |
| 602 | Ga0496111_0053760 | 3300048914 | Bacteria | 2910 |
| 603 | Ga0496111_0108873 | 3300048914 | Bacteria | 2040 |
| 604 | Ga0496111_0111123 | 3300048914 | Bacteria | 2019 |
| 605 | Ga0496111_0124293 | 3300048914 | Bacteria | 1907 |
| 606 | Ga0496111_0145873 | 3300048914 | Bacteria | 1755 |
| 607 | Ga0496112_0009404 | 3300048915 | Bacteria | 8803 |
| 608 | Ga0496112_0010002 | 3300048915 | Bacteria | 8584 |
| 609 | Ga0496112_0012308 | 3300048915 | Bacteria | 7857 |
| 610 | Ga0496112_0089752 | 3300048915 | Bacteria | 3042 |
| 611 | Ga0496113_0041450 | 3300048916 | Bacteria | 3398 |
| 612 | Ga0496113_0091785 | 3300048916 | Bacteria | 2341 |
| 613 | Ga0496114_0006455 | 3300048917 | Bacteria | 9238 |
| 614 | Ga0496114_0077415 | 3300048917 | Bacteria | 2804 |
| 615 | Ga0496114_0192099 | 3300048917 | Bacteria | 1787 |
| 616 | Ga0496115_0038565 | 3300048918 | Bacteria | 3791 |
| 617 | Ga0496115_0108796 | 3300048918 | Bacteria | 2276 |
| 618 | Ga0496115_0367262 | 3300048918 | Bacteria | 1172 |
| 619 | Ga0496116_0000208 | 3300048919 | Bacteria | 111165 |
| 620 | Ga0496116_0000371 | 3300048919 | Bacteria | 67456 |
| 621 | Ga0496117_0000063 | 3300048920 | Bacteria | 254446 |
| 622 | Ga0496117_0000191 | 3300048920 | Bacteria | 124489 |
| 623 | Ga0496117_0003104 | 3300048920 | Bacteria | 19864 |
| 624 | Ga0496117_0017074 | 3300048920 | Bacteria | 6078 |
| 625 | Ga0496117_0062912 | 3300048920 | Bacteria | 2540 |
| 626 | Ga0496117_0068764 | 3300048920 | Bacteria | 2389 |
| 627 | Ga0496117_0077169 | 3300048920 | Bacteria | 2206 |
| 628 | Ga0496118_0000220 | 3300048921 | Bacteria | 99877 |
| 629 | Ga0496118_0002375 | 3300048921 | Bacteria | 25435 |
| 630 | Ga0496118_0003721 | 3300048921 | Bacteria | 18881 |
| 631 | Ga0496118_0008903 | 3300048921 | Bacteria | 10255 |
| 632 | Ga0496118_0017172 | 3300048921 | Bacteria | 6602 |
| 633 | Ga0496119_0000634 | 3300048922 | Bacteria | 47422 |
| 634 | Ga0496119_0000892 | 3300048922 | Bacteria | 39075 |
| 635 | Ga0496119_0002091 | 3300048922 | Bacteria | 22550 |
| 636 | Ga0496119_0004156 | 3300048922 | Bacteria | 14556 |
| 637 | Ga0496119_0009813 | 3300048922 | Bacteria | 8143 |
| 638 | Ga0496119_0025979 | 3300048922 | Bacteria | 4075 |
| 639 | Ga0496119_0076583 | 3300048922 | Bacteria | 1940 |
| 640 | Ga0496120_0001936 | 3300048923 | Bacteria | 22752 |
| 641 | Ga0496120_0002612 | 3300048923 | Bacteria | 17853 |
| 642 | Ga0496120_0003042 | 3300048923 | Bacteria | 15828 |
| 643 | Ga0496120_0006445 | 3300048923 | Bacteria | 9014 |
| 644 | Ga0496120_0023873 | 3300048923 | Bacteria | 3821 |
| 645 | Ga0496121_0029106 | 3300048924 | Bacteria | 5120 |
| 646 | Ga0496121_0073884 | 3300048924 | Bacteria | 2730 |
| 647 | Ga0496121_0133316 | 3300048924 | Bacteria | 1855 |
| 648 | Ga0496122_0000022 | 3300048925 | Bacteria | 388704 |
| 649 | Ga0496122_0002058 | 3300048925 | Bacteria | 29852 |
| 650 | Ga0496122_0005683 | 3300048925 | Bacteria | 14724 |
| 651 | Ga0496122_0052756 | 3300048925 | Bacteria | 3074 |
| 652 | Ga0496123_0000016 | 3300048926 | Bacteria | 424330 |
| 653 | Ga0496123_0002798 | 3300048926 | Bacteria | 20726 |
| 654 | Ga0496123_0014505 | 3300048926 | Bacteria | 6526 |
| 655 | Ga0496123_0018712 | 3300048926 | Bacteria | 5490 |
| 656 | Ga0496123_0047642 | 3300048926 | Bacteria | 2893 |
| 657 | Ga0496124_0000389 | 3300048927 | Bacteria | 80434 |
| 658 | Ga0496124_0011542 | 3300048927 | Bacteria | 8816 |
| 659 | Ga0496125_0036635 | 3300048928 | Bacteria | 4278 |
| 660 | Ga0496126_0001114 | 3300048929 | Bacteria | 45010 |
| 661 | Ga0496126_0002220 | 3300048929 | Bacteria | 26882 |
| 662 | Ga0496126_0004214 | 3300048929 | Bacteria | 17327 |
| 663 | Ga0496126_0013693 | 3300048929 | Bacteria | 8233 |
| 664 | Ga0496126_0020829 | 3300048929 | Bacteria | 6418 |
| 665 | Ga0496126_0038376 | 3300048929 | Bacteria | 4458 |
| 666 | Ga0496126_0118116 | 3300048929 | Bacteria | 2303 |
| 667 | Ga0496126_0142716 | 3300048929 | Bacteria | 2060 |
| 668 | Ga0501031_0005570 | 3300049568 | Bacteria | 8204 |
| 669 | Ga0501031_0111414 | 3300049568 | Bacteria | 1787 |
| 670 | Ga0501032_0002340 | 3300049569 | Bacteria | 14860 |
| 671 | Ga0501032_0048933 | 3300049569 | Bacteria | 2853 |
| 672 | Ga0501033_0004025 | 3300049570 | Bacteria | 11879 |
| 673 | Ga0501033_0016214 | 3300049570 | Bacteria | 5642 |
| 674 | Ga0501033_0037419 | 3300049570 | Bacteria | 3632 |
| 675 | Ga0501034_0002740 | 3300049571 | Bacteria | 20737 |
| 676 | Ga0501034_0003858 | 3300049571 | Bacteria | 16893 |
| 677 | Ga0501034_0005401 | 3300049571 | Bacteria | 13969 |
| 678 | Ga0501034_0005853 | 3300049571 | Bacteria | 13375 |
| 679 | Ga0501034_0014985 | 3300049571 | Bacteria | 7974 |
| 680 | Ga0501034_0019391 | 3300049571 | Bacteria | 6956 |
| 681 | Ga0501034_0037337 | 3300049571 | Bacteria | 4918 |
| 682 | Ga0501034_0042962 | 3300049571 | Bacteria | 4575 |
| 683 | Ga0501034_0065347 | 3300049571 | Bacteria | 3650 |
| 684 | Ga0501034_0135740 | 3300049571 | Bacteria | 2441 |
| 685 | Ga0501036_0011560 | 3300049572 | Bacteria | 7315 |
| 686 | Ga0501036_0033494 | 3300049572 | Bacteria | 4345 |
| 687 | Ga0501036_0041367 | 3300049572 | Bacteria | 3900 |
| 688 | Ga0501036_0100163 | 3300049572 | Bacteria | 2451 |
| 689 | Ga0501037_0001389 | 3300049573 | Bacteria | 17759 |
| 690 | Ga0501037_0002506 | 3300049573 | Bacteria | 13259 |
| 691 | Ga0501037_0010590 | 3300049573 | Bacteria | 6773 |
| 692 | Ga0501038_0004227 | 3300049574 | Bacteria | 13342 |
| 693 | Ga0501038_0013077 | 3300049574 | Bacteria | 7570 |
| 694 | Ga0501038_0077158 | 3300049574 | Bacteria | 2813 |
| 695 | Ga0501039_0038238 | 3300049575 | Bacteria | 3707 |
| 696 | Ga0501039_0069298 | 3300049575 | Bacteria | 2739 |
| 697 | Ga0501039_0303894 | 3300049575 | Bacteria | 1254 |
| 698 | Ga0501041_0074422 | 3300049577 | Bacteria | 2087 |
| 699 | Ga0501042_0015678 | 3300049578 | Bacteria | 5191 |
| 700 | Ga0501042_0023790 | 3300049578 | Bacteria | 4290 |
| 701 | Ga0501042_0066077 | 3300049578 | Bacteria | 2585 |
| 702 | Ga0501043_0004169 | 3300049579 | Bacteria | 11812 |
| 703 | Ga0501043_0006552 | 3300049579 | Bacteria | 9339 |
| 704 | Ga0501046_0023618 | 3300049580 | Bacteria | 5053 |
| 705 | Ga0501046_0116026 | 3300049580 | Bacteria | 2041 |
| 706 | Ga0501046_0137659 | 3300049580 | Bacteria | 1849 |
| 707 | Ga0501047_0008684 | 3300049581 | Bacteria | 9595 |
| 708 | Ga0501047_0024485 | 3300049581 | Bacteria | 5792 |
| 709 | Ga0501047_0049297 | 3300049581 | Bacteria | 4066 |
| 710 | Ga0501047_0105410 | 3300049581 | Bacteria | 2699 |
| 711 | Ga0501048_0002684 | 3300049582 | Bacteria | 13587 |
| 712 | Ga0501048_0037788 | 3300049582 | Bacteria | 3467 |
| 713 | Ga0501048_0040076 | 3300049582 | Bacteria | 3357 |
| 714 | Ga0501048_0062565 | 3300049582 | Bacteria | 2634 |
| 715 | Ga0501067_0004631 | 3300049583 | Bacteria | 7618 |
| 716 | Ga0501068_0001815 | 3300049584 | Bacteria | 11335 |
| 717 | Ga0501068_0011051 | 3300049584 | Bacteria | 5082 |
| 718 | Ga0501069_0001225 | 3300049585 | Bacteria | 12530 |
| 719 | Ga0501069_0013761 | 3300049585 | Bacteria | 4316 |
| 720 | Ga0501070_0004078 | 3300049586 | Bacteria | 12554 |
| 721 | Ga0501070_0017082 | 3300049586 | Bacteria | 6090 |
| 722 | Ga0501070_0033286 | 3300049586 | Bacteria | 4312 |
| 723 | Ga0501070_0055192 | 3300049586 | Bacteria | 3293 |
| 724 | Ga0501071_0001085 | 3300049587 | Bacteria | 15117 |
| 725 | Ga0501071_0203204 | 3300049587 | Bacteria | 1489 |
| 726 | Ga0501072_0390098 | 3300049588 | Bacteria | 1105 |
| 727 | Ga0501073_0000965 | 3300049589 | Bacteria | 20696 |
| 728 | Ga0501073_0019249 | 3300049589 | Bacteria | 4931 |
| 729 | Ga0501073_0078868 | 3300049589 | Bacteria | 2292 |
| 730 | Ga0501073_0114028 | 3300049589 | Bacteria | 1874 |
| 731 | Ga0501075_0011325 | 3300049591 | Bacteria | 6309 |
| 732 | Ga0501075_0082245 | 3300049591 | Bacteria | 2439 |
| 733 | Ga0501076_0145365 | 3300049592 | Bacteria | 1928 |
| 734 | Ga0501077_0049286 | 3300049593 | Bacteria | 2677 |
| 735 | Ga0501077_0087901 | 3300049593 | Bacteria | 1969 |
| 736 | Ga0501079_0116525 | 3300049741 | Bacteria | 2076 |
| 737 | Ga0501080_0003844 | 3300049742 | Bacteria | 13266 |
| 738 | Ga0501080_0454891 | 3300049742 | Bacteria | 1147 |
| 739 | Ga0501083_0001426 | 3300049744 | Bacteria | 16299 |
| 740 | Ga0501083_0001558 | 3300049744 | Bacteria | 15668 |
| 741 | Ga0501035_0006226 | 3300049822 | Bacteria | 11221 |
| 742 | Ga0501035_0011783 | 3300049822 | Bacteria | 8095 |
| 743 | Ga0501035_0088794 | 3300049822 | Bacteria | 2723 |
| 744 | Ga0501035_0198355 | 3300049822 | Bacteria | 1722 |
| 745 | Ga0501044_0009726 | 3300049823 | Bacteria | 10460 |
| 746 | Ga0501044_0051779 | 3300049823 | Bacteria | 4232 |
| 747 | Ga0501044_0067538 | 3300049823 | Bacteria | 3643 |
| 748 | Ga0501044_0093354 | 3300049823 | Bacteria | 3034 |
| 749 | Ga0501044_0099382 | 3300049823 | Bacteria | 2928 |
| 750 | Ga0501045_0058965 | 3300049824 | Bacteria | 2812 |
| 751 | Ga0501045_0076112 | 3300049824 | Bacteria | 2472 |
| 752 | Ga0501045_0185045 | 3300049824 | Bacteria | 1552 |
| 753 | nmdc:mga03683_18115_c1 | 3300050489 | Bacteria | 2674 |
| 754 | nmdc:mga00v17_454_c1 | 3300050491 | Bacteria | 17369 |
| 755 | nmdc:mga00v17_62819_c1 | 3300050491 | Bacteria | 2286 |
| 756 | nmdc:mga0yw44_93344_c1 | 3300050492 | Bacteria | 1906 |
| 757 | nmdc:mga07m45_132319_c1 | 3300050496 | Bacteria | 1443 |
| 758 | nmdc:mga05p37_106223_c1 | 3300050507 | Bacteria | 3454 |
| 759 | nmdc:mga05p37_17610_c1 | 3300050507 | Bacteria | 8623 |
| 760 | nmdc:mga05p37_188224_c1 | 3300050507 | Bacteria | 2508 |
| 761 | nmdc:mga05p37_23533_c1 | 3300050507 | Bacteria | 7475 |
| 762 | nmdc:mga05p37_27589_c1 | 3300050507 | Bacteria | 6915 |
| 763 | nmdc:mga05p37_5655_c1 | 3300050507 | Bacteria | 14699 |
| 764 | nmdc:mga05p37_84862_c1 | 3300050507 | Bacteria | 3902 |
| 765 | nmdc:mga05p37_982_c1 | 3300050507 | Bacteria | 32429 |
| 766 | nmdc:mga09592_1616_c1 | 3300050508 | Bacteria | 18153 |
| 767 | nmdc:mga09592_33717_c1 | 3300050508 | Bacteria | 4276 |
| 768 | nmdc:mga09592_4451_c1 | 3300050508 | Bacteria | 11338 |
| 769 | nmdc:mga09592_47131_c1 | 3300050508 | Bacteria | 3632 |
| 770 | nmdc:mga09592_66051_c1 | 3300050508 | Bacteria | 3065 |
| 771 | nmdc:mga09592_79847_c1 | 3300050508 | Bacteria | 2786 |
| 772 | nmdc:mga09592_89_c1 | 3300050508 | Bacteria | 54416 |
| 773 | nmdc:mga0qj67_2866_c1 | 3300050509 | Bacteria | 12373 |
| 774 | nmdc:mga0qj67_54800_c1 | 3300050509 | Bacteria | 3158 |
| 775 | nmdc:mga0qj67_56630_c1 | 3300050509 | Bacteria | 3107 |
| 776 | nmdc:mga0qj67_8_c5 | 3300050509 | Bacteria | 62463 |
| 777 | nmdc:mga06r32_126_c1 | 3300050510 | Bacteria | 55377 |
| 778 | nmdc:mga06r32_150029_c1 | 3300050510 | Bacteria | 2309 |
| 779 | nmdc:mga06r32_15281_c1 | 3300050510 | Bacteria | 6974 |
| 780 | nmdc:mga06r32_28087_c1 | 3300050510 | Bacteria | 5262 |
| 781 | nmdc:mga08y16_109606_c1 | 3300050511 | Bacteria | 2874 |
| 782 | nmdc:mga08y16_11761_c1 | 3300050511 | Bacteria | 9194 |
| 783 | nmdc:mga08y16_426445_c1 | 3300050511 | Bacteria | 1355 |
| 784 | nmdc:mga0n895_109096_c1 | 3300050512 | Bacteria | 2783 |
| 785 | nmdc:mga0n895_652006_c1 | 3300050512 | Bacteria | 1051 |
| 786 | nmdc:mga0n895_7081_c1 | 3300050512 | Bacteria | 9585 |
| 787 | nmdc:mga0n895_99242_c1 | 3300050512 | Bacteria | 2920 |
| 788 | nmdc:mga0rr50_320459_c1 | 3300050513 | Bacteria | 1299 |
| 789 | nmdc:mga0a205_45069_c1 | 3300050515 | Bacteria | 4253 |
| 790 | nmdc:mga0sz30_136611_c1 | 3300050516 | Bacteria | 1082 |
| 791 | Ga0495595_0061984 | 3300053084 | Bacteria | 1753 |
| 792 | Ga0500643_000072 | 3300053087 | Bacteria | 112810 |
| 793 | Ga0500644_0061301 | 3300053088 | Bacteria | 1326 |
| 794 | Ga0500644_0064853 | 3300053088 | Bacteria | 1299 |
| 795 | Ga0500650_0003218 | 3300053098 | Bacteria | 5618 |
| 796 | Ga0500556_0000001 | 3300053104 | Bacteria | 1135060 |
| 797 | Ga0500556_0001107 | 3300053104 | Bacteria | 13405 |
| 798 | Ga0500652_056375 | 3300053131 | Bacteria | 1611 |
| 799 | Ga0500559_0000043 | 3300053136 | Bacteria | 100617 |
| 800 | Ga0500559_0003767 | 3300053136 | Bacteria | 7364 |
| 801 | Ga0500559_0022047 | 3300053136 | Bacteria | 2701 |
| 802 | Ga0500568_0000003 | 3300053139 | Bacteria | 863587 |
| 803 | Ga0500568_0000071 | 3300053139 | Bacteria | 99625 |
| 804 | Ga0500568_0000714 | 3300053139 | Bacteria | 23777 |
| 805 | Ga0500573_0000001 | 3300053140 | Bacteria | 436394 |
| 806 | Ga0500573_0017028 | 3300053140 | Bacteria | 4134 |
| 807 | Ga0500616_0000058 | 3300053153 | Bacteria | 266276 |
| 808 | Ga0500616_0000885 | 3300053153 | Bacteria | 33029 |
| 809 | Ga0500616_0000953 | 3300053153 | Bacteria | 31416 |
| 810 | Ga0500616_0004063 | 3300053153 | Bacteria | 10644 |
| 811 | Ga0500616_0005888 | 3300053153 | Bacteria | 8200 |
| 812 | Ga0500616_0015772 | 3300053153 | Bacteria | 4313 |
| 813 | Ga0500616_0017259 | 3300053153 | Bacteria | 4098 |
| 814 | Ga0500645_004187 | 3300053730 | Bacteria | 5613 |
| 815 | Ga0501084_0011719 | 3300054114 | Bacteria | 7257 |
| 816 | Ga0501082_0174501 | 3300060353 | Bacteria | 1869 |
| 817 | Ga0466962_0000651 | 3300061719 | Bacteria | 15399 |
| 818 | Ga0466962_0068529 | 3300061719 | Bacteria | 1694 |
| 819 | Ga0530510_0083078 | 3300061734 | Bacteria | 2332 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025911 | Ga0207654_10265164 | Ga0207654_102651641 | 283 |
| 2 | 3300009094 | Ga0111539_10668257 | Ga0111539_106682571 | 289 |
| 3 | 3300049574 | Ga0501038_0013077 | Ga0501038_0013077_1129_2013 | 293 |
| 4 | 3300049592 | Ga0501076_0145365 | Ga0501076_0145365_11_937 | 307 |
| 5 | 3300050513 | nmdc:mga0rr50_320459_c1 | nmdc:mga0rr50_320459_c1_137_1063 | 307 |
| 6 | 3300034957 | Ga0373938_0030442 | Ga0373938_0030442_209_1138 | 309 |
| 7 | 3300048913 | Ga0496110_0387049 | Ga0496110_0387049_20_985 | 316 |
| 8 | 3300050512 | nmdc:mga0n895_652006_c1 | nmdc:mga0n895_652006_c1_45_1010 | 318 |
| 9 | 3300047320 | Ga0495672_0005993 | Ga0495672_0005993_4433_5404 | 321 |
| 10 | 3300050516 | nmdc:mga0sz30_136611_c1 | nmdc:mga0sz30_136611_c1_92_1072 | 321 |
| 11 | 3300031824 | Ga0307413_10000248 | Ga0307413_100002484 | 322 |
| 12 | 3300047470 | Ga0495681_0079489 | Ga0495681_0079489_16_987 | 323 |
| 13 | 3300048918 | Ga0496115_0367262 | Ga0496115_0367262_22_1008 | 323 |
| 14 | iso_pu_bacteria | 2751185782 | 2753269179 | 326 |
| 15 | iso_pu_bacteria | 2915358134 | 2915360174 | 326 |
| 16 | iso_pu_bacteria | 2816332139 | 2816505238 | 327 |
| 17 | iso_pu_bacteria | 2863067949 | 2863073713 | 327 |
| 18 | iso_pu_bacteria | 2866552031 | 2866554026 | 327 |
| 19 | iso_pu_bacteria | 8056207758 | 8056214244 | 327 |
| 20 | iso_pu_bacteria | 2579778521 | 2579856985 | 328 |
| 21 | iso_pu_bacteria | 2619618881 | 2619858602 | 328 |
| 22 | iso_pu_bacteria | 2619619003 | 2620352826 | 328 |
| 23 | iso_pu_bacteria | 2675903059 | 2676484362 | 328 |
| 24 | iso_pu_bacteria | 2887478801 | 2887483452 | 328 |
| 25 | iso_pu_bacteria | 2966598605 | 2966599889 | 328 |
| 26 | iso_pu_bacteria | 8001781756 | 8001782723 | 328 |
| 27 | 3300005841 | Ga0068863_100008129 | Ga0068863_1000081295 | 329 |
| 28 | 3300005937 | Ga0081455_10083784 | Ga0081455_100837842 | 329 |
| 29 | 3300014968 | Ga0157379_10006923 | Ga0157379_1000692310 | 329 |
| 30 | 3300025904 | Ga0207647_10004472 | Ga0207647_1000447212 | 329 |
| 31 | 3300026088 | Ga0207641_10004202 | Ga0207641_100042026 | 329 |
| 32 | 3300026116 | Ga0207674_10192127 | Ga0207674_101921272 | 329 |
| 33 | 3300048903 | Ga0496100_0008751 | Ga0496100_0008751_2660_3655 | 329 |
| 34 | 3300048904 | Ga0496101_0002427 | Ga0496101_0002427_562_1557 | 329 |
| 35 | 3300048905 | Ga0496102_0000089 | Ga0496102_0000089_80663_81658 | 329 |
| 36 | 3300048906 | Ga0496103_0000065 | Ga0496103_0000065_46970_47965 | 329 |
| 37 | 3300048907 | Ga0496104_0193989 | Ga0496104_0193989_660_1655 | 329 |
| 38 | 3300048910 | Ga0496107_0221371 | Ga0496107_0221371_388_1383 | 329 |
| 39 | 3300048911 | Ga0496108_0065104 | Ga0496108_0065104_1813_2808 | 329 |
| 40 | 3300048913 | Ga0496110_0072706 | Ga0496110_0072706_979_1974 | 329 |
| 41 | 3300048914 | Ga0496111_0124293 | Ga0496111_0124293_753_1748 | 329 |
| 42 | 3300048919 | Ga0496116_0000208 | Ga0496116_0000208_80628_81623 | 329 |
| 43 | 3300048920 | Ga0496117_0000191 | Ga0496117_0000191_80594_81589 | 329 |
| 44 | 3300048921 | Ga0496118_0000220 | Ga0496118_0000220_80672_81667 | 329 |
| 45 | 3300048922 | Ga0496119_0000634 | Ga0496119_0000634_42932_43927 | 329 |
| 46 | 3300048923 | Ga0496120_0003042 | Ga0496120_0003042_12245_13240 | 329 |
| 47 | 3300048929 | Ga0496126_0001114 | Ga0496126_0001114_18229_19224 | 329 |
| 48 | 3300050509 | nmdc:mga0qj67_56630_c1 | nmdc:mga0qj67_56630_c1_827_1831 | 329 |
| 49 | iso_pu_bacteria | 2887478801 | 2887486423 | 329 |
| 50 | iso_pu_bacteria | 8001781756 | 8001782589 | 329 |
| 51 | 3300005336 | Ga0070680_100237299 | Ga0070680_1002372992 | 330 |
| 52 | 3300005548 | Ga0070665_100007578 | Ga0070665_1000075783 | 330 |
| 53 | 3300005841 | Ga0068863_100055915 | Ga0068863_1000559154 | 330 |
| 54 | 3300006844 | Ga0075428_100000474 | Ga0075428_1000004744 | 330 |
| 55 | 3300006844 | Ga0075428_100022805 | Ga0075428_1000228053 | 330 |
| 56 | 3300006846 | Ga0075430_100002201 | Ga0075430_1000022012 | 330 |
| 57 | 3300006846 | Ga0075430_100021522 | Ga0075430_1000215222 | 330 |
| 58 | 3300006847 | Ga0075431_100001764 | Ga0075431_10000176411 | 330 |
| 59 | 3300006847 | Ga0075431_100012785 | Ga0075431_1000127857 | 330 |
| 60 | 3300006847 | Ga0075431_100085475 | Ga0075431_1000854752 | 330 |
| 61 | 3300006880 | Ga0075429_100001303 | Ga0075429_10000130311 | 330 |
| 62 | 3300006880 | Ga0075429_100007859 | Ga0075429_1000078598 | 330 |
| 63 | 3300009147 | Ga0114129_10000048 | Ga0114129_100000485 | 330 |
| 64 | 3300009147 | Ga0114129_10000128 | Ga0114129_1000012828 | 330 |
| 65 | 3300009147 | Ga0114129_10001574 | Ga0114129_100015742 | 330 |
| 66 | 3300026088 | Ga0207641_10048886 | Ga0207641_100488864 | 330 |
| 67 | 3300028379 | Ga0268266_10023513 | Ga0268266_100235132 | 330 |
| 68 | 3300028794 | Ga0307515_10000315 | Ga0307515_1000031582 | 330 |
| 69 | 3300031456 | Ga0307513_10089507 | Ga0307513_100895073 | 330 |
| 70 | 3300031548 | Ga0307408_100250692 | Ga0307408_1002506922 | 330 |
| 71 | 3300031616 | Ga0307508_10107869 | Ga0307508_101078692 | 330 |
| 72 | 3300031730 | Ga0307516_10122908 | Ga0307516_101229083 | 330 |
| 73 | 3300031852 | Ga0307410_10036772 | Ga0307410_100367722 | 330 |
| 74 | 3300032002 | Ga0307416_100039541 | Ga0307416_1000395412 | 330 |
| 75 | 3300033180 | Ga0307510_10227630 | Ga0307510_102276302 | 330 |
| 76 | 3300035242 | Ga0373962_0002589 | Ga0373962_0002589_900_1895 | 330 |
| 77 | 3300039062 | Ga0400483_215983 | Ga0400483_215983_10202_11200 | 330 |
| 78 | 3300041512 | Ga0451853_1726224 | Ga0451853_1726224_452_1447 | 330 |
| 79 | 3300050507 | nmdc:mga05p37_27589_c1 | nmdc:mga05p37_27589_c1_1694_2689 | 330 |
| 80 | 3300050507 | nmdc:mga05p37_5655_c1 | nmdc:mga05p37_5655_c1_11588_12583 | 330 |
| 81 | 3300050507 | nmdc:mga05p37_982_c1 | nmdc:mga05p37_982_c1_10962_11957 | 330 |
| 82 | 3300050508 | nmdc:mga09592_79847_c1 | nmdc:mga09592_79847_c1_1186_2181 | 330 |
| 83 | 3300050508 | nmdc:mga09592_89_c1 | nmdc:mga09592_89_c1_32470_33465 | 330 |
| 84 | 3300050509 | nmdc:mga0qj67_54800_c1 | nmdc:mga0qj67_54800_c1_1186_2181 | 330 |
| 85 | 3300050509 | nmdc:mga0qj67_8_c5 | nmdc:mga0qj67_8_c5_28999_29994 | 330 |
| 86 | 3300050510 | nmdc:mga06r32_126_c1 | nmdc:mga06r32_126_c1_32470_33465 | 330 |
| 87 | 3300050510 | nmdc:mga06r32_15281_c1 | nmdc:mga06r32_15281_c1_1190_2185 | 330 |
| 88 | 3300053088 | Ga0500644_0061301 | Ga0500644_0061301_176_1171 | 330 |
| 89 | 3300003203 | JGI25406J46586_10033705 | JGI25406J46586_100337052 | 331 |
| 90 | 3300005337 | Ga0070682_100078320 | Ga0070682_1000783203 | 331 |
| 91 | 3300005548 | Ga0070665_100102824 | Ga0070665_1001028242 | 331 |
| 92 | 3300005618 | Ga0068864_100265931 | Ga0068864_1002659312 | 331 |
| 93 | 3300005841 | Ga0068863_100220203 | Ga0068863_1002202032 | 331 |
| 94 | 3300005985 | Ga0081539_10000135 | Ga0081539_1000013584 | 331 |
| 95 | 3300005985 | Ga0081539_10004612 | Ga0081539_1000461210 | 331 |
| 96 | 3300005985 | Ga0081539_10072935 | Ga0081539_100729352 | 331 |
| 97 | 3300006881 | Ga0068865_100221036 | Ga0068865_1002210362 | 331 |
| 98 | 3300009094 | Ga0111539_10434264 | Ga0111539_104342641 | 331 |
| 99 | 3300009979 | Ga0105032_104382 | Ga0105032_1043822 | 331 |
| 100 | 3300009988 | Ga0105035_100234 | Ga0105035_1002343 | 331 |
| 101 | 3300011119 | Ga0105246_10066499 | Ga0105246_100664992 | 331 |
| 102 | 3300013308 | Ga0157375_10234003 | Ga0157375_102340032 | 331 |
| 103 | 3300025901 | Ga0207688_10135586 | Ga0207688_101355862 | 331 |
| 104 | 3300025919 | Ga0207657_10118487 | Ga0207657_101184872 | 331 |
| 105 | 3300025932 | Ga0207690_10094929 | Ga0207690_100949292 | 331 |
| 106 | 3300025939 | Ga0207665_10002648 | Ga0207665_100026486 | 331 |
| 107 | 3300025981 | Ga0207640_10194095 | Ga0207640_101940951 | 331 |
| 108 | 3300028379 | Ga0268266_10109028 | Ga0268266_101090282 | 331 |
| 109 | 3300031730 | Ga0307516_10008029 | Ga0307516_100080296 | 331 |
| 110 | 3300039062 | Ga0400483_076985 | Ga0400483_076985_1274_2275 | 331 |
| 111 | 3300048091 | Ga0495626_0003948 | Ga0495626_0003948_57_1055 | 331 |
| 112 | 3300048911 | Ga0496108_0000168 | Ga0496108_0000168_41599_42597 | 331 |
| 113 | 3300048915 | Ga0496112_0009404 | Ga0496112_0009404_1527_2525 | 331 |
| 114 | 3300048915 | Ga0496112_0010002 | Ga0496112_0010002_497_1558 | 331 |
| 115 | iso_pu_bacteria | 2775506925 | 2776370903 | 331 |
| 116 | iso_pu_bacteria | 2799112218 | 2799183123 | 331 |
| 117 | 3300005467 | Ga0070706_100100092 | Ga0070706_1001000924 | 332 |
| 118 | 3300005467 | Ga0070706_100233944 | Ga0070706_1002339442 | 332 |
| 119 | 3300005471 | Ga0070698_100001406 | Ga0070698_1000014065 | 332 |
| 120 | 3300005518 | Ga0070699_100078843 | Ga0070699_1000788431 | 332 |
| 121 | 3300005535 | Ga0070684_100008570 | Ga0070684_1000085707 | 332 |
| 122 | 3300005564 | Ga0070664_100146236 | Ga0070664_1001462362 | 332 |
| 123 | 3300005577 | Ga0068857_100031944 | Ga0068857_1000319443 | 332 |
| 124 | 3300005843 | Ga0068860_100078365 | Ga0068860_1000783652 | 332 |
| 125 | 3300006871 | Ga0075434_100360379 | Ga0075434_1003603792 | 332 |
| 126 | 3300025910 | Ga0207684_10423780 | Ga0207684_104237801 | 332 |
| 127 | 3300025922 | Ga0207646_10015271 | Ga0207646_100152712 | 332 |
| 128 | 3300026078 | Ga0207702_10128040 | Ga0207702_101280403 | 332 |
| 129 | 3300028381 | Ga0268264_10213519 | Ga0268264_102135192 | 332 |
| 130 | 3300035725 | Ga0373947_0127363 | Ga0373947_0127363_213_1232 | 332 |
| 131 | 3300037418 | Ga0395900_0109929 | Ga0395900_0109929_1652_2659 | 332 |
| 132 | 3300038443 | Ga0395901_0114566 | Ga0395901_0114566_616_1623 | 332 |
| 133 | 3300048915 | Ga0496112_0012308 | Ga0496112_0012308_3400_4419 | 332 |
| 134 | 3300050512 | nmdc:mga0n895_99242_c1 | nmdc:mga0n895_99242_c1_441_1460 | 332 |
| 135 | 3300005468 | Ga0070707_100289997 | Ga0070707_1002899972 | 333 |
| 136 | 3300005614 | Ga0068856_100009168 | Ga0068856_1000091689 | 333 |
| 137 | 3300005614 | Ga0068856_100033521 | Ga0068856_1000335215 | 333 |
| 138 | 3300006847 | Ga0075431_100365494 | Ga0075431_1003654942 | 333 |
| 139 | 3300026078 | Ga0207702_10026927 | Ga0207702_100269272 | 333 |
| 140 | 3300046507 | Ga0495606_0011511 | Ga0495606_0011511_5894_6898 | 333 |
| 141 | 3300046616 | Ga0495668_0002329 | Ga0495668_0002329_961_1965 | 333 |
| 142 | 3300047323 | Ga0495683_0080074 | Ga0495683_0080074_241_1245 | 333 |
| 143 | 3300048091 | Ga0495626_0000237 | Ga0495626_0000237_805_1809 | 333 |
| 144 | 3300048915 | Ga0496112_0089752 | Ga0496112_0089752_675_1697 | 333 |
| 145 | 3300048922 | Ga0496119_0025979 | Ga0496119_0025979_3013_4047 | 333 |
| 146 | 3300050492 | nmdc:mga0yw44_93344_c1 | nmdc:mga0yw44_93344_c1_680_1693 | 333 |
| 147 | iso_pu_bacteria | 2537561592 | 2537898680 | 333 |
| 148 | iso_pu_bacteria | 2551306166 | 2552112494 | 333 |
| 149 | iso_pu_bacteria | 2585428157 | 2588107916 | 333 |
| 150 | iso_pu_bacteria | 2626541554 | 2626638154 | 333 |
| 151 | iso_pu_bacteria | 2643221566 | 2643847735 | 333 |
| 152 | iso_pu_bacteria | 2643221572 | 2643876955 | 333 |
| 153 | iso_pu_bacteria | 2643221575 | 2643885863 | 333 |
| 154 | iso_pu_bacteria | 2643221649 | 2644278270 | 333 |
| 155 | iso_pu_bacteria | 2643221669 | 2644384010 | 333 |
| 156 | iso_pu_bacteria | 2643221690 | 2644506653 | 333 |
| 157 | iso_pu_bacteria | 2721755702 | 2723643765 | 333 |
| 158 | iso_pu_bacteria | 2728369276 | 2729906557 | 333 |
| 159 | iso_pu_bacteria | 2751185725 | 2753037653 | 333 |
| 160 | iso_pu_bacteria | 2751185792 | 2753325521 | 333 |
| 161 | iso_pu_bacteria | 2757320536 | 2758226633 | 333 |
| 162 | iso_pu_bacteria | 2773857758 | 2774381777 | 333 |
| 163 | iso_pu_bacteria | 2808606306 | 2808628821 | 333 |
| 164 | iso_pu_bacteria | 2808606372 | 2808900337 | 333 |
| 165 | iso_pu_bacteria | 2808606447 | 2809226202 | 333 |
| 166 | iso_pu_bacteria | 2811994872 | 2812324452 | 333 |
| 167 | iso_pu_bacteria | 2821268502 | 2821268945 | 333 |
| 168 | iso_pu_bacteria | 2844852863 | 2844856046 | 333 |
| 169 | iso_pu_bacteria | 2852643534 | 2852646032 | 333 |
| 170 | iso_pu_bacteria | 2857733635 | 2857733986 | 333 |
| 171 | iso_pu_bacteria | 2895660088 | 2895662265 | 333 |
| 172 | iso_pu_bacteria | 2904509784 | 2904511478 | 333 |
| 173 | iso_pu_bacteria | 2906799679 | 2906801594 | 333 |
| 174 | iso_pu_bacteria | 2908678064 | 2908679806 | 333 |
| 175 | iso_pu_bacteria | 2919069694 | 2919073042 | 333 |
| 176 | iso_pu_bacteria | 2935409751 | 2935413428 | 333 |
| 177 | iso_pu_bacteria | 2939660829 | 2939661578 | 333 |
| 178 | iso_pu_bacteria | 2966921586 | 2966922288 | 333 |
| 179 | iso_pu_bacteria | 2974294766 | 2974296854 | 333 |
| 180 | iso_pu_bacteria | 2974324384 | 2974326911 | 333 |
| 181 | iso_pu_bacteria | 2977228692 | 2977231930 | 333 |
| 182 | iso_pu_bacteria | 2977236895 | 2977237289 | 333 |
| 183 | iso_pu_bacteria | 2977264416 | 2977267249 | 333 |
| 184 | iso_pu_bacteria | 2984542743 | 2984544924 | 333 |
| 185 | iso_pu_bacteria | 8004025490 | 8004028521 | 333 |
| 186 | iso_pu_bacteria | 8016254467 | 8016257052 | 333 |
| 187 | iso_pu_bacteria | 8046352972 | 8046354328 | 333 |
| 188 | iso_pu_bacteria | 8054913762 | 8054920779 | 333 |
| 189 | iso_pu_bacteria | 8054920844 | 8054926252 | 333 |
| 190 | iso_pu_bacteria | 8056037122 | 8056039931 | 333 |
| 191 | iso_pu_bacteria | 8057345674 | 8057348156 | 333 |
| 192 | 3300005467 | Ga0070706_100045762 | Ga0070706_1000457622 | 334 |
| 193 | 3300005468 | Ga0070707_100017861 | Ga0070707_1000178614 | 334 |
| 194 | 3300005468 | Ga0070707_100155044 | Ga0070707_1001550442 | 334 |
| 195 | 3300005471 | Ga0070698_100006165 | Ga0070698_1000061654 | 334 |
| 196 | 3300005518 | Ga0070699_100022651 | Ga0070699_1000226514 | 334 |
| 197 | 3300005548 | Ga0070665_100121113 | Ga0070665_1001211133 | 334 |
| 198 | 3300006847 | Ga0075431_100017699 | Ga0075431_1000176994 | 334 |
| 199 | 3300006880 | Ga0075429_100001981 | Ga0075429_10000198115 | 334 |
| 200 | 3300009147 | Ga0114129_10020234 | Ga0114129_100202348 | 334 |
| 201 | 3300009147 | Ga0114129_10722981 | Ga0114129_107229812 | 334 |
| 202 | 3300025910 | Ga0207684_10028199 | Ga0207684_100281993 | 334 |
| 203 | 3300025910 | Ga0207684_10088247 | Ga0207684_100882473 | 334 |
| 204 | 3300025922 | Ga0207646_10011964 | Ga0207646_100119645 | 334 |
| 205 | 3300050507 | nmdc:mga05p37_17610_c1 | nmdc:mga05p37_17610_c1_6586_7599 | 334 |
| 206 | 3300050508 | nmdc:mga09592_1616_c1 | nmdc:mga09592_1616_c1_8822_9835 | 334 |
| 207 | 3300053088 | Ga0500644_0064853 | Ga0500644_0064853_18_1025 | 334 |
| 208 | iso_pu_bacteria | 2508501039 | 2508670337 | 334 |
| 209 | iso_pu_bacteria | 2517572101 | 2517762819 | 334 |
| 210 | iso_pu_bacteria | 2671180195 | 2671839537 | 334 |
| 211 | iso_pu_bacteria | 2675902999 | 2676202919 | 334 |
| 212 | iso_pu_bacteria | 2684623035 | 2686535157 | 334 |
| 213 | iso_pu_bacteria | 2687453737 | 2689958817 | 334 |
| 214 | iso_pu_bacteria | 2738543034 | 2739367075 | 334 |
| 215 | iso_pu_bacteria | 2773857763 | 2774400828 | 334 |
| 216 | iso_pu_bacteria | 2773857921 | 2774847495 | 334 |
| 217 | iso_pu_bacteria | 2773857922 | 2774857693 | 334 |
| 218 | iso_pu_bacteria | 2895880812 | 2895885231 | 334 |
| 219 | iso_pu_bacteria | 2904765812 | 2904770804 | 334 |
| 220 | iso_pu_bacteria | 2904770941 | 2904776279 | 334 |
| 221 | iso_pu_bacteria | 2908811453 | 2908812796 | 334 |
| 222 | iso_pu_bacteria | 2919420072 | 2919425141 | 334 |
| 223 | iso_pu_bacteria | 2919432681 | 2919437750 | 334 |
| 224 | iso_pu_bacteria | 8002775197 | 8002783113 | 334 |
| 225 | iso_pu_bacteria | 8002784119 | 8002791617 | 334 |
| 226 | iso_pu_bacteria | 8045830549 | 8045832125 | 334 |
| 227 | 3300005327 | Ga0070658_10000516 | Ga0070658_100005165 | 336 |
| 228 | 3300005563 | Ga0068855_100106798 | Ga0068855_1001067983 | 336 |
| 229 | 3300006880 | Ga0075429_100151300 | Ga0075429_1001513002 | 336 |
| 230 | 3300013104 | Ga0157370_10050894 | Ga0157370_100508943 | 336 |
| 231 | 3300025904 | Ga0207647_10018243 | Ga0207647_100182432 | 336 |
| 232 | 3300025909 | Ga0207705_10000001 | Ga0207705_100000011708 | 336 |
| 233 | 3300026067 | Ga0207678_10011578 | Ga0207678_100115788 | 336 |
| 234 | 3300031731 | Ga0307405_10240444 | Ga0307405_102404442 | 336 |
| 235 | 3300048908 | Ga0496105_0129634 | Ga0496105_0129634_441_1457 | 336 |
| 236 | 3300048908 | Ga0496105_0176165 | Ga0496105_0176165_359_1375 | 336 |
| 237 | 3300048917 | Ga0496114_0192099 | Ga0496114_0192099_13_1029 | 336 |
| 238 | 3300053139 | Ga0500568_0000071 | Ga0500568_0000071_94130_95146 | 336 |
| 239 | iso_pu_bacteria | 2852632344 | 2852632460 | 336 |
| 240 | 3300005288 | Ga0065714_10065905 | Ga0065714_100659055 | 337 |
| 241 | 3300005327 | Ga0070658_10018666 | Ga0070658_100186663 | 337 |
| 242 | 3300005336 | Ga0070680_100367309 | Ga0070680_1003673091 | 337 |
| 243 | 3300005366 | Ga0070659_100058228 | Ga0070659_1000582283 | 337 |
| 244 | 3300005548 | Ga0070665_100091726 | Ga0070665_1000917261 | 337 |
| 245 | 3300005563 | Ga0068855_100271021 | Ga0068855_1002710212 | 337 |
| 246 | 3300005616 | Ga0068852_100033719 | Ga0068852_1000337195 | 337 |
| 247 | 3300005616 | Ga0068852_100282047 | Ga0068852_1002820471 | 337 |
| 248 | 3300005617 | Ga0068859_100007129 | Ga0068859_1000071296 | 337 |
| 249 | 3300005719 | Ga0068861_100069499 | Ga0068861_1000694993 | 337 |
| 250 | 3300005842 | Ga0068858_100019804 | Ga0068858_1000198043 | 337 |
| 251 | 3300005937 | Ga0081455_10003346 | Ga0081455_1000334610 | 337 |
| 252 | 3300005937 | Ga0081455_10033413 | Ga0081455_100334135 | 337 |
| 253 | 3300005937 | Ga0081455_10141516 | Ga0081455_101415162 | 337 |
| 254 | 3300006051 | Ga0075364_10081214 | Ga0075364_100812142 | 337 |
| 255 | 3300006847 | Ga0075431_100520878 | Ga0075431_1005208781 | 337 |
| 256 | 3300006852 | Ga0075433_10302904 | Ga0075433_103029042 | 337 |
| 257 | 3300006931 | Ga0097620_100007129 | Ga0097620_1000071293 | 337 |
| 258 | 3300009036 | Ga0105244_10063886 | Ga0105244_100638862 | 337 |
| 259 | 3300009036 | Ga0105244_10073842 | Ga0105244_100738422 | 337 |
| 260 | 3300009093 | Ga0105240_10008219 | Ga0105240_1000821913 | 337 |
| 261 | 3300009093 | Ga0105240_10094668 | Ga0105240_100946683 | 337 |
| 262 | 3300009148 | Ga0105243_10008507 | Ga0105243_100085071 | 337 |
| 263 | 3300009148 | Ga0105243_10399345 | Ga0105243_103993452 | 337 |
| 264 | 3300009551 | Ga0105238_10470603 | Ga0105238_104706032 | 337 |
| 265 | 3300009553 | Ga0105249_10365682 | Ga0105249_103656821 | 337 |
| 266 | 3300010375 | Ga0105239_10054716 | Ga0105239_100547162 | 337 |
| 267 | 3300010375 | Ga0105239_10396797 | Ga0105239_103967972 | 337 |
| 268 | 3300011119 | Ga0105246_10031106 | Ga0105246_100311063 | 337 |
| 269 | 3300013102 | Ga0157371_10000794 | Ga0157371_1000079433 | 337 |
| 270 | 3300013104 | Ga0157370_10032665 | Ga0157370_100326654 | 337 |
| 271 | 3300013105 | Ga0157369_10006194 | Ga0157369_1000619410 | 337 |
| 272 | 3300013105 | Ga0157369_10239923 | Ga0157369_102399232 | 337 |
| 273 | 3300013306 | Ga0163162_10021945 | Ga0163162_100219452 | 337 |
| 274 | 3300013306 | Ga0163162_10257411 | Ga0163162_102574112 | 337 |
| 275 | 3300013307 | Ga0157372_10040927 | Ga0157372_100409274 | 337 |
| 276 | 3300013308 | Ga0157375_10322717 | Ga0157375_103227172 | 337 |
| 277 | 3300025728 | Ga0207655_1050447 | Ga0207655_10504472 | 337 |
| 278 | 3300025898 | Ga0207692_10009035 | Ga0207692_100090353 | 337 |
| 279 | 3300025901 | Ga0207688_10161509 | Ga0207688_101615092 | 337 |
| 280 | 3300025911 | Ga0207654_10191320 | Ga0207654_101913202 | 337 |
| 281 | 3300025913 | Ga0207695_10184877 | Ga0207695_101848772 | 337 |
| 282 | 3300025921 | Ga0207652_10084788 | Ga0207652_100847882 | 337 |
| 283 | 3300025927 | Ga0207687_10025387 | Ga0207687_100253874 | 337 |
| 284 | 3300025949 | Ga0207667_10072433 | Ga0207667_100724334 | 337 |
| 285 | 3300025972 | Ga0207668_10029077 | Ga0207668_100290771 | 337 |
| 286 | 3300027907 | Ga0207428_10199753 | Ga0207428_101997532 | 337 |
| 287 | 3300028379 | Ga0268266_10192776 | Ga0268266_101927762 | 337 |
| 288 | 3300031548 | Ga0307408_100214775 | Ga0307408_1002147752 | 337 |
| 289 | 3300031616 | Ga0307508_10000095 | Ga0307508_1000009593 | 337 |
| 290 | 3300031649 | Ga0307514_10018106 | Ga0307514_100181062 | 337 |
| 291 | 3300031824 | Ga0307413_10007349 | Ga0307413_100073491 | 337 |
| 292 | 3300031852 | Ga0307410_10000654 | Ga0307410_100006546 | 337 |
| 293 | 3300031852 | Ga0307410_10072912 | Ga0307410_100729122 | 337 |
| 294 | 3300031901 | Ga0307406_10015705 | Ga0307406_100157053 | 337 |
| 295 | 3300031901 | Ga0307406_10053901 | Ga0307406_100539012 | 337 |
| 296 | 3300031901 | Ga0307406_10150519 | Ga0307406_101505192 | 337 |
| 297 | 3300031903 | Ga0307407_10000164 | Ga0307407_1000016424 | 337 |
| 298 | 3300031911 | Ga0307412_10165960 | Ga0307412_101659602 | 337 |
| 299 | 3300031995 | Ga0307409_100001551 | Ga0307409_10000155110 | 337 |
| 300 | 3300031995 | Ga0307409_100016948 | Ga0307409_1000169484 | 337 |
| 301 | 3300031995 | Ga0307409_100161046 | Ga0307409_1001610462 | 337 |
| 302 | 3300031995 | Ga0307409_100328082 | Ga0307409_1003280822 | 337 |
| 303 | 3300032002 | Ga0307416_100036062 | Ga0307416_1000360624 | 337 |
| 304 | 3300032004 | Ga0307414_10003245 | Ga0307414_100032456 | 337 |
| 305 | 3300032004 | Ga0307414_10299403 | Ga0307414_102994032 | 337 |
| 306 | 3300032005 | Ga0307411_10021291 | Ga0307411_100212913 | 337 |
| 307 | 3300032126 | Ga0307415_100100172 | Ga0307415_1001001722 | 337 |
| 308 | 3300035084 | Ga0373928_0014121 | Ga0373928_0014121_363_1379 | 337 |
| 309 | 3300038443 | Ga0395901_0247406 | Ga0395901_0247406_408_1436 | 337 |
| 310 | 3300041451 | Ga0451791_0903131 | Ga0451791_0903131_1235_2251 | 337 |
| 311 | 3300041452 | Ga0451793_0187550 | Ga0451793_0187550_392_1408 | 337 |
| 312 | 3300042007 | Ga0439449_0066171 | Ga0439449_0066171_98_1114 | 337 |
| 313 | 3300042993 | Ga0439440_0012566 | Ga0439440_0012566_589_1605 | 337 |
| 314 | 3300044683 | Ga0466965_0173887 | Ga0466965_0173887_34_1050 | 337 |
| 315 | 3300044684 | Ga0466966_0030407 | Ga0466966_0030407_1898_2926 | 337 |
| 316 | 3300044693 | Ga0466961_0095519 | Ga0466961_0095519_286_1314 | 337 |
| 317 | 3300045049 | Ga0466959_0058764 | Ga0466959_0058764_1361_2389 | 337 |
| 318 | 3300046463 | Ga0495653_0019082 | Ga0495653_0019082_4030_5058 | 337 |
| 319 | 3300047472 | Ga0495686_0107764 | Ga0495686_0107764_360_1376 | 337 |
| 320 | 3300048903 | Ga0496100_0053581 | Ga0496100_0053581_532_1548 | 337 |
| 321 | 3300048905 | Ga0496102_0091914 | Ga0496102_0091914_1317_2345 | 337 |
| 322 | 3300048906 | Ga0496103_0018471 | Ga0496103_0018471_2149_3177 | 337 |
| 323 | 3300048907 | Ga0496104_0148867 | Ga0496104_0148867_121_1137 | 337 |
| 324 | 3300048907 | Ga0496104_0180076 | Ga0496104_0180076_130_1146 | 337 |
| 325 | 3300048908 | Ga0496105_0006741 | Ga0496105_0006741_17_1033 | 337 |
| 326 | 3300048910 | Ga0496107_0339772 | Ga0496107_0339772_34_1050 | 337 |
| 327 | 3300048912 | Ga0496109_0066056 | Ga0496109_0066056_1817_2833 | 337 |
| 328 | 3300048912 | Ga0496109_0259678 | Ga0496109_0259678_414_1430 | 337 |
| 329 | 3300048913 | Ga0496110_0175779 | Ga0496110_0175779_242_1258 | 337 |
| 330 | 3300048916 | Ga0496113_0091785 | Ga0496113_0091785_202_1218 | 337 |
| 331 | 3300048918 | Ga0496115_0038565 | Ga0496115_0038565_1907_2923 | 337 |
| 332 | 3300048920 | Ga0496117_0000063 | Ga0496117_0000063_114845_115873 | 337 |
| 333 | 3300048920 | Ga0496117_0003104 | Ga0496117_0003104_3765_4781 | 337 |
| 334 | 3300048920 | Ga0496117_0017074 | Ga0496117_0017074_4818_5834 | 337 |
| 335 | 3300048920 | Ga0496117_0062912 | Ga0496117_0062912_659_1690 | 337 |
| 336 | 3300048921 | Ga0496118_0008903 | Ga0496118_0008903_449_1465 | 337 |
| 337 | 3300048922 | Ga0496119_0002091 | Ga0496119_0002091_3566_4594 | 337 |
| 338 | 3300048922 | Ga0496119_0004156 | Ga0496119_0004156_8238_9254 | 337 |
| 339 | 3300048922 | Ga0496119_0009813 | Ga0496119_0009813_3264_4292 | 337 |
| 340 | 3300048923 | Ga0496120_0001936 | Ga0496120_0001936_3797_4825 | 337 |
| 341 | 3300048923 | Ga0496120_0006445 | Ga0496120_0006445_2054_3070 | 337 |
| 342 | 3300048923 | Ga0496120_0023873 | Ga0496120_0023873_2610_3638 | 337 |
| 343 | 3300048924 | Ga0496121_0029106 | Ga0496121_0029106_787_1851 | 337 |
| 344 | 3300048924 | Ga0496121_0133316 | Ga0496121_0133316_367_1395 | 337 |
| 345 | 3300048925 | Ga0496122_0000022 | Ga0496122_0000022_296393_297409 | 337 |
| 346 | 3300048925 | Ga0496122_0002058 | Ga0496122_0002058_85_1101 | 337 |
| 347 | 3300048925 | Ga0496122_0005683 | Ga0496122_0005683_6080_7108 | 337 |
| 348 | 3300048925 | Ga0496122_0052756 | Ga0496122_0052756_563_1579 | 337 |
| 349 | 3300048926 | Ga0496123_0000016 | Ga0496123_0000016_331876_332892 | 337 |
| 350 | 3300048926 | Ga0496123_0002798 | Ga0496123_0002798_181_1209 | 337 |
| 351 | 3300048926 | Ga0496123_0014505 | Ga0496123_0014505_5003_6019 | 337 |
| 352 | 3300048926 | Ga0496123_0018712 | Ga0496123_0018712_1012_2028 | 337 |
| 353 | 3300048926 | Ga0496123_0047642 | Ga0496123_0047642_469_1485 | 337 |
| 354 | 3300048927 | Ga0496124_0000389 | Ga0496124_0000389_45628_46656 | 337 |
| 355 | 3300048927 | Ga0496124_0011542 | Ga0496124_0011542_1351_2367 | 337 |
| 356 | 3300048928 | Ga0496125_0036635 | Ga0496125_0036635_141_1169 | 337 |
| 357 | 3300048929 | Ga0496126_0002220 | Ga0496126_0002220_9444_10460 | 337 |
| 358 | 3300048929 | Ga0496126_0004214 | Ga0496126_0004214_1151_2179 | 337 |
| 359 | 3300048929 | Ga0496126_0013693 | Ga0496126_0013693_5759_6787 | 337 |
| 360 | 3300048929 | Ga0496126_0020829 | Ga0496126_0020829_4936_5952 | 337 |
| 361 | 3300048929 | Ga0496126_0038376 | Ga0496126_0038376_2408_3424 | 337 |
| 362 | 3300048929 | Ga0496126_0118116 | Ga0496126_0118116_1190_2206 | 337 |
| 363 | 3300048929 | Ga0496126_0142716 | Ga0496126_0142716_135_1154 | 337 |
| 364 | 3300049568 | Ga0501031_0111414 | Ga0501031_0111414_283_1314 | 337 |
| 365 | 3300049570 | Ga0501033_0037419 | Ga0501033_0037419_726_1742 | 337 |
| 366 | 3300049571 | Ga0501034_0005401 | Ga0501034_0005401_1651_2667 | 337 |
| 367 | 3300049571 | Ga0501034_0019391 | Ga0501034_0019391_146_1207 | 337 |
| 368 | 3300049571 | Ga0501034_0037337 | Ga0501034_0037337_951_2012 | 337 |
| 369 | 3300049572 | Ga0501036_0033494 | Ga0501036_0033494_2975_3991 | 337 |
| 370 | 3300049573 | Ga0501037_0010590 | Ga0501037_0010590_1441_2457 | 337 |
| 371 | 3300049575 | Ga0501039_0038238 | Ga0501039_0038238_1649_2665 | 337 |
| 372 | 3300049579 | Ga0501043_0004169 | Ga0501043_0004169_2752_3768 | 337 |
| 373 | 3300049580 | Ga0501046_0116026 | Ga0501046_0116026_420_1436 | 337 |
| 374 | 3300049581 | Ga0501047_0049297 | Ga0501047_0049297_889_1905 | 337 |
| 375 | 3300049582 | Ga0501048_0037788 | Ga0501048_0037788_1649_2665 | 337 |
| 376 | 3300049586 | Ga0501070_0033286 | Ga0501070_0033286_234_1295 | 337 |
| 377 | 3300049586 | Ga0501070_0055192 | Ga0501070_0055192_1308_2324 | 337 |
| 378 | 3300049587 | Ga0501071_0001085 | Ga0501071_0001085_731_1792 | 337 |
| 379 | 3300049589 | Ga0501073_0114028 | Ga0501073_0114028_701_1717 | 337 |
| 380 | 3300049822 | Ga0501035_0198355 | Ga0501035_0198355_421_1437 | 337 |
| 381 | 3300049823 | Ga0501044_0051779 | Ga0501044_0051779_1878_2894 | 337 |
| 382 | 3300049824 | Ga0501045_0076112 | Ga0501045_0076112_726_1742 | 337 |
| 383 | 3300053087 | Ga0500643_000072 | Ga0500643_000072_106425_107459 | 337 |
| 384 | 3300053098 | Ga0500650_0003218 | Ga0500650_0003218_3612_4628 | 337 |
| 385 | 3300053104 | Ga0500556_0000001 | Ga0500556_0000001_809087_810103 | 337 |
| 386 | 3300053131 | Ga0500652_056375 | Ga0500652_056375_71_1099 | 337 |
| 387 | 3300053136 | Ga0500559_0000043 | Ga0500559_0000043_62235_63263 | 337 |
| 388 | 3300053136 | Ga0500559_0003767 | Ga0500559_0003767_2614_3630 | 337 |
| 389 | 3300053136 | Ga0500559_0022047 | Ga0500559_0022047_1022_2038 | 337 |
| 390 | 3300053139 | Ga0500568_0000003 | Ga0500568_0000003_813827_814843 | 337 |
| 391 | 3300053139 | Ga0500568_0000714 | Ga0500568_0000714_236_1264 | 337 |
| 392 | 3300053140 | Ga0500573_0000001 | Ga0500573_0000001_278625_279653 | 337 |
| 393 | 3300053140 | Ga0500573_0017028 | Ga0500573_0017028_1461_2477 | 337 |
| 394 | 3300053153 | Ga0500616_0000058 | Ga0500616_0000058_25037_26053 | 337 |
| 395 | 3300053153 | Ga0500616_0005888 | Ga0500616_0005888_3420_4436 | 337 |
| 396 | 3300053730 | Ga0500645_004187 | Ga0500645_004187_320_1348 | 337 |
| 397 | 3300060353 | Ga0501082_0174501 | Ga0501082_0174501_354_1370 | 337 |
| 398 | iso_pu_bacteria | 2870622029 | 2870624287 | 337 |
| 399 | 3300001976 | JGI24752J21851_1001068 | JGI24752J21851_10010681 | 338 |
| 400 | 3300001976 | JGI24752J21851_1002035 | JGI24752J21851_10020353 | 338 |
| 401 | 3300001976 | JGI24752J21851_1002296 | JGI24752J21851_10022962 | 338 |
| 402 | 3300002459 | JGI24751J29686_10000424 | JGI24751J29686_1000042412 | 338 |
| 403 | 3300002459 | JGI24751J29686_10003910 | JGI24751J29686_100039103 | 338 |
| 404 | 3300003203 | JGI25406J46586_10001099 | JGI25406J46586_100010994 | 338 |
| 405 | 3300003911 | JGI25405J52794_10007179 | JGI25405J52794_100071791 | 338 |
| 406 | 3300005327 | Ga0070658_10036380 | Ga0070658_100363802 | 338 |
| 407 | 3300005330 | Ga0070690_100129436 | Ga0070690_1001294362 | 338 |
| 408 | 3300005331 | Ga0070670_100054425 | Ga0070670_1000544254 | 338 |
| 409 | 3300005334 | Ga0068869_100005134 | Ga0068869_1000051347 | 338 |
| 410 | 3300005334 | Ga0068869_100163759 | Ga0068869_1001637592 | 338 |
| 411 | 3300005336 | Ga0070680_100012976 | Ga0070680_1000129762 | 338 |
| 412 | 3300005337 | Ga0070682_100007230 | Ga0070682_1000072306 | 338 |
| 413 | 3300005345 | Ga0070692_10002768 | Ga0070692_100027682 | 338 |
| 414 | 3300005354 | Ga0070675_100017195 | Ga0070675_1000171954 | 338 |
| 415 | 3300005354 | Ga0070675_100025157 | Ga0070675_1000251573 | 338 |
| 416 | 3300005355 | Ga0070671_100005657 | Ga0070671_1000056576 | 338 |
| 417 | 3300005365 | Ga0070688_100046743 | Ga0070688_1000467433 | 338 |
| 418 | 3300005366 | Ga0070659_100012289 | Ga0070659_1000122892 | 338 |
| 419 | 3300005366 | Ga0070659_100282133 | Ga0070659_1002821332 | 338 |
| 420 | 3300005406 | Ga0070703_10011057 | Ga0070703_100110572 | 338 |
| 421 | 3300005434 | Ga0070709_10007107 | Ga0070709_100071073 | 338 |
| 422 | 3300005434 | Ga0070709_10150960 | Ga0070709_101509602 | 338 |
| 423 | 3300005435 | Ga0070714_100041568 | Ga0070714_1000415684 | 338 |
| 424 | 3300005435 | Ga0070714_100084338 | Ga0070714_1000843383 | 338 |
| 425 | 3300005435 | Ga0070714_100100492 | Ga0070714_1001004922 | 338 |
| 426 | 3300005436 | Ga0070713_100075079 | Ga0070713_1000750793 | 338 |
| 427 | 3300005438 | Ga0070701_10099806 | Ga0070701_100998062 | 338 |
| 428 | 3300005438 | Ga0070701_10167902 | Ga0070701_101679021 | 338 |
| 429 | 3300005441 | Ga0070700_100009088 | Ga0070700_1000090885 | 338 |
| 430 | 3300005455 | Ga0070663_100015507 | Ga0070663_1000155071 | 338 |
| 431 | 3300005458 | Ga0070681_10018792 | Ga0070681_100187928 | 338 |
| 432 | 3300005466 | Ga0070685_10150575 | Ga0070685_101505751 | 338 |
| 433 | 3300005466 | Ga0070685_10191337 | Ga0070685_101913371 | 338 |
| 434 | 3300005471 | Ga0070698_100051129 | Ga0070698_1000511292 | 338 |
| 435 | 3300005530 | Ga0070679_100051719 | Ga0070679_1000517194 | 338 |
| 436 | 3300005535 | Ga0070684_100001918 | Ga0070684_10000191811 | 338 |
| 437 | 3300005539 | Ga0068853_100064029 | Ga0068853_1000640293 | 338 |
| 438 | 3300005544 | Ga0070686_100070590 | Ga0070686_1000705901 | 338 |
| 439 | 3300005547 | Ga0070693_100000347 | Ga0070693_10000034716 | 338 |
| 440 | 3300005548 | Ga0070665_100000791 | Ga0070665_10000079117 | 338 |
| 441 | 3300005548 | Ga0070665_100011326 | Ga0070665_1000113263 | 338 |
| 442 | 3300005549 | Ga0070704_100001943 | Ga0070704_1000019433 | 338 |
| 443 | 3300005563 | Ga0068855_100019945 | Ga0068855_1000199456 | 338 |
| 444 | 3300005563 | Ga0068855_100097904 | Ga0068855_1000979043 | 338 |
| 445 | 3300005563 | Ga0068855_100179482 | Ga0068855_1001794822 | 338 |
| 446 | 3300005563 | Ga0068855_100315157 | Ga0068855_1003151572 | 338 |
| 447 | 3300005564 | Ga0070664_100008359 | Ga0070664_1000083598 | 338 |
| 448 | 3300005577 | Ga0068857_100142844 | Ga0068857_1001428442 | 338 |
| 449 | 3300005578 | Ga0068854_100073625 | Ga0068854_1000736252 | 338 |
| 450 | 3300005614 | Ga0068856_100118962 | Ga0068856_1001189623 | 338 |
| 451 | 3300005614 | Ga0068856_100149510 | Ga0068856_1001495101 | 338 |
| 452 | 3300005615 | Ga0070702_100002009 | Ga0070702_1000020097 | 338 |
| 453 | 3300005615 | Ga0070702_100192261 | Ga0070702_1001922612 | 338 |
| 454 | 3300005616 | Ga0068852_100344019 | Ga0068852_1003440192 | 338 |
| 455 | 3300005617 | Ga0068859_100002957 | Ga0068859_10000295711 | 338 |
| 456 | 3300005617 | Ga0068859_100041923 | Ga0068859_1000419234 | 338 |
| 457 | 3300005618 | Ga0068864_100008495 | Ga0068864_1000084953 | 338 |
| 458 | 3300005719 | Ga0068861_100007184 | Ga0068861_1000071846 | 338 |
| 459 | 3300005719 | Ga0068861_100023686 | Ga0068861_1000236863 | 338 |
| 460 | 3300005719 | Ga0068861_100151077 | Ga0068861_1001510772 | 338 |
| 461 | 3300005719 | Ga0068861_100193103 | Ga0068861_1001931032 | 338 |
| 462 | 3300005840 | Ga0068870_10000390 | Ga0068870_100003909 | 338 |
| 463 | 3300005840 | Ga0068870_10001611 | Ga0068870_100016116 | 338 |
| 464 | 3300005841 | Ga0068863_100000274 | Ga0068863_10000027433 | 338 |
| 465 | 3300005841 | Ga0068863_100003122 | Ga0068863_1000031222 | 338 |
| 466 | 3300005841 | Ga0068863_100013760 | Ga0068863_1000137604 | 338 |
| 467 | 3300005841 | Ga0068863_100208619 | Ga0068863_1002086192 | 338 |
| 468 | 3300005842 | Ga0068858_100136130 | Ga0068858_1001361302 | 338 |
| 469 | 3300005843 | Ga0068860_100035775 | Ga0068860_1000357752 | 338 |
| 470 | 3300005843 | Ga0068860_100054272 | Ga0068860_1000542722 | 338 |
| 471 | 3300005843 | Ga0068860_100113550 | Ga0068860_1001135503 | 338 |
| 472 | 3300005843 | Ga0068860_100217048 | Ga0068860_1002170482 | 338 |
| 473 | 3300005844 | Ga0068862_100000237 | Ga0068862_10000023740 | 338 |
| 474 | 3300005937 | Ga0081455_10001004 | Ga0081455_1000100417 | 338 |
| 475 | 3300005937 | Ga0081455_10014805 | Ga0081455_100148054 | 338 |
| 476 | 3300005981 | Ga0081538_10000359 | Ga0081538_1000035926 | 338 |
| 477 | 3300005985 | Ga0081539_10000352 | Ga0081539_100003525 | 338 |
| 478 | 3300005985 | Ga0081539_10003711 | Ga0081539_1000371120 | 338 |
| 479 | 3300005985 | Ga0081539_10022554 | Ga0081539_100225542 | 338 |
| 480 | 3300006038 | Ga0075365_10000350 | Ga0075365_100003503 | 338 |
| 481 | 3300006038 | Ga0075365_10095649 | Ga0075365_100956492 | 338 |
| 482 | 3300006042 | Ga0075368_10027906 | Ga0075368_100279062 | 338 |
| 483 | 3300006051 | Ga0075364_10003412 | Ga0075364_100034123 | 338 |
| 484 | 3300006051 | Ga0075364_10038095 | Ga0075364_100380953 | 338 |
| 485 | 3300006051 | Ga0075364_10093575 | Ga0075364_100935752 | 338 |
| 486 | 3300006058 | Ga0075432_10007868 | Ga0075432_100078683 | 338 |
| 487 | 3300006173 | Ga0070716_100039526 | Ga0070716_1000395262 | 338 |
| 488 | 3300006177 | Ga0075362_10020696 | Ga0075362_100206962 | 338 |
| 489 | 3300006178 | Ga0075367_10189460 | Ga0075367_101894602 | 338 |
| 490 | 3300006237 | Ga0097621_100011172 | Ga0097621_1000111727 | 338 |
| 491 | 3300006358 | Ga0068871_100042170 | Ga0068871_1000421702 | 338 |
| 492 | 3300006844 | Ga0075428_100191729 | Ga0075428_1001917292 | 338 |
| 493 | 3300006844 | Ga0075428_100281049 | Ga0075428_1002810492 | 338 |
| 494 | 3300006844 | Ga0075428_100289571 | Ga0075428_1002895712 | 338 |
| 495 | 3300006846 | Ga0075430_100000935 | Ga0075430_10000093514 | 338 |
| 496 | 3300006846 | Ga0075430_100024879 | Ga0075430_1000248794 | 338 |
| 497 | 3300006847 | Ga0075431_100003722 | Ga0075431_1000037229 | 338 |
| 498 | 3300006847 | Ga0075431_100117121 | Ga0075431_1001171212 | 338 |
| 499 | 3300006852 | Ga0075433_10075156 | Ga0075433_100751563 | 338 |
| 500 | 3300006871 | Ga0075434_100006513 | Ga0075434_1000065137 | 338 |
| 501 | 3300006871 | Ga0075434_100089702 | Ga0075434_1000897023 | 338 |
| 502 | 3300006871 | Ga0075434_100233336 | Ga0075434_1002333361 | 338 |
| 503 | 3300006880 | Ga0075429_100219883 | Ga0075429_1002198832 | 338 |
| 504 | 3300006914 | Ga0075436_100001698 | Ga0075436_1000016986 | 338 |
| 505 | 3300006931 | Ga0097620_100002957 | Ga0097620_1000029574 | 338 |
| 506 | 3300006931 | Ga0097620_100006662 | Ga0097620_1000066622 | 338 |
| 507 | 3300006931 | Ga0097620_100041922 | Ga0097620_1000419224 | 338 |
| 508 | 3300007076 | Ga0075435_100027739 | Ga0075435_1000277392 | 338 |
| 509 | 3300009011 | Ga0105251_10040011 | Ga0105251_100400113 | 338 |
| 510 | 3300009093 | Ga0105240_10019078 | Ga0105240_100190788 | 338 |
| 511 | 3300009093 | Ga0105240_10117763 | Ga0105240_101177632 | 338 |
| 512 | 3300009094 | Ga0111539_10031182 | Ga0111539_100311824 | 338 |
| 513 | 3300009094 | Ga0111539_10684867 | Ga0111539_106848671 | 338 |
| 514 | 3300009098 | Ga0105245_10036774 | Ga0105245_100367744 | 338 |
| 515 | 3300009098 | Ga0105245_10180691 | Ga0105245_101806912 | 338 |
| 516 | 3300009098 | Ga0105245_10367390 | Ga0105245_103673902 | 338 |
| 517 | 3300009101 | Ga0105247_10000971 | Ga0105247_100009716 | 338 |
| 518 | 3300009101 | Ga0105247_10014730 | Ga0105247_100147305 | 338 |
| 519 | 3300009147 | Ga0114129_10001279 | Ga0114129_1000127919 | 338 |
| 520 | 3300009147 | Ga0114129_10052270 | Ga0114129_100522701 | 338 |
| 521 | 3300009148 | Ga0105243_10027614 | Ga0105243_100276142 | 338 |
| 522 | 3300009148 | Ga0105243_10079731 | Ga0105243_100797312 | 338 |
| 523 | 3300009174 | Ga0105241_10064837 | Ga0105241_100648372 | 338 |
| 524 | 3300009177 | Ga0105248_10000034 | Ga0105248_1000003455 | 338 |
| 525 | 3300009177 | Ga0105248_10240009 | Ga0105248_102400092 | 338 |
| 526 | 3300009177 | Ga0105248_10437199 | Ga0105248_104371991 | 338 |
| 527 | 3300009177 | Ga0105248_10686916 | Ga0105248_106869161 | 338 |
| 528 | 3300009545 | Ga0105237_10005381 | Ga0105237_100053818 | 338 |
| 529 | 3300009551 | Ga0105238_10267490 | Ga0105238_102674901 | 338 |
| 530 | 3300009553 | Ga0105249_10075684 | Ga0105249_100756843 | 338 |
| 531 | 3300009553 | Ga0105249_10351755 | Ga0105249_103517552 | 338 |
| 532 | 3300009553 | Ga0105249_10668185 | Ga0105249_106681851 | 338 |
| 533 | 3300010375 | Ga0105239_10013363 | Ga0105239_100133634 | 338 |
| 534 | 3300010375 | Ga0105239_10394606 | Ga0105239_103946062 | 338 |
| 535 | 3300012515 | Ga0157338_1002637 | Ga0157338_10026372 | 338 |
| 536 | 3300013100 | Ga0157373_10124402 | Ga0157373_101244022 | 338 |
| 537 | 3300013296 | Ga0157374_10018863 | Ga0157374_100188632 | 338 |
| 538 | 3300013297 | Ga0157378_10208617 | Ga0157378_102086172 | 338 |
| 539 | 3300013297 | Ga0157378_10389138 | Ga0157378_103891382 | 338 |
| 540 | 3300013307 | Ga0157372_10019524 | Ga0157372_100195242 | 338 |
| 541 | 3300013307 | Ga0157372_10597684 | Ga0157372_105976842 | 338 |
| 542 | 3300013308 | Ga0157375_10107580 | Ga0157375_101075802 | 338 |
| 543 | 3300014325 | Ga0163163_10013199 | Ga0163163_100131992 | 338 |
| 544 | 3300014325 | Ga0163163_10068093 | Ga0163163_100680932 | 338 |
| 545 | 3300014325 | Ga0163163_10114254 | Ga0163163_101142542 | 338 |
| 546 | 3300014325 | Ga0163163_10307592 | Ga0163163_103075922 | 338 |
| 547 | 3300014326 | Ga0157380_10023569 | Ga0157380_100235693 | 338 |
| 548 | 3300014745 | Ga0157377_10041322 | Ga0157377_100413222 | 338 |
| 549 | 3300014968 | Ga0157379_10016266 | Ga0157379_100162664 | 338 |
| 550 | 3300014968 | Ga0157379_10461186 | Ga0157379_104611861 | 338 |
| 551 | 3300014969 | Ga0157376_10277777 | Ga0157376_102777772 | 338 |
| 552 | 3300017792 | Ga0163161_10180061 | Ga0163161_101800611 | 338 |
| 553 | 3300020070 | Ga0206356_10758018 | Ga0206356_107580182 | 338 |
| 554 | 3300020077 | Ga0206351_10658466 | Ga0206351_106584664 | 338 |
| 555 | 3300020078 | Ga0206352_10915400 | Ga0206352_109154002 | 338 |
| 556 | 3300020080 | Ga0206350_10122299 | Ga0206350_101222992 | 338 |
| 557 | 3300020081 | Ga0206354_11650881 | Ga0206354_116508812 | 338 |
| 558 | 3300020082 | Ga0206353_10109164 | Ga0206353_101091642 | 338 |
| 559 | 3300021384 | Ga0213876_10149661 | Ga0213876_101496611 | 338 |
| 560 | 3300022467 | Ga0224712_10001135 | Ga0224712_100011352 | 338 |
| 561 | 3300025893 | Ga0207682_10094629 | Ga0207682_100946291 | 338 |
| 562 | 3300025900 | Ga0207710_10000682 | Ga0207710_1000068218 | 338 |
| 563 | 3300025900 | Ga0207710_10017307 | Ga0207710_100173072 | 338 |
| 564 | 3300025901 | Ga0207688_10000765 | Ga0207688_100007657 | 338 |
| 565 | 3300025901 | Ga0207688_10099785 | Ga0207688_100997851 | 338 |
| 566 | 3300025904 | Ga0207647_10024270 | Ga0207647_100242703 | 338 |
| 567 | 3300025904 | Ga0207647_10029797 | Ga0207647_100297973 | 338 |
| 568 | 3300025904 | Ga0207647_10046375 | Ga0207647_100463752 | 338 |
| 569 | 3300025907 | Ga0207645_10070843 | Ga0207645_100708432 | 338 |
| 570 | 3300025907 | Ga0207645_10077104 | Ga0207645_100771042 | 338 |
| 571 | 3300025908 | Ga0207643_10000049 | Ga0207643_1000004950 | 338 |
| 572 | 3300025908 | Ga0207643_10000517 | Ga0207643_1000051723 | 338 |
| 573 | 3300025911 | Ga0207654_10028648 | Ga0207654_100286483 | 338 |
| 574 | 3300025912 | Ga0207707_10040010 | Ga0207707_100400103 | 338 |
| 575 | 3300025913 | Ga0207695_10104876 | Ga0207695_101048762 | 338 |
| 576 | 3300025914 | Ga0207671_10008858 | Ga0207671_100088587 | 338 |
| 577 | 3300025914 | Ga0207671_10063600 | Ga0207671_100636002 | 338 |
| 578 | 3300025916 | Ga0207663_10040137 | Ga0207663_100401372 | 338 |
| 579 | 3300025917 | Ga0207660_10010527 | Ga0207660_100105271 | 338 |
| 580 | 3300025919 | Ga0207657_10011572 | Ga0207657_1001157211 | 338 |
| 581 | 3300025920 | Ga0207649_10021347 | Ga0207649_100213473 | 338 |
| 582 | 3300025920 | Ga0207649_10027450 | Ga0207649_100274502 | 338 |
| 583 | 3300025922 | Ga0207646_10343606 | Ga0207646_103436061 | 338 |
| 584 | 3300025924 | Ga0207694_10105685 | Ga0207694_101056851 | 338 |
| 585 | 3300025925 | Ga0207650_10000713 | Ga0207650_1000071312 | 338 |
| 586 | 3300025925 | Ga0207650_10006096 | Ga0207650_100060964 | 338 |
| 587 | 3300025925 | Ga0207650_10009466 | Ga0207650_100094663 | 338 |
| 588 | 3300025925 | Ga0207650_10249138 | Ga0207650_102491382 | 338 |
| 589 | 3300025926 | Ga0207659_10011241 | Ga0207659_100112413 | 338 |
| 590 | 3300025927 | Ga0207687_10046559 | Ga0207687_100465592 | 338 |
| 591 | 3300025928 | Ga0207700_10057631 | Ga0207700_100576312 | 338 |
| 592 | 3300025929 | Ga0207664_10002478 | Ga0207664_1000247811 | 338 |
| 593 | 3300025929 | Ga0207664_10386220 | Ga0207664_103862202 | 338 |
| 594 | 3300025931 | Ga0207644_10024574 | Ga0207644_100245742 | 338 |
| 595 | 3300025932 | Ga0207690_10034873 | Ga0207690_100348734 | 338 |
| 596 | 3300025933 | Ga0207706_10050638 | Ga0207706_100506382 | 338 |
| 597 | 3300025935 | Ga0207709_10064095 | Ga0207709_100640953 | 338 |
| 598 | 3300025937 | Ga0207669_10144720 | Ga0207669_101447202 | 338 |
| 599 | 3300025938 | Ga0207704_10250281 | Ga0207704_102502811 | 338 |
| 600 | 3300025939 | Ga0207665_10029257 | Ga0207665_100292572 | 338 |
| 601 | 3300025941 | Ga0207711_10000203 | Ga0207711_1000020330 | 338 |
| 602 | 3300025941 | Ga0207711_10095568 | Ga0207711_100955683 | 338 |
| 603 | 3300025942 | Ga0207689_10000355 | Ga0207689_1000035519 | 338 |
| 604 | 3300025945 | Ga0207679_10003632 | Ga0207679_100036322 | 338 |
| 605 | 3300025945 | Ga0207679_10041816 | Ga0207679_100418162 | 338 |
| 606 | 3300025949 | Ga0207667_10024050 | Ga0207667_100240502 | 338 |
| 607 | 3300025949 | Ga0207667_10226613 | Ga0207667_102266132 | 338 |
| 608 | 3300025961 | Ga0207712_10014587 | Ga0207712_100145874 | 338 |
| 609 | 3300025986 | Ga0207658_10099400 | Ga0207658_100994001 | 338 |
| 610 | 3300026035 | Ga0207703_10071146 | Ga0207703_100711462 | 338 |
| 611 | 3300026035 | Ga0207703_10159842 | Ga0207703_101598422 | 338 |
| 612 | 3300026041 | Ga0207639_10010005 | Ga0207639_100100054 | 338 |
| 613 | 3300026067 | Ga0207678_10000705 | Ga0207678_1000070512 | 338 |
| 614 | 3300026075 | Ga0207708_10016932 | Ga0207708_100169325 | 338 |
| 615 | 3300026078 | Ga0207702_10001520 | Ga0207702_1000152013 | 338 |
| 616 | 3300026088 | Ga0207641_10000772 | Ga0207641_1000077210 | 338 |
| 617 | 3300026088 | Ga0207641_10009478 | Ga0207641_100094783 | 338 |
| 618 | 3300026088 | Ga0207641_10016724 | Ga0207641_100167242 | 338 |
| 619 | 3300026088 | Ga0207641_10069942 | Ga0207641_100699423 | 338 |
| 620 | 3300026095 | Ga0207676_10001048 | Ga0207676_1000104811 | 338 |
| 621 | 3300026095 | Ga0207676_10003132 | Ga0207676_100031329 | 338 |
| 622 | 3300026116 | Ga0207674_10000186 | Ga0207674_1000018645 | 338 |
| 623 | 3300026116 | Ga0207674_10058473 | Ga0207674_100584732 | 338 |
| 624 | 3300026118 | Ga0207675_100001392 | Ga0207675_10000139224 | 338 |
| 625 | 3300026118 | Ga0207675_100005123 | Ga0207675_10000512310 | 338 |
| 626 | 3300026121 | Ga0207683_10000155 | Ga0207683_1000015526 | 338 |
| 627 | 3300026121 | Ga0207683_10080966 | Ga0207683_100809662 | 338 |
| 628 | 3300026142 | Ga0207698_10017059 | Ga0207698_100170594 | 338 |
| 629 | 3300027907 | Ga0207428_10001815 | Ga0207428_100018157 | 338 |
| 630 | 3300027907 | Ga0207428_10003991 | Ga0207428_100039919 | 338 |
| 631 | 3300027907 | Ga0207428_10006198 | Ga0207428_100061989 | 338 |
| 632 | 3300027907 | Ga0207428_10225530 | Ga0207428_102255302 | 338 |
| 633 | 3300028379 | Ga0268266_10004003 | Ga0268266_100040039 | 338 |
| 634 | 3300028379 | Ga0268266_10012018 | Ga0268266_100120183 | 338 |
| 635 | 3300028380 | Ga0268265_10000015 | Ga0268265_10000015109 | 338 |
| 636 | 3300028381 | Ga0268264_10010704 | Ga0268264_100107044 | 338 |
| 637 | 3300028381 | Ga0268264_10041774 | Ga0268264_100417744 | 338 |
| 638 | 3300028381 | Ga0268264_10070550 | Ga0268264_100705502 | 338 |
| 639 | 3300028381 | Ga0268264_10134787 | Ga0268264_101347872 | 338 |
| 640 | 3300028556 | Ga0265337_1000399 | Ga0265337_10003997 | 338 |
| 641 | 3300028563 | Ga0265319_1014567 | Ga0265319_10145672 | 338 |
| 642 | 3300028573 | Ga0265334_10000641 | Ga0265334_100006413 | 338 |
| 643 | 3300028577 | Ga0265318_10005884 | Ga0265318_100058844 | 338 |
| 644 | 3300028666 | Ga0265336_10010947 | Ga0265336_100109472 | 338 |
| 645 | 3300028800 | Ga0265338_10001050 | Ga0265338_1000105023 | 338 |
| 646 | 3300028800 | Ga0265338_10023116 | Ga0265338_100231166 | 338 |
| 647 | 3300028800 | Ga0265338_10197611 | Ga0265338_101976112 | 338 |
| 648 | 3300031238 | Ga0265332_10009593 | Ga0265332_100095936 | 338 |
| 649 | 3300031241 | Ga0265325_10014158 | Ga0265325_100141584 | 338 |
| 650 | 3300031247 | Ga0265340_10005983 | Ga0265340_100059832 | 338 |
| 651 | 3300031249 | Ga0265339_10017534 | Ga0265339_100175342 | 338 |
| 652 | 3300031249 | Ga0265339_10021423 | Ga0265339_100214233 | 338 |
| 653 | 3300031249 | Ga0265339_10052790 | Ga0265339_100527902 | 338 |
| 654 | 3300031344 | Ga0265316_10061518 | Ga0265316_100615183 | 338 |
| 655 | 3300031344 | Ga0265316_10063605 | Ga0265316_100636053 | 338 |
| 656 | 3300031456 | Ga0307513_10001518 | Ga0307513_100015189 | 338 |
| 657 | 3300031595 | Ga0265313_10040040 | Ga0265313_100400402 | 338 |
| 658 | 3300031691 | Ga0316579_10029736 | Ga0316579_100297361 | 338 |
| 659 | 3300031711 | Ga0265314_10052926 | Ga0265314_100529261 | 338 |
| 660 | 3300031712 | Ga0265342_10061845 | Ga0265342_100618452 | 338 |
| 661 | 3300031727 | Ga0316576_10002490 | Ga0316576_100024908 | 338 |
| 662 | 3300031727 | Ga0316576_10018856 | Ga0316576_100188563 | 338 |
| 663 | 3300031727 | Ga0316576_10029254 | Ga0316576_100292544 | 338 |
| 664 | 3300031728 | Ga0316578_10008648 | Ga0316578_100086484 | 338 |
| 665 | 3300031733 | Ga0316577_10037966 | Ga0316577_100379663 | 338 |
| 666 | 3300032002 | Ga0307416_100051682 | Ga0307416_1000516821 | 338 |
| 667 | 3300032002 | Ga0307416_100192867 | Ga0307416_1001928672 | 338 |
| 668 | 3300035090 | Ga0373949_0023095 | Ga0373949_0023095_111_1127 | 338 |
| 669 | 3300035114 | Ga0373939_0004331 | Ga0373939_0004331_1331_2347 | 338 |
| 670 | 3300035398 | Ga0316574_0013787 | Ga0316574_0013787_3397_4413 | 338 |
| 671 | 3300035398 | Ga0316574_0016958 | Ga0316574_0016958_347_1369 | 338 |
| 672 | 3300035398 | Ga0316574_0094733 | Ga0316574_0094733_471_1487 | 338 |
| 673 | 3300036647 | Ga0316582_0034085 | Ga0316582_0034085_1682_2698 | 338 |
| 674 | 3300036712 | Ga0316584_0168362 | Ga0316584_0168362_48_1070 | 338 |
| 675 | 3300037068 | Ga0373925_0000098 | Ga0373925_0000098_15962_16978 | 338 |
| 676 | 3300037068 | Ga0373925_0279757 | Ga0373925_0279757_296_1312 | 338 |
| 677 | 3300037312 | Ga0395899_0005205 | Ga0395899_0005205_2299_3315 | 338 |
| 678 | 3300037418 | Ga0395900_0005413 | Ga0395900_0005413_7844_8860 | 338 |
| 679 | 3300037418 | Ga0395900_0078043 | Ga0395900_0078043_997_2013 | 338 |
| 680 | 3300037418 | Ga0395900_0112583 | Ga0395900_0112583_362_1378 | 338 |
| 681 | 3300037466 | Ga0395898_0003440 | Ga0395898_0003440_11339_12355 | 338 |
| 682 | 3300037466 | Ga0395898_0128350 | Ga0395898_0128350_42_1058 | 338 |
| 683 | 3300037471 | Ga0395905_0015563 | Ga0395905_0015563_4539_5555 | 338 |
| 684 | 3300037471 | Ga0395905_0073922 | Ga0395905_0073922_1162_2184 | 338 |
| 685 | 3300037853 | Ga0436364_1050884 | Ga0436364_1050884_932_1963 | 338 |
| 686 | 3300038443 | Ga0395901_0003919 | Ga0395901_0003919_12011_13027 | 338 |
| 687 | 3300038443 | Ga0395901_0016954 | Ga0395901_0016954_5588_6604 | 338 |
| 688 | 3300038443 | Ga0395901_0023959 | Ga0395901_0023959_3494_4525 | 338 |
| 689 | 3300039437 | Ga0436365_0681063 | Ga0436365_0681063_26139_27170 | 338 |
| 690 | 3300039437 | Ga0436365_1655282 | Ga0436365_1655282_168_1199 | 338 |
| 691 | 3300041451 | Ga0451791_1281809 | Ga0451791_1281809_359_1381 | 338 |
| 692 | 3300041452 | Ga0451793_1426489 | Ga0451793_1426489_211_1248 | 338 |
| 693 | 3300041496 | Ga0451839_0463024 | Ga0451839_0463024_377_1393 | 338 |
| 694 | 3300041498 | Ga0451841_0327528 | Ga0451841_0327528_250_1287 | 338 |
| 695 | 3300041509 | Ga0451843_0083459 | Ga0451843_0083459_866_1903 | 338 |
| 696 | 3300042016 | Ga0439463_001486 | Ga0439463_001486_428_1444 | 338 |
| 697 | 3300042118 | Ga0450914_001537 | Ga0450914_001537_386_1402 | 338 |
| 698 | 3300042436 | Ga0439435_0009784 | Ga0439435_0009784_83_1099 | 338 |
| 699 | 3300042438 | Ga0439459_0002988 | Ga0439459_0002988_1459_2475 | 338 |
| 700 | 3300042439 | Ga0439464_0021944 | Ga0439464_0021944_43_1083 | 338 |
| 701 | 3300042439 | Ga0439464_0047518 | Ga0439464_0047518_117_1133 | 338 |
| 702 | 3300042876 | Ga0451577_0015881 | Ga0451577_0015881_3638_4669 | 338 |
| 703 | 3300044656 | Ga0466969_0042390 | Ga0466969_0042390_809_1840 | 338 |
| 704 | 3300044658 | Ga0466972_0081751 | Ga0466972_0081751_142_1173 | 338 |
| 705 | 3300044683 | Ga0466965_0046094 | Ga0466965_0046094_129_1160 | 338 |
| 706 | 3300044684 | Ga0466966_0021447 | Ga0466966_0021447_756_1787 | 338 |
| 707 | 3300044684 | Ga0466966_0059515 | Ga0466966_0059515_286_1317 | 338 |
| 708 | 3300044693 | Ga0466961_0014589 | Ga0466961_0014589_1855_2886 | 338 |
| 709 | 3300044693 | Ga0466961_0018181 | Ga0466961_0018181_962_1993 | 338 |
| 710 | 3300044693 | Ga0466961_0060019 | Ga0466961_0060019_1020_2051 | 338 |
| 711 | 3300044693 | Ga0466961_0113988 | Ga0466961_0113988_268_1299 | 338 |
| 712 | 3300044693 | Ga0466961_0163337 | Ga0466961_0163337_82_1113 | 338 |
| 713 | 3300044694 | Ga0466963_0008210 | Ga0466963_0008210_4380_5411 | 338 |
| 714 | 3300044694 | Ga0466963_0014074 | Ga0466963_0014074_3017_4048 | 338 |
| 715 | 3300044694 | Ga0466963_0038573 | Ga0466963_0038573_88_1119 | 338 |
| 716 | 3300044694 | Ga0466963_0118935 | Ga0466963_0118935_550_1581 | 338 |
| 717 | 3300044694 | Ga0466963_0208443 | Ga0466963_0208443_92_1123 | 338 |
| 718 | 3300044706 | Ga0466964_0001285 | Ga0466964_0001285_1918_2949 | 338 |
| 719 | 3300044712 | Ga0453684_0015821 | Ga0453684_0015821_2211_3242 | 338 |
| 720 | 3300044719 | Ga0466971_0004116 | Ga0466971_0004116_3300_4331 | 338 |
| 721 | 3300044719 | Ga0466971_0023279 | Ga0466971_0023279_1571_2602 | 338 |
| 722 | 3300044842 | Ga0466957_0001021 | Ga0466957_0001021_383_1414 | 338 |
| 723 | 3300044842 | Ga0466957_0057846 | Ga0466957_0057846_393_1424 | 338 |
| 724 | 3300044842 | Ga0466957_0146900 | Ga0466957_0146900_245_1276 | 338 |
| 725 | 3300044901 | Ga0466960_0000045 | Ga0466960_0000045_21952_22983 | 338 |
| 726 | 3300044901 | Ga0466960_0011211 | Ga0466960_0011211_221_1252 | 338 |
| 727 | 3300045049 | Ga0466959_0001609 | Ga0466959_0001609_7674_8705 | 338 |
| 728 | 3300045049 | Ga0466959_0010490 | Ga0466959_0010490_3907_4938 | 338 |
| 729 | 3300045049 | Ga0466959_0066849 | Ga0466959_0066849_462_1493 | 338 |
| 730 | 3300045049 | Ga0466959_0070910 | Ga0466959_0070910_460_1491 | 338 |
| 731 | 3300045836 | Ga0466958_0006072 | Ga0466958_0006072_3353_4384 | 338 |
| 732 | 3300045836 | Ga0466958_0006804 | Ga0466958_0006804_3375_4406 | 338 |
| 733 | 3300045836 | Ga0466958_0013868 | Ga0466958_0013868_1761_2792 | 338 |
| 734 | 3300045836 | Ga0466958_0025466 | Ga0466958_0025466_2166_3197 | 338 |
| 735 | 3300045976 | Ga0466967_0006548 | Ga0466967_0006548_1755_2786 | 338 |
| 736 | 3300045976 | Ga0466967_0017392 | Ga0466967_0017392_689_1720 | 338 |
| 737 | 3300045976 | Ga0466967_0017602 | Ga0466967_0017602_3611_4642 | 338 |
| 738 | 3300045976 | Ga0466967_0112910 | Ga0466967_0112910_1016_2047 | 338 |
| 739 | 3300045976 | Ga0466967_0115371 | Ga0466967_0115371_1309_2340 | 338 |
| 740 | 3300045976 | Ga0466967_0143197 | Ga0466967_0143197_1027_2058 | 338 |
| 741 | 3300045976 | Ga0466967_0204392 | Ga0466967_0204392_265_1296 | 338 |
| 742 | 3300045976 | Ga0466967_0318102 | Ga0466967_0318102_66_1097 | 338 |
| 743 | 3300046455 | Ga0495603_0048879 | Ga0495603_0048879_805_1821 | 338 |
| 744 | 3300046461 | Ga0495641_0006967 | Ga0495641_0006967_921_1949 | 338 |
| 745 | 3300046461 | Ga0495641_0016086 | Ga0495641_0016086_1793_2824 | 338 |
| 746 | 3300046471 | Ga0495650_0000331 | Ga0495650_0000331_42134_43165 | 338 |
| 747 | 3300046500 | Ga0495596_0058302 | Ga0495596_0058302_66_1082 | 338 |
| 748 | 3300046518 | Ga0495631_0042914 | Ga0495631_0042914_959_1975 | 338 |
| 749 | 3300046524 | Ga0495648_0012243 | Ga0495648_0012243_1598_3043 | 338 |
| 750 | 3300046528 | Ga0495642_0027420 | Ga0495642_0027420_915_1931 | 338 |
| 751 | 3300046539 | Ga0495621_0044804 | Ga0495621_0044804_144_1160 | 338 |
| 752 | 3300046615 | Ga0495656_0070133 | Ga0495656_0070133_344_1360 | 338 |
| 753 | 3300046665 | Ga0495661_0101635 | Ga0495661_0101635_39_1055 | 338 |
| 754 | 3300047321 | Ga0495676_0040163 | Ga0495676_0040163_1282_2310 | 338 |
| 755 | 3300048904 | Ga0496101_0020991 | Ga0496101_0020991_1476_2492 | 338 |
| 756 | 3300048904 | Ga0496101_0110037 | Ga0496101_0110037_312_1343 | 338 |
| 757 | 3300048905 | Ga0496102_0000059 | Ga0496102_0000059_119772_120803 | 338 |
| 758 | 3300048905 | Ga0496102_0004742 | Ga0496102_0004742_2012_3028 | 338 |
| 759 | 3300048905 | Ga0496102_0025051 | Ga0496102_0025051_4242_5297 | 338 |
| 760 | 3300048905 | Ga0496102_0046024 | Ga0496102_0046024_314_1345 | 338 |
| 761 | 3300048905 | Ga0496102_0119850 | Ga0496102_0119850_1346_2374 | 338 |
| 762 | 3300048905 | Ga0496102_0275129 | Ga0496102_0275129_440_1471 | 338 |
| 763 | 3300048906 | Ga0496103_0000063 | Ga0496103_0000063_34876_35907 | 338 |
| 764 | 3300048906 | Ga0496103_0127463 | Ga0496103_0127463_207_1238 | 338 |
| 765 | 3300048906 | Ga0496103_0171703 | Ga0496103_0171703_77_1093 | 338 |
| 766 | 3300048907 | Ga0496104_0047487 | Ga0496104_0047487_217_1233 | 338 |
| 767 | 3300048907 | Ga0496104_0065948 | Ga0496104_0065948_905_1921 | 338 |
| 768 | 3300048907 | Ga0496104_0208139 | Ga0496104_0208139_528_1559 | 338 |
| 769 | 3300048907 | Ga0496104_0376413 | Ga0496104_0376413_71_1102 | 338 |
| 770 | 3300048908 | Ga0496105_0036330 | Ga0496105_0036330_2012_3028 | 338 |
| 771 | 3300048908 | Ga0496105_0105937 | Ga0496105_0105937_671_1702 | 338 |
| 772 | 3300048910 | Ga0496107_0240950 | Ga0496107_0240950_40_1056 | 338 |
| 773 | 3300048911 | Ga0496108_0026484 | Ga0496108_0026484_1738_2754 | 338 |
| 774 | 3300048911 | Ga0496108_0035825 | Ga0496108_0035825_1999_3024 | 338 |
| 775 | 3300048911 | Ga0496108_0079922 | Ga0496108_0079922_94_1125 | 338 |
| 776 | 3300048911 | Ga0496108_0180445 | Ga0496108_0180445_136_1167 | 338 |
| 777 | 3300048912 | Ga0496109_0004796 | Ga0496109_0004796_5632_6663 | 338 |
| 778 | 3300048912 | Ga0496109_0034074 | Ga0496109_0034074_379_1395 | 338 |
| 779 | 3300048912 | Ga0496109_0038731 | Ga0496109_0038731_1876_2892 | 338 |
| 780 | 3300048912 | Ga0496109_0045518 | Ga0496109_0045518_2154_3179 | 338 |
| 781 | 3300048912 | Ga0496109_0052740 | Ga0496109_0052740_2497_3516 | 338 |
| 782 | 3300048913 | Ga0496110_0001456 | Ga0496110_0001456_9939_10964 | 338 |
| 783 | 3300048913 | Ga0496110_0011966 | Ga0496110_0011966_3839_4855 | 338 |
| 784 | 3300048913 | Ga0496110_0017590 | Ga0496110_0017590_2256_3287 | 338 |
| 785 | 3300048913 | Ga0496110_0032641 | Ga0496110_0032641_29_1045 | 338 |
| 786 | 3300048914 | Ga0496111_0020992 | Ga0496111_0020992_482_1498 | 338 |
| 787 | 3300048914 | Ga0496111_0026821 | Ga0496111_0026821_179_1204 | 338 |
| 788 | 3300048914 | Ga0496111_0053217 | Ga0496111_0053217_337_1368 | 338 |
| 789 | 3300048914 | Ga0496111_0053760 | Ga0496111_0053760_1403_2419 | 338 |
| 790 | 3300048914 | Ga0496111_0108873 | Ga0496111_0108873_371_1393 | 338 |
| 791 | 3300048914 | Ga0496111_0111123 | Ga0496111_0111123_555_1571 | 338 |
| 792 | 3300048914 | Ga0496111_0145873 | Ga0496111_0145873_388_1419 | 338 |
| 793 | 3300048916 | Ga0496113_0041450 | Ga0496113_0041450_716_1747 | 338 |
| 794 | 3300048917 | Ga0496114_0006455 | Ga0496114_0006455_6717_7742 | 338 |
| 795 | 3300048917 | Ga0496114_0077415 | Ga0496114_0077415_1709_2740 | 338 |
| 796 | 3300048918 | Ga0496115_0108796 | Ga0496115_0108796_587_1618 | 338 |
| 797 | 3300048919 | Ga0496116_0000371 | Ga0496116_0000371_4272_5327 | 338 |
| 798 | 3300048920 | Ga0496117_0068764 | Ga0496117_0068764_60_1109 | 338 |
| 799 | 3300048920 | Ga0496117_0077169 | Ga0496117_0077169_365_1396 | 338 |
| 800 | 3300048921 | Ga0496118_0002375 | Ga0496118_0002375_14840_15889 | 338 |
| 801 | 3300048921 | Ga0496118_0003721 | Ga0496118_0003721_17757_18812 | 338 |
| 802 | 3300048921 | Ga0496118_0017172 | Ga0496118_0017172_302_1333 | 338 |
| 803 | 3300048922 | Ga0496119_0000892 | Ga0496119_0000892_30170_31201 | 338 |
| 804 | 3300048922 | Ga0496119_0076583 | Ga0496119_0076583_171_1226 | 338 |
| 805 | 3300048923 | Ga0496120_0002612 | Ga0496120_0002612_3464_4495 | 338 |
| 806 | 3300048924 | Ga0496121_0073884 | Ga0496121_0073884_588_1619 | 338 |
| 807 | 3300049568 | Ga0501031_0005570 | Ga0501031_0005570_5394_6425 | 338 |
| 808 | 3300049569 | Ga0501032_0002340 | Ga0501032_0002340_9638_10669 | 338 |
| 809 | 3300049569 | Ga0501032_0048933 | Ga0501032_0048933_1245_2261 | 338 |
| 810 | 3300049570 | Ga0501033_0004025 | Ga0501033_0004025_442_1458 | 338 |
| 811 | 3300049570 | Ga0501033_0016214 | Ga0501033_0016214_4193_5224 | 338 |
| 812 | 3300049571 | Ga0501034_0002740 | Ga0501034_0002740_8507_9523 | 338 |
| 813 | 3300049571 | Ga0501034_0003858 | Ga0501034_0003858_12061_13077 | 338 |
| 814 | 3300049571 | Ga0501034_0005853 | Ga0501034_0005853_6873_7904 | 338 |
| 815 | 3300049571 | Ga0501034_0014985 | Ga0501034_0014985_438_1469 | 338 |
| 816 | 3300049571 | Ga0501034_0042962 | Ga0501034_0042962_393_1409 | 338 |
| 817 | 3300049571 | Ga0501034_0065347 | Ga0501034_0065347_775_1827 | 338 |
| 818 | 3300049571 | Ga0501034_0135740 | Ga0501034_0135740_61_1089 | 338 |
| 819 | 3300049572 | Ga0501036_0011560 | Ga0501036_0011560_4024_5055 | 338 |
| 820 | 3300049572 | Ga0501036_0041367 | Ga0501036_0041367_2408_3460 | 338 |
| 821 | 3300049572 | Ga0501036_0100163 | Ga0501036_0100163_318_1334 | 338 |
| 822 | 3300049573 | Ga0501037_0001389 | Ga0501037_0001389_1668_2684 | 338 |
| 823 | 3300049573 | Ga0501037_0002506 | Ga0501037_0002506_3951_4982 | 338 |
| 824 | 3300049574 | Ga0501038_0004227 | Ga0501038_0004227_5940_6971 | 338 |
| 825 | 3300049574 | Ga0501038_0077158 | Ga0501038_0077158_952_2004 | 338 |
| 826 | 3300049575 | Ga0501039_0069298 | Ga0501039_0069298_81_1103 | 338 |
| 827 | 3300049575 | Ga0501039_0303894 | Ga0501039_0303894_115_1131 | 338 |
| 828 | 3300049577 | Ga0501041_0074422 | Ga0501041_0074422_875_1891 | 338 |
| 829 | 3300049578 | Ga0501042_0015678 | Ga0501042_0015678_1218_2234 | 338 |
| 830 | 3300049578 | Ga0501042_0023790 | Ga0501042_0023790_1956_2972 | 338 |
| 831 | 3300049578 | Ga0501042_0066077 | Ga0501042_0066077_1209_2261 | 338 |
| 832 | 3300049579 | Ga0501043_0006552 | Ga0501043_0006552_4373_5404 | 338 |
| 833 | 3300049580 | Ga0501046_0023618 | Ga0501046_0023618_129_1160 | 338 |
| 834 | 3300049580 | Ga0501046_0137659 | Ga0501046_0137659_353_1405 | 338 |
| 835 | 3300049581 | Ga0501047_0008684 | Ga0501047_0008684_7714_8730 | 338 |
| 836 | 3300049581 | Ga0501047_0024485 | Ga0501047_0024485_3822_4853 | 338 |
| 837 | 3300049581 | Ga0501047_0105410 | Ga0501047_0105410_693_1745 | 338 |
| 838 | 3300049582 | Ga0501048_0002684 | Ga0501048_0002684_3949_4980 | 338 |
| 839 | 3300049582 | Ga0501048_0040076 | Ga0501048_0040076_1637_2653 | 338 |
| 840 | 3300049582 | Ga0501048_0062565 | Ga0501048_0062565_374_1390 | 338 |
| 841 | 3300049583 | Ga0501067_0004631 | Ga0501067_0004631_2684_3715 | 338 |
| 842 | 3300049584 | Ga0501068_0001815 | Ga0501068_0001815_8547_9563 | 338 |
| 843 | 3300049584 | Ga0501068_0011051 | Ga0501068_0011051_28_1059 | 338 |
| 844 | 3300049585 | Ga0501069_0001225 | Ga0501069_0001225_7678_8709 | 338 |
| 845 | 3300049585 | Ga0501069_0013761 | Ga0501069_0013761_247_1263 | 338 |
| 846 | 3300049586 | Ga0501070_0004078 | Ga0501070_0004078_9964_10980 | 338 |
| 847 | 3300049586 | Ga0501070_0017082 | Ga0501070_0017082_3992_5023 | 338 |
| 848 | 3300049587 | Ga0501071_0203204 | Ga0501071_0203204_461_1477 | 338 |
| 849 | 3300049588 | Ga0501072_0390098 | Ga0501072_0390098_66_1082 | 338 |
| 850 | 3300049589 | Ga0501073_0000965 | Ga0501073_0000965_18461_19477 | 338 |
| 851 | 3300049589 | Ga0501073_0019249 | Ga0501073_0019249_3833_4864 | 338 |
| 852 | 3300049589 | Ga0501073_0078868 | Ga0501073_0078868_22_1038 | 338 |
| 853 | 3300049591 | Ga0501075_0011325 | Ga0501075_0011325_2225_3241 | 338 |
| 854 | 3300049591 | Ga0501075_0082245 | Ga0501075_0082245_546_1568 | 338 |
| 855 | 3300049593 | Ga0501077_0049286 | Ga0501077_0049286_718_1734 | 338 |
| 856 | 3300049593 | Ga0501077_0087901 | Ga0501077_0087901_233_1249 | 338 |
| 857 | 3300049741 | Ga0501079_0116525 | Ga0501079_0116525_233_1249 | 338 |
| 858 | 3300049742 | Ga0501080_0003844 | Ga0501080_0003844_3949_4980 | 338 |
| 859 | 3300049742 | Ga0501080_0454891 | Ga0501080_0454891_34_1050 | 338 |
| 860 | 3300049744 | Ga0501083_0001426 | Ga0501083_0001426_3003_4019 | 338 |
| 861 | 3300049744 | Ga0501083_0001558 | Ga0501083_0001558_5520_6551 | 338 |
| 862 | 3300049822 | Ga0501035_0006226 | Ga0501035_0006226_8817_9848 | 338 |
| 863 | 3300049822 | Ga0501035_0011783 | Ga0501035_0011783_1819_2835 | 338 |
| 864 | 3300049822 | Ga0501035_0088794 | Ga0501035_0088794_1237_2274 | 338 |
| 865 | 3300049823 | Ga0501044_0009726 | Ga0501044_0009726_5406_6437 | 338 |
| 866 | 3300049823 | Ga0501044_0067538 | Ga0501044_0067538_457_1473 | 338 |
| 867 | 3300049823 | Ga0501044_0093354 | Ga0501044_0093354_1755_2807 | 338 |
| 868 | 3300049823 | Ga0501044_0099382 | Ga0501044_0099382_233_1270 | 338 |
| 869 | 3300049824 | Ga0501045_0058965 | Ga0501045_0058965_1505_2536 | 338 |
| 870 | 3300049824 | Ga0501045_0185045 | Ga0501045_0185045_165_1181 | 338 |
| 871 | 3300050489 | nmdc:mga03683_18115_c1 | nmdc:mga03683_18115_c1_707_1735 | 338 |
| 872 | 3300050491 | nmdc:mga00v17_454_c1 | nmdc:mga00v17_454_c1_15522_16553 | 338 |
| 873 | 3300050491 | nmdc:mga00v17_62819_c1 | nmdc:mga00v17_62819_c1_631_1683 | 338 |
| 874 | 3300050496 | nmdc:mga07m45_132319_c1 | nmdc:mga07m45_132319_c1_55_1083 | 338 |
| 875 | 3300050507 | nmdc:mga05p37_106223_c1 | nmdc:mga05p37_106223_c1_492_1508 | 338 |
| 876 | 3300050507 | nmdc:mga05p37_188224_c1 | nmdc:mga05p37_188224_c1_896_1912 | 338 |
| 877 | 3300050507 | nmdc:mga05p37_23533_c1 | nmdc:mga05p37_23533_c1_583_1599 | 338 |
| 878 | 3300050507 | nmdc:mga05p37_84862_c1 | nmdc:mga05p37_84862_c1_1914_2930 | 338 |
| 879 | 3300050508 | nmdc:mga09592_33717_c1 | nmdc:mga09592_33717_c1_2179_3195 | 338 |
| 880 | 3300050508 | nmdc:mga09592_4451_c1 | nmdc:mga09592_4451_c1_1903_2919 | 338 |
| 881 | 3300050508 | nmdc:mga09592_47131_c1 | nmdc:mga09592_47131_c1_1417_2433 | 338 |
| 882 | 3300050508 | nmdc:mga09592_66051_c1 | nmdc:mga09592_66051_c1_1501_2517 | 338 |
| 883 | 3300050509 | nmdc:mga0qj67_2866_c1 | nmdc:mga0qj67_2866_c1_3902_4918 | 338 |
| 884 | 3300050510 | nmdc:mga06r32_150029_c1 | nmdc:mga06r32_150029_c1_1036_2052 | 338 |
| 885 | 3300050510 | nmdc:mga06r32_28087_c1 | nmdc:mga06r32_28087_c1_2075_3091 | 338 |
| 886 | 3300050511 | nmdc:mga08y16_109606_c1 | nmdc:mga08y16_109606_c1_385_1401 | 338 |
| 887 | 3300050511 | nmdc:mga08y16_11761_c1 | nmdc:mga08y16_11761_c1_3570_4586 | 338 |
| 888 | 3300050511 | nmdc:mga08y16_426445_c1 | nmdc:mga08y16_426445_c1_66_1106 | 338 |
| 889 | 3300050512 | nmdc:mga0n895_109096_c1 | nmdc:mga0n895_109096_c1_548_1564 | 338 |
| 890 | 3300050512 | nmdc:mga0n895_7081_c1 | nmdc:mga0n895_7081_c1_253_1269 | 338 |
| 891 | 3300050515 | nmdc:mga0a205_45069_c1 | nmdc:mga0a205_45069_c1_767_1783 | 338 |
| 892 | 3300053084 | Ga0495595_0061984 | Ga0495595_0061984_59_1090 | 338 |
| 893 | 3300053104 | Ga0500556_0001107 | Ga0500556_0001107_6553_7587 | 338 |
| 894 | 3300053153 | Ga0500616_0000885 | Ga0500616_0000885_16661_17677 | 338 |
| 895 | 3300053153 | Ga0500616_0000953 | Ga0500616_0000953_4345_5361 | 338 |
| 896 | 3300053153 | Ga0500616_0004063 | Ga0500616_0004063_5880_6914 | 338 |
| 897 | 3300053153 | Ga0500616_0015772 | Ga0500616_0015772_1037_2053 | 338 |
| 898 | 3300053153 | Ga0500616_0017259 | Ga0500616_0017259_123_1157 | 338 |
| 899 | 3300054114 | Ga0501084_0011719 | Ga0501084_0011719_4267_5298 | 338 |
| 900 | 3300061719 | Ga0466962_0000651 | Ga0466962_0000651_1906_2937 | 338 |
| 901 | 3300061719 | Ga0466962_0068529 | Ga0466962_0068529_369_1400 | 338 |
| 902 | 3300061734 | Ga0530510_0083078 | Ga0530510_0083078_956_1972 | 338 |
| 903 | iso_pu_bacteria | 2870628048 | 2870629347 | 338 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1f07-assembly1.cif.gz_A | structure of coenzyme f420 dependent tetrahydromethanopterin reductase from methanobacterium thermoautotrophicum | 0.8204 | 1 | 327 |
| 1f07-assembly1.cif.gz_A | structure of coenzyme f420 dependent tetrahydromethanopterin reductase from methanobacterium thermoautotrophicum | 0.8108 | 1 | 327 |
| 1rhc-assembly1.cif.gz_A-2 | f420-dependent secondary alcohol dehydrogenase in complex with an f420-acetone adduct | 0.7961 | 2 | 332 |
| 1z69-assembly1.cif.gz_B | crystal structure of methylenetetrahydromethanopterin reductase (mer) in complex with coenzyme f420 | 0.7872 | 1 | 327 |
| 3c8n-assembly2.cif.gz_D | crystal structure of apo-fgd1 from mycobacterium tuberculosis | 0.7871 | 2 | 330 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1rhcA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.7961 | 2 | 332 | 3.20.20.30 |
| 1rhcA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.787 | 2 | 332 | 3.20.20.30 |
| af_O05772_7_317_3.20.20.30 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.7759 | 12 | 319 | 3.20.20.30 |
| 1ezwA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.7658 | 1 | 331 | 3.20.20.30 |
| af_P96809_35_360_3.20.20.30 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.7571 | 2 | 328 | 3.20.20.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A351EVS5-F1-model_v4 | TIGR03842 family LLM class F420-dependent oxidoreductase | 0.9902 | 1 | 157 |
GO:0016705
|
| AF-A0A401M885-F1-model_v4 | N5,N10-methylenetetrahydromethanopterin reductase-related protein | 0.9872 | 1 | 332 |
GO:0016705
|
| AF-A0A3D0HFL4-F1-model_v4 | TIGR03842 family LLM class F420-dependent oxidoreductase | 0.9851 | 1 | 101 |
GO:0016705
|
| AF-A0A7Y0PGT9-F1-model_v4 | LLM class flavin-dependent oxidoreductase | 0.9833 | 40 | 203 |
GO:0016705
|
| AF-A0A7Y3HFA4-F1-model_v4 | TIGR03842 family LLM class F420-dependent oxidoreductase | 0.9829 | 1 | 286 |
GO:0016705
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar