F485251

General Info

Members Datasets Scaffolds Average Seq Length
903 437 819 339

Family's Representative Sequence

Representative Sequence 3300046524|Ga0495648_0012243|Ga0495648_0012243_1598_3043
Length 383
Sequence MDDTDTDAARGLDGGPRPRTATTGLDIGVVLQTNPPACRVVELARQAETMGFSHVWTFDSHLLWEEPFVIYSQILAATRKVLVGPMVTNPATRDWTVTASLFATLNEMFGNRTICGIGRGDSAVRVLNGRPTTLATLRECVGVVRELANGREADVGGTRLRLPWGGDSRLDVWVAGYGPRALALAGEIGDGYILQLADPAVVAWTIDAVRAAAAAAGRDPAAVKICVAAPAYVGGADEASMAHQRDQCRWFGGMVGNHVADLVARYGQAVSAAVADADGAGGGIPPALTAYVAGRTAYDYNEHGRPGNIHADFVPDEIIDRFCLLGPAQEHVRRLTELADLGVDQFAVYLQHDAKSATLEAYGETVIPTIAARTLAITAPSRG

Samples

Sample ID Description Type Environment
1 2508501039 Frankia saprophytica CN3 Isolate Nodule
2 2517572101 Frankia sp. DC12 Isolate Nodule
3 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
4 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
5 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
6 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
7 2619618881 Frankia sp. ACN1ag Isolate Unclassified
8 2619619003 Frankia sp. CpI1-P Isolate Nodule
9 2626541554 Frankia sp. AvcI.1 Isolate Nodule
10 2643221566 Microbacterium sp. Root166 Isolate Unclassified
11 2643221572 Leifsonia sp. Root60 Isolate Unclassified
12 2643221575 Microbacterium sp. Root61 Isolate Unclassified
13 2643221649 Leifsonia sp. Root4 Isolate Unclassified
14 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
15 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
16 2671180195 Frankia sp. CcI49 Isolate Nodule
17 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
18 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
19 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
20 2687453737 Frankia sp. BMG5.36 Isolate Nodule
21 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
22 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
23 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
24 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
25 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
26 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
27 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
28 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
29 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
30 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
31 2773857922 Frankia sp. CcI49 Isolate Nodule
32 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
33 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
34 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
35 2808606372 Agromyces sp. 23-23 Isolate Unclassified
36 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
37 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
38 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
39 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
40 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
41 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
42 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
43 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
44 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
45 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
46 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
47 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
48 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
49 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
50 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
51 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
52 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
53 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
54 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
55 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
56 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
57 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
58 2919069694 Microbacterium sp. 1154 Isolate Unclassified
59 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
60 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
61 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
62 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
63 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
64 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
65 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
66 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
67 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
68 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
69 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
70 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
71 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
72 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
73 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
76 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
77 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
78 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
79 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
80 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
81 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
82 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
83 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
84 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
85 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
86 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
87 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
88 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
89 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
90 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
91 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
92 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
93 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
94 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
95 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
96 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
97 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
98 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
99 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
100 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
101 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
102 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
103 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
104 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
105 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
106 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
107 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
108 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
109 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
110 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
111 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
112 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
113 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
114 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
115 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
116 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
117 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
118 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
119 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
120 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
121 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
122 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
123 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
124 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
125 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
126 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
127 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
128 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
129 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
130 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
131 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
132 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
133 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
134 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
135 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
136 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
137 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
138 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
139 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
140 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
141 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
142 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
143 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
144 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
145 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
146 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
147 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
148 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
149 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
150 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
151 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
152 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
153 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
154 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
155 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
156 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
157 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
158 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
159 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
160 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
161 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
162 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
163 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
164 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
165 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
166 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
167 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
168 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
169 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
170 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
171 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
172 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
173 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
174 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
175 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
176 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
177 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
178 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
179 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
180 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
181 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
182 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
183 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
184 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
185 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
238 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
242 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
243 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
244 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
245 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
246 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
247 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
248 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
249 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
250 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
251 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
252 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
253 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
254 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
255 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
256 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
257 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
258 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
259 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
260 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
261 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
262 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
263 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
264 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
265 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
266 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
267 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
268 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
269 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
270 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
271 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
272 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
273 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
274 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
275 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
276 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
277 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
278 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
279 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
280 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
281 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
282 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
283 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
284 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
285 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
286 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
287 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
288 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
289 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
290 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
291 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
292 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
293 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
294 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
295 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
296 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
297 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
298 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
299 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
300 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
301 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
302 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
303 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
304 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
305 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
306 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
307 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
308 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
309 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
310 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
311 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
312 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
313 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
314 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
315 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
316 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
317 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
318 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
319 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
320 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
321 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
322 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
323 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
324 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
325 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
326 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
327 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
328 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
329 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
330 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
331 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
332 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
333 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
334 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
335 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
336 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
337 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
338 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
339 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
340 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
341 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
342 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
343 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
344 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
345 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
346 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
347 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
348 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
349 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
350 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
351 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
352 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
353 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
354 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
355 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
356 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
357 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
358 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
359 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
360 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
361 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
362 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
363 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
364 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
365 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
366 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
367 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
368 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
371 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
374 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
375 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
376 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
377 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
378 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
379 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
380 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
381 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
382 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
383 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
384 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
385 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
386 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
387 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
388 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
389 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
390 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
391 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
392 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
393 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
394 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
395 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
396 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
397 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
398 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
399 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
400 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
401 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
402 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
403 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
404 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
405 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
406 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
407 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
408 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
409 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
410 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
411 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
412 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
413 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
414 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
415 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
416 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
417 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
418 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
419 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
420 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
421 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
422 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
423 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
424 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
425 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
426 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
427 8002775197 Frankia nepalensis CN7 Isolate Nodule
428 8002784119 Frankia sp. AgB1.9 Isolate Nodule
429 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
430 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
431 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
432 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere
433 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
434 8054920844 Frankia tisae Agncl-8 Isolate Nodule
435 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
436 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere
437 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.92
Metatranscriptomes 0.78
Isolates 9.3

Biome Distribution

Category Percentage (%)
Aerial Root 0.11
Bulb 0
Endosphere 4.21
Nodule 1.44
Rhizoplane 8.53
Rhizosphere 74.42
Stem 0
Stem Tuber 0
Unclassified 11.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1001068 3300001976 Bacteria 3734
2 JGI24752J21851_1002035 3300001976 Bacteria 2700
3 JGI24752J21851_1002296 3300001976 Bacteria 2550
4 JGI24751J29686_10000424 3300002459 Bacteria 13157
5 JGI24751J29686_10003910 3300002459 Bacteria 3009
6 JGI25406J46586_10001099 3300003203 Bacteria 12668
7 JGI25406J46586_10033705 3300003203 Bacteria 1888
8 JGI25405J52794_10007179 3300003911 Bacteria 2050
9 Ga0065714_10065905 3300005288 Bacteria 8127
10 Ga0070658_10000516 3300005327 Bacteria 33519
11 Ga0070658_10018666 3300005327 Bacteria 5554
12 Ga0070658_10036380 3300005327 Bacteria 3968
13 Ga0070690_100129436 3300005330 Bacteria 1703
14 Ga0070670_100054425 3300005331 Bacteria 3435
15 Ga0068869_100005134 3300005334 Bacteria 8210
16 Ga0068869_100163759 3300005334 Bacteria 1733
17 Ga0070680_100012976 3300005336 Bacteria 6481
18 Ga0070680_100237299 3300005336 Bacteria 1541
19 Ga0070680_100367309 3300005336 Bacteria 1224
20 Ga0070682_100007230 3300005337 Bacteria 6255
21 Ga0070682_100078320 3300005337 Bacteria 2132
22 Ga0070692_10002768 3300005345 Bacteria 6906
23 Ga0070675_100017195 3300005354 Bacteria 5747
24 Ga0070675_100025157 3300005354 Bacteria 4771
25 Ga0070671_100005657 3300005355 Bacteria 9948
26 Ga0070688_100046743 3300005365 Bacteria 2682
27 Ga0070659_100012289 3300005366 Bacteria 6348
28 Ga0070659_100058228 3300005366 Bacteria 3049
29 Ga0070659_100282133 3300005366 Bacteria 1382
30 Ga0070703_10011057 3300005406 Bacteria 2548
31 Ga0070709_10007107 3300005434 Bacteria 6125
32 Ga0070709_10150960 3300005434 Bacteria 1606
33 Ga0070714_100041568 3300005435 Bacteria 3880
34 Ga0070714_100084338 3300005435 Bacteria 2772
35 Ga0070714_100100492 3300005435 Bacteria 2548
36 Ga0070713_100075079 3300005436 Bacteria 2866
37 Ga0070701_10099806 3300005438 Bacteria 1606
38 Ga0070701_10167902 3300005438 Bacteria 1276
39 Ga0070700_100009088 3300005441 Bacteria 5447
40 Ga0070663_100015507 3300005455 Bacteria 4923
41 Ga0070681_10018792 3300005458 Bacteria 6917
42 Ga0070685_10150575 3300005466 Bacteria 1474
43 Ga0070685_10191337 3300005466 Bacteria 1324
44 Ga0070706_100045762 3300005467 Bacteria 4040
45 Ga0070706_100100092 3300005467 Unclassified 2693
46 Ga0070706_100233944 3300005467 Unclassified 1715
47 Ga0070707_100017861 3300005468 Bacteria 6670
48 Ga0070707_100155044 3300005468 Unclassified 2231
49 Ga0070707_100289997 3300005468 Unclassified 1590
50 Ga0070698_100001406 3300005471 Bacteria 26671
51 Ga0070698_100006165 3300005471 Bacteria 13057
52 Ga0070698_100051129 3300005471 Bacteria 4210
53 Ga0070699_100022651 3300005518 Bacteria 5415
54 Ga0070699_100078843 3300005518 Bacteria 2868
55 Ga0070679_100051719 3300005530 Bacteria 4092
56 Ga0070684_100001918 3300005535 Bacteria 15253
57 Ga0070684_100008570 3300005535 Bacteria 8006
58 Ga0068853_100064029 3300005539 Bacteria 3186
59 Ga0070686_100070590 3300005544 Bacteria 2284
60 Ga0070693_100000347 3300005547 Bacteria 21059
61 Ga0070665_100000791 3300005548 Bacteria 41601
62 Ga0070665_100007578 3300005548 Bacteria 11036
63 Ga0070665_100011326 3300005548 Bacteria 9020
64 Ga0070665_100091726 3300005548 Bacteria 3043
65 Ga0070665_100102824 3300005548 Bacteria 2861
66 Ga0070665_100121113 3300005548 Bacteria 2618
67 Ga0070704_100001943 3300005549 Bacteria 11442
68 Ga0068855_100019945 3300005563 Bacteria 8051
69 Ga0068855_100097904 3300005563 Bacteria 3379
70 Ga0068855_100106798 3300005563 Bacteria 3217
71 Ga0068855_100179482 3300005563 Bacteria 2394
72 Ga0068855_100271021 3300005563 Bacteria 1887
73 Ga0068855_100315157 3300005563 Bacteria 1730
74 Ga0070664_100008359 3300005564 Bacteria 8367
75 Ga0070664_100146236 3300005564 Bacteria 2085
76 Ga0068857_100031944 3300005577 Bacteria 4653
77 Ga0068857_100142844 3300005577 Bacteria 2164
78 Ga0068854_100073625 3300005578 Bacteria 2504
79 Ga0068856_100009168 3300005614 Bacteria 9621
80 Ga0068856_100033521 3300005614 Bacteria 5029
81 Ga0068856_100118962 3300005614 Bacteria 2643
82 Ga0068856_100149510 3300005614 Bacteria 2344
83 Ga0070702_100002009 3300005615 Bacteria 8578
84 Ga0070702_100192261 3300005615 Bacteria 1344
85 Ga0068852_100033719 3300005616 Bacteria 4254
86 Ga0068852_100282047 3300005616 Bacteria 1602
87 Ga0068852_100344019 3300005616 Bacteria 1454
88 Ga0068859_100002957 3300005617 Bacteria 17235
89 Ga0068859_100007129 3300005617 Bacteria 11345
90 Ga0068859_100041923 3300005617 Bacteria 4598
91 Ga0068864_100008495 3300005618 Bacteria 8473
92 Ga0068864_100265931 3300005618 Bacteria 1596
93 Ga0068861_100007184 3300005719 Bacteria 7626
94 Ga0068861_100023686 3300005719 Bacteria 4431
95 Ga0068861_100069499 3300005719 Bacteria 2725
96 Ga0068861_100151077 3300005719 Bacteria 1906
97 Ga0068861_100193103 3300005719 Bacteria 1704
98 Ga0068870_10000390 3300005840 Bacteria 16496
99 Ga0068870_10001611 3300005840 Bacteria 9183
100 Ga0068863_100000274 3300005841 Bacteria 53564
101 Ga0068863_100003122 3300005841 Bacteria 16358
102 Ga0068863_100008129 3300005841 Bacteria 10242
103 Ga0068863_100013760 3300005841 Bacteria 7798
104 Ga0068863_100055915 3300005841 Bacteria 3736
105 Ga0068863_100208619 3300005841 Bacteria 1881
106 Ga0068863_100220203 3300005841 Bacteria 1828
107 Ga0068858_100019804 3300005842 Bacteria 6289
108 Ga0068858_100136130 3300005842 Bacteria 2305
109 Ga0068860_100035775 3300005843 Bacteria 4762
110 Ga0068860_100054272 3300005843 Bacteria 3809
111 Ga0068860_100078365 3300005843 Bacteria 3142
112 Ga0068860_100113550 3300005843 Bacteria 2590
113 Ga0068860_100217048 3300005843 Bacteria 1856
114 Ga0068862_100000237 3300005844 Bacteria 61270
115 Ga0081455_10001004 3300005937 Bacteria 35765
116 Ga0081455_10003346 3300005937 Bacteria 18489
117 Ga0081455_10014805 3300005937 Bacteria 7611
118 Ga0081455_10033413 3300005937 Bacteria 4623
119 Ga0081455_10083784 3300005937 Bacteria 2604
120 Ga0081455_10141516 3300005937 Bacteria 1868
121 Ga0081538_10000359 3300005981 Bacteria 51874
122 Ga0081539_10000135 3300005985 Bacteria 172789
123 Ga0081539_10000352 3300005985 Bacteria 100942
124 Ga0081539_10003711 3300005985 Bacteria 18198
125 Ga0081539_10004612 3300005985 Bacteria 15017
126 Ga0081539_10022554 3300005985 Bacteria 4161
127 Ga0081539_10072935 3300005985 Bacteria 1833
128 Ga0075365_10000350 3300006038 Bacteria 16540
129 Ga0075365_10095649 3300006038 Bacteria 2029
130 Ga0075368_10027906 3300006042 Bacteria 2180
131 Ga0075364_10003412 3300006051 Bacteria 9029
132 Ga0075364_10038095 3300006051 Bacteria 3115
133 Ga0075364_10081214 3300006051 Bacteria 2143
134 Ga0075364_10093575 3300006051 Bacteria 1996
135 Ga0075432_10007868 3300006058 Bacteria 3634
136 Ga0070716_100039526 3300006173 Bacteria 2619
137 Ga0075362_10020696 3300006177 Bacteria 2751
138 Ga0075367_10189460 3300006178 Bacteria 1283
139 Ga0097621_100011172 3300006237 Bacteria 6609
140 Ga0068871_100042170 3300006358 Bacteria 3662
141 Ga0075428_100000474 3300006844 Bacteria 40339
142 Ga0075428_100022805 3300006844 Bacteria 6927
143 Ga0075428_100191729 3300006844 Bacteria 2210
144 Ga0075428_100281049 3300006844 Bacteria 1791
145 Ga0075428_100289571 3300006844 Bacteria 1762
146 Ga0075430_100000935 3300006846 Bacteria 22920
147 Ga0075430_100002201 3300006846 Bacteria 16155
148 Ga0075430_100021522 3300006846 Bacteria 5481
149 Ga0075430_100024879 3300006846 Bacteria 5093
150 Ga0075431_100001764 3300006847 Bacteria 20381
151 Ga0075431_100003722 3300006847 Bacteria 14818
152 Ga0075431_100012785 3300006847 Bacteria 8475
153 Ga0075431_100017699 3300006847 Bacteria 7246
154 Ga0075431_100085475 3300006847 Bacteria 3256
155 Ga0075431_100117121 3300006847 Bacteria 2749
156 Ga0075431_100365494 3300006847 Bacteria 1449
157 Ga0075431_100520878 3300006847 Bacteria 1178
158 Ga0075433_10075156 3300006852 Bacteria 2973
159 Ga0075433_10302904 3300006852 Bacteria 1415
160 Ga0075434_100006513 3300006871 Bacteria 10708
161 Ga0075434_100089702 3300006871 Bacteria 3075
162 Ga0075434_100233336 3300006871 Bacteria 1860
163 Ga0075434_100360379 3300006871 Bacteria 1475
164 Ga0075429_100001303 3300006880 Bacteria 20326
165 Ga0075429_100001981 3300006880 Bacteria 17025
166 Ga0075429_100007859 3300006880 Bacteria 9262
167 Ga0075429_100151300 3300006880 Bacteria 2032
168 Ga0075429_100219883 3300006880 Bacteria 1664
169 Ga0068865_100221036 3300006881 Bacteria 1481
170 Ga0075436_100001698 3300006914 Bacteria 15076
171 Ga0097620_100002957 3300006931 Bacteria 17235
172 Ga0097620_100006662 3300006931 Bacteria 11728
173 Ga0097620_100007129 3300006931 Bacteria 11345
174 Ga0097620_100041922 3300006931 Bacteria 4598
175 Ga0075435_100027739 3300007076 Bacteria 4433
176 Ga0105251_10040011 3300009011 Bacteria 2287
177 Ga0105244_10063886 3300009036 Bacteria 1848
178 Ga0105244_10073842 3300009036 Bacteria 1697
179 Ga0105240_10008219 3300009093 Bacteria 14957
180 Ga0105240_10019078 3300009093 Bacteria 9171
181 Ga0105240_10094668 3300009093 Bacteria 3642
182 Ga0105240_10117763 3300009093 Bacteria 3202
183 Ga0111539_10031182 3300009094 Bacteria 6479
184 Ga0111539_10434264 3300009094 Bacteria 1529
185 Ga0111539_10668257 3300009094 Bacteria 1210
186 Ga0111539_10684867 3300009094 Bacteria 1193
187 Ga0105245_10036774 3300009098 Bacteria 4351
188 Ga0105245_10180691 3300009098 Bacteria 2015
189 Ga0105245_10367390 3300009098 Bacteria 1429
190 Ga0105247_10000971 3300009101 Bacteria 21642
191 Ga0105247_10014730 3300009101 Bacteria 4687
192 Ga0114129_10000048 3300009147 Bacteria 103451
193 Ga0114129_10000128 3300009147 Bacteria 77291
194 Ga0114129_10001279 3300009147 Bacteria 33592
195 Ga0114129_10001574 3300009147 Bacteria 30996
196 Ga0114129_10020234 3300009147 Bacteria 9470
197 Ga0114129_10052270 3300009147 Bacteria 5734
198 Ga0114129_10722981 3300009147 Unclassified 1277
199 Ga0105243_10008507 3300009148 Bacteria 7874
200 Ga0105243_10027614 3300009148 Bacteria 4350
201 Ga0105243_10079731 3300009148 Bacteria 2669
202 Ga0105243_10399345 3300009148 Bacteria 1276
203 Ga0105241_10064837 3300009174 Bacteria 2822
204 Ga0105248_10000034 3300009177 Bacteria 192324
205 Ga0105248_10240009 3300009177 Bacteria 2040
206 Ga0105248_10437199 3300009177 Bacteria 1474
207 Ga0105248_10686916 3300009177 Bacteria 1155
208 Ga0105237_10005381 3300009545 Bacteria 14471
209 Ga0105238_10267490 3300009551 Bacteria 1690
210 Ga0105238_10470603 3300009551 Bacteria 1255
211 Ga0105249_10075684 3300009553 Bacteria 3118
212 Ga0105249_10351755 3300009553 Bacteria 1493
213 Ga0105249_10365682 3300009553 Bacteria 1465
214 Ga0105249_10668185 3300009553 Bacteria 1097
215 Ga0105032_104382 3300009979 Bacteria 1205
216 Ga0105035_100234 3300009988 Bacteria 3730
217 Ga0105239_10013363 3300010375 Bacteria 9121
218 Ga0105239_10054716 3300010375 Bacteria 4378
219 Ga0105239_10394606 3300010375 Bacteria 1565
220 Ga0105239_10396797 3300010375 Bacteria 1561
221 Ga0105246_10031106 3300011119 Bacteria 3530
222 Ga0105246_10066499 3300011119 Bacteria 2524
223 Ga0157338_1002637 3300012515 Bacteria 1424
224 Ga0157373_10124402 3300013100 Bacteria 1813
225 Ga0157371_10000794 3300013102 Bacteria 36216
226 Ga0157370_10032665 3300013104 Bacteria 5081
227 Ga0157370_10050894 3300013104 Bacteria 3958
228 Ga0157369_10006194 3300013105 Bacteria 13880
229 Ga0157369_10239923 3300013105 Bacteria 1893
230 Ga0157374_10018863 3300013296 Bacteria 6097
231 Ga0157378_10208617 3300013297 Bacteria 1851
232 Ga0157378_10389138 3300013297 Bacteria 1371
233 Ga0163162_10021945 3300013306 Bacteria 6290
234 Ga0163162_10257411 3300013306 Bacteria 1877
235 Ga0157372_10019524 3300013307 Bacteria 7306
236 Ga0157372_10040927 3300013307 Bacteria 5122
237 Ga0157372_10597684 3300013307 Bacteria 1286
238 Ga0157375_10107580 3300013308 Bacteria 2882
239 Ga0157375_10234003 3300013308 Bacteria 1996
240 Ga0157375_10322717 3300013308 Bacteria 1709
241 Ga0163163_10013199 3300014325 Bacteria 7550
242 Ga0163163_10068093 3300014325 Bacteria 3542
243 Ga0163163_10114254 3300014325 Bacteria 2730
244 Ga0163163_10307592 3300014325 Bacteria 1637
245 Ga0157380_10023569 3300014326 Bacteria 4645
246 Ga0157377_10041322 3300014745 Bacteria 2558
247 Ga0157379_10006923 3300014968 Bacteria 9804
248 Ga0157379_10016266 3300014968 Bacteria 6545
249 Ga0157379_10461186 3300014968 Bacteria 1174
250 Ga0157376_10277777 3300014969 Bacteria 1576
251 Ga0163161_10180061 3300017792 Bacteria 1620
252 Ga0206356_10758018 3300020070 Bacteria 2444
253 Ga0206351_10658466 3300020077 Bacteria 8249
254 Ga0206352_10915400 3300020078 Bacteria 2013
255 Ga0206350_10122299 3300020080 Bacteria 2456
256 Ga0206354_11650881 3300020081 Bacteria 1521
257 Ga0206353_10109164 3300020082 Bacteria 5678
258 Ga0213876_10149661 3300021384 Bacteria 1241
259 Ga0224712_10001135 3300022467 Bacteria 5928
260 Ga0207655_1050447 3300025728 Bacteria 1691
261 Ga0207682_10094629 3300025893 Bacteria 1300
262 Ga0207692_10009035 3300025898 Bacteria 4150
263 Ga0207710_10000682 3300025900 Bacteria 19100
264 Ga0207710_10017307 3300025900 Bacteria 3058
265 Ga0207688_10000765 3300025901 Bacteria 15989
266 Ga0207688_10099785 3300025901 Bacteria 1675
267 Ga0207688_10135586 3300025901 Bacteria 1446
268 Ga0207688_10161509 3300025901 Bacteria 1328
269 Ga0207647_10004472 3300025904 Bacteria 10359
270 Ga0207647_10018243 3300025904 Bacteria 4753
271 Ga0207647_10024270 3300025904 Bacteria 4000
272 Ga0207647_10029797 3300025904 Bacteria 3526
273 Ga0207647_10046375 3300025904 Bacteria 2709
274 Ga0207645_10070843 3300025907 Bacteria 2231
275 Ga0207645_10077104 3300025907 Bacteria 2135
276 Ga0207643_10000049 3300025908 Bacteria 78784
277 Ga0207643_10000517 3300025908 Bacteria 24731
278 Ga0207705_10000001 3300025909 Bacteria 2061880
279 Ga0207684_10028199 3300025910 Bacteria 4782
280 Ga0207684_10088247 3300025910 Bacteria 2642
281 Ga0207684_10423780 3300025910 Unclassified 1143
282 Ga0207654_10028648 3300025911 Bacteria 3038
283 Ga0207654_10191320 3300025911 Bacteria 1341
284 Ga0207654_10265164 3300025911 Bacteria 1156
285 Ga0207707_10040010 3300025912 Bacteria 4097
286 Ga0207695_10104876 3300025913 Bacteria 2815
287 Ga0207695_10184877 3300025913 Bacteria 2004
288 Ga0207671_10008858 3300025914 Bacteria 8473
289 Ga0207671_10063600 3300025914 Bacteria 2742
290 Ga0207663_10040137 3300025916 Bacteria 2843
291 Ga0207660_10010527 3300025917 Bacteria 6006
292 Ga0207657_10011572 3300025919 Bacteria 8752
293 Ga0207657_10118487 3300025919 Bacteria 2179
294 Ga0207649_10021347 3300025920 Bacteria 3726
295 Ga0207649_10027450 3300025920 Bacteria 3340
296 Ga0207652_10084788 3300025921 Bacteria 2776
297 Ga0207646_10011964 3300025922 Bacteria 8366
298 Ga0207646_10015271 3300025922 Bacteria 7262
299 Ga0207646_10343606 3300025922 Bacteria 1348
300 Ga0207694_10105685 3300025924 Bacteria 2235
301 Ga0207650_10000713 3300025925 Bacteria 25899
302 Ga0207650_10006096 3300025925 Bacteria 8217
303 Ga0207650_10009466 3300025925 Bacteria 6655
304 Ga0207650_10249138 3300025925 Bacteria 1438
305 Ga0207659_10011241 3300025926 Bacteria 5651
306 Ga0207687_10025387 3300025927 Bacteria 3966
307 Ga0207687_10046559 3300025927 Bacteria 3003
308 Ga0207700_10057631 3300025928 Bacteria 2930
309 Ga0207664_10002478 3300025929 Bacteria 12223
310 Ga0207664_10386220 3300025929 Bacteria 1243
311 Ga0207644_10024574 3300025931 Bacteria 4137
312 Ga0207690_10034873 3300025932 Bacteria 3245
313 Ga0207690_10094929 3300025932 Bacteria 2117
314 Ga0207706_10050638 3300025933 Bacteria 3670
315 Ga0207709_10064095 3300025935 Bacteria 2306
316 Ga0207669_10144720 3300025937 Bacteria 1656
317 Ga0207704_10250281 3300025938 Bacteria 1330
318 Ga0207665_10002648 3300025939 Bacteria 12030
319 Ga0207665_10029257 3300025939 Bacteria 3642
320 Ga0207711_10000203 3300025941 Bacteria 63383
321 Ga0207711_10095568 3300025941 Bacteria 2621
322 Ga0207689_10000355 3300025942 Bacteria 42965
323 Ga0207679_10003632 3300025945 Bacteria 9567
324 Ga0207679_10041816 3300025945 Bacteria 3290
325 Ga0207667_10024050 3300025949 Bacteria 6699
326 Ga0207667_10072433 3300025949 Bacteria 3581
327 Ga0207667_10226613 3300025949 Bacteria 1915
328 Ga0207712_10014587 3300025961 Bacteria 5059
329 Ga0207668_10029077 3300025972 Bacteria 3620
330 Ga0207640_10194095 3300025981 Bacteria 1533
331 Ga0207658_10099400 3300025986 Bacteria 2276
332 Ga0207703_10071146 3300026035 Bacteria 2873
333 Ga0207703_10159842 3300026035 Bacteria 1972
334 Ga0207639_10010005 3300026041 Bacteria 6555
335 Ga0207678_10000705 3300026067 Bacteria 30524
336 Ga0207678_10011578 3300026067 Bacteria 7747
337 Ga0207708_10016932 3300026075 Bacteria 5488
338 Ga0207702_10001520 3300026078 Bacteria 22948
339 Ga0207702_10026927 3300026078 Bacteria 4774
340 Ga0207702_10128040 3300026078 Bacteria 2282
341 Ga0207641_10000772 3300026088 Bacteria 34278
342 Ga0207641_10004202 3300026088 Bacteria 12555
343 Ga0207641_10009478 3300026088 Bacteria 8024
344 Ga0207641_10016724 3300026088 Bacteria 6007
345 Ga0207641_10048886 3300026088 Bacteria 3572
346 Ga0207641_10069942 3300026088 Bacteria 3015
347 Ga0207676_10001048 3300026095 Bacteria 21049
348 Ga0207676_10003132 3300026095 Bacteria 11807
349 Ga0207674_10000186 3300026116 Bacteria 75904
350 Ga0207674_10058473 3300026116 Bacteria 3905
351 Ga0207674_10192127 3300026116 Bacteria 1991
352 Ga0207675_100001392 3300026118 Bacteria 24245
353 Ga0207675_100005123 3300026118 Bacteria 12618
354 Ga0207683_10000155 3300026121 Bacteria 57375
355 Ga0207683_10080966 3300026121 Bacteria 2881
356 Ga0207698_10017059 3300026142 Bacteria 4916
357 Ga0207428_10001815 3300027907 Bacteria 21876
358 Ga0207428_10003991 3300027907 Bacteria 14165
359 Ga0207428_10006198 3300027907 Bacteria 11050
360 Ga0207428_10199753 3300027907 Bacteria 1505
361 Ga0207428_10225530 3300027907 Bacteria 1403
362 Ga0268266_10004003 3300028379 Bacteria 14257
363 Ga0268266_10012018 3300028379 Bacteria 7493
364 Ga0268266_10023513 3300028379 Bacteria 5245
365 Ga0268266_10109028 3300028379 Bacteria 2451
366 Ga0268266_10192776 3300028379 Bacteria 1861
367 Ga0268265_10000015 3300028380 Bacteria 322854
368 Ga0268264_10010704 3300028381 Bacteria 7576
369 Ga0268264_10041774 3300028381 Bacteria 3794
370 Ga0268264_10070550 3300028381 Bacteria 2958
371 Ga0268264_10134787 3300028381 Bacteria 2194
372 Ga0268264_10213519 3300028381 Bacteria 1773
373 Ga0265337_1000399 3300028556 Bacteria 23359
374 Ga0265319_1014567 3300028563 Bacteria 3081
375 Ga0265334_10000641 3300028573 Bacteria 17614
376 Ga0265318_10005884 3300028577 Bacteria 5708
377 Ga0265336_10010947 3300028666 Bacteria 3092
378 Ga0307515_10000315 3300028794 Bacteria 119286
379 Ga0265338_10001050 3300028800 Bacteria 46114
380 Ga0265338_10023116 3300028800 Bacteria 6402
381 Ga0265338_10197611 3300028800 Bacteria 1519
382 Ga0265332_10009593 3300031238 Bacteria 4319
383 Ga0265325_10014158 3300031241 Bacteria 4516
384 Ga0265340_10005983 3300031247 Bacteria 6723
385 Ga0265339_10017534 3300031249 Bacteria 4238
386 Ga0265339_10021423 3300031249 Bacteria 3761
387 Ga0265339_10052790 3300031249 Bacteria 2213
388 Ga0265316_10061518 3300031344 Bacteria 2916
389 Ga0265316_10063605 3300031344 Bacteria 2861
390 Ga0307513_10001518 3300031456 Bacteria 33342
391 Ga0307513_10089507 3300031456 Bacteria 3142
392 Ga0307408_100214775 3300031548 Bacteria 1566
393 Ga0307408_100250692 3300031548 Bacteria 1460
394 Ga0265313_10040040 3300031595 Bacteria 2320
395 Ga0307508_10000095 3300031616 Bacteria 103944
396 Ga0307508_10107869 3300031616 Bacteria 2384
397 Ga0307514_10018106 3300031649 Bacteria 5786
398 Ga0316579_10029736 3300031691 Bacteria 2494
399 Ga0265314_10052926 3300031711 Bacteria 2819
400 Ga0265342_10061845 3300031712 Bacteria 2205
401 Ga0316576_10002490 3300031727 Bacteria 10488
402 Ga0316576_10018856 3300031727 Bacteria 4719
403 Ga0316576_10029254 3300031727 Bacteria 3892
404 Ga0316578_10008648 3300031728 Bacteria 5192
405 Ga0307516_10008029 3300031730 Bacteria 12008
406 Ga0307516_10122908 3300031730 Bacteria 2383
407 Ga0307405_10240444 3300031731 Bacteria 1341
408 Ga0316577_10037966 3300031733 Bacteria 2693
409 Ga0307413_10000248 3300031824 Bacteria 16228
410 Ga0307413_10007349 3300031824 Bacteria 5109
411 Ga0307410_10000654 3300031852 Bacteria 14294
412 Ga0307410_10036772 3300031852 Bacteria 3192
413 Ga0307410_10072912 3300031852 Bacteria 2386
414 Ga0307406_10015705 3300031901 Bacteria 4388
415 Ga0307406_10053901 3300031901 Bacteria 2564
416 Ga0307406_10150519 3300031901 Bacteria 1659
417 Ga0307407_10000164 3300031903 Bacteria 20509
418 Ga0307412_10165960 3300031911 Bacteria 1646
419 Ga0307409_100001551 3300031995 Bacteria 11405
420 Ga0307409_100016948 3300031995 Bacteria 4840
421 Ga0307409_100161046 3300031995 Bacteria 1962
422 Ga0307409_100328082 3300031995 Bacteria 1435
423 Ga0307416_100036062 3300032002 Bacteria 3787
424 Ga0307416_100039541 3300032002 Bacteria 3653
425 Ga0307416_100051682 3300032002 Bacteria 3285
426 Ga0307416_100192867 3300032002 Bacteria 1924
427 Ga0307414_10003245 3300032004 Bacteria 8662
428 Ga0307414_10299403 3300032004 Bacteria 1360
429 Ga0307411_10021291 3300032005 Bacteria 3790
430 Ga0307415_100100172 3300032126 Bacteria 2122
431 Ga0307510_10227630 3300033180 Bacteria 1370
432 Ga0373938_0030442 3300034957 Bacteria 1152
433 Ga0373928_0014121 3300035084 Bacteria 1611
434 Ga0373949_0023095 3300035090 Bacteria 1438
435 Ga0373939_0004331 3300035114 Bacteria 3352
436 Ga0373962_0002589 3300035242 Bacteria 4296
437 Ga0316574_0013787 3300035398 Bacteria 4655
438 Ga0316574_0016958 3300035398 Bacteria 4253
439 Ga0316574_0094733 3300035398 Bacteria 1907
440 Ga0373947_0127363 3300035725 Unclassified 1623
441 Ga0316582_0034085 3300036647 Bacteria 3133
442 Ga0316584_0168362 3300036712 Bacteria 1626
443 Ga0373925_0000098 3300037068 Bacteria 94011
444 Ga0373925_0279757 3300037068 Bacteria 1344
445 Ga0395899_0005205 3300037312 Bacteria 10117
446 Ga0395900_0005413 3300037418 Bacteria 13375
447 Ga0395900_0078043 3300037418 Bacteria 3403
448 Ga0395900_0109929 3300037418 Bacteria 2832
449 Ga0395900_0112583 3300037418 Bacteria 2794
450 Ga0395898_0003440 3300037466 Bacteria 17697
451 Ga0395898_0128350 3300037466 Bacteria 2429
452 Ga0395905_0015563 3300037471 Bacteria 7227
453 Ga0395905_0073922 3300037471 Bacteria 3195
454 Ga0436364_1050884 3300037853 Bacteria 2055
455 Ga0395901_0003919 3300038443 Bacteria 14972
456 Ga0395901_0016954 3300038443 Bacteria 7424
457 Ga0395901_0023959 3300038443 Bacteria 6262
458 Ga0395901_0114566 3300038443 Bacteria 2832
459 Ga0395901_0247406 3300038443 Bacteria 1858
460 Ga0400483_076985 3300039062 Bacteria 4585
461 Ga0400483_215983 3300039062 Bacteria 44583
462 Ga0436365_0681063 3300039437 Bacteria 33078
463 Ga0436365_1655282 3300039437 Bacteria 1338
464 Ga0451791_0903131 3300041451 Bacteria 2854
465 Ga0451791_1281809 3300041451 Bacteria 1728
466 Ga0451793_0187550 3300041452 Bacteria 2596
467 Ga0451793_1426489 3300041452 Bacteria 2159
468 Ga0451839_0463024 3300041496 Bacteria 1475
469 Ga0451841_0327528 3300041498 Bacteria 1675
470 Ga0451843_0083459 3300041509 Bacteria 2074
471 Ga0451853_1726224 3300041512 Bacteria 4112
472 Ga0439449_0066171 3300042007 Bacteria 1333
473 Ga0439463_001486 3300042016 Bacteria 6193
474 Ga0450914_001537 3300042118 Bacteria 1472
475 Ga0439435_0009784 3300042436 Bacteria 2258
476 Ga0439459_0002988 3300042438 Bacteria 2652
477 Ga0439464_0021944 3300042439 Bacteria 1755
478 Ga0439464_0047518 3300042439 Bacteria 1235
479 Ga0451577_0015881 3300042876 Bacteria 6984
480 Ga0439440_0012566 3300042993 Bacteria 1802
481 Ga0466969_0042390 3300044656 Bacteria 2273
482 Ga0466972_0081751 3300044658 Bacteria 1538
483 Ga0466965_0046094 3300044683 Bacteria 2157
484 Ga0466965_0173887 3300044683 Bacteria 1134
485 Ga0466966_0021447 3300044684 Bacteria 4242
486 Ga0466966_0030407 3300044684 Bacteria 3507
487 Ga0466966_0059515 3300044684 Bacteria 2412
488 Ga0466961_0014589 3300044693 Bacteria 5048
489 Ga0466961_0018181 3300044693 Bacteria 4519
490 Ga0466961_0060019 3300044693 Bacteria 2418
491 Ga0466961_0095519 3300044693 Bacteria 1874
492 Ga0466961_0113988 3300044693 Bacteria 1699
493 Ga0466961_0163337 3300044693 Bacteria 1388
494 Ga0466963_0008210 3300044694 Bacteria 6256
495 Ga0466963_0014074 3300044694 Bacteria 4928
496 Ga0466963_0038573 3300044694 Bacteria 3125
497 Ga0466963_0118935 3300044694 Bacteria 1817
498 Ga0466963_0208443 3300044694 Bacteria 1367
499 Ga0466964_0001285 3300044706 Bacteria 8567
500 Ga0453684_0015821 3300044712 Bacteria 11862
501 Ga0466971_0004116 3300044719 Bacteria 6261
502 Ga0466971_0023279 3300044719 Bacteria 2760
503 Ga0466957_0001021 3300044842 Bacteria 14441
504 Ga0466957_0057846 3300044842 Bacteria 2374
505 Ga0466957_0146900 3300044842 Bacteria 1522
506 Ga0466960_0000045 3300044901 Bacteria 40693
507 Ga0466960_0011211 3300044901 Bacteria 3742
508 Ga0466959_0001609 3300045049 Bacteria 13911
509 Ga0466959_0010490 3300045049 Bacteria 6626
510 Ga0466959_0058764 3300045049 Bacteria 2801
511 Ga0466959_0066849 3300045049 Bacteria 2607
512 Ga0466959_0070910 3300045049 Bacteria 2524
513 Ga0466958_0006072 3300045836 Bacteria 6548
514 Ga0466958_0006804 3300045836 Bacteria 6249
515 Ga0466958_0013868 3300045836 Bacteria 4595
516 Ga0466958_0025466 3300045836 Bacteria 3489
517 Ga0466967_0006548 3300045976 Bacteria 8261
518 Ga0466967_0017392 3300045976 Bacteria 5706
519 Ga0466967_0017602 3300045976 Bacteria 5681
520 Ga0466967_0112910 3300045976 Bacteria 2499
521 Ga0466967_0115371 3300045976 Bacteria 2473
522 Ga0466967_0143197 3300045976 Bacteria 2228
523 Ga0466967_0204392 3300045976 Bacteria 1871
524 Ga0466967_0318102 3300045976 Bacteria 1500
525 Ga0495603_0048879 3300046455 Bacteria 2518
526 Ga0495641_0006967 3300046461 Bacteria 7192
527 Ga0495641_0016086 3300046461 Bacteria 3954
528 Ga0495653_0019082 3300046463 Bacteria 5563
529 Ga0495650_0000331 3300046471 Bacteria 84807
530 Ga0495596_0058302 3300046500 Bacteria 1506
531 Ga0495606_0011511 3300046507 Bacteria 7208
532 Ga0495631_0042914 3300046518 Bacteria 1997
533 Ga0495648_0012243 3300046524 Bacteria 6409
534 Ga0495642_0027420 3300046528 Bacteria 2267
535 Ga0495621_0044804 3300046539 Bacteria 1565
536 Ga0495656_0070133 3300046615 Bacteria 1554
537 Ga0495668_0002329 3300046616 Bacteria 15819
538 Ga0495661_0101635 3300046665 Bacteria 1617
539 Ga0495672_0005993 3300047320 Bacteria 9522
540 Ga0495676_0040163 3300047321 Bacteria 3865
541 Ga0495683_0080074 3300047323 Bacteria 1595
542 Ga0495681_0079489 3300047470 Bacteria 1467
543 Ga0495686_0107764 3300047472 Bacteria 1674
544 Ga0495626_0000237 3300048091 Bacteria 63826
545 Ga0495626_0003948 3300048091 Bacteria 9273
546 Ga0496100_0008751 3300048903 Bacteria 5658
547 Ga0496100_0053581 3300048903 Bacteria 2627
548 Ga0496101_0002427 3300048904 Bacteria 11450
549 Ga0496101_0020991 3300048904 Bacteria 4482
550 Ga0496101_0110037 3300048904 Bacteria 2073
551 Ga0496102_0000059 3300048905 Bacteria 168633
552 Ga0496102_0000089 3300048905 Bacteria 128594
553 Ga0496102_0004742 3300048905 Bacteria 11512
554 Ga0496102_0025051 3300048905 Bacteria 5307
555 Ga0496102_0046024 3300048905 Bacteria 3962
556 Ga0496102_0091914 3300048905 Bacteria 2810
557 Ga0496102_0119850 3300048905 Bacteria 2457
558 Ga0496102_0275129 3300048905 Bacteria 1587
559 Ga0496103_0000063 3300048906 Bacteria 128503
560 Ga0496103_0000065 3300048906 Bacteria 128496
561 Ga0496103_0018471 3300048906 Bacteria 4182
562 Ga0496103_0127463 3300048906 Bacteria 1624
563 Ga0496103_0171703 3300048906 Bacteria 1392
564 Ga0496104_0047487 3300048907 Bacteria 4046
565 Ga0496104_0065948 3300048907 Bacteria 3437
566 Ga0496104_0148867 3300048907 Bacteria 2247
567 Ga0496104_0180076 3300048907 Bacteria 2024
568 Ga0496104_0193989 3300048907 Bacteria 1943
569 Ga0496104_0208139 3300048907 Bacteria 1868
570 Ga0496104_0376413 3300048907 Bacteria 1332
571 Ga0496105_0006741 3300048908 Bacteria 8830
572 Ga0496105_0036330 3300048908 Bacteria 4058
573 Ga0496105_0105937 3300048908 Bacteria 2321
574 Ga0496105_0129634 3300048908 Bacteria 2080
575 Ga0496105_0176165 3300048908 Bacteria 1752
576 Ga0496107_0221371 3300048910 Bacteria 1408
577 Ga0496107_0240950 3300048910 Bacteria 1346
578 Ga0496107_0339772 3300048910 Bacteria 1117
579 Ga0496108_0000168 3300048911 Bacteria 61503
580 Ga0496108_0026484 3300048911 Bacteria 4782
581 Ga0496108_0035825 3300048911 Bacteria 4127
582 Ga0496108_0065104 3300048911 Bacteria 3072
583 Ga0496108_0079922 3300048911 Bacteria 2769
584 Ga0496108_0180445 3300048911 Bacteria 1828
585 Ga0496109_0004796 3300048912 Bacteria 11290
586 Ga0496109_0034074 3300048912 Bacteria 4583
587 Ga0496109_0038731 3300048912 Bacteria 4311
588 Ga0496109_0045518 3300048912 Bacteria 3983
589 Ga0496109_0052740 3300048912 Bacteria 3708
590 Ga0496109_0066056 3300048912 Bacteria 3311
591 Ga0496109_0259678 3300048912 Bacteria 1636
592 Ga0496110_0001456 3300048913 Bacteria 17158
593 Ga0496110_0011966 3300048913 Bacteria 7125
594 Ga0496110_0017590 3300048913 Bacteria 5978
595 Ga0496110_0032641 3300048913 Bacteria 4499
596 Ga0496110_0072706 3300048913 Bacteria 3052
597 Ga0496110_0175779 3300048913 Bacteria 1943
598 Ga0496110_0387049 3300048913 Bacteria 1274
599 Ga0496111_0020992 3300048914 Bacteria 4553
600 Ga0496111_0026821 3300048914 Bacteria 4070
601 Ga0496111_0053217 3300048914 Bacteria 2924
602 Ga0496111_0053760 3300048914 Bacteria 2910
603 Ga0496111_0108873 3300048914 Bacteria 2040
604 Ga0496111_0111123 3300048914 Bacteria 2019
605 Ga0496111_0124293 3300048914 Bacteria 1907
606 Ga0496111_0145873 3300048914 Bacteria 1755
607 Ga0496112_0009404 3300048915 Bacteria 8803
608 Ga0496112_0010002 3300048915 Bacteria 8584
609 Ga0496112_0012308 3300048915 Bacteria 7857
610 Ga0496112_0089752 3300048915 Bacteria 3042
611 Ga0496113_0041450 3300048916 Bacteria 3398
612 Ga0496113_0091785 3300048916 Bacteria 2341
613 Ga0496114_0006455 3300048917 Bacteria 9238
614 Ga0496114_0077415 3300048917 Bacteria 2804
615 Ga0496114_0192099 3300048917 Bacteria 1787
616 Ga0496115_0038565 3300048918 Bacteria 3791
617 Ga0496115_0108796 3300048918 Bacteria 2276
618 Ga0496115_0367262 3300048918 Bacteria 1172
619 Ga0496116_0000208 3300048919 Bacteria 111165
620 Ga0496116_0000371 3300048919 Bacteria 67456
621 Ga0496117_0000063 3300048920 Bacteria 254446
622 Ga0496117_0000191 3300048920 Bacteria 124489
623 Ga0496117_0003104 3300048920 Bacteria 19864
624 Ga0496117_0017074 3300048920 Bacteria 6078
625 Ga0496117_0062912 3300048920 Bacteria 2540
626 Ga0496117_0068764 3300048920 Bacteria 2389
627 Ga0496117_0077169 3300048920 Bacteria 2206
628 Ga0496118_0000220 3300048921 Bacteria 99877
629 Ga0496118_0002375 3300048921 Bacteria 25435
630 Ga0496118_0003721 3300048921 Bacteria 18881
631 Ga0496118_0008903 3300048921 Bacteria 10255
632 Ga0496118_0017172 3300048921 Bacteria 6602
633 Ga0496119_0000634 3300048922 Bacteria 47422
634 Ga0496119_0000892 3300048922 Bacteria 39075
635 Ga0496119_0002091 3300048922 Bacteria 22550
636 Ga0496119_0004156 3300048922 Bacteria 14556
637 Ga0496119_0009813 3300048922 Bacteria 8143
638 Ga0496119_0025979 3300048922 Bacteria 4075
639 Ga0496119_0076583 3300048922 Bacteria 1940
640 Ga0496120_0001936 3300048923 Bacteria 22752
641 Ga0496120_0002612 3300048923 Bacteria 17853
642 Ga0496120_0003042 3300048923 Bacteria 15828
643 Ga0496120_0006445 3300048923 Bacteria 9014
644 Ga0496120_0023873 3300048923 Bacteria 3821
645 Ga0496121_0029106 3300048924 Bacteria 5120
646 Ga0496121_0073884 3300048924 Bacteria 2730
647 Ga0496121_0133316 3300048924 Bacteria 1855
648 Ga0496122_0000022 3300048925 Bacteria 388704
649 Ga0496122_0002058 3300048925 Bacteria 29852
650 Ga0496122_0005683 3300048925 Bacteria 14724
651 Ga0496122_0052756 3300048925 Bacteria 3074
652 Ga0496123_0000016 3300048926 Bacteria 424330
653 Ga0496123_0002798 3300048926 Bacteria 20726
654 Ga0496123_0014505 3300048926 Bacteria 6526
655 Ga0496123_0018712 3300048926 Bacteria 5490
656 Ga0496123_0047642 3300048926 Bacteria 2893
657 Ga0496124_0000389 3300048927 Bacteria 80434
658 Ga0496124_0011542 3300048927 Bacteria 8816
659 Ga0496125_0036635 3300048928 Bacteria 4278
660 Ga0496126_0001114 3300048929 Bacteria 45010
661 Ga0496126_0002220 3300048929 Bacteria 26882
662 Ga0496126_0004214 3300048929 Bacteria 17327
663 Ga0496126_0013693 3300048929 Bacteria 8233
664 Ga0496126_0020829 3300048929 Bacteria 6418
665 Ga0496126_0038376 3300048929 Bacteria 4458
666 Ga0496126_0118116 3300048929 Bacteria 2303
667 Ga0496126_0142716 3300048929 Bacteria 2060
668 Ga0501031_0005570 3300049568 Bacteria 8204
669 Ga0501031_0111414 3300049568 Bacteria 1787
670 Ga0501032_0002340 3300049569 Bacteria 14860
671 Ga0501032_0048933 3300049569 Bacteria 2853
672 Ga0501033_0004025 3300049570 Bacteria 11879
673 Ga0501033_0016214 3300049570 Bacteria 5642
674 Ga0501033_0037419 3300049570 Bacteria 3632
675 Ga0501034_0002740 3300049571 Bacteria 20737
676 Ga0501034_0003858 3300049571 Bacteria 16893
677 Ga0501034_0005401 3300049571 Bacteria 13969
678 Ga0501034_0005853 3300049571 Bacteria 13375
679 Ga0501034_0014985 3300049571 Bacteria 7974
680 Ga0501034_0019391 3300049571 Bacteria 6956
681 Ga0501034_0037337 3300049571 Bacteria 4918
682 Ga0501034_0042962 3300049571 Bacteria 4575
683 Ga0501034_0065347 3300049571 Bacteria 3650
684 Ga0501034_0135740 3300049571 Bacteria 2441
685 Ga0501036_0011560 3300049572 Bacteria 7315
686 Ga0501036_0033494 3300049572 Bacteria 4345
687 Ga0501036_0041367 3300049572 Bacteria 3900
688 Ga0501036_0100163 3300049572 Bacteria 2451
689 Ga0501037_0001389 3300049573 Bacteria 17759
690 Ga0501037_0002506 3300049573 Bacteria 13259
691 Ga0501037_0010590 3300049573 Bacteria 6773
692 Ga0501038_0004227 3300049574 Bacteria 13342
693 Ga0501038_0013077 3300049574 Bacteria 7570
694 Ga0501038_0077158 3300049574 Bacteria 2813
695 Ga0501039_0038238 3300049575 Bacteria 3707
696 Ga0501039_0069298 3300049575 Bacteria 2739
697 Ga0501039_0303894 3300049575 Bacteria 1254
698 Ga0501041_0074422 3300049577 Bacteria 2087
699 Ga0501042_0015678 3300049578 Bacteria 5191
700 Ga0501042_0023790 3300049578 Bacteria 4290
701 Ga0501042_0066077 3300049578 Bacteria 2585
702 Ga0501043_0004169 3300049579 Bacteria 11812
703 Ga0501043_0006552 3300049579 Bacteria 9339
704 Ga0501046_0023618 3300049580 Bacteria 5053
705 Ga0501046_0116026 3300049580 Bacteria 2041
706 Ga0501046_0137659 3300049580 Bacteria 1849
707 Ga0501047_0008684 3300049581 Bacteria 9595
708 Ga0501047_0024485 3300049581 Bacteria 5792
709 Ga0501047_0049297 3300049581 Bacteria 4066
710 Ga0501047_0105410 3300049581 Bacteria 2699
711 Ga0501048_0002684 3300049582 Bacteria 13587
712 Ga0501048_0037788 3300049582 Bacteria 3467
713 Ga0501048_0040076 3300049582 Bacteria 3357
714 Ga0501048_0062565 3300049582 Bacteria 2634
715 Ga0501067_0004631 3300049583 Bacteria 7618
716 Ga0501068_0001815 3300049584 Bacteria 11335
717 Ga0501068_0011051 3300049584 Bacteria 5082
718 Ga0501069_0001225 3300049585 Bacteria 12530
719 Ga0501069_0013761 3300049585 Bacteria 4316
720 Ga0501070_0004078 3300049586 Bacteria 12554
721 Ga0501070_0017082 3300049586 Bacteria 6090
722 Ga0501070_0033286 3300049586 Bacteria 4312
723 Ga0501070_0055192 3300049586 Bacteria 3293
724 Ga0501071_0001085 3300049587 Bacteria 15117
725 Ga0501071_0203204 3300049587 Bacteria 1489
726 Ga0501072_0390098 3300049588 Bacteria 1105
727 Ga0501073_0000965 3300049589 Bacteria 20696
728 Ga0501073_0019249 3300049589 Bacteria 4931
729 Ga0501073_0078868 3300049589 Bacteria 2292
730 Ga0501073_0114028 3300049589 Bacteria 1874
731 Ga0501075_0011325 3300049591 Bacteria 6309
732 Ga0501075_0082245 3300049591 Bacteria 2439
733 Ga0501076_0145365 3300049592 Bacteria 1928
734 Ga0501077_0049286 3300049593 Bacteria 2677
735 Ga0501077_0087901 3300049593 Bacteria 1969
736 Ga0501079_0116525 3300049741 Bacteria 2076
737 Ga0501080_0003844 3300049742 Bacteria 13266
738 Ga0501080_0454891 3300049742 Bacteria 1147
739 Ga0501083_0001426 3300049744 Bacteria 16299
740 Ga0501083_0001558 3300049744 Bacteria 15668
741 Ga0501035_0006226 3300049822 Bacteria 11221
742 Ga0501035_0011783 3300049822 Bacteria 8095
743 Ga0501035_0088794 3300049822 Bacteria 2723
744 Ga0501035_0198355 3300049822 Bacteria 1722
745 Ga0501044_0009726 3300049823 Bacteria 10460
746 Ga0501044_0051779 3300049823 Bacteria 4232
747 Ga0501044_0067538 3300049823 Bacteria 3643
748 Ga0501044_0093354 3300049823 Bacteria 3034
749 Ga0501044_0099382 3300049823 Bacteria 2928
750 Ga0501045_0058965 3300049824 Bacteria 2812
751 Ga0501045_0076112 3300049824 Bacteria 2472
752 Ga0501045_0185045 3300049824 Bacteria 1552
753 nmdc:mga03683_18115_c1 3300050489 Bacteria 2674
754 nmdc:mga00v17_454_c1 3300050491 Bacteria 17369
755 nmdc:mga00v17_62819_c1 3300050491 Bacteria 2286
756 nmdc:mga0yw44_93344_c1 3300050492 Bacteria 1906
757 nmdc:mga07m45_132319_c1 3300050496 Bacteria 1443
758 nmdc:mga05p37_106223_c1 3300050507 Bacteria 3454
759 nmdc:mga05p37_17610_c1 3300050507 Bacteria 8623
760 nmdc:mga05p37_188224_c1 3300050507 Bacteria 2508
761 nmdc:mga05p37_23533_c1 3300050507 Bacteria 7475
762 nmdc:mga05p37_27589_c1 3300050507 Bacteria 6915
763 nmdc:mga05p37_5655_c1 3300050507 Bacteria 14699
764 nmdc:mga05p37_84862_c1 3300050507 Bacteria 3902
765 nmdc:mga05p37_982_c1 3300050507 Bacteria 32429
766 nmdc:mga09592_1616_c1 3300050508 Bacteria 18153
767 nmdc:mga09592_33717_c1 3300050508 Bacteria 4276
768 nmdc:mga09592_4451_c1 3300050508 Bacteria 11338
769 nmdc:mga09592_47131_c1 3300050508 Bacteria 3632
770 nmdc:mga09592_66051_c1 3300050508 Bacteria 3065
771 nmdc:mga09592_79847_c1 3300050508 Bacteria 2786
772 nmdc:mga09592_89_c1 3300050508 Bacteria 54416
773 nmdc:mga0qj67_2866_c1 3300050509 Bacteria 12373
774 nmdc:mga0qj67_54800_c1 3300050509 Bacteria 3158
775 nmdc:mga0qj67_56630_c1 3300050509 Bacteria 3107
776 nmdc:mga0qj67_8_c5 3300050509 Bacteria 62463
777 nmdc:mga06r32_126_c1 3300050510 Bacteria 55377
778 nmdc:mga06r32_150029_c1 3300050510 Bacteria 2309
779 nmdc:mga06r32_15281_c1 3300050510 Bacteria 6974
780 nmdc:mga06r32_28087_c1 3300050510 Bacteria 5262
781 nmdc:mga08y16_109606_c1 3300050511 Bacteria 2874
782 nmdc:mga08y16_11761_c1 3300050511 Bacteria 9194
783 nmdc:mga08y16_426445_c1 3300050511 Bacteria 1355
784 nmdc:mga0n895_109096_c1 3300050512 Bacteria 2783
785 nmdc:mga0n895_652006_c1 3300050512 Bacteria 1051
786 nmdc:mga0n895_7081_c1 3300050512 Bacteria 9585
787 nmdc:mga0n895_99242_c1 3300050512 Bacteria 2920
788 nmdc:mga0rr50_320459_c1 3300050513 Bacteria 1299
789 nmdc:mga0a205_45069_c1 3300050515 Bacteria 4253
790 nmdc:mga0sz30_136611_c1 3300050516 Bacteria 1082
791 Ga0495595_0061984 3300053084 Bacteria 1753
792 Ga0500643_000072 3300053087 Bacteria 112810
793 Ga0500644_0061301 3300053088 Bacteria 1326
794 Ga0500644_0064853 3300053088 Bacteria 1299
795 Ga0500650_0003218 3300053098 Bacteria 5618
796 Ga0500556_0000001 3300053104 Bacteria 1135060
797 Ga0500556_0001107 3300053104 Bacteria 13405
798 Ga0500652_056375 3300053131 Bacteria 1611
799 Ga0500559_0000043 3300053136 Bacteria 100617
800 Ga0500559_0003767 3300053136 Bacteria 7364
801 Ga0500559_0022047 3300053136 Bacteria 2701
802 Ga0500568_0000003 3300053139 Bacteria 863587
803 Ga0500568_0000071 3300053139 Bacteria 99625
804 Ga0500568_0000714 3300053139 Bacteria 23777
805 Ga0500573_0000001 3300053140 Bacteria 436394
806 Ga0500573_0017028 3300053140 Bacteria 4134
807 Ga0500616_0000058 3300053153 Bacteria 266276
808 Ga0500616_0000885 3300053153 Bacteria 33029
809 Ga0500616_0000953 3300053153 Bacteria 31416
810 Ga0500616_0004063 3300053153 Bacteria 10644
811 Ga0500616_0005888 3300053153 Bacteria 8200
812 Ga0500616_0015772 3300053153 Bacteria 4313
813 Ga0500616_0017259 3300053153 Bacteria 4098
814 Ga0500645_004187 3300053730 Bacteria 5613
815 Ga0501084_0011719 3300054114 Bacteria 7257
816 Ga0501082_0174501 3300060353 Bacteria 1869
817 Ga0466962_0000651 3300061719 Bacteria 15399
818 Ga0466962_0068529 3300061719 Bacteria 1694
819 Ga0530510_0083078 3300061734 Bacteria 2332

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025911 Ga0207654_10265164 Ga0207654_102651641 283
2 3300009094 Ga0111539_10668257 Ga0111539_106682571 289
3 3300049574 Ga0501038_0013077 Ga0501038_0013077_1129_2013 293
4 3300049592 Ga0501076_0145365 Ga0501076_0145365_11_937 307
5 3300050513 nmdc:mga0rr50_320459_c1 nmdc:mga0rr50_320459_c1_137_1063 307
6 3300034957 Ga0373938_0030442 Ga0373938_0030442_209_1138 309
7 3300048913 Ga0496110_0387049 Ga0496110_0387049_20_985 316
8 3300050512 nmdc:mga0n895_652006_c1 nmdc:mga0n895_652006_c1_45_1010 318
9 3300047320 Ga0495672_0005993 Ga0495672_0005993_4433_5404 321
10 3300050516 nmdc:mga0sz30_136611_c1 nmdc:mga0sz30_136611_c1_92_1072 321
11 3300031824 Ga0307413_10000248 Ga0307413_100002484 322
12 3300047470 Ga0495681_0079489 Ga0495681_0079489_16_987 323
13 3300048918 Ga0496115_0367262 Ga0496115_0367262_22_1008 323
14 iso_pu_bacteria 2751185782 2753269179 326
15 iso_pu_bacteria 2915358134 2915360174 326
16 iso_pu_bacteria 2816332139 2816505238 327
17 iso_pu_bacteria 2863067949 2863073713 327
18 iso_pu_bacteria 2866552031 2866554026 327
19 iso_pu_bacteria 8056207758 8056214244 327
20 iso_pu_bacteria 2579778521 2579856985 328
21 iso_pu_bacteria 2619618881 2619858602 328
22 iso_pu_bacteria 2619619003 2620352826 328
23 iso_pu_bacteria 2675903059 2676484362 328
24 iso_pu_bacteria 2887478801 2887483452 328
25 iso_pu_bacteria 2966598605 2966599889 328
26 iso_pu_bacteria 8001781756 8001782723 328
27 3300005841 Ga0068863_100008129 Ga0068863_1000081295 329
28 3300005937 Ga0081455_10083784 Ga0081455_100837842 329
29 3300014968 Ga0157379_10006923 Ga0157379_1000692310 329
30 3300025904 Ga0207647_10004472 Ga0207647_1000447212 329
31 3300026088 Ga0207641_10004202 Ga0207641_100042026 329
32 3300026116 Ga0207674_10192127 Ga0207674_101921272 329
33 3300048903 Ga0496100_0008751 Ga0496100_0008751_2660_3655 329
34 3300048904 Ga0496101_0002427 Ga0496101_0002427_562_1557 329
35 3300048905 Ga0496102_0000089 Ga0496102_0000089_80663_81658 329
36 3300048906 Ga0496103_0000065 Ga0496103_0000065_46970_47965 329
37 3300048907 Ga0496104_0193989 Ga0496104_0193989_660_1655 329
38 3300048910 Ga0496107_0221371 Ga0496107_0221371_388_1383 329
39 3300048911 Ga0496108_0065104 Ga0496108_0065104_1813_2808 329
40 3300048913 Ga0496110_0072706 Ga0496110_0072706_979_1974 329
41 3300048914 Ga0496111_0124293 Ga0496111_0124293_753_1748 329
42 3300048919 Ga0496116_0000208 Ga0496116_0000208_80628_81623 329
43 3300048920 Ga0496117_0000191 Ga0496117_0000191_80594_81589 329
44 3300048921 Ga0496118_0000220 Ga0496118_0000220_80672_81667 329
45 3300048922 Ga0496119_0000634 Ga0496119_0000634_42932_43927 329
46 3300048923 Ga0496120_0003042 Ga0496120_0003042_12245_13240 329
47 3300048929 Ga0496126_0001114 Ga0496126_0001114_18229_19224 329
48 3300050509 nmdc:mga0qj67_56630_c1 nmdc:mga0qj67_56630_c1_827_1831 329
49 iso_pu_bacteria 2887478801 2887486423 329
50 iso_pu_bacteria 8001781756 8001782589 329
51 3300005336 Ga0070680_100237299 Ga0070680_1002372992 330
52 3300005548 Ga0070665_100007578 Ga0070665_1000075783 330
53 3300005841 Ga0068863_100055915 Ga0068863_1000559154 330
54 3300006844 Ga0075428_100000474 Ga0075428_1000004744 330
55 3300006844 Ga0075428_100022805 Ga0075428_1000228053 330
56 3300006846 Ga0075430_100002201 Ga0075430_1000022012 330
57 3300006846 Ga0075430_100021522 Ga0075430_1000215222 330
58 3300006847 Ga0075431_100001764 Ga0075431_10000176411 330
59 3300006847 Ga0075431_100012785 Ga0075431_1000127857 330
60 3300006847 Ga0075431_100085475 Ga0075431_1000854752 330
61 3300006880 Ga0075429_100001303 Ga0075429_10000130311 330
62 3300006880 Ga0075429_100007859 Ga0075429_1000078598 330
63 3300009147 Ga0114129_10000048 Ga0114129_100000485 330
64 3300009147 Ga0114129_10000128 Ga0114129_1000012828 330
65 3300009147 Ga0114129_10001574 Ga0114129_100015742 330
66 3300026088 Ga0207641_10048886 Ga0207641_100488864 330
67 3300028379 Ga0268266_10023513 Ga0268266_100235132 330
68 3300028794 Ga0307515_10000315 Ga0307515_1000031582 330
69 3300031456 Ga0307513_10089507 Ga0307513_100895073 330
70 3300031548 Ga0307408_100250692 Ga0307408_1002506922 330
71 3300031616 Ga0307508_10107869 Ga0307508_101078692 330
72 3300031730 Ga0307516_10122908 Ga0307516_101229083 330
73 3300031852 Ga0307410_10036772 Ga0307410_100367722 330
74 3300032002 Ga0307416_100039541 Ga0307416_1000395412 330
75 3300033180 Ga0307510_10227630 Ga0307510_102276302 330
76 3300035242 Ga0373962_0002589 Ga0373962_0002589_900_1895 330
77 3300039062 Ga0400483_215983 Ga0400483_215983_10202_11200 330
78 3300041512 Ga0451853_1726224 Ga0451853_1726224_452_1447 330
79 3300050507 nmdc:mga05p37_27589_c1 nmdc:mga05p37_27589_c1_1694_2689 330
80 3300050507 nmdc:mga05p37_5655_c1 nmdc:mga05p37_5655_c1_11588_12583 330
81 3300050507 nmdc:mga05p37_982_c1 nmdc:mga05p37_982_c1_10962_11957 330
82 3300050508 nmdc:mga09592_79847_c1 nmdc:mga09592_79847_c1_1186_2181 330
83 3300050508 nmdc:mga09592_89_c1 nmdc:mga09592_89_c1_32470_33465 330
84 3300050509 nmdc:mga0qj67_54800_c1 nmdc:mga0qj67_54800_c1_1186_2181 330
85 3300050509 nmdc:mga0qj67_8_c5 nmdc:mga0qj67_8_c5_28999_29994 330
86 3300050510 nmdc:mga06r32_126_c1 nmdc:mga06r32_126_c1_32470_33465 330
87 3300050510 nmdc:mga06r32_15281_c1 nmdc:mga06r32_15281_c1_1190_2185 330
88 3300053088 Ga0500644_0061301 Ga0500644_0061301_176_1171 330
89 3300003203 JGI25406J46586_10033705 JGI25406J46586_100337052 331
90 3300005337 Ga0070682_100078320 Ga0070682_1000783203 331
91 3300005548 Ga0070665_100102824 Ga0070665_1001028242 331
92 3300005618 Ga0068864_100265931 Ga0068864_1002659312 331
93 3300005841 Ga0068863_100220203 Ga0068863_1002202032 331
94 3300005985 Ga0081539_10000135 Ga0081539_1000013584 331
95 3300005985 Ga0081539_10004612 Ga0081539_1000461210 331
96 3300005985 Ga0081539_10072935 Ga0081539_100729352 331
97 3300006881 Ga0068865_100221036 Ga0068865_1002210362 331
98 3300009094 Ga0111539_10434264 Ga0111539_104342641 331
99 3300009979 Ga0105032_104382 Ga0105032_1043822 331
100 3300009988 Ga0105035_100234 Ga0105035_1002343 331
101 3300011119 Ga0105246_10066499 Ga0105246_100664992 331
102 3300013308 Ga0157375_10234003 Ga0157375_102340032 331
103 3300025901 Ga0207688_10135586 Ga0207688_101355862 331
104 3300025919 Ga0207657_10118487 Ga0207657_101184872 331
105 3300025932 Ga0207690_10094929 Ga0207690_100949292 331
106 3300025939 Ga0207665_10002648 Ga0207665_100026486 331
107 3300025981 Ga0207640_10194095 Ga0207640_101940951 331
108 3300028379 Ga0268266_10109028 Ga0268266_101090282 331
109 3300031730 Ga0307516_10008029 Ga0307516_100080296 331
110 3300039062 Ga0400483_076985 Ga0400483_076985_1274_2275 331
111 3300048091 Ga0495626_0003948 Ga0495626_0003948_57_1055 331
112 3300048911 Ga0496108_0000168 Ga0496108_0000168_41599_42597 331
113 3300048915 Ga0496112_0009404 Ga0496112_0009404_1527_2525 331
114 3300048915 Ga0496112_0010002 Ga0496112_0010002_497_1558 331
115 iso_pu_bacteria 2775506925 2776370903 331
116 iso_pu_bacteria 2799112218 2799183123 331
117 3300005467 Ga0070706_100100092 Ga0070706_1001000924 332
118 3300005467 Ga0070706_100233944 Ga0070706_1002339442 332
119 3300005471 Ga0070698_100001406 Ga0070698_1000014065 332
120 3300005518 Ga0070699_100078843 Ga0070699_1000788431 332
121 3300005535 Ga0070684_100008570 Ga0070684_1000085707 332
122 3300005564 Ga0070664_100146236 Ga0070664_1001462362 332
123 3300005577 Ga0068857_100031944 Ga0068857_1000319443 332
124 3300005843 Ga0068860_100078365 Ga0068860_1000783652 332
125 3300006871 Ga0075434_100360379 Ga0075434_1003603792 332
126 3300025910 Ga0207684_10423780 Ga0207684_104237801 332
127 3300025922 Ga0207646_10015271 Ga0207646_100152712 332
128 3300026078 Ga0207702_10128040 Ga0207702_101280403 332
129 3300028381 Ga0268264_10213519 Ga0268264_102135192 332
130 3300035725 Ga0373947_0127363 Ga0373947_0127363_213_1232 332
131 3300037418 Ga0395900_0109929 Ga0395900_0109929_1652_2659 332
132 3300038443 Ga0395901_0114566 Ga0395901_0114566_616_1623 332
133 3300048915 Ga0496112_0012308 Ga0496112_0012308_3400_4419 332
134 3300050512 nmdc:mga0n895_99242_c1 nmdc:mga0n895_99242_c1_441_1460 332
135 3300005468 Ga0070707_100289997 Ga0070707_1002899972 333
136 3300005614 Ga0068856_100009168 Ga0068856_1000091689 333
137 3300005614 Ga0068856_100033521 Ga0068856_1000335215 333
138 3300006847 Ga0075431_100365494 Ga0075431_1003654942 333
139 3300026078 Ga0207702_10026927 Ga0207702_100269272 333
140 3300046507 Ga0495606_0011511 Ga0495606_0011511_5894_6898 333
141 3300046616 Ga0495668_0002329 Ga0495668_0002329_961_1965 333
142 3300047323 Ga0495683_0080074 Ga0495683_0080074_241_1245 333
143 3300048091 Ga0495626_0000237 Ga0495626_0000237_805_1809 333
144 3300048915 Ga0496112_0089752 Ga0496112_0089752_675_1697 333
145 3300048922 Ga0496119_0025979 Ga0496119_0025979_3013_4047 333
146 3300050492 nmdc:mga0yw44_93344_c1 nmdc:mga0yw44_93344_c1_680_1693 333
147 iso_pu_bacteria 2537561592 2537898680 333
148 iso_pu_bacteria 2551306166 2552112494 333
149 iso_pu_bacteria 2585428157 2588107916 333
150 iso_pu_bacteria 2626541554 2626638154 333
151 iso_pu_bacteria 2643221566 2643847735 333
152 iso_pu_bacteria 2643221572 2643876955 333
153 iso_pu_bacteria 2643221575 2643885863 333
154 iso_pu_bacteria 2643221649 2644278270 333
155 iso_pu_bacteria 2643221669 2644384010 333
156 iso_pu_bacteria 2643221690 2644506653 333
157 iso_pu_bacteria 2721755702 2723643765 333
158 iso_pu_bacteria 2728369276 2729906557 333
159 iso_pu_bacteria 2751185725 2753037653 333
160 iso_pu_bacteria 2751185792 2753325521 333
161 iso_pu_bacteria 2757320536 2758226633 333
162 iso_pu_bacteria 2773857758 2774381777 333
163 iso_pu_bacteria 2808606306 2808628821 333
164 iso_pu_bacteria 2808606372 2808900337 333
165 iso_pu_bacteria 2808606447 2809226202 333
166 iso_pu_bacteria 2811994872 2812324452 333
167 iso_pu_bacteria 2821268502 2821268945 333
168 iso_pu_bacteria 2844852863 2844856046 333
169 iso_pu_bacteria 2852643534 2852646032 333
170 iso_pu_bacteria 2857733635 2857733986 333
171 iso_pu_bacteria 2895660088 2895662265 333
172 iso_pu_bacteria 2904509784 2904511478 333
173 iso_pu_bacteria 2906799679 2906801594 333
174 iso_pu_bacteria 2908678064 2908679806 333
175 iso_pu_bacteria 2919069694 2919073042 333
176 iso_pu_bacteria 2935409751 2935413428 333
177 iso_pu_bacteria 2939660829 2939661578 333
178 iso_pu_bacteria 2966921586 2966922288 333
179 iso_pu_bacteria 2974294766 2974296854 333
180 iso_pu_bacteria 2974324384 2974326911 333
181 iso_pu_bacteria 2977228692 2977231930 333
182 iso_pu_bacteria 2977236895 2977237289 333
183 iso_pu_bacteria 2977264416 2977267249 333
184 iso_pu_bacteria 2984542743 2984544924 333
185 iso_pu_bacteria 8004025490 8004028521 333
186 iso_pu_bacteria 8016254467 8016257052 333
187 iso_pu_bacteria 8046352972 8046354328 333
188 iso_pu_bacteria 8054913762 8054920779 333
189 iso_pu_bacteria 8054920844 8054926252 333
190 iso_pu_bacteria 8056037122 8056039931 333
191 iso_pu_bacteria 8057345674 8057348156 333
192 3300005467 Ga0070706_100045762 Ga0070706_1000457622 334
193 3300005468 Ga0070707_100017861 Ga0070707_1000178614 334
194 3300005468 Ga0070707_100155044 Ga0070707_1001550442 334
195 3300005471 Ga0070698_100006165 Ga0070698_1000061654 334
196 3300005518 Ga0070699_100022651 Ga0070699_1000226514 334
197 3300005548 Ga0070665_100121113 Ga0070665_1001211133 334
198 3300006847 Ga0075431_100017699 Ga0075431_1000176994 334
199 3300006880 Ga0075429_100001981 Ga0075429_10000198115 334
200 3300009147 Ga0114129_10020234 Ga0114129_100202348 334
201 3300009147 Ga0114129_10722981 Ga0114129_107229812 334
202 3300025910 Ga0207684_10028199 Ga0207684_100281993 334
203 3300025910 Ga0207684_10088247 Ga0207684_100882473 334
204 3300025922 Ga0207646_10011964 Ga0207646_100119645 334
205 3300050507 nmdc:mga05p37_17610_c1 nmdc:mga05p37_17610_c1_6586_7599 334
206 3300050508 nmdc:mga09592_1616_c1 nmdc:mga09592_1616_c1_8822_9835 334
207 3300053088 Ga0500644_0064853 Ga0500644_0064853_18_1025 334
208 iso_pu_bacteria 2508501039 2508670337 334
209 iso_pu_bacteria 2517572101 2517762819 334
210 iso_pu_bacteria 2671180195 2671839537 334
211 iso_pu_bacteria 2675902999 2676202919 334
212 iso_pu_bacteria 2684623035 2686535157 334
213 iso_pu_bacteria 2687453737 2689958817 334
214 iso_pu_bacteria 2738543034 2739367075 334
215 iso_pu_bacteria 2773857763 2774400828 334
216 iso_pu_bacteria 2773857921 2774847495 334
217 iso_pu_bacteria 2773857922 2774857693 334
218 iso_pu_bacteria 2895880812 2895885231 334
219 iso_pu_bacteria 2904765812 2904770804 334
220 iso_pu_bacteria 2904770941 2904776279 334
221 iso_pu_bacteria 2908811453 2908812796 334
222 iso_pu_bacteria 2919420072 2919425141 334
223 iso_pu_bacteria 2919432681 2919437750 334
224 iso_pu_bacteria 8002775197 8002783113 334
225 iso_pu_bacteria 8002784119 8002791617 334
226 iso_pu_bacteria 8045830549 8045832125 334
227 3300005327 Ga0070658_10000516 Ga0070658_100005165 336
228 3300005563 Ga0068855_100106798 Ga0068855_1001067983 336
229 3300006880 Ga0075429_100151300 Ga0075429_1001513002 336
230 3300013104 Ga0157370_10050894 Ga0157370_100508943 336
231 3300025904 Ga0207647_10018243 Ga0207647_100182432 336
232 3300025909 Ga0207705_10000001 Ga0207705_100000011708 336
233 3300026067 Ga0207678_10011578 Ga0207678_100115788 336
234 3300031731 Ga0307405_10240444 Ga0307405_102404442 336
235 3300048908 Ga0496105_0129634 Ga0496105_0129634_441_1457 336
236 3300048908 Ga0496105_0176165 Ga0496105_0176165_359_1375 336
237 3300048917 Ga0496114_0192099 Ga0496114_0192099_13_1029 336
238 3300053139 Ga0500568_0000071 Ga0500568_0000071_94130_95146 336
239 iso_pu_bacteria 2852632344 2852632460 336
240 3300005288 Ga0065714_10065905 Ga0065714_100659055 337
241 3300005327 Ga0070658_10018666 Ga0070658_100186663 337
242 3300005336 Ga0070680_100367309 Ga0070680_1003673091 337
243 3300005366 Ga0070659_100058228 Ga0070659_1000582283 337
244 3300005548 Ga0070665_100091726 Ga0070665_1000917261 337
245 3300005563 Ga0068855_100271021 Ga0068855_1002710212 337
246 3300005616 Ga0068852_100033719 Ga0068852_1000337195 337
247 3300005616 Ga0068852_100282047 Ga0068852_1002820471 337
248 3300005617 Ga0068859_100007129 Ga0068859_1000071296 337
249 3300005719 Ga0068861_100069499 Ga0068861_1000694993 337
250 3300005842 Ga0068858_100019804 Ga0068858_1000198043 337
251 3300005937 Ga0081455_10003346 Ga0081455_1000334610 337
252 3300005937 Ga0081455_10033413 Ga0081455_100334135 337
253 3300005937 Ga0081455_10141516 Ga0081455_101415162 337
254 3300006051 Ga0075364_10081214 Ga0075364_100812142 337
255 3300006847 Ga0075431_100520878 Ga0075431_1005208781 337
256 3300006852 Ga0075433_10302904 Ga0075433_103029042 337
257 3300006931 Ga0097620_100007129 Ga0097620_1000071293 337
258 3300009036 Ga0105244_10063886 Ga0105244_100638862 337
259 3300009036 Ga0105244_10073842 Ga0105244_100738422 337
260 3300009093 Ga0105240_10008219 Ga0105240_1000821913 337
261 3300009093 Ga0105240_10094668 Ga0105240_100946683 337
262 3300009148 Ga0105243_10008507 Ga0105243_100085071 337
263 3300009148 Ga0105243_10399345 Ga0105243_103993452 337
264 3300009551 Ga0105238_10470603 Ga0105238_104706032 337
265 3300009553 Ga0105249_10365682 Ga0105249_103656821 337
266 3300010375 Ga0105239_10054716 Ga0105239_100547162 337
267 3300010375 Ga0105239_10396797 Ga0105239_103967972 337
268 3300011119 Ga0105246_10031106 Ga0105246_100311063 337
269 3300013102 Ga0157371_10000794 Ga0157371_1000079433 337
270 3300013104 Ga0157370_10032665 Ga0157370_100326654 337
271 3300013105 Ga0157369_10006194 Ga0157369_1000619410 337
272 3300013105 Ga0157369_10239923 Ga0157369_102399232 337
273 3300013306 Ga0163162_10021945 Ga0163162_100219452 337
274 3300013306 Ga0163162_10257411 Ga0163162_102574112 337
275 3300013307 Ga0157372_10040927 Ga0157372_100409274 337
276 3300013308 Ga0157375_10322717 Ga0157375_103227172 337
277 3300025728 Ga0207655_1050447 Ga0207655_10504472 337
278 3300025898 Ga0207692_10009035 Ga0207692_100090353 337
279 3300025901 Ga0207688_10161509 Ga0207688_101615092 337
280 3300025911 Ga0207654_10191320 Ga0207654_101913202 337
281 3300025913 Ga0207695_10184877 Ga0207695_101848772 337
282 3300025921 Ga0207652_10084788 Ga0207652_100847882 337
283 3300025927 Ga0207687_10025387 Ga0207687_100253874 337
284 3300025949 Ga0207667_10072433 Ga0207667_100724334 337
285 3300025972 Ga0207668_10029077 Ga0207668_100290771 337
286 3300027907 Ga0207428_10199753 Ga0207428_101997532 337
287 3300028379 Ga0268266_10192776 Ga0268266_101927762 337
288 3300031548 Ga0307408_100214775 Ga0307408_1002147752 337
289 3300031616 Ga0307508_10000095 Ga0307508_1000009593 337
290 3300031649 Ga0307514_10018106 Ga0307514_100181062 337
291 3300031824 Ga0307413_10007349 Ga0307413_100073491 337
292 3300031852 Ga0307410_10000654 Ga0307410_100006546 337
293 3300031852 Ga0307410_10072912 Ga0307410_100729122 337
294 3300031901 Ga0307406_10015705 Ga0307406_100157053 337
295 3300031901 Ga0307406_10053901 Ga0307406_100539012 337
296 3300031901 Ga0307406_10150519 Ga0307406_101505192 337
297 3300031903 Ga0307407_10000164 Ga0307407_1000016424 337
298 3300031911 Ga0307412_10165960 Ga0307412_101659602 337
299 3300031995 Ga0307409_100001551 Ga0307409_10000155110 337
300 3300031995 Ga0307409_100016948 Ga0307409_1000169484 337
301 3300031995 Ga0307409_100161046 Ga0307409_1001610462 337
302 3300031995 Ga0307409_100328082 Ga0307409_1003280822 337
303 3300032002 Ga0307416_100036062 Ga0307416_1000360624 337
304 3300032004 Ga0307414_10003245 Ga0307414_100032456 337
305 3300032004 Ga0307414_10299403 Ga0307414_102994032 337
306 3300032005 Ga0307411_10021291 Ga0307411_100212913 337
307 3300032126 Ga0307415_100100172 Ga0307415_1001001722 337
308 3300035084 Ga0373928_0014121 Ga0373928_0014121_363_1379 337
309 3300038443 Ga0395901_0247406 Ga0395901_0247406_408_1436 337
310 3300041451 Ga0451791_0903131 Ga0451791_0903131_1235_2251 337
311 3300041452 Ga0451793_0187550 Ga0451793_0187550_392_1408 337
312 3300042007 Ga0439449_0066171 Ga0439449_0066171_98_1114 337
313 3300042993 Ga0439440_0012566 Ga0439440_0012566_589_1605 337
314 3300044683 Ga0466965_0173887 Ga0466965_0173887_34_1050 337
315 3300044684 Ga0466966_0030407 Ga0466966_0030407_1898_2926 337
316 3300044693 Ga0466961_0095519 Ga0466961_0095519_286_1314 337
317 3300045049 Ga0466959_0058764 Ga0466959_0058764_1361_2389 337
318 3300046463 Ga0495653_0019082 Ga0495653_0019082_4030_5058 337
319 3300047472 Ga0495686_0107764 Ga0495686_0107764_360_1376 337
320 3300048903 Ga0496100_0053581 Ga0496100_0053581_532_1548 337
321 3300048905 Ga0496102_0091914 Ga0496102_0091914_1317_2345 337
322 3300048906 Ga0496103_0018471 Ga0496103_0018471_2149_3177 337
323 3300048907 Ga0496104_0148867 Ga0496104_0148867_121_1137 337
324 3300048907 Ga0496104_0180076 Ga0496104_0180076_130_1146 337
325 3300048908 Ga0496105_0006741 Ga0496105_0006741_17_1033 337
326 3300048910 Ga0496107_0339772 Ga0496107_0339772_34_1050 337
327 3300048912 Ga0496109_0066056 Ga0496109_0066056_1817_2833 337
328 3300048912 Ga0496109_0259678 Ga0496109_0259678_414_1430 337
329 3300048913 Ga0496110_0175779 Ga0496110_0175779_242_1258 337
330 3300048916 Ga0496113_0091785 Ga0496113_0091785_202_1218 337
331 3300048918 Ga0496115_0038565 Ga0496115_0038565_1907_2923 337
332 3300048920 Ga0496117_0000063 Ga0496117_0000063_114845_115873 337
333 3300048920 Ga0496117_0003104 Ga0496117_0003104_3765_4781 337
334 3300048920 Ga0496117_0017074 Ga0496117_0017074_4818_5834 337
335 3300048920 Ga0496117_0062912 Ga0496117_0062912_659_1690 337
336 3300048921 Ga0496118_0008903 Ga0496118_0008903_449_1465 337
337 3300048922 Ga0496119_0002091 Ga0496119_0002091_3566_4594 337
338 3300048922 Ga0496119_0004156 Ga0496119_0004156_8238_9254 337
339 3300048922 Ga0496119_0009813 Ga0496119_0009813_3264_4292 337
340 3300048923 Ga0496120_0001936 Ga0496120_0001936_3797_4825 337
341 3300048923 Ga0496120_0006445 Ga0496120_0006445_2054_3070 337
342 3300048923 Ga0496120_0023873 Ga0496120_0023873_2610_3638 337
343 3300048924 Ga0496121_0029106 Ga0496121_0029106_787_1851 337
344 3300048924 Ga0496121_0133316 Ga0496121_0133316_367_1395 337
345 3300048925 Ga0496122_0000022 Ga0496122_0000022_296393_297409 337
346 3300048925 Ga0496122_0002058 Ga0496122_0002058_85_1101 337
347 3300048925 Ga0496122_0005683 Ga0496122_0005683_6080_7108 337
348 3300048925 Ga0496122_0052756 Ga0496122_0052756_563_1579 337
349 3300048926 Ga0496123_0000016 Ga0496123_0000016_331876_332892 337
350 3300048926 Ga0496123_0002798 Ga0496123_0002798_181_1209 337
351 3300048926 Ga0496123_0014505 Ga0496123_0014505_5003_6019 337
352 3300048926 Ga0496123_0018712 Ga0496123_0018712_1012_2028 337
353 3300048926 Ga0496123_0047642 Ga0496123_0047642_469_1485 337
354 3300048927 Ga0496124_0000389 Ga0496124_0000389_45628_46656 337
355 3300048927 Ga0496124_0011542 Ga0496124_0011542_1351_2367 337
356 3300048928 Ga0496125_0036635 Ga0496125_0036635_141_1169 337
357 3300048929 Ga0496126_0002220 Ga0496126_0002220_9444_10460 337
358 3300048929 Ga0496126_0004214 Ga0496126_0004214_1151_2179 337
359 3300048929 Ga0496126_0013693 Ga0496126_0013693_5759_6787 337
360 3300048929 Ga0496126_0020829 Ga0496126_0020829_4936_5952 337
361 3300048929 Ga0496126_0038376 Ga0496126_0038376_2408_3424 337
362 3300048929 Ga0496126_0118116 Ga0496126_0118116_1190_2206 337
363 3300048929 Ga0496126_0142716 Ga0496126_0142716_135_1154 337
364 3300049568 Ga0501031_0111414 Ga0501031_0111414_283_1314 337
365 3300049570 Ga0501033_0037419 Ga0501033_0037419_726_1742 337
366 3300049571 Ga0501034_0005401 Ga0501034_0005401_1651_2667 337
367 3300049571 Ga0501034_0019391 Ga0501034_0019391_146_1207 337
368 3300049571 Ga0501034_0037337 Ga0501034_0037337_951_2012 337
369 3300049572 Ga0501036_0033494 Ga0501036_0033494_2975_3991 337
370 3300049573 Ga0501037_0010590 Ga0501037_0010590_1441_2457 337
371 3300049575 Ga0501039_0038238 Ga0501039_0038238_1649_2665 337
372 3300049579 Ga0501043_0004169 Ga0501043_0004169_2752_3768 337
373 3300049580 Ga0501046_0116026 Ga0501046_0116026_420_1436 337
374 3300049581 Ga0501047_0049297 Ga0501047_0049297_889_1905 337
375 3300049582 Ga0501048_0037788 Ga0501048_0037788_1649_2665 337
376 3300049586 Ga0501070_0033286 Ga0501070_0033286_234_1295 337
377 3300049586 Ga0501070_0055192 Ga0501070_0055192_1308_2324 337
378 3300049587 Ga0501071_0001085 Ga0501071_0001085_731_1792 337
379 3300049589 Ga0501073_0114028 Ga0501073_0114028_701_1717 337
380 3300049822 Ga0501035_0198355 Ga0501035_0198355_421_1437 337
381 3300049823 Ga0501044_0051779 Ga0501044_0051779_1878_2894 337
382 3300049824 Ga0501045_0076112 Ga0501045_0076112_726_1742 337
383 3300053087 Ga0500643_000072 Ga0500643_000072_106425_107459 337
384 3300053098 Ga0500650_0003218 Ga0500650_0003218_3612_4628 337
385 3300053104 Ga0500556_0000001 Ga0500556_0000001_809087_810103 337
386 3300053131 Ga0500652_056375 Ga0500652_056375_71_1099 337
387 3300053136 Ga0500559_0000043 Ga0500559_0000043_62235_63263 337
388 3300053136 Ga0500559_0003767 Ga0500559_0003767_2614_3630 337
389 3300053136 Ga0500559_0022047 Ga0500559_0022047_1022_2038 337
390 3300053139 Ga0500568_0000003 Ga0500568_0000003_813827_814843 337
391 3300053139 Ga0500568_0000714 Ga0500568_0000714_236_1264 337
392 3300053140 Ga0500573_0000001 Ga0500573_0000001_278625_279653 337
393 3300053140 Ga0500573_0017028 Ga0500573_0017028_1461_2477 337
394 3300053153 Ga0500616_0000058 Ga0500616_0000058_25037_26053 337
395 3300053153 Ga0500616_0005888 Ga0500616_0005888_3420_4436 337
396 3300053730 Ga0500645_004187 Ga0500645_004187_320_1348 337
397 3300060353 Ga0501082_0174501 Ga0501082_0174501_354_1370 337
398 iso_pu_bacteria 2870622029 2870624287 337
399 3300001976 JGI24752J21851_1001068 JGI24752J21851_10010681 338
400 3300001976 JGI24752J21851_1002035 JGI24752J21851_10020353 338
401 3300001976 JGI24752J21851_1002296 JGI24752J21851_10022962 338
402 3300002459 JGI24751J29686_10000424 JGI24751J29686_1000042412 338
403 3300002459 JGI24751J29686_10003910 JGI24751J29686_100039103 338
404 3300003203 JGI25406J46586_10001099 JGI25406J46586_100010994 338
405 3300003911 JGI25405J52794_10007179 JGI25405J52794_100071791 338
406 3300005327 Ga0070658_10036380 Ga0070658_100363802 338
407 3300005330 Ga0070690_100129436 Ga0070690_1001294362 338
408 3300005331 Ga0070670_100054425 Ga0070670_1000544254 338
409 3300005334 Ga0068869_100005134 Ga0068869_1000051347 338
410 3300005334 Ga0068869_100163759 Ga0068869_1001637592 338
411 3300005336 Ga0070680_100012976 Ga0070680_1000129762 338
412 3300005337 Ga0070682_100007230 Ga0070682_1000072306 338
413 3300005345 Ga0070692_10002768 Ga0070692_100027682 338
414 3300005354 Ga0070675_100017195 Ga0070675_1000171954 338
415 3300005354 Ga0070675_100025157 Ga0070675_1000251573 338
416 3300005355 Ga0070671_100005657 Ga0070671_1000056576 338
417 3300005365 Ga0070688_100046743 Ga0070688_1000467433 338
418 3300005366 Ga0070659_100012289 Ga0070659_1000122892 338
419 3300005366 Ga0070659_100282133 Ga0070659_1002821332 338
420 3300005406 Ga0070703_10011057 Ga0070703_100110572 338
421 3300005434 Ga0070709_10007107 Ga0070709_100071073 338
422 3300005434 Ga0070709_10150960 Ga0070709_101509602 338
423 3300005435 Ga0070714_100041568 Ga0070714_1000415684 338
424 3300005435 Ga0070714_100084338 Ga0070714_1000843383 338
425 3300005435 Ga0070714_100100492 Ga0070714_1001004922 338
426 3300005436 Ga0070713_100075079 Ga0070713_1000750793 338
427 3300005438 Ga0070701_10099806 Ga0070701_100998062 338
428 3300005438 Ga0070701_10167902 Ga0070701_101679021 338
429 3300005441 Ga0070700_100009088 Ga0070700_1000090885 338
430 3300005455 Ga0070663_100015507 Ga0070663_1000155071 338
431 3300005458 Ga0070681_10018792 Ga0070681_100187928 338
432 3300005466 Ga0070685_10150575 Ga0070685_101505751 338
433 3300005466 Ga0070685_10191337 Ga0070685_101913371 338
434 3300005471 Ga0070698_100051129 Ga0070698_1000511292 338
435 3300005530 Ga0070679_100051719 Ga0070679_1000517194 338
436 3300005535 Ga0070684_100001918 Ga0070684_10000191811 338
437 3300005539 Ga0068853_100064029 Ga0068853_1000640293 338
438 3300005544 Ga0070686_100070590 Ga0070686_1000705901 338
439 3300005547 Ga0070693_100000347 Ga0070693_10000034716 338
440 3300005548 Ga0070665_100000791 Ga0070665_10000079117 338
441 3300005548 Ga0070665_100011326 Ga0070665_1000113263 338
442 3300005549 Ga0070704_100001943 Ga0070704_1000019433 338
443 3300005563 Ga0068855_100019945 Ga0068855_1000199456 338
444 3300005563 Ga0068855_100097904 Ga0068855_1000979043 338
445 3300005563 Ga0068855_100179482 Ga0068855_1001794822 338
446 3300005563 Ga0068855_100315157 Ga0068855_1003151572 338
447 3300005564 Ga0070664_100008359 Ga0070664_1000083598 338
448 3300005577 Ga0068857_100142844 Ga0068857_1001428442 338
449 3300005578 Ga0068854_100073625 Ga0068854_1000736252 338
450 3300005614 Ga0068856_100118962 Ga0068856_1001189623 338
451 3300005614 Ga0068856_100149510 Ga0068856_1001495101 338
452 3300005615 Ga0070702_100002009 Ga0070702_1000020097 338
453 3300005615 Ga0070702_100192261 Ga0070702_1001922612 338
454 3300005616 Ga0068852_100344019 Ga0068852_1003440192 338
455 3300005617 Ga0068859_100002957 Ga0068859_10000295711 338
456 3300005617 Ga0068859_100041923 Ga0068859_1000419234 338
457 3300005618 Ga0068864_100008495 Ga0068864_1000084953 338
458 3300005719 Ga0068861_100007184 Ga0068861_1000071846 338
459 3300005719 Ga0068861_100023686 Ga0068861_1000236863 338
460 3300005719 Ga0068861_100151077 Ga0068861_1001510772 338
461 3300005719 Ga0068861_100193103 Ga0068861_1001931032 338
462 3300005840 Ga0068870_10000390 Ga0068870_100003909 338
463 3300005840 Ga0068870_10001611 Ga0068870_100016116 338
464 3300005841 Ga0068863_100000274 Ga0068863_10000027433 338
465 3300005841 Ga0068863_100003122 Ga0068863_1000031222 338
466 3300005841 Ga0068863_100013760 Ga0068863_1000137604 338
467 3300005841 Ga0068863_100208619 Ga0068863_1002086192 338
468 3300005842 Ga0068858_100136130 Ga0068858_1001361302 338
469 3300005843 Ga0068860_100035775 Ga0068860_1000357752 338
470 3300005843 Ga0068860_100054272 Ga0068860_1000542722 338
471 3300005843 Ga0068860_100113550 Ga0068860_1001135503 338
472 3300005843 Ga0068860_100217048 Ga0068860_1002170482 338
473 3300005844 Ga0068862_100000237 Ga0068862_10000023740 338
474 3300005937 Ga0081455_10001004 Ga0081455_1000100417 338
475 3300005937 Ga0081455_10014805 Ga0081455_100148054 338
476 3300005981 Ga0081538_10000359 Ga0081538_1000035926 338
477 3300005985 Ga0081539_10000352 Ga0081539_100003525 338
478 3300005985 Ga0081539_10003711 Ga0081539_1000371120 338
479 3300005985 Ga0081539_10022554 Ga0081539_100225542 338
480 3300006038 Ga0075365_10000350 Ga0075365_100003503 338
481 3300006038 Ga0075365_10095649 Ga0075365_100956492 338
482 3300006042 Ga0075368_10027906 Ga0075368_100279062 338
483 3300006051 Ga0075364_10003412 Ga0075364_100034123 338
484 3300006051 Ga0075364_10038095 Ga0075364_100380953 338
485 3300006051 Ga0075364_10093575 Ga0075364_100935752 338
486 3300006058 Ga0075432_10007868 Ga0075432_100078683 338
487 3300006173 Ga0070716_100039526 Ga0070716_1000395262 338
488 3300006177 Ga0075362_10020696 Ga0075362_100206962 338
489 3300006178 Ga0075367_10189460 Ga0075367_101894602 338
490 3300006237 Ga0097621_100011172 Ga0097621_1000111727 338
491 3300006358 Ga0068871_100042170 Ga0068871_1000421702 338
492 3300006844 Ga0075428_100191729 Ga0075428_1001917292 338
493 3300006844 Ga0075428_100281049 Ga0075428_1002810492 338
494 3300006844 Ga0075428_100289571 Ga0075428_1002895712 338
495 3300006846 Ga0075430_100000935 Ga0075430_10000093514 338
496 3300006846 Ga0075430_100024879 Ga0075430_1000248794 338
497 3300006847 Ga0075431_100003722 Ga0075431_1000037229 338
498 3300006847 Ga0075431_100117121 Ga0075431_1001171212 338
499 3300006852 Ga0075433_10075156 Ga0075433_100751563 338
500 3300006871 Ga0075434_100006513 Ga0075434_1000065137 338
501 3300006871 Ga0075434_100089702 Ga0075434_1000897023 338
502 3300006871 Ga0075434_100233336 Ga0075434_1002333361 338
503 3300006880 Ga0075429_100219883 Ga0075429_1002198832 338
504 3300006914 Ga0075436_100001698 Ga0075436_1000016986 338
505 3300006931 Ga0097620_100002957 Ga0097620_1000029574 338
506 3300006931 Ga0097620_100006662 Ga0097620_1000066622 338
507 3300006931 Ga0097620_100041922 Ga0097620_1000419224 338
508 3300007076 Ga0075435_100027739 Ga0075435_1000277392 338
509 3300009011 Ga0105251_10040011 Ga0105251_100400113 338
510 3300009093 Ga0105240_10019078 Ga0105240_100190788 338
511 3300009093 Ga0105240_10117763 Ga0105240_101177632 338
512 3300009094 Ga0111539_10031182 Ga0111539_100311824 338
513 3300009094 Ga0111539_10684867 Ga0111539_106848671 338
514 3300009098 Ga0105245_10036774 Ga0105245_100367744 338
515 3300009098 Ga0105245_10180691 Ga0105245_101806912 338
516 3300009098 Ga0105245_10367390 Ga0105245_103673902 338
517 3300009101 Ga0105247_10000971 Ga0105247_100009716 338
518 3300009101 Ga0105247_10014730 Ga0105247_100147305 338
519 3300009147 Ga0114129_10001279 Ga0114129_1000127919 338
520 3300009147 Ga0114129_10052270 Ga0114129_100522701 338
521 3300009148 Ga0105243_10027614 Ga0105243_100276142 338
522 3300009148 Ga0105243_10079731 Ga0105243_100797312 338
523 3300009174 Ga0105241_10064837 Ga0105241_100648372 338
524 3300009177 Ga0105248_10000034 Ga0105248_1000003455 338
525 3300009177 Ga0105248_10240009 Ga0105248_102400092 338
526 3300009177 Ga0105248_10437199 Ga0105248_104371991 338
527 3300009177 Ga0105248_10686916 Ga0105248_106869161 338
528 3300009545 Ga0105237_10005381 Ga0105237_100053818 338
529 3300009551 Ga0105238_10267490 Ga0105238_102674901 338
530 3300009553 Ga0105249_10075684 Ga0105249_100756843 338
531 3300009553 Ga0105249_10351755 Ga0105249_103517552 338
532 3300009553 Ga0105249_10668185 Ga0105249_106681851 338
533 3300010375 Ga0105239_10013363 Ga0105239_100133634 338
534 3300010375 Ga0105239_10394606 Ga0105239_103946062 338
535 3300012515 Ga0157338_1002637 Ga0157338_10026372 338
536 3300013100 Ga0157373_10124402 Ga0157373_101244022 338
537 3300013296 Ga0157374_10018863 Ga0157374_100188632 338
538 3300013297 Ga0157378_10208617 Ga0157378_102086172 338
539 3300013297 Ga0157378_10389138 Ga0157378_103891382 338
540 3300013307 Ga0157372_10019524 Ga0157372_100195242 338
541 3300013307 Ga0157372_10597684 Ga0157372_105976842 338
542 3300013308 Ga0157375_10107580 Ga0157375_101075802 338
543 3300014325 Ga0163163_10013199 Ga0163163_100131992 338
544 3300014325 Ga0163163_10068093 Ga0163163_100680932 338
545 3300014325 Ga0163163_10114254 Ga0163163_101142542 338
546 3300014325 Ga0163163_10307592 Ga0163163_103075922 338
547 3300014326 Ga0157380_10023569 Ga0157380_100235693 338
548 3300014745 Ga0157377_10041322 Ga0157377_100413222 338
549 3300014968 Ga0157379_10016266 Ga0157379_100162664 338
550 3300014968 Ga0157379_10461186 Ga0157379_104611861 338
551 3300014969 Ga0157376_10277777 Ga0157376_102777772 338
552 3300017792 Ga0163161_10180061 Ga0163161_101800611 338
553 3300020070 Ga0206356_10758018 Ga0206356_107580182 338
554 3300020077 Ga0206351_10658466 Ga0206351_106584664 338
555 3300020078 Ga0206352_10915400 Ga0206352_109154002 338
556 3300020080 Ga0206350_10122299 Ga0206350_101222992 338
557 3300020081 Ga0206354_11650881 Ga0206354_116508812 338
558 3300020082 Ga0206353_10109164 Ga0206353_101091642 338
559 3300021384 Ga0213876_10149661 Ga0213876_101496611 338
560 3300022467 Ga0224712_10001135 Ga0224712_100011352 338
561 3300025893 Ga0207682_10094629 Ga0207682_100946291 338
562 3300025900 Ga0207710_10000682 Ga0207710_1000068218 338
563 3300025900 Ga0207710_10017307 Ga0207710_100173072 338
564 3300025901 Ga0207688_10000765 Ga0207688_100007657 338
565 3300025901 Ga0207688_10099785 Ga0207688_100997851 338
566 3300025904 Ga0207647_10024270 Ga0207647_100242703 338
567 3300025904 Ga0207647_10029797 Ga0207647_100297973 338
568 3300025904 Ga0207647_10046375 Ga0207647_100463752 338
569 3300025907 Ga0207645_10070843 Ga0207645_100708432 338
570 3300025907 Ga0207645_10077104 Ga0207645_100771042 338
571 3300025908 Ga0207643_10000049 Ga0207643_1000004950 338
572 3300025908 Ga0207643_10000517 Ga0207643_1000051723 338
573 3300025911 Ga0207654_10028648 Ga0207654_100286483 338
574 3300025912 Ga0207707_10040010 Ga0207707_100400103 338
575 3300025913 Ga0207695_10104876 Ga0207695_101048762 338
576 3300025914 Ga0207671_10008858 Ga0207671_100088587 338
577 3300025914 Ga0207671_10063600 Ga0207671_100636002 338
578 3300025916 Ga0207663_10040137 Ga0207663_100401372 338
579 3300025917 Ga0207660_10010527 Ga0207660_100105271 338
580 3300025919 Ga0207657_10011572 Ga0207657_1001157211 338
581 3300025920 Ga0207649_10021347 Ga0207649_100213473 338
582 3300025920 Ga0207649_10027450 Ga0207649_100274502 338
583 3300025922 Ga0207646_10343606 Ga0207646_103436061 338
584 3300025924 Ga0207694_10105685 Ga0207694_101056851 338
585 3300025925 Ga0207650_10000713 Ga0207650_1000071312 338
586 3300025925 Ga0207650_10006096 Ga0207650_100060964 338
587 3300025925 Ga0207650_10009466 Ga0207650_100094663 338
588 3300025925 Ga0207650_10249138 Ga0207650_102491382 338
589 3300025926 Ga0207659_10011241 Ga0207659_100112413 338
590 3300025927 Ga0207687_10046559 Ga0207687_100465592 338
591 3300025928 Ga0207700_10057631 Ga0207700_100576312 338
592 3300025929 Ga0207664_10002478 Ga0207664_1000247811 338
593 3300025929 Ga0207664_10386220 Ga0207664_103862202 338
594 3300025931 Ga0207644_10024574 Ga0207644_100245742 338
595 3300025932 Ga0207690_10034873 Ga0207690_100348734 338
596 3300025933 Ga0207706_10050638 Ga0207706_100506382 338
597 3300025935 Ga0207709_10064095 Ga0207709_100640953 338
598 3300025937 Ga0207669_10144720 Ga0207669_101447202 338
599 3300025938 Ga0207704_10250281 Ga0207704_102502811 338
600 3300025939 Ga0207665_10029257 Ga0207665_100292572 338
601 3300025941 Ga0207711_10000203 Ga0207711_1000020330 338
602 3300025941 Ga0207711_10095568 Ga0207711_100955683 338
603 3300025942 Ga0207689_10000355 Ga0207689_1000035519 338
604 3300025945 Ga0207679_10003632 Ga0207679_100036322 338
605 3300025945 Ga0207679_10041816 Ga0207679_100418162 338
606 3300025949 Ga0207667_10024050 Ga0207667_100240502 338
607 3300025949 Ga0207667_10226613 Ga0207667_102266132 338
608 3300025961 Ga0207712_10014587 Ga0207712_100145874 338
609 3300025986 Ga0207658_10099400 Ga0207658_100994001 338
610 3300026035 Ga0207703_10071146 Ga0207703_100711462 338
611 3300026035 Ga0207703_10159842 Ga0207703_101598422 338
612 3300026041 Ga0207639_10010005 Ga0207639_100100054 338
613 3300026067 Ga0207678_10000705 Ga0207678_1000070512 338
614 3300026075 Ga0207708_10016932 Ga0207708_100169325 338
615 3300026078 Ga0207702_10001520 Ga0207702_1000152013 338
616 3300026088 Ga0207641_10000772 Ga0207641_1000077210 338
617 3300026088 Ga0207641_10009478 Ga0207641_100094783 338
618 3300026088 Ga0207641_10016724 Ga0207641_100167242 338
619 3300026088 Ga0207641_10069942 Ga0207641_100699423 338
620 3300026095 Ga0207676_10001048 Ga0207676_1000104811 338
621 3300026095 Ga0207676_10003132 Ga0207676_100031329 338
622 3300026116 Ga0207674_10000186 Ga0207674_1000018645 338
623 3300026116 Ga0207674_10058473 Ga0207674_100584732 338
624 3300026118 Ga0207675_100001392 Ga0207675_10000139224 338
625 3300026118 Ga0207675_100005123 Ga0207675_10000512310 338
626 3300026121 Ga0207683_10000155 Ga0207683_1000015526 338
627 3300026121 Ga0207683_10080966 Ga0207683_100809662 338
628 3300026142 Ga0207698_10017059 Ga0207698_100170594 338
629 3300027907 Ga0207428_10001815 Ga0207428_100018157 338
630 3300027907 Ga0207428_10003991 Ga0207428_100039919 338
631 3300027907 Ga0207428_10006198 Ga0207428_100061989 338
632 3300027907 Ga0207428_10225530 Ga0207428_102255302 338
633 3300028379 Ga0268266_10004003 Ga0268266_100040039 338
634 3300028379 Ga0268266_10012018 Ga0268266_100120183 338
635 3300028380 Ga0268265_10000015 Ga0268265_10000015109 338
636 3300028381 Ga0268264_10010704 Ga0268264_100107044 338
637 3300028381 Ga0268264_10041774 Ga0268264_100417744 338
638 3300028381 Ga0268264_10070550 Ga0268264_100705502 338
639 3300028381 Ga0268264_10134787 Ga0268264_101347872 338
640 3300028556 Ga0265337_1000399 Ga0265337_10003997 338
641 3300028563 Ga0265319_1014567 Ga0265319_10145672 338
642 3300028573 Ga0265334_10000641 Ga0265334_100006413 338
643 3300028577 Ga0265318_10005884 Ga0265318_100058844 338
644 3300028666 Ga0265336_10010947 Ga0265336_100109472 338
645 3300028800 Ga0265338_10001050 Ga0265338_1000105023 338
646 3300028800 Ga0265338_10023116 Ga0265338_100231166 338
647 3300028800 Ga0265338_10197611 Ga0265338_101976112 338
648 3300031238 Ga0265332_10009593 Ga0265332_100095936 338
649 3300031241 Ga0265325_10014158 Ga0265325_100141584 338
650 3300031247 Ga0265340_10005983 Ga0265340_100059832 338
651 3300031249 Ga0265339_10017534 Ga0265339_100175342 338
652 3300031249 Ga0265339_10021423 Ga0265339_100214233 338
653 3300031249 Ga0265339_10052790 Ga0265339_100527902 338
654 3300031344 Ga0265316_10061518 Ga0265316_100615183 338
655 3300031344 Ga0265316_10063605 Ga0265316_100636053 338
656 3300031456 Ga0307513_10001518 Ga0307513_100015189 338
657 3300031595 Ga0265313_10040040 Ga0265313_100400402 338
658 3300031691 Ga0316579_10029736 Ga0316579_100297361 338
659 3300031711 Ga0265314_10052926 Ga0265314_100529261 338
660 3300031712 Ga0265342_10061845 Ga0265342_100618452 338
661 3300031727 Ga0316576_10002490 Ga0316576_100024908 338
662 3300031727 Ga0316576_10018856 Ga0316576_100188563 338
663 3300031727 Ga0316576_10029254 Ga0316576_100292544 338
664 3300031728 Ga0316578_10008648 Ga0316578_100086484 338
665 3300031733 Ga0316577_10037966 Ga0316577_100379663 338
666 3300032002 Ga0307416_100051682 Ga0307416_1000516821 338
667 3300032002 Ga0307416_100192867 Ga0307416_1001928672 338
668 3300035090 Ga0373949_0023095 Ga0373949_0023095_111_1127 338
669 3300035114 Ga0373939_0004331 Ga0373939_0004331_1331_2347 338
670 3300035398 Ga0316574_0013787 Ga0316574_0013787_3397_4413 338
671 3300035398 Ga0316574_0016958 Ga0316574_0016958_347_1369 338
672 3300035398 Ga0316574_0094733 Ga0316574_0094733_471_1487 338
673 3300036647 Ga0316582_0034085 Ga0316582_0034085_1682_2698 338
674 3300036712 Ga0316584_0168362 Ga0316584_0168362_48_1070 338
675 3300037068 Ga0373925_0000098 Ga0373925_0000098_15962_16978 338
676 3300037068 Ga0373925_0279757 Ga0373925_0279757_296_1312 338
677 3300037312 Ga0395899_0005205 Ga0395899_0005205_2299_3315 338
678 3300037418 Ga0395900_0005413 Ga0395900_0005413_7844_8860 338
679 3300037418 Ga0395900_0078043 Ga0395900_0078043_997_2013 338
680 3300037418 Ga0395900_0112583 Ga0395900_0112583_362_1378 338
681 3300037466 Ga0395898_0003440 Ga0395898_0003440_11339_12355 338
682 3300037466 Ga0395898_0128350 Ga0395898_0128350_42_1058 338
683 3300037471 Ga0395905_0015563 Ga0395905_0015563_4539_5555 338
684 3300037471 Ga0395905_0073922 Ga0395905_0073922_1162_2184 338
685 3300037853 Ga0436364_1050884 Ga0436364_1050884_932_1963 338
686 3300038443 Ga0395901_0003919 Ga0395901_0003919_12011_13027 338
687 3300038443 Ga0395901_0016954 Ga0395901_0016954_5588_6604 338
688 3300038443 Ga0395901_0023959 Ga0395901_0023959_3494_4525 338
689 3300039437 Ga0436365_0681063 Ga0436365_0681063_26139_27170 338
690 3300039437 Ga0436365_1655282 Ga0436365_1655282_168_1199 338
691 3300041451 Ga0451791_1281809 Ga0451791_1281809_359_1381 338
692 3300041452 Ga0451793_1426489 Ga0451793_1426489_211_1248 338
693 3300041496 Ga0451839_0463024 Ga0451839_0463024_377_1393 338
694 3300041498 Ga0451841_0327528 Ga0451841_0327528_250_1287 338
695 3300041509 Ga0451843_0083459 Ga0451843_0083459_866_1903 338
696 3300042016 Ga0439463_001486 Ga0439463_001486_428_1444 338
697 3300042118 Ga0450914_001537 Ga0450914_001537_386_1402 338
698 3300042436 Ga0439435_0009784 Ga0439435_0009784_83_1099 338
699 3300042438 Ga0439459_0002988 Ga0439459_0002988_1459_2475 338
700 3300042439 Ga0439464_0021944 Ga0439464_0021944_43_1083 338
701 3300042439 Ga0439464_0047518 Ga0439464_0047518_117_1133 338
702 3300042876 Ga0451577_0015881 Ga0451577_0015881_3638_4669 338
703 3300044656 Ga0466969_0042390 Ga0466969_0042390_809_1840 338
704 3300044658 Ga0466972_0081751 Ga0466972_0081751_142_1173 338
705 3300044683 Ga0466965_0046094 Ga0466965_0046094_129_1160 338
706 3300044684 Ga0466966_0021447 Ga0466966_0021447_756_1787 338
707 3300044684 Ga0466966_0059515 Ga0466966_0059515_286_1317 338
708 3300044693 Ga0466961_0014589 Ga0466961_0014589_1855_2886 338
709 3300044693 Ga0466961_0018181 Ga0466961_0018181_962_1993 338
710 3300044693 Ga0466961_0060019 Ga0466961_0060019_1020_2051 338
711 3300044693 Ga0466961_0113988 Ga0466961_0113988_268_1299 338
712 3300044693 Ga0466961_0163337 Ga0466961_0163337_82_1113 338
713 3300044694 Ga0466963_0008210 Ga0466963_0008210_4380_5411 338
714 3300044694 Ga0466963_0014074 Ga0466963_0014074_3017_4048 338
715 3300044694 Ga0466963_0038573 Ga0466963_0038573_88_1119 338
716 3300044694 Ga0466963_0118935 Ga0466963_0118935_550_1581 338
717 3300044694 Ga0466963_0208443 Ga0466963_0208443_92_1123 338
718 3300044706 Ga0466964_0001285 Ga0466964_0001285_1918_2949 338
719 3300044712 Ga0453684_0015821 Ga0453684_0015821_2211_3242 338
720 3300044719 Ga0466971_0004116 Ga0466971_0004116_3300_4331 338
721 3300044719 Ga0466971_0023279 Ga0466971_0023279_1571_2602 338
722 3300044842 Ga0466957_0001021 Ga0466957_0001021_383_1414 338
723 3300044842 Ga0466957_0057846 Ga0466957_0057846_393_1424 338
724 3300044842 Ga0466957_0146900 Ga0466957_0146900_245_1276 338
725 3300044901 Ga0466960_0000045 Ga0466960_0000045_21952_22983 338
726 3300044901 Ga0466960_0011211 Ga0466960_0011211_221_1252 338
727 3300045049 Ga0466959_0001609 Ga0466959_0001609_7674_8705 338
728 3300045049 Ga0466959_0010490 Ga0466959_0010490_3907_4938 338
729 3300045049 Ga0466959_0066849 Ga0466959_0066849_462_1493 338
730 3300045049 Ga0466959_0070910 Ga0466959_0070910_460_1491 338
731 3300045836 Ga0466958_0006072 Ga0466958_0006072_3353_4384 338
732 3300045836 Ga0466958_0006804 Ga0466958_0006804_3375_4406 338
733 3300045836 Ga0466958_0013868 Ga0466958_0013868_1761_2792 338
734 3300045836 Ga0466958_0025466 Ga0466958_0025466_2166_3197 338
735 3300045976 Ga0466967_0006548 Ga0466967_0006548_1755_2786 338
736 3300045976 Ga0466967_0017392 Ga0466967_0017392_689_1720 338
737 3300045976 Ga0466967_0017602 Ga0466967_0017602_3611_4642 338
738 3300045976 Ga0466967_0112910 Ga0466967_0112910_1016_2047 338
739 3300045976 Ga0466967_0115371 Ga0466967_0115371_1309_2340 338
740 3300045976 Ga0466967_0143197 Ga0466967_0143197_1027_2058 338
741 3300045976 Ga0466967_0204392 Ga0466967_0204392_265_1296 338
742 3300045976 Ga0466967_0318102 Ga0466967_0318102_66_1097 338
743 3300046455 Ga0495603_0048879 Ga0495603_0048879_805_1821 338
744 3300046461 Ga0495641_0006967 Ga0495641_0006967_921_1949 338
745 3300046461 Ga0495641_0016086 Ga0495641_0016086_1793_2824 338
746 3300046471 Ga0495650_0000331 Ga0495650_0000331_42134_43165 338
747 3300046500 Ga0495596_0058302 Ga0495596_0058302_66_1082 338
748 3300046518 Ga0495631_0042914 Ga0495631_0042914_959_1975 338
749 3300046524 Ga0495648_0012243 Ga0495648_0012243_1598_3043 338
750 3300046528 Ga0495642_0027420 Ga0495642_0027420_915_1931 338
751 3300046539 Ga0495621_0044804 Ga0495621_0044804_144_1160 338
752 3300046615 Ga0495656_0070133 Ga0495656_0070133_344_1360 338
753 3300046665 Ga0495661_0101635 Ga0495661_0101635_39_1055 338
754 3300047321 Ga0495676_0040163 Ga0495676_0040163_1282_2310 338
755 3300048904 Ga0496101_0020991 Ga0496101_0020991_1476_2492 338
756 3300048904 Ga0496101_0110037 Ga0496101_0110037_312_1343 338
757 3300048905 Ga0496102_0000059 Ga0496102_0000059_119772_120803 338
758 3300048905 Ga0496102_0004742 Ga0496102_0004742_2012_3028 338
759 3300048905 Ga0496102_0025051 Ga0496102_0025051_4242_5297 338
760 3300048905 Ga0496102_0046024 Ga0496102_0046024_314_1345 338
761 3300048905 Ga0496102_0119850 Ga0496102_0119850_1346_2374 338
762 3300048905 Ga0496102_0275129 Ga0496102_0275129_440_1471 338
763 3300048906 Ga0496103_0000063 Ga0496103_0000063_34876_35907 338
764 3300048906 Ga0496103_0127463 Ga0496103_0127463_207_1238 338
765 3300048906 Ga0496103_0171703 Ga0496103_0171703_77_1093 338
766 3300048907 Ga0496104_0047487 Ga0496104_0047487_217_1233 338
767 3300048907 Ga0496104_0065948 Ga0496104_0065948_905_1921 338
768 3300048907 Ga0496104_0208139 Ga0496104_0208139_528_1559 338
769 3300048907 Ga0496104_0376413 Ga0496104_0376413_71_1102 338
770 3300048908 Ga0496105_0036330 Ga0496105_0036330_2012_3028 338
771 3300048908 Ga0496105_0105937 Ga0496105_0105937_671_1702 338
772 3300048910 Ga0496107_0240950 Ga0496107_0240950_40_1056 338
773 3300048911 Ga0496108_0026484 Ga0496108_0026484_1738_2754 338
774 3300048911 Ga0496108_0035825 Ga0496108_0035825_1999_3024 338
775 3300048911 Ga0496108_0079922 Ga0496108_0079922_94_1125 338
776 3300048911 Ga0496108_0180445 Ga0496108_0180445_136_1167 338
777 3300048912 Ga0496109_0004796 Ga0496109_0004796_5632_6663 338
778 3300048912 Ga0496109_0034074 Ga0496109_0034074_379_1395 338
779 3300048912 Ga0496109_0038731 Ga0496109_0038731_1876_2892 338
780 3300048912 Ga0496109_0045518 Ga0496109_0045518_2154_3179 338
781 3300048912 Ga0496109_0052740 Ga0496109_0052740_2497_3516 338
782 3300048913 Ga0496110_0001456 Ga0496110_0001456_9939_10964 338
783 3300048913 Ga0496110_0011966 Ga0496110_0011966_3839_4855 338
784 3300048913 Ga0496110_0017590 Ga0496110_0017590_2256_3287 338
785 3300048913 Ga0496110_0032641 Ga0496110_0032641_29_1045 338
786 3300048914 Ga0496111_0020992 Ga0496111_0020992_482_1498 338
787 3300048914 Ga0496111_0026821 Ga0496111_0026821_179_1204 338
788 3300048914 Ga0496111_0053217 Ga0496111_0053217_337_1368 338
789 3300048914 Ga0496111_0053760 Ga0496111_0053760_1403_2419 338
790 3300048914 Ga0496111_0108873 Ga0496111_0108873_371_1393 338
791 3300048914 Ga0496111_0111123 Ga0496111_0111123_555_1571 338
792 3300048914 Ga0496111_0145873 Ga0496111_0145873_388_1419 338
793 3300048916 Ga0496113_0041450 Ga0496113_0041450_716_1747 338
794 3300048917 Ga0496114_0006455 Ga0496114_0006455_6717_7742 338
795 3300048917 Ga0496114_0077415 Ga0496114_0077415_1709_2740 338
796 3300048918 Ga0496115_0108796 Ga0496115_0108796_587_1618 338
797 3300048919 Ga0496116_0000371 Ga0496116_0000371_4272_5327 338
798 3300048920 Ga0496117_0068764 Ga0496117_0068764_60_1109 338
799 3300048920 Ga0496117_0077169 Ga0496117_0077169_365_1396 338
800 3300048921 Ga0496118_0002375 Ga0496118_0002375_14840_15889 338
801 3300048921 Ga0496118_0003721 Ga0496118_0003721_17757_18812 338
802 3300048921 Ga0496118_0017172 Ga0496118_0017172_302_1333 338
803 3300048922 Ga0496119_0000892 Ga0496119_0000892_30170_31201 338
804 3300048922 Ga0496119_0076583 Ga0496119_0076583_171_1226 338
805 3300048923 Ga0496120_0002612 Ga0496120_0002612_3464_4495 338
806 3300048924 Ga0496121_0073884 Ga0496121_0073884_588_1619 338
807 3300049568 Ga0501031_0005570 Ga0501031_0005570_5394_6425 338
808 3300049569 Ga0501032_0002340 Ga0501032_0002340_9638_10669 338
809 3300049569 Ga0501032_0048933 Ga0501032_0048933_1245_2261 338
810 3300049570 Ga0501033_0004025 Ga0501033_0004025_442_1458 338
811 3300049570 Ga0501033_0016214 Ga0501033_0016214_4193_5224 338
812 3300049571 Ga0501034_0002740 Ga0501034_0002740_8507_9523 338
813 3300049571 Ga0501034_0003858 Ga0501034_0003858_12061_13077 338
814 3300049571 Ga0501034_0005853 Ga0501034_0005853_6873_7904 338
815 3300049571 Ga0501034_0014985 Ga0501034_0014985_438_1469 338
816 3300049571 Ga0501034_0042962 Ga0501034_0042962_393_1409 338
817 3300049571 Ga0501034_0065347 Ga0501034_0065347_775_1827 338
818 3300049571 Ga0501034_0135740 Ga0501034_0135740_61_1089 338
819 3300049572 Ga0501036_0011560 Ga0501036_0011560_4024_5055 338
820 3300049572 Ga0501036_0041367 Ga0501036_0041367_2408_3460 338
821 3300049572 Ga0501036_0100163 Ga0501036_0100163_318_1334 338
822 3300049573 Ga0501037_0001389 Ga0501037_0001389_1668_2684 338
823 3300049573 Ga0501037_0002506 Ga0501037_0002506_3951_4982 338
824 3300049574 Ga0501038_0004227 Ga0501038_0004227_5940_6971 338
825 3300049574 Ga0501038_0077158 Ga0501038_0077158_952_2004 338
826 3300049575 Ga0501039_0069298 Ga0501039_0069298_81_1103 338
827 3300049575 Ga0501039_0303894 Ga0501039_0303894_115_1131 338
828 3300049577 Ga0501041_0074422 Ga0501041_0074422_875_1891 338
829 3300049578 Ga0501042_0015678 Ga0501042_0015678_1218_2234 338
830 3300049578 Ga0501042_0023790 Ga0501042_0023790_1956_2972 338
831 3300049578 Ga0501042_0066077 Ga0501042_0066077_1209_2261 338
832 3300049579 Ga0501043_0006552 Ga0501043_0006552_4373_5404 338
833 3300049580 Ga0501046_0023618 Ga0501046_0023618_129_1160 338
834 3300049580 Ga0501046_0137659 Ga0501046_0137659_353_1405 338
835 3300049581 Ga0501047_0008684 Ga0501047_0008684_7714_8730 338
836 3300049581 Ga0501047_0024485 Ga0501047_0024485_3822_4853 338
837 3300049581 Ga0501047_0105410 Ga0501047_0105410_693_1745 338
838 3300049582 Ga0501048_0002684 Ga0501048_0002684_3949_4980 338
839 3300049582 Ga0501048_0040076 Ga0501048_0040076_1637_2653 338
840 3300049582 Ga0501048_0062565 Ga0501048_0062565_374_1390 338
841 3300049583 Ga0501067_0004631 Ga0501067_0004631_2684_3715 338
842 3300049584 Ga0501068_0001815 Ga0501068_0001815_8547_9563 338
843 3300049584 Ga0501068_0011051 Ga0501068_0011051_28_1059 338
844 3300049585 Ga0501069_0001225 Ga0501069_0001225_7678_8709 338
845 3300049585 Ga0501069_0013761 Ga0501069_0013761_247_1263 338
846 3300049586 Ga0501070_0004078 Ga0501070_0004078_9964_10980 338
847 3300049586 Ga0501070_0017082 Ga0501070_0017082_3992_5023 338
848 3300049587 Ga0501071_0203204 Ga0501071_0203204_461_1477 338
849 3300049588 Ga0501072_0390098 Ga0501072_0390098_66_1082 338
850 3300049589 Ga0501073_0000965 Ga0501073_0000965_18461_19477 338
851 3300049589 Ga0501073_0019249 Ga0501073_0019249_3833_4864 338
852 3300049589 Ga0501073_0078868 Ga0501073_0078868_22_1038 338
853 3300049591 Ga0501075_0011325 Ga0501075_0011325_2225_3241 338
854 3300049591 Ga0501075_0082245 Ga0501075_0082245_546_1568 338
855 3300049593 Ga0501077_0049286 Ga0501077_0049286_718_1734 338
856 3300049593 Ga0501077_0087901 Ga0501077_0087901_233_1249 338
857 3300049741 Ga0501079_0116525 Ga0501079_0116525_233_1249 338
858 3300049742 Ga0501080_0003844 Ga0501080_0003844_3949_4980 338
859 3300049742 Ga0501080_0454891 Ga0501080_0454891_34_1050 338
860 3300049744 Ga0501083_0001426 Ga0501083_0001426_3003_4019 338
861 3300049744 Ga0501083_0001558 Ga0501083_0001558_5520_6551 338
862 3300049822 Ga0501035_0006226 Ga0501035_0006226_8817_9848 338
863 3300049822 Ga0501035_0011783 Ga0501035_0011783_1819_2835 338
864 3300049822 Ga0501035_0088794 Ga0501035_0088794_1237_2274 338
865 3300049823 Ga0501044_0009726 Ga0501044_0009726_5406_6437 338
866 3300049823 Ga0501044_0067538 Ga0501044_0067538_457_1473 338
867 3300049823 Ga0501044_0093354 Ga0501044_0093354_1755_2807 338
868 3300049823 Ga0501044_0099382 Ga0501044_0099382_233_1270 338
869 3300049824 Ga0501045_0058965 Ga0501045_0058965_1505_2536 338
870 3300049824 Ga0501045_0185045 Ga0501045_0185045_165_1181 338
871 3300050489 nmdc:mga03683_18115_c1 nmdc:mga03683_18115_c1_707_1735 338
872 3300050491 nmdc:mga00v17_454_c1 nmdc:mga00v17_454_c1_15522_16553 338
873 3300050491 nmdc:mga00v17_62819_c1 nmdc:mga00v17_62819_c1_631_1683 338
874 3300050496 nmdc:mga07m45_132319_c1 nmdc:mga07m45_132319_c1_55_1083 338
875 3300050507 nmdc:mga05p37_106223_c1 nmdc:mga05p37_106223_c1_492_1508 338
876 3300050507 nmdc:mga05p37_188224_c1 nmdc:mga05p37_188224_c1_896_1912 338
877 3300050507 nmdc:mga05p37_23533_c1 nmdc:mga05p37_23533_c1_583_1599 338
878 3300050507 nmdc:mga05p37_84862_c1 nmdc:mga05p37_84862_c1_1914_2930 338
879 3300050508 nmdc:mga09592_33717_c1 nmdc:mga09592_33717_c1_2179_3195 338
880 3300050508 nmdc:mga09592_4451_c1 nmdc:mga09592_4451_c1_1903_2919 338
881 3300050508 nmdc:mga09592_47131_c1 nmdc:mga09592_47131_c1_1417_2433 338
882 3300050508 nmdc:mga09592_66051_c1 nmdc:mga09592_66051_c1_1501_2517 338
883 3300050509 nmdc:mga0qj67_2866_c1 nmdc:mga0qj67_2866_c1_3902_4918 338
884 3300050510 nmdc:mga06r32_150029_c1 nmdc:mga06r32_150029_c1_1036_2052 338
885 3300050510 nmdc:mga06r32_28087_c1 nmdc:mga06r32_28087_c1_2075_3091 338
886 3300050511 nmdc:mga08y16_109606_c1 nmdc:mga08y16_109606_c1_385_1401 338
887 3300050511 nmdc:mga08y16_11761_c1 nmdc:mga08y16_11761_c1_3570_4586 338
888 3300050511 nmdc:mga08y16_426445_c1 nmdc:mga08y16_426445_c1_66_1106 338
889 3300050512 nmdc:mga0n895_109096_c1 nmdc:mga0n895_109096_c1_548_1564 338
890 3300050512 nmdc:mga0n895_7081_c1 nmdc:mga0n895_7081_c1_253_1269 338
891 3300050515 nmdc:mga0a205_45069_c1 nmdc:mga0a205_45069_c1_767_1783 338
892 3300053084 Ga0495595_0061984 Ga0495595_0061984_59_1090 338
893 3300053104 Ga0500556_0001107 Ga0500556_0001107_6553_7587 338
894 3300053153 Ga0500616_0000885 Ga0500616_0000885_16661_17677 338
895 3300053153 Ga0500616_0000953 Ga0500616_0000953_4345_5361 338
896 3300053153 Ga0500616_0004063 Ga0500616_0004063_5880_6914 338
897 3300053153 Ga0500616_0015772 Ga0500616_0015772_1037_2053 338
898 3300053153 Ga0500616_0017259 Ga0500616_0017259_123_1157 338
899 3300054114 Ga0501084_0011719 Ga0501084_0011719_4267_5298 338
900 3300061719 Ga0466962_0000651 Ga0466962_0000651_1906_2937 338
901 3300061719 Ga0466962_0068529 Ga0466962_0068529_369_1400 338
902 3300061734 Ga0530510_0083078 Ga0530510_0083078_956_1972 338
903 iso_pu_bacteria 2870628048 2870629347 338

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

19

345

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1f07-assembly1.cif.gz_A structure of coenzyme f420 dependent tetrahydromethanopterin reductase from methanobacterium thermoautotrophicum 0.8204 1 327
1f07-assembly1.cif.gz_A structure of coenzyme f420 dependent tetrahydromethanopterin reductase from methanobacterium thermoautotrophicum 0.8108 1 327
1rhc-assembly1.cif.gz_A-2 f420-dependent secondary alcohol dehydrogenase in complex with an f420-acetone adduct 0.7961 2 332
1z69-assembly1.cif.gz_B crystal structure of methylenetetrahydromethanopterin reductase (mer) in complex with coenzyme f420 0.7872 1 327
3c8n-assembly2.cif.gz_D crystal structure of apo-fgd1 from mycobacterium tuberculosis 0.7871 2 330
ID Description Score Start End Superfamily
1rhcA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.7961 2 332 3.20.20.30
1rhcA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.787 2 332 3.20.20.30
af_O05772_7_317_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.7759 12 319 3.20.20.30
1ezwA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.7658 1 331 3.20.20.30
af_P96809_35_360_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.7571 2 328 3.20.20.30
ID Description Score Start End GO Terms
AF-A0A351EVS5-F1-model_v4 TIGR03842 family LLM class F420-dependent oxidoreductase 0.9902 1 157 GO:0016705
AF-A0A401M885-F1-model_v4 N5,N10-methylenetetrahydromethanopterin reductase-related protein 0.9872 1 332 GO:0016705
AF-A0A3D0HFL4-F1-model_v4 TIGR03842 family LLM class F420-dependent oxidoreductase 0.9851 1 101 GO:0016705
AF-A0A7Y0PGT9-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9833 40 203 GO:0016705
AF-A0A7Y3HFA4-F1-model_v4 TIGR03842 family LLM class F420-dependent oxidoreductase 0.9829 1 286 GO:0016705

Feature Viewer

pLDDT pTM Quality
93.29 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map