F485202

General Info

Members Datasets Scaffolds Average Seq Length
902 394 879 288

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10000798|Ga0105239_1000079838
Length 310
Sequence VLLLDCKTRVPQFGAIPSGEKNMLVNKAIFPVAGLGTRFLPATKAQPKEMLPVVDKPLIQYAVEEAYAAGVREMIFVTGRHKRPIEDHFDMTFELEVALEQAGKQELLDVVRTVKPNDMECVYVRQAQALGLGHAVLCGQRLIGNEPFAVLLADDLMVGSPPVLRQMVEQFEEWRASILAVQEVPAEQTRRYGIVDGTEVNDRMMDISRIVEKPAPEDAPSRLGVAGRYILTPGVFHEIASQQRGVGGEIQLTDGIAALLRREKVFAYRYEGKRYDCGSKEGFLEANVELALQHPQLGEGFRKYLSTLQF

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
4 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
5 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
6 2643221585 Pelomonas sp. Root662 Isolate Unclassified
7 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
8 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
9 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
10 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
11 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
12 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
13 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
14 2643221656 Pelomonas sp. Root405 Isolate Unclassified
15 2643221660 Methylibium sp. Root1272 Isolate Unclassified
16 2738541337 Pelomonas sp. BT06 Isolate Unclassified
17 2831864461 Roseateles noduli HZ7 Isolate Nodule
18 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
19 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
20 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
21 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
22 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
23 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
24 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
25 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
26 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
27 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
28 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
29 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
30 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
31 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
32 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
33 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
34 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
35 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
36 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
37 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
38 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
39 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
40 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
41 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
42 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
43 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
44 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
45 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
46 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
47 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
48 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
49 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
50 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
51 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
52 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
53 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
54 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
55 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
56 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
57 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
58 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
59 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
60 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
61 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
62 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
63 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
64 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
65 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
66 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
67 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
68 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
69 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
70 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
71 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
72 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
73 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
74 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
75 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
76 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
77 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
78 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
79 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
80 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
81 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
82 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
83 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
84 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
85 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
86 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
87 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
88 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
89 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
90 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
91 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
92 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
93 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
94 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
95 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
96 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
97 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
99 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
100 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
101 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
102 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
103 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
105 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
106 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
107 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
108 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
110 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
111 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
112 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
113 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
114 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
115 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
116 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
117 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
118 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
119 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
120 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
121 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
122 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
123 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
124 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
125 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
126 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
127 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
128 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
129 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
130 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
131 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
132 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
133 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
134 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
136 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
137 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
143 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
197 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
198 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
203 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
208 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
209 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
210 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
211 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
212 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
213 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
214 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
215 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
216 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
217 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
218 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
219 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
220 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
221 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
222 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
223 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
224 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
225 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
226 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
227 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
228 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
229 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
230 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
231 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
232 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
233 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
235 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
236 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
240 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
241 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
242 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
243 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
244 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
245 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
246 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
247 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
248 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
249 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
250 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
251 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
252 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
253 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
254 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
255 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
256 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
257 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
258 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
259 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
260 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
261 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
262 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
263 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
264 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
265 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
266 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
267 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
268 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
269 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
270 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
271 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
272 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
273 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
274 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
275 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
276 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
277 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
278 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
279 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
280 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
281 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
282 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
283 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
284 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
285 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
286 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
287 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
288 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
289 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
290 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
291 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
292 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
293 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
294 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
295 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
296 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
297 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
298 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
299 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
300 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
301 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
302 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
303 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
304 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
305 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
306 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
307 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
308 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
309 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
310 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
311 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
312 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
313 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
314 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
315 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
316 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
317 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
318 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
319 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
320 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
321 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
322 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
323 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
324 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
325 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
326 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
327 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
328 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
329 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
330 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
331 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
332 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
333 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
335 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
336 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
337 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
338 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
345 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
346 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
347 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
348 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
349 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
350 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
351 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
352 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
353 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
354 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
355 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
356 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
357 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
358 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
359 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
360 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
361 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
362 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
363 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
364 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
365 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
366 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
367 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
368 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
369 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
370 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
371 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
372 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
373 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
374 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
375 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
376 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
377 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
378 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
379 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
380 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
381 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
382 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
383 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
384 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
385 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
386 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
387 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
388 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
389 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
390 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
391 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
392 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
393 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
394 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.45
Metatranscriptomes 1
Isolates 2.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.3
Nodule 0.55
Rhizoplane 2.44
Rhizosphere 75.39
Stem 0
Stem Tuber 0
Unclassified 7.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10009695 3300002077 Bacteria 1977
2 JGI25153J46596_10010114 3300003215 Bacteria 4301
3 rootH2_10003861 3300003320 Bacteria 10179
4 rootL2_10008947 3300003322 Bacteria 3632
5 rootL2_10011993 3300003322 Bacteria 4512
6 rootH1_10027651 3300003323 Bacteria 6466
7 Ga0055525_1000011 3300003759 Bacteria 503124
8 Ga0055526_1002081 3300003771 Bacteria 13745
9 Ga0055526_1009068 3300003771 Bacteria 4853
10 Ga0055524_1000423 3300003775 Bacteria 35532
11 Ga0055530_10026604 3300003791 Bacteria 1595
12 Ga0055530_10032948 3300003791 Bacteria 1342
13 Ga0055540_1000015 3300003792 Bacteria 232986
14 Ga0055531_10000214 3300003794 Bacteria 63569
15 Ga0055531_10012695 3300003794 Bacteria 3940
16 Ga0055531_10012745 3300003794 Bacteria 3928
17 Ga0055543_1002451 3300004625 Bacteria 6124
18 Ga0055543_1018468 3300004625 Bacteria 1301
19 Ga0065165_1000024 3300005262 Bacteria 247672
20 Ga0065165_1000401 3300005262 Bacteria 69929
21 Ga0065165_1007960 3300005262 Bacteria 5073
22 Ga0065704_10115258 3300005289 Bacteria 1875
23 Ga0065707_10086296 3300005295 Bacteria 5545
24 Ga0070658_10442350 3300005327 Bacteria 1119
25 Ga0070676_10002580 3300005328 Bacteria 9317
26 Ga0070676_10003107 3300005328 Bacteria 8578
27 Ga0070676_10176335 3300005328 Bacteria 1386
28 Ga0070676_10182727 3300005328 Bacteria 1364
29 Ga0070683_100001824 3300005329 Bacteria 16612
30 Ga0070690_100015822 3300005330 Bacteria 4507
31 Ga0070690_100027719 3300005330 Bacteria 3504
32 Ga0070670_100000817 3300005331 Bacteria 24262
33 Ga0070670_100030985 3300005331 Bacteria 4606
34 Ga0070670_100113628 3300005331 Bacteria 2334
35 Ga0070670_100120306 3300005331 Bacteria 2265
36 Ga0070677_10011646 3300005333 Bacteria 3038
37 Ga0070677_10108708 3300005333 Bacteria 1235
38 Ga0070677_10119071 3300005333 Bacteria 1190
39 Ga0070677_10128255 3300005333 Bacteria 1154
40 Ga0068869_100008068 3300005334 Bacteria 6767
41 Ga0068869_100011581 3300005334 Bacteria 5790
42 Ga0068869_100049338 3300005334 Bacteria 3047
43 Ga0068869_100315725 3300005334 Bacteria 1266
44 Ga0070666_10000785 3300005335 Bacteria 19230
45 Ga0070682_100195879 3300005337 Bacteria 1422
46 Ga0068868_100007918 3300005338 Bacteria 7590
47 Ga0068868_100047011 3300005338 Bacteria 3380
48 Ga0068868_100063355 3300005338 Bacteria 2933
49 Ga0068868_100095787 3300005338 Bacteria 2396
50 Ga0068868_100345864 3300005338 Bacteria 1273
51 Ga0070660_100285612 3300005339 Bacteria 1351
52 Ga0070689_100036794 3300005340 Bacteria 3743
53 Ga0070687_100024523 3300005343 Bacteria 2881
54 Ga0070687_100035933 3300005343 Bacteria 2465
55 Ga0070661_100001209 3300005344 Bacteria 18186
56 Ga0070661_100044171 3300005344 Bacteria 3255
57 Ga0070661_100236421 3300005344 Bacteria 1405
58 Ga0070668_100020742 3300005347 Bacteria 4962
59 Ga0070668_100024278 3300005347 Bacteria 4592
60 Ga0070668_100028843 3300005347 Bacteria 4211
61 Ga0070668_100039349 3300005347 Bacteria 3617
62 Ga0070669_100031357 3300005353 Bacteria 3839
63 Ga0070669_100072267 3300005353 Bacteria 2553
64 Ga0070669_100082423 3300005353 Bacteria 2398
65 Ga0070669_100130631 3300005353 Bacteria 1926
66 Ga0070669_100153435 3300005353 Bacteria 1784
67 Ga0070675_100000285 3300005354 Bacteria 33772
68 Ga0070675_100003281 3300005354 Bacteria 12273
69 Ga0070675_100035548 3300005354 Bacteria 4049
70 Ga0070675_100045165 3300005354 Bacteria 3604
71 Ga0070675_100172746 3300005354 Bacteria 1864
72 Ga0070671_100002575 3300005355 Bacteria 14065
73 Ga0070671_100011706 3300005355 Bacteria 7055
74 Ga0070671_100015522 3300005355 Bacteria 6155
75 Ga0070671_100019406 3300005355 Bacteria 5532
76 Ga0070671_100049253 3300005355 Bacteria 3505
77 Ga0070671_100074679 3300005355 Bacteria 2832
78 Ga0070671_100083482 3300005355 Bacteria 2671
79 Ga0070671_100090319 3300005355 Bacteria 2564
80 Ga0070671_100134959 3300005355 Bacteria 2080
81 Ga0070671_100349687 3300005355 Bacteria 1261
82 Ga0070674_100032006 3300005356 Bacteria 3490
83 Ga0070674_100046123 3300005356 Bacteria 2980
84 Ga0070673_100001009 3300005364 Bacteria 15963
85 Ga0070673_100013002 3300005364 Bacteria 5740
86 Ga0070673_100058983 3300005364 Bacteria 3037
87 Ga0070673_100159301 3300005364 Bacteria 1918
88 Ga0070673_100178321 3300005364 Bacteria 1817
89 Ga0070673_100230122 3300005364 Bacteria 1608
90 Ga0070659_100005054 3300005366 Bacteria 9458
91 Ga0070659_100014835 3300005366 Bacteria 5826
92 Ga0070659_100097584 3300005366 Bacteria 2362
93 Ga0070667_100002773 3300005367 Bacteria 15141
94 Ga0070667_100003684 3300005367 Bacteria 13046
95 Ga0070667_100004040 3300005367 Bacteria 12405
96 Ga0070667_100028787 3300005367 Bacteria 4625
97 Ga0070667_100052972 3300005367 Bacteria 3424
98 Ga0070667_100105409 3300005367 Bacteria 2440
99 Ga0070667_100236828 3300005367 Bacteria 1629
100 Ga0070667_100306561 3300005367 Bacteria 1430
101 Ga0070667_100459851 3300005367 Bacteria 1163
102 Ga0070700_100018609 3300005441 Bacteria 3996
103 Ga0070663_100000774 3300005455 Bacteria 17411
104 Ga0070663_100004332 3300005455 Bacteria 8320
105 Ga0070663_100180664 3300005455 Bacteria 1636
106 Ga0070678_100013525 3300005456 Bacteria 5121
107 Ga0070678_100027689 3300005456 Bacteria 3852
108 Ga0070678_100119433 3300005456 Bacteria 2076
109 Ga0070678_100322351 3300005456 Bacteria 1320
110 Ga0070678_100409008 3300005456 Bacteria 1180
111 Ga0070662_100069801 3300005457 Bacteria 2588
112 Ga0070662_100164880 3300005457 Bacteria 1736
113 Ga0068867_100000042 3300005459 Bacteria 77140
114 Ga0068867_100002447 3300005459 Bacteria 13049
115 Ga0068867_100004433 3300005459 Bacteria 9869
116 Ga0068867_100007433 3300005459 Bacteria 7748
117 Ga0068867_100023789 3300005459 Bacteria 4388
118 Ga0068867_100038381 3300005459 Bacteria 3487
119 Ga0068867_100050732 3300005459 Bacteria 3059
120 Ga0068867_100193634 3300005459 Bacteria 1624
121 Ga0070706_100006300 3300005467 Bacteria 11210
122 Ga0070707_100365515 3300005468 Bacteria 1402
123 Ga0070707_100626795 3300005468 Bacteria 1038
124 Ga0070698_100136280 3300005471 Bacteria 2409
125 Ga0070699_100565021 3300005518 Bacteria 1036
126 Ga0070679_100006907 3300005530 Bacteria 10586
127 Ga0068853_100043022 3300005539 Bacteria 3864
128 Ga0068853_100146170 3300005539 Bacteria 2125
129 Ga0070672_100001055 3300005543 Bacteria 16808
130 Ga0070672_100003224 3300005543 Bacteria 10558
131 Ga0070672_100005119 3300005543 Bacteria 8650
132 Ga0070672_100037899 3300005543 Bacteria 3681
133 Ga0070672_100060089 3300005543 Bacteria 2992
134 Ga0070672_100069134 3300005543 Bacteria 2803
135 Ga0070672_100088044 3300005543 Bacteria 2499
136 Ga0070665_100189898 3300005548 Bacteria 2055
137 Ga0070665_100243450 3300005548 Bacteria 1799
138 Ga0068855_100056667 3300005563 Bacteria 4597
139 Ga0070664_100018592 3300005564 Bacteria 5712
140 Ga0070664_100049307 3300005564 Bacteria 3561
141 Ga0070664_100097436 3300005564 Bacteria 2553
142 Ga0070664_100691812 3300005564 Bacteria 949
143 Ga0068857_100054241 3300005577 Bacteria 3556
144 Ga0068857_100462992 3300005577 Bacteria 1187
145 Ga0068854_100081182 3300005578 Bacteria 2394
146 Ga0068854_100103875 3300005578 Bacteria 2134
147 Ga0068856_100030381 3300005614 Bacteria 5282
148 Ga0068856_100046644 3300005614 Bacteria 4267
149 Ga0068856_100071622 3300005614 Bacteria 3431
150 Ga0068856_100261102 3300005614 Bacteria 1747
151 Ga0070702_100041875 3300005615 Bacteria 2572
152 Ga0070702_100412145 3300005615 Bacteria 970
153 Ga0068852_100005860 3300005616 Bacteria 8830
154 Ga0068852_100042868 3300005616 Bacteria 3834
155 Ga0068852_100059785 3300005616 Bacteria 3306
156 Ga0068852_100094336 3300005616 Bacteria 2684
157 Ga0068852_100102707 3300005616 Bacteria 2584
158 Ga0068852_100103478 3300005616 Bacteria 2575
159 Ga0068852_100177915 3300005616 Bacteria 1998
160 Ga0068859_100006127 3300005617 Bacteria 12221
161 Ga0068859_100046989 3300005617 Bacteria 4335
162 Ga0068859_100055367 3300005617 Bacteria 3992
163 Ga0068859_100076727 3300005617 Bacteria 3382
164 Ga0068859_100263104 3300005617 Bacteria 1816
165 Ga0068859_100453483 3300005617 Bacteria 1379
166 Ga0068864_100008087 3300005618 Bacteria 8673
167 Ga0068864_100016853 3300005618 Bacteria 6088
168 Ga0068864_100023050 3300005618 Bacteria 5226
169 Ga0068864_100079544 3300005618 Bacteria 2870
170 Ga0068864_100273556 3300005618 Bacteria 1574
171 Ga0068866_10009815 3300005718 Bacteria 4080
172 Ga0068866_10218004 3300005718 Bacteria 1150
173 Ga0068866_10240878 3300005718 Bacteria 1101
174 Ga0068861_100003647 3300005719 Bacteria 10261
175 Ga0068861_100004823 3300005719 Bacteria 9067
176 Ga0068861_100092008 3300005719 Bacteria 2395
177 Ga0068861_100115763 3300005719 Bacteria 2154
178 Ga0068861_100425157 3300005719 Bacteria 1184
179 Ga0068851_10021056 3300005834 Bacteria 3163
180 Ga0068851_10033511 3300005834 Bacteria 2560
181 Ga0068851_10055387 3300005834 Bacteria 2020
182 Ga0068851_10134934 3300005834 Bacteria 1338
183 Ga0068870_10085206 3300005840 Bacteria 1756
184 Ga0068863_100003799 3300005841 Bacteria 14929
185 Ga0068863_100004935 3300005841 Bacteria 13153
186 Ga0068863_100024370 3300005841 Bacteria 5771
187 Ga0068863_100124200 3300005841 Bacteria 2462
188 Ga0068863_100174157 3300005841 Bacteria 2065
189 Ga0068863_100225772 3300005841 Bacteria 1805
190 Ga0068858_100002240 3300005842 Bacteria 19545
191 Ga0068858_100018725 3300005842 Bacteria 6480
192 Ga0068858_100030676 3300005842 Bacteria 4993
193 Ga0068858_100100687 3300005842 Bacteria 2695
194 Ga0068860_100000445 3300005843 Bacteria 52236
195 Ga0068860_100011586 3300005843 Bacteria 8694
196 Ga0068860_100104553 3300005843 Bacteria 2703
197 Ga0068860_100116222 3300005843 Bacteria 2559
198 Ga0068862_100007883 3300005844 Bacteria 8812
199 Ga0068862_100283482 3300005844 Bacteria 1519
200 Ga0075363_100007306 3300006048 Bacteria 5066
201 Ga0075364_10159044 3300006051 Bacteria 1524
202 Ga0075362_10012411 3300006177 Bacteria 3384
203 Ga0075362_10024479 3300006177 Bacteria 2561
204 Ga0075367_10003540 3300006178 Bacteria 7469
205 Ga0075367_10010023 3300006178 Bacteria 4965
206 Ga0075367_10020279 3300006178 Bacteria 3699
207 Ga0075367_10100393 3300006178 Bacteria 1768
208 Ga0075369_10006310 3300006186 Bacteria 4479
209 Ga0075366_10004769 3300006195 Bacteria 7313
210 Ga0075366_10006048 3300006195 Bacteria 6593
211 Ga0075366_10008731 3300006195 Bacteria 5642
212 Ga0075366_10012069 3300006195 Bacteria 4893
213 Ga0075366_10027438 3300006195 Bacteria 3340
214 Ga0075366_10072758 3300006195 Bacteria 2048
215 Ga0075366_10087914 3300006195 Bacteria 1861
216 Ga0075366_10095865 3300006195 Bacteria 1779
217 Ga0075366_10111105 3300006195 Bacteria 1648
218 Ga0075366_10142635 3300006195 Bacteria 1449
219 Ga0075366_10145499 3300006195 Bacteria 1434
220 Ga0075366_10162681 3300006195 Bacteria 1352
221 Ga0097621_100010996 3300006237 Bacteria 6648
222 Ga0097621_100011620 3300006237 Bacteria 6492
223 Ga0097621_100035014 3300006237 Bacteria 4009
224 Ga0097621_100065798 3300006237 Bacteria 2984
225 Ga0097621_100125754 3300006237 Bacteria 2177
226 Ga0097621_100138249 3300006237 Bacteria 2080
227 Ga0075370_10000058 3300006353 Bacteria 32658
228 Ga0075370_10000309 3300006353 Bacteria 17630
229 Ga0075370_10001852 3300006353 Bacteria 9478
230 Ga0075370_10005206 3300006353 Bacteria 6433
231 Ga0075370_10028537 3300006353 Bacteria 3102
232 Ga0075370_10049240 3300006353 Bacteria 2388
233 Ga0075370_10067197 3300006353 Bacteria 2046
234 Ga0075370_10094258 3300006353 Bacteria 1729
235 Ga0068871_100019544 3300006358 Bacteria 5174
236 Ga0068871_100030326 3300006358 Bacteria 4257
237 Ga0068871_100165884 3300006358 Bacteria 1891
238 Ga0068871_100252060 3300006358 Bacteria 1538
239 Ga0068871_100429821 3300006358 Bacteria 1180
240 Ga0075428_100638243 3300006844 Bacteria 1136
241 Ga0075429_100022073 3300006880 Bacteria 5521
242 Ga0068865_100016331 3300006881 Bacteria 4750
243 Ga0097620_100006126 3300006931 Bacteria 12221
244 Ga0097620_100046990 3300006931 Bacteria 4335
245 Ga0097620_100055369 3300006931 Bacteria 3992
246 Ga0097620_100076724 3300006931 Bacteria 3382
247 Ga0097620_100263110 3300006931 Bacteria 1816
248 Ga0097620_100453462 3300006931 Bacteria 1379
249 Ga0099823_1013910 3300006944 Bacteria 8072
250 Ga0079104_1000219 3300006946 Bacteria 79928
251 Ga0105240_10056490 3300009093 Bacteria 4911
252 Ga0105245_10019948 3300009098 Bacteria 5878
253 Ga0105245_10086804 3300009098 Bacteria 2870
254 Ga0105245_10177935 3300009098 Bacteria 2030
255 Ga0114129_10225999 3300009147 Bacteria 2523
256 Ga0105243_10005579 3300009148 Bacteria 9801
257 Ga0105243_10027205 3300009148 Bacteria 4380
258 Ga0105243_10075641 3300009148 Bacteria 2734
259 Ga0105243_10076482 3300009148 Bacteria 2720
260 Ga0105243_10183478 3300009148 Bacteria 1822
261 Ga0105243_10254998 3300009148 Bacteria 1568
262 Ga0105243_10425451 3300009148 Bacteria 1240
263 Ga0105241_10392015 3300009174 Bacteria 1216
264 Ga0105242_10093683 3300009176 Bacteria 2533
265 Ga0105242_10108564 3300009176 Bacteria 2362
266 Ga0105242_10252702 3300009176 Bacteria 1589
267 Ga0105248_10059118 3300009177 Bacteria 4305
268 Ga0105248_10094534 3300009177 Bacteria 3366
269 Ga0105248_10102774 3300009177 Bacteria 3221
270 Ga0105248_10129449 3300009177 Bacteria 2847
271 Ga0105248_10143573 3300009177 Bacteria 2693
272 Ga0105237_10001461 3300009545 Bacteria 31169
273 Ga0105237_10015735 3300009545 Bacteria 7865
274 Ga0105237_10029245 3300009545 Bacteria 5604
275 Ga0105237_10100294 3300009545 Bacteria 2887
276 Ga0105238_10041551 3300009551 Bacteria 4656
277 Ga0105249_10005956 3300009553 Bacteria 10564
278 Ga0105249_10441764 3300009553 Bacteria 1338
279 Ga0105239_10000798 3300010375 Bacteria 44685
280 Ga0105239_10389407 3300010375 Bacteria 1576
281 Ga0105239_10701336 3300010375 Bacteria 1157
282 Ga0105239_10776161 3300010375 Bacteria 1097
283 Ga0157317_1001003 3300012475 Bacteria 1422
284 Ga0157319_1000001 3300012497 Bacteria 423237
285 Ga0157373_10044395 3300013100 Bacteria 3173
286 Ga0157369_10246035 3300013105 Bacteria 1867
287 Ga0157369_10689220 3300013105 Bacteria 1052
288 Ga0157374_10034608 3300013296 Bacteria 4616
289 Ga0157374_10169179 3300013296 Bacteria 2131
290 Ga0157378_10026414 3300013297 Bacteria 5118
291 Ga0157378_10099437 3300013297 Bacteria 2654
292 Ga0157378_10343340 3300013297 Bacteria 1457
293 Ga0157378_10595247 3300013297 Bacteria 1116
294 Ga0163162_10002995 3300013306 Bacteria 16145
295 Ga0163162_10034726 3300013306 Bacteria 5020
296 Ga0163162_10052199 3300013306 Bacteria 4106
297 Ga0163162_10112573 3300013306 Bacteria 2820
298 Ga0157372_10988954 3300013307 Bacteria 974
299 Ga0157375_10011447 3300013308 Bacteria 7833
300 Ga0157375_10022022 3300013308 Bacteria 5860
301 Ga0157375_10028630 3300013308 Bacteria 5227
302 Ga0157375_10066886 3300013308 Bacteria 3589
303 Ga0157375_10073701 3300013308 Bacteria 3433
304 Ga0157375_10201742 3300013308 Bacteria 2145
305 Ga0157375_10251130 3300013308 Bacteria 1929
306 Ga0157375_10384036 3300013308 Bacteria 1571
307 Ga0163163_10045264 3300014325 Bacteria 4319
308 Ga0163163_10200494 3300014325 Bacteria 2044
309 Ga0157380_10024747 3300014326 Bacteria 4547
310 Ga0157380_10038429 3300014326 Bacteria 3716
311 Ga0157380_10044937 3300014326 Bacteria 3464
312 Ga0157380_10145152 3300014326 Bacteria 2044
313 Ga0157380_10149420 3300014326 Bacteria 2018
314 Ga0157380_10184452 3300014326 Bacteria 1836
315 Ga0157377_10000038 3300014745 Bacteria 113777
316 Ga0157377_10017418 3300014745 Bacteria 3715
317 Ga0157379_10008098 3300014968 Bacteria 9127
318 Ga0157379_10041068 3300014968 Bacteria 4129
319 Ga0157379_10064914 3300014968 Bacteria 3263
320 Ga0157379_10076979 3300014968 Bacteria 2987
321 Ga0157379_10148959 3300014968 Bacteria 2111
322 Ga0157376_10016516 3300014969 Bacteria 5607
323 Ga0157376_10034451 3300014969 Bacteria 4089
324 Ga0157376_10379927 3300014969 Bacteria 1360
325 Ga0182007_10021855 3300015262 Bacteria 2266
326 Ga0163161_10004047 3300017792 Bacteria 10254
327 Ga0163161_10023239 3300017792 Bacteria 4372
328 Ga0163161_10061561 3300017792 Bacteria 2732
329 Ga0163161_10174345 3300017792 Bacteria 1646
330 Ga0163161_10428099 3300017792 Bacteria 1066
331 Ga0213872_10000003 3300021361 Bacteria 366948
332 Ga0213872_10000046 3300021361 Bacteria 109934
333 Ga0213872_10000124 3300021361 Bacteria 72197
334 Ga0213872_10003125 3300021361 Bacteria 9306
335 Ga0213872_10019223 3300021361 Bacteria 3147
336 Ga0213872_10025664 3300021361 Bacteria 2708
337 Ga0213872_10035777 3300021361 Bacteria 2270
338 Ga0209563_100005 3300025230 Bacteria 1774893
339 Ga0207425_1000135 3300025245 Bacteria 66450
340 Ga0209129_1000043 3300025258 Bacteria 298978
341 Ga0209565_1011977 3300025263 Bacteria 2086
342 Ga0207666_1001401 3300025271 Bacteria 2841
343 Ga0209673_1006841 3300025273 Bacteria 5407
344 Ga0209673_1016786 3300025273 Bacteria 2724
345 Ga0209675_1007084 3300025291 Bacteria 4369
346 Ga0209564_1000005 3300025295 Bacteria 1147192
347 Ga0209564_1000014 3300025295 Bacteria 621501
348 Ga0209758_1000492 3300025297 Bacteria 64511
349 Ga0209758_1005135 3300025297 Bacteria 10334
350 Ga0209050_1000493 3300025298 Bacteria 67885
351 Ga0209050_1000543 3300025298 Bacteria 62404
352 Ga0209050_1003305 3300025298 Bacteria 12067
353 Ga0209050_1033582 3300025298 Bacteria 1553
354 Ga0209256_1000092 3300025299 Bacteria 210547
355 Ga0209256_1000213 3300025299 Bacteria 108298
356 Ga0209256_1005252 3300025299 Bacteria 7563
357 Ga0209051_1000020 3300025303 Bacteria 508628
358 Ga0209051_1005067 3300025303 Bacteria 7833
359 Ga0209051_1010963 3300025303 Bacteria 4521
360 Ga0209257_1000017 3300025304 Bacteria 866287
361 Ga0209257_1000189 3300025304 Bacteria 153917
362 Ga0209257_1000805 3300025304 Bacteria 45597
363 Ga0209257_1000913 3300025304 Bacteria 41162
364 Ga0209257_1024150 3300025304 Bacteria 2113
365 Ga0209257_1031534 3300025304 Bacteria 1694
366 Ga0207697_10027645 3300025315 Bacteria 2319
367 Ga0207656_10061537 3300025321 Bacteria 1648
368 Ga0207656_10063503 3300025321 Bacteria 1626
369 Ga0207682_10001133 3300025893 Bacteria 12330
370 Ga0207682_10002990 3300025893 Bacteria 7417
371 Ga0207682_10013224 3300025893 Bacteria 3218
372 Ga0207682_10023137 3300025893 Bacteria 2453
373 Ga0207682_10038238 3300025893 Bacteria 1946
374 Ga0207688_10123877 3300025901 Bacteria 1510
375 Ga0207680_10020608 3300025903 Bacteria 3554
376 Ga0207645_10001485 3300025907 Bacteria 19163
377 Ga0207645_10003455 3300025907 Bacteria 11994
378 Ga0207643_10043348 3300025908 Bacteria 2539
379 Ga0207643_10105249 3300025908 Bacteria 1658
380 Ga0207705_10035148 3300025909 Bacteria 3585
381 Ga0207705_10177492 3300025909 Bacteria 1606
382 Ga0207684_10018378 3300025910 Bacteria 5985
383 Ga0207695_10042429 3300025913 Bacteria 4859
384 Ga0207671_10010195 3300025914 Bacteria 7780
385 Ga0207671_10253053 3300025914 Bacteria 1385
386 Ga0207662_10033599 3300025918 Bacteria 2991
387 Ga0207662_10058170 3300025918 Bacteria 2313
388 Ga0207657_10056764 3300025919 Bacteria 3376
389 Ga0207657_10109249 3300025919 Bacteria 2286
390 Ga0207657_10151582 3300025919 Bacteria 1888
391 Ga0207657_10506731 3300025919 Bacteria 945
392 Ga0207649_10001821 3300025920 Bacteria 12174
393 Ga0207649_10294009 3300025920 Bacteria 1185
394 Ga0207646_10180410 3300025922 Bacteria 1907
395 Ga0207681_10004618 3300025923 Bacteria 8465
396 Ga0207681_10026584 3300025923 Bacteria 3734
397 Ga0207681_10403638 3300025923 Bacteria 1104
398 Ga0207694_10025174 3300025924 Bacteria 4521
399 Ga0207694_10418624 3300025924 Bacteria 1116
400 Ga0207650_10001149 3300025925 Bacteria 19437
401 Ga0207650_10003908 3300025925 Bacteria 10189
402 Ga0207650_10055912 3300025925 Bacteria 2931
403 Ga0207650_10378100 3300025925 Bacteria 1169
404 Ga0207659_10000477 3300025926 Bacteria 24093
405 Ga0207659_10000691 3300025926 Bacteria 20035
406 Ga0207659_10032109 3300025926 Bacteria 3600
407 Ga0207659_10112447 3300025926 Bacteria 2072
408 Ga0207687_10007233 3300025927 Bacteria 7321
409 Ga0207687_10064103 3300025927 Bacteria 2604
410 Ga0207687_10110502 3300025927 Bacteria 2039
411 Ga0207644_10001362 3300025931 Bacteria 15719
412 Ga0207644_10002098 3300025931 Bacteria 12916
413 Ga0207644_10006058 3300025931 Bacteria 7888
414 Ga0207644_10012856 3300025931 Bacteria 5568
415 Ga0207644_10034811 3300025931 Bacteria 3525
416 Ga0207644_10098074 3300025931 Bacteria 2196
417 Ga0207690_10005130 3300025932 Bacteria 7732
418 Ga0207706_10000756 3300025933 Bacteria 33603
419 Ga0207706_10001466 3300025933 Bacteria 23574
420 Ga0207706_10004450 3300025933 Bacteria 13166
421 Ga0207706_10051089 3300025933 Bacteria 3651
422 Ga0207706_10120264 3300025933 Bacteria 2309
423 Ga0207706_10141138 3300025933 Bacteria 2119
424 Ga0207706_10159532 3300025933 Bacteria 1983
425 Ga0207686_10006958 3300025934 Bacteria 6088
426 Ga0207686_10262698 3300025934 Bacteria 1266
427 Ga0207686_10388882 3300025934 Bacteria 1060
428 Ga0207709_10003694 3300025935 Bacteria 9012
429 Ga0207709_10106040 3300025935 Bacteria 1869
430 Ga0207709_10185783 3300025935 Bacteria 1472
431 Ga0207670_10025777 3300025936 Bacteria 3696
432 Ga0207670_10080473 3300025936 Bacteria 2277
433 Ga0207669_10005292 3300025937 Bacteria 5773
434 Ga0207669_10085614 3300025937 Bacteria 2035
435 Ga0207669_10098013 3300025937 Bacteria 1929
436 Ga0207704_10085429 3300025938 Bacteria 2054
437 Ga0207704_10188428 3300025938 Bacteria 1498
438 Ga0207691_10001243 3300025940 Bacteria 25438
439 Ga0207691_10003923 3300025940 Bacteria 14453
440 Ga0207691_10005630 3300025940 Bacteria 12112
441 Ga0207691_10017263 3300025940 Bacteria 6846
442 Ga0207691_10039879 3300025940 Bacteria 4343
443 Ga0207691_10111776 3300025940 Bacteria 2429
444 Ga0207691_10141115 3300025940 Bacteria 2123
445 Ga0207691_10244532 3300025940 Bacteria 1550
446 Ga0207711_10021174 3300025941 Bacteria 5431
447 Ga0207711_10087955 3300025941 Bacteria 2727
448 Ga0207711_10225169 3300025941 Bacteria 1716
449 Ga0207711_10332043 3300025941 Bacteria 1406
450 Ga0207689_10006829 3300025942 Bacteria 10035
451 Ga0207689_10012976 3300025942 Bacteria 7115
452 Ga0207689_10015924 3300025942 Bacteria 6366
453 Ga0207689_10207502 3300025942 Bacteria 1618
454 Ga0207689_10569822 3300025942 Bacteria 952
455 Ga0207661_10109080 3300025944 Bacteria 2338
456 Ga0207661_10214944 3300025944 Bacteria 1696
457 Ga0207679_10000249 3300025945 Bacteria 41064
458 Ga0207679_10024487 3300025945 Bacteria 4139
459 Ga0207679_10083377 3300025945 Bacteria 2450
460 Ga0207679_10130780 3300025945 Bacteria 2013
461 Ga0207679_10554680 3300025945 Bacteria 1031
462 Ga0207651_10001278 3300025960 Bacteria 11329
463 Ga0207651_10016116 3300025960 Bacteria 4366
464 Ga0207651_10175494 3300025960 Bacteria 1694
465 Ga0207651_10198323 3300025960 Bacteria 1606
466 Ga0207651_10249569 3300025960 Bacteria 1451
467 Ga0207651_10268485 3300025960 Bacteria 1404
468 Ga0207651_10325067 3300025960 Bacteria 1287
469 Ga0207668_10004912 3300025972 Bacteria 7862
470 Ga0207668_10215294 3300025972 Bacteria 1539
471 Ga0207668_10294430 3300025972 Bacteria 1337
472 Ga0207658_10001089 3300025986 Bacteria 21924
473 Ga0207658_10018268 3300025986 Bacteria 4839
474 Ga0207658_10027241 3300025986 Bacteria 4013
475 Ga0207658_10064121 3300025986 Bacteria 2755
476 Ga0207658_10205475 3300025986 Bacteria 1647
477 Ga0207677_10003776 3300026023 Bacteria 8043
478 Ga0207677_10008741 3300026023 Bacteria 5671
479 Ga0207677_10032641 3300026023 Bacteria 3350
480 Ga0207677_10063934 3300026023 Bacteria 2560
481 Ga0207677_10069721 3300026023 Bacteria 2474
482 Ga0207677_10081795 3300026023 Bacteria 2319
483 Ga0207703_10000996 3300026035 Bacteria 27254
484 Ga0207703_10011365 3300026035 Bacteria 6926
485 Ga0207703_10041270 3300026035 Bacteria 3695
486 Ga0207703_10085277 3300026035 Bacteria 2643
487 Ga0207639_10014119 3300026041 Bacteria 5608
488 Ga0207639_10026149 3300026041 Bacteria 4239
489 Ga0207639_10213351 3300026041 Bacteria 1663
490 Ga0207639_10599492 3300026041 Bacteria 1016
491 Ga0207678_10000966 3300026067 Bacteria 26297
492 Ga0207678_10022962 3300026067 Bacteria 5459
493 Ga0207678_10170485 3300026067 Bacteria 1858
494 Ga0207678_10182419 3300026067 Bacteria 1792
495 Ga0207708_10012827 3300026075 Bacteria 6249
496 Ga0207702_10039270 3300026078 Bacteria 3965
497 Ga0207641_10007488 3300026088 Bacteria 9086
498 Ga0207641_10014783 3300026088 Bacteria 6400
499 Ga0207641_10017054 3300026088 Bacteria 5942
500 Ga0207641_10387053 3300026088 Bacteria 1340
501 Ga0207648_10000118 3300026089 Bacteria 77144
502 Ga0207648_10002634 3300026089 Bacteria 19183
503 Ga0207648_10003767 3300026089 Bacteria 15842
504 Ga0207648_10028344 3300026089 Bacteria 4965
505 Ga0207648_10034335 3300026089 Bacteria 4471
506 Ga0207648_10048712 3300026089 Bacteria 3709
507 Ga0207648_10086378 3300026089 Bacteria 2737
508 Ga0207648_10144132 3300026089 Bacteria 2101
509 Ga0207676_10002837 3300026095 Bacteria 12331
510 Ga0207676_10008453 3300026095 Bacteria 7319
511 Ga0207676_10024294 3300026095 Bacteria 4482
512 Ga0207676_10075841 3300026095 Bacteria 2714
513 Ga0207676_10171182 3300026095 Bacteria 1892
514 Ga0207676_10197356 3300026095 Bacteria 1775
515 Ga0207674_10053978 3300026116 Bacteria 4094
516 Ga0207674_10310100 3300026116 Bacteria 1527
517 Ga0207674_10346592 3300026116 Bacteria 1436
518 Ga0207674_10488682 3300026116 Bacteria 1190
519 Ga0207675_100002744 3300026118 Bacteria 17315
520 Ga0207675_100003062 3300026118 Bacteria 16396
521 Ga0207675_100003340 3300026118 Bacteria 15701
522 Ga0207675_100054366 3300026118 Bacteria 3735
523 Ga0207683_10004250 3300026121 Bacteria 12360
524 Ga0207683_10040254 3300026121 Bacteria 4077
525 Ga0207683_10070680 3300026121 Bacteria 3084
526 Ga0207683_10098580 3300026121 Bacteria 2607
527 Ga0207683_10123684 3300026121 Bacteria 2323
528 Ga0207683_10216173 3300026121 Bacteria 1746
529 Ga0207698_10002449 3300026142 Bacteria 11002
530 Ga0207698_10028828 3300026142 Bacteria 3965
531 Ga0207698_10044988 3300026142 Bacteria 3322
532 Ga0207698_10067441 3300026142 Bacteria 2821
533 Ga0207698_10080338 3300026142 Bacteria 2626
534 Ga0209281_1000074 3300027111 Bacteria 267848
535 Ga0209389_1029316 3300027296 Bacteria 4683
536 Ga0209996_1001245 3300027395 Bacteria 3073
537 Ga0209968_1000261 3300027526 Bacteria 8985
538 Ga0209970_1001467 3300027614 Bacteria 4121
539 Ga0209966_1000074 3300027695 Bacteria 43833
540 Ga0209813_10046708 3300027866 Bacteria 1338
541 Ga0209974_10038421 3300027876 Bacteria 1591
542 Ga0209974_10110227 3300027876 Bacteria 968
543 Ga0268266_10038784 3300028379 Bacteria 4055
544 Ga0268266_10144301 3300028379 Bacteria 2139
545 Ga0268265_10598748 3300028380 Bacteria 1053
546 Ga0268264_10001857 3300028381 Bacteria 19207
547 Ga0268264_10002570 3300028381 Bacteria 15905
548 Ga0268264_10005397 3300028381 Bacteria 10824
549 Ga0307517_10010725 3300028786 Bacteria 12781
550 Ga0307517_10087776 3300028786 Bacteria 2580
551 Ga0307515_10000165 3300028794 Bacteria 162589
552 Ga0307515_10000188 3300028794 Bacteria 151439
553 Ga0307515_10005461 3300028794 Bacteria 25733
554 Ga0307515_10018969 3300028794 Bacteria 12413
555 Ga0307515_10029938 3300028794 Bacteria 9173
556 Ga0307515_10105203 3300028794 Bacteria 3363
557 Ga0307515_10178168 3300028794 Bacteria 2087
558 Ga0307512_10045736 3300030522 Bacteria 3579
559 Ga0307512_10187295 3300030522 Bacteria 1149
560 Ga0265328_10009090 3300031239 Bacteria 4059
561 Ga0265331_10002493 3300031250 Bacteria 12446
562 Ga0265327_10000144 3300031251 Bacteria 156779
563 Ga0265327_10000210 3300031251 Bacteria 122385
564 Ga0265316_10000005 3300031344 Bacteria 304442
565 Ga0307513_10001902 3300031456 Bacteria 29673
566 Ga0307513_10008355 3300031456 Bacteria 13260
567 Ga0307513_10017436 3300031456 Bacteria 8610
568 Ga0307513_10138011 3300031456 Bacteria 2370
569 Ga0307513_10294259 3300031456 Bacteria 1393
570 Ga0307513_10318897 3300031456 Bacteria 1313
571 Ga0307509_10000234 3300031507 Bacteria 89398
572 Ga0307509_10056928 3300031507 Bacteria 4147
573 Ga0307509_10146314 3300031507 Bacteria 2288
574 Ga0307408_100000038 3300031548 Bacteria 183170
575 Ga0307408_100064886 3300031548 Bacteria 2676
576 Ga0307408_100200356 3300031548 Bacteria 1615
577 Ga0307408_100300530 3300031548 Bacteria 1344
578 Ga0307508_10000169 3300031616 Bacteria 78769
579 Ga0307508_10044094 3300031616 Bacteria 3991
580 Ga0307514_10013831 3300031649 Bacteria 6687
581 Ga0307514_10051134 3300031649 Bacteria 3204
582 Ga0307514_10072288 3300031649 Bacteria 2583
583 Ga0316576_10006300 3300031727 Bacteria 7373
584 Ga0316576_10021087 3300031727 Bacteria 4500
585 Ga0316578_10000172 3300031728 Bacteria 17665
586 Ga0316578_10014111 3300031728 Bacteria 4257
587 Ga0307516_10000311 3300031730 Bacteria 63197
588 Ga0307516_10000326 3300031730 Bacteria 61941
589 Ga0307516_10000897 3300031730 Bacteria 40914
590 Ga0307516_10446494 3300031730 Bacteria 950
591 Ga0307405_10011775 3300031731 Bacteria 4603
592 Ga0307405_10014690 3300031731 Bacteria 4219
593 Ga0307405_10109461 3300031731 Bacteria 1869
594 Ga0307405_10303706 3300031731 Bacteria 1212
595 Ga0307518_10292677 3300031838 Bacteria 997
596 Ga0307410_10020161 3300031852 Bacteria 4072
597 Ga0307410_10031911 3300031852 Bacteria 3385
598 Ga0307410_10052069 3300031852 Bacteria 2763
599 Ga0307406_10028541 3300031901 Bacteria 3372
600 Ga0307406_10361782 3300031901 Bacteria 1138
601 Ga0307407_10078395 3300031903 Bacteria 1990
602 Ga0307412_10006968 3300031911 Bacteria 6418
603 Ga0307412_10017136 3300031911 Bacteria 4332
604 Ga0307412_10028415 3300031911 Bacteria 3498
605 Ga0307412_10140247 3300031911 Bacteria 1769
606 Ga0307412_10315739 3300031911 Bacteria 1241
607 Ga0307409_100002191 3300031995 Bacteria 10092
608 Ga0307409_100007440 3300031995 Bacteria 6550
609 Ga0307416_100002040 3300032002 Bacteria 11368
610 Ga0307416_100030437 3300032002 Bacteria 4050
611 Ga0307416_100035298 3300032002 Bacteria 3817
612 Ga0307416_100532570 3300032002 Bacteria 1245
613 Ga0307416_100658449 3300032002 Bacteria 1133
614 Ga0307414_10062189 3300032004 Bacteria 2648
615 Ga0307411_10000111 3300032005 Bacteria 25501
616 Ga0307411_10005718 3300032005 Bacteria 6145
617 Ga0307411_10219080 3300032005 Bacteria 1475
618 Ga0307415_100012627 3300032126 Bacteria 4891
619 Ga0316593_10007882 3300032168 Bacteria 2945
620 Ga0307507_10053173 3300033179 Bacteria 3873
621 Ga0307507_10087111 3300033179 Bacteria 2702
622 Ga0307510_10003147 3300033180 Bacteria 19133
623 Ga0307510_10022531 3300033180 Bacteria 7314
624 Ga0316592_1008210 3300033524 Bacteria 2057
625 Ga0316592_1047859 3300033524 Bacteria 953
626 Ga0316588_1017053 3300033528 Bacteria 1616
627 Ga0316596_1005666 3300033541 Bacteria 2864
628 Ga0316596_1050199 3300033541 Bacteria 1103
629 Ga0373930_0018783 3300034816 Bacteria 1333
630 Ga0373940_0011703 3300035088 Bacteria 2089
631 Ga0373951_0015495 3300035091 Bacteria 1717
632 Ga0373939_0000004 3300035114 Bacteria 106519
633 Ga0373939_0060531 3300035114 Bacteria 1204
634 Ga0373956_0059059 3300035119 Bacteria 1735
635 Ga0373960_0006274 3300035121 Bacteria 2784
636 Ga0373943_0050329 3300035170 Bacteria 2047
637 Ga0373946_0040358 3300035171 Bacteria 1909
638 Ga0373962_0006239 3300035242 Bacteria 2885
639 Ga0373924_0034927 3300035410 Bacteria 2038
640 Ga0373931_0000546 3300035691 Bacteria 15448
641 Ga0373931_0009953 3300035691 Bacteria 4557
642 Ga0373935_0031345 3300035692 Bacteria 3299
643 Ga0373927_0039242 3300035695 Bacteria 3073
644 Ga0373937_0019374 3300036401 Bacteria 6091
645 Ga0373937_0097556 3300036401 Bacteria 2726
646 Ga0316584_0028137 3300036712 Bacteria 4142
647 Ga0316584_0091968 3300036712 Bacteria 2271
648 Ga0373925_0035960 3300037068 Bacteria 3656
649 Ga0373925_0094578 3300037068 Bacteria 2288
650 Ga0373925_0210626 3300037068 Bacteria 1548
651 Ga0373925_0267503 3300037068 Bacteria 1374
652 Ga0395900_0000355 3300037418 Bacteria 66598
653 Ga0395900_0508785 3300037418 Bacteria 1154
654 Ga0395905_0000777 3300037471 Bacteria 41933
655 Ga0395905_0003411 3300037471 Bacteria 17002
656 Ga0395905_0004659 3300037471 Bacteria 14178
657 Ga0395905_0008552 3300037471 Bacteria 10093
658 Ga0395905_0009989 3300037471 Bacteria 9251
659 Ga0395905_0023405 3300037471 Bacteria 5837
660 Ga0395905_0178674 3300037471 Bacteria 1992
661 Ga0395905_0328566 3300037471 Bacteria 1419
662 Ga0436365_0561202 3300039437 Bacteria 1329
663 Ga0436365_0936688 3300039437 Bacteria 1470
664 Ga0436361_0003822 3300039447 Bacteria 65675
665 Ga0436361_0633280 3300039447 Bacteria 103480
666 Ga0436361_0638016 3300039447 Bacteria 61418
667 Ga0436361_0895746 3300039447 Bacteria 1379
668 Ga0436361_0916159 3300039447 Bacteria 49060
669 Ga0436361_1079715 3300039447 Bacteria 4877
670 Ga0439461_0045495 3300041410 Bacteria 960
671 Ga0451798_0696078 3300041458 Bacteria 2059
672 Ga0451802_0574082 3300041460 Bacteria 1954
673 Ga0451807_1744250 3300041486 Bacteria 1149
674 Ga0451833_1159483 3300041491 Bacteria 1441
675 Ga0451841_0774662 3300041498 Bacteria 1035
676 Ga0451843_1695661 3300041509 Bacteria 1307
677 Ga0451853_2209517 3300041512 Bacteria 1102
678 Ga0439431_0001589 3300041997 Bacteria 5033
679 Ga0439449_0083375 3300042007 Bacteria 1179
680 Ga0439450_021953 3300042008 Bacteria 1374
681 Ga0439455_0000995 3300042012 Bacteria 4450
682 Ga0450890_001964 3300042127 Bacteria 2906
683 Ga0450889_001429 3300042144 Bacteria 2461
684 Ga0439446_0008764 3300042156 Bacteria 2695
685 Ga0439458_0047443 3300042157 Bacteria 1054
686 Ga0439459_0000191 3300042438 Bacteria 6711
687 Ga0439460_0010600 3300042461 Bacteria 2364
688 Ga0450916_000815 3300042530 Bacteria 2921
689 Ga0450918_001043 3300042531 Bacteria 5715
690 Ga0451577_0000641 3300042876 Bacteria 55722
691 Ga0451577_0008482 3300042876 Bacteria 10003
692 Ga0451577_0011912 3300042876 Bacteria 8199
693 Ga0451577_0015837 3300042876 Bacteria 6997
694 Ga0451577_0038688 3300042876 Bacteria 4289
695 Ga0451577_0077908 3300042876 Bacteria 2956
696 Ga0451577_0318412 3300042876 Bacteria 1410
697 Ga0451577_0415163 3300042876 Bacteria 1222
698 Ga0451577_0592286 3300042876 Bacteria 1006
699 Ga0466969_0000028 3300044656 Bacteria 92394
700 Ga0466972_0001085 3300044658 Bacteria 13048
701 Ga0466972_0029875 3300044658 Bacteria 2683
702 Ga0466966_0008387 3300044684 Bacteria 6843
703 Ga0466966_0020086 3300044684 Bacteria 4395
704 Ga0466961_0018744 3300044693 Bacteria 4452
705 Ga0466963_0000306 3300044694 Bacteria 22103
706 Ga0466964_0010048 3300044706 Bacteria 3565
707 Ga0466964_0178118 3300044706 Bacteria 1006
708 Ga0453684_0001818 3300044712 Bacteria 56168
709 Ga0453684_0009747 3300044712 Bacteria 16684
710 Ga0453684_0137499 3300044712 Bacteria 2922
711 Ga0453684_0157052 3300044712 Bacteria 2695
712 Ga0453684_0195762 3300044712 Bacteria 2361
713 Ga0453684_0314595 3300044712 Bacteria 1775
714 Ga0466971_0028647 3300044719 Bacteria 2491
715 Ga0466968_0050105 3300044735 Bacteria 1780
716 Ga0466970_0038282 3300044765 Bacteria 2543
717 Ga0466970_0111191 3300044765 Bacteria 1496
718 Ga0466957_0053737 3300044842 Bacteria 2456
719 Ga0466959_0001676 3300045049 Bacteria 13723
720 Ga0466959_0082802 3300045049 Bacteria 2311
721 Ga0451576_0002104 3300045051 Bacteria 31012
722 Ga0451576_0015228 3300045051 Bacteria 8526
723 Ga0451576_0019110 3300045051 Bacteria 7487
724 Ga0451576_0039970 3300045051 Bacteria 4966
725 Ga0451576_0237748 3300045051 Bacteria 1902
726 Ga0451576_0432301 3300045051 Bacteria 1381
727 Ga0466958_0159955 3300045836 Bacteria 1422
728 Ga0495592_0012833 3300046454 Bacteria 6370
729 Ga0495590_0016223 3300046457 Bacteria 2692
730 Ga0495590_0039265 3300046457 Bacteria 1651
731 Ga0495629_0025312 3300046459 Bacteria 4220
732 Ga0495629_0219417 3300046459 Bacteria 1312
733 Ga0495638_0127217 3300046460 Bacteria 1501
734 Ga0495638_0216196 3300046460 Bacteria 1074
735 Ga0495650_0000976 3300046471 Bacteria 32712
736 Ga0495580_0125242 3300046472 Bacteria 1783
737 Ga0495583_0042459 3300046506 Bacteria 2124
738 Ga0495606_0184383 3300046507 Bacteria 1201
739 Ga0495628_0301160 3300046516 Bacteria 1187
740 Ga0495632_0003074 3300046519 Bacteria 12127
741 Ga0495632_0006463 3300046519 Bacteria 7529
742 Ga0495642_0039547 3300046528 Bacteria 1914
743 Ga0495586_0064987 3300046535 Bacteria 1989
744 Ga0495621_0002740 3300046539 Bacteria 4781
745 Ga0495597_0022439 3300046542 Bacteria 2928
746 Ga0495625_0053069 3300046660 Bacteria 2901
747 Ga0495625_0079548 3300046660 Bacteria 2285
748 Ga0495658_0016429 3300046683 Bacteria 3810
749 Ga0495613_0060723 3300046689 Bacteria 2768
750 Ga0495670_0020117 3300046691 Bacteria 3290
751 Ga0495649_0001852 3300046694 Bacteria 15512
752 Ga0495674_0168034 3300047319 Bacteria 1832
753 Ga0495676_0054670 3300047321 Bacteria 3172
754 Ga0495687_000367 3300047443 Bacteria 56387
755 Ga0495687_006395 3300047443 Bacteria 7229
756 Ga0495684_0078731 3300047471 Bacteria 2502
757 Ga0495686_0006531 3300047472 Bacteria 8906
758 Ga0495593_0093103 3300047673 Bacteria 1551
759 Ga0496102_0003534 3300048905 Bacteria 13246
760 Ga0496102_0005742 3300048905 Bacteria 10544
761 Ga0496104_0106712 3300048907 Bacteria 2684
762 Ga0496104_0593837 3300048907 Bacteria 1018
763 Ga0496106_0012481 3300048909 Bacteria 6274
764 Ga0496106_0074237 3300048909 Bacteria 2603
765 Ga0496106_0121074 3300048909 Bacteria 2045
766 Ga0496108_0037095 3300048911 Bacteria 4059
767 Ga0496108_0115085 3300048911 Bacteria 2303
768 Ga0496109_0258525 3300048912 Bacteria 1640
769 Ga0496110_0096611 3300048913 Bacteria 2648
770 Ga0496110_0100048 3300048913 Bacteria 2599
771 Ga0496110_0258867 3300048913 Bacteria 1584
772 Ga0496110_0542526 3300048913 Bacteria 1057
773 Ga0496111_0016712 3300048914 Bacteria 5062
774 Ga0496112_0043915 3300048915 Bacteria 4376
775 Ga0496113_0006211 3300048916 Bacteria 7549
776 Ga0496113_0203823 3300048916 Bacteria 1573
777 Ga0496114_0007670 3300048917 Bacteria 8534
778 Ga0496121_0022834 3300048924 Bacteria 6048
779 Ga0496122_0074566 3300048925 Bacteria 2400
780 Ga0496124_0000138 3300048927 Bacteria 150311
781 Ga0496124_0063527 3300048927 Bacteria 3084
782 Ga0496124_0123263 3300048927 Bacteria 2068
783 Ga0496125_0001189 3300048928 Bacteria 39370
784 Ga0496125_0197833 3300048928 Bacteria 1320
785 Ga0501308_004681 3300049128 Bacteria 1331
786 Ga0501304_002933 3300049160 Bacteria 1220
787 Ga0501292_015918 3300049515 Bacteria 1179
788 Ga0501300_008168 3300049523 Bacteria 1533
789 Ga0501314_003951 3300049530 Bacteria 1213
790 Ga0501034_0375546 3300049571 Bacteria 1347
791 Ga0501039_0362830 3300049575 Bacteria 1138
792 Ga0501041_0088284 3300049577 Bacteria 1914
793 Ga0501043_0000002 3300049579 Bacteria 351081
794 Ga0501046_0000008 3300049580 Bacteria 351167
795 Ga0501047_0000003 3300049581 Bacteria 508375
796 Ga0501198_000014 3300049649 Bacteria 106940
797 Ga0501201_004887 3300049651 Bacteria 1248
798 Ga0501206_008312 3300049653 Bacteria 1370
799 Ga0501211_001618 3300049658 Bacteria 2411
800 Ga0501222_000008 3300049662 Bacteria 120904
801 Ga0501222_001642 3300049662 Bacteria 3107
802 Ga0501223_004639 3300049663 Bacteria 2924
803 Ga0501227_002798 3300049665 Bacteria 3831
804 Ga0501233_018737 3300049668 Bacteria 1459
805 Ga0501235_008379 3300049669 Bacteria 2256
806 Ga0501236_013541 3300049670 Bacteria 1117
807 Ga0501252_003010 3300049682 Bacteria 1713
808 Ga0501253_008366 3300049683 Bacteria 1486
809 Ga0501221_002992 3300049704 Bacteria 2785
810 Ga0501229_000954 3300049706 Bacteria 3272
811 Ga0501262_003682 3300049759 Bacteria 1766
812 Ga0501267_001793 3300049764 Bacteria 1876
813 Ga0501268_004583 3300049765 Bacteria 1954
814 Ga0501272_001041 3300049769 Bacteria 2558
815 Ga0501282_004903 3300049778 Bacteria 1430
816 Ga0501283_001477 3300049779 Bacteria 3042
817 Ga0501045_0012726 3300049824 Bacteria 5927
818 nmdc:mga00v17_19912_c1 3300050491 Bacteria 3837
819 nmdc:mga00v17_36384_c1 3300050491 Bacteria 2933
820 nmdc:mga00v17_90001_c1 3300050491 Bacteria 1926
821 nmdc:mga0k408_101548_c1 3300050493 Bacteria 1696
822 nmdc:mga0k408_104944_c1 3300050493 Bacteria 1668
823 nmdc:mga0k408_111673_c1 3300050493 Bacteria 1616
824 nmdc:mga0k408_137584_c1 3300050493 Bacteria 1452
825 nmdc:mga0k408_17696_c1 3300050493 Bacteria 3972
826 nmdc:mga0k408_23013_c1 3300050493 Bacteria 3512
827 nmdc:mga0k408_24559_c1 3300050493 Bacteria 3408
828 nmdc:mga0k408_24684_c1 3300050493 Bacteria 3399
829 nmdc:mga0k408_24760_c1 3300050493 Bacteria 3395
830 nmdc:mga0k408_26432_c1 3300050493 Bacteria 3291
831 nmdc:mga0k408_4347_c1 3300050493 Bacteria 7526
832 nmdc:mga0k408_5357_c1 3300050493 Bacteria 4614
833 nmdc:mga0k408_67349_c1 3300050493 Bacteria 2087
834 nmdc:mga0k408_734_c1 3300050493 Bacteria 16164
835 nmdc:mga0k408_7706_c1 3300050493 Bacteria 5754
836 nmdc:mga06z11_32273_c1 3300050494 Bacteria 2553
837 nmdc:mga06z11_33419_c1 3300050494 Bacteria 2516
838 nmdc:mga04h51_71035_c1 3300050495 Bacteria 1215
839 nmdc:mga07m45_14178_c1 3300050496 Bacteria 4240
840 nmdc:mga07m45_19348_c1 3300050496 Bacteria 3689
841 nmdc:mga07m45_194694_c1 3300050496 Bacteria 1179
842 nmdc:mga07m45_25391_c1 3300050496 Bacteria 3249
843 nmdc:mga07m45_57_c1 3300050496 Bacteria 46544
844 nmdc:mga07m45_7428_c1 3300050496 Bacteria 5601
845 nmdc:mga07m45_79116_c1 3300050496 Bacteria 1876
846 nmdc:mga07m45_8433_c1 3300050496 Bacteria 5300
847 nmdc:mga05p37_351329_c1 3300050507 Bacteria 1736
848 nmdc:mga09592_5629_c1 3300050508 Bacteria 10213
849 nmdc:mga0sz30_29883_c1 3300050516 Bacteria 2249
850 Ga0495619_0028690 3300053085 Bacteria 3591
851 Ga0500578_0000058 3300053086 Bacteria 119650
852 Ga0500578_0054149 3300053086 Bacteria 2569
853 Ga0500646_0025159 3300053090 Bacteria 1606
854 Ga0500583_0043952 3300053092 Bacteria 2043
855 Ga0500651_0009126 3300053093 Bacteria 5876
856 Ga0500651_0019235 3300053093 Bacteria 4240
857 Ga0500651_0059450 3300053093 Bacteria 2389
858 Ga0500593_001065 3300053117 Bacteria 9913
859 Ga0500623_051234 3300053127 Bacteria 2075
860 Ga0500642_0003464 3300053130 Bacteria 4773
861 Ga0500652_000027 3300053131 Bacteria 98912
862 Ga0500655_004171 3300053133 Bacteria 2602
863 Ga0500658_0091271 3300053134 Bacteria 1317
864 Ga0500658_0115906 3300053134 Bacteria 1184
865 Ga0500559_0000119 3300053136 Bacteria 62358
866 Ga0500568_0014139 3300053139 Bacteria 3614
867 Ga0500568_0049683 3300053139 Bacteria 1654
868 Ga0500573_0133676 3300053140 Bacteria 1372
869 Ga0500590_011236 3300053148 Bacteria 4534
870 Ga0500616_0050411 3300053153 Bacteria 2199
871 Ga0500619_000611 3300053154 Bacteria 6094
872 Ga0500622_0000221 3300053156 Bacteria 59833
873 Ga0500622_0004359 3300053156 Bacteria 8936
874 Ga0500622_0005218 3300053156 Bacteria 7857
875 Ga0500645_006045 3300053730 Bacteria 4369
876 Ga0500645_059627 3300053730 Bacteria 1105
877 Ga0590071_000370 3300059421 Bacteria 13155
878 Ga0501082_0139543 3300060353 Bacteria 2104
879 Ga0466962_0026119 3300061719 Bacteria 2804

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003320 rootH2_10003861 rootH2_100038619 237
2 3300041410 Ga0439461_0045495 Ga0439461_0045495_22_747 237
3 iso_pu_bacteria 2585428062 2587758582 257
4 3300028794 Ga0307515_10000165 Ga0307515_10000165130 258
5 3300013297 Ga0157378_10595247 Ga0157378_105952472 261
6 3300025931 Ga0207644_10098074 Ga0207644_100980743 261
7 3300030522 Ga0307512_10045736 Ga0307512_100457363 261
8 3300031507 Ga0307509_10146314 Ga0307509_101463143 261
9 3300031616 Ga0307508_10000169 Ga0307508_1000016930 261
10 3300031649 Ga0307514_10013831 Ga0307514_100138314 261
11 3300033179 Ga0307507_10053173 Ga0307507_100531733 261
12 3300042876 Ga0451577_0592286 Ga0451577_0592286_32_826 261
13 3300047673 Ga0495593_0093103 Ga0495593_0093103_74_859 261
14 3300053092 Ga0500583_0043952 Ga0500583_0043952_11_796 261
15 3300025972 Ga0207668_10294430 Ga0207668_102944302 267
16 3300005530 Ga0070679_100006907 Ga0070679_1000069074 268
17 3300005564 Ga0070664_100049307 Ga0070664_1000493071 268
18 3300025945 Ga0207679_10083377 Ga0207679_100833771 268
19 3300042531 Ga0450918_001043 Ga0450918_001043_896_1762 269
20 3300042876 Ga0451577_0008482 Ga0451577_0008482_6389_7255 269
21 3300048905 Ga0496102_0003534 Ga0496102_0003534_3261_4127 269
22 3300053086 Ga0500578_0000058 Ga0500578_0000058_20049_20915 269
23 3300021361 Ga0213872_10003125 Ga0213872_100031253 270
24 3300039447 Ga0436361_0916159 Ga0436361_0916159_46016_46894 270
25 3300049649 Ga0501198_000014 Ga0501198_000014_12247_13113 270
26 3300049662 Ga0501222_000008 Ga0501222_000008_91371_92237 270
27 3300005615 Ga0070702_100412145 Ga0070702_1004121451 272
28 3300025972 Ga0207668_10215294 Ga0207668_102152942 272
29 3300031911 Ga0307412_10140247 Ga0307412_101402472 272
30 3300006844 Ga0075428_100638243 Ga0075428_1006382432 273
31 3300031344 Ga0265316_10000005 Ga0265316_10000005150 275
32 3300042876 Ga0451577_0415163 Ga0451577_0415163_37_873 276
33 3300049575 Ga0501039_0362830 Ga0501039_0362830_111_947 276
34 3300049577 Ga0501041_0088284 Ga0501041_0088284_179_1015 276
35 3300006195 Ga0075366_10027438 Ga0075366_100274383 277
36 3300050493 nmdc:mga0k408_24760_c1 nmdc:mga0k408_24760_c1_500_1366 277
37 3300003794 Ga0055531_10000214 Ga0055531_1000021437 278
38 3300025303 Ga0209051_1010963 Ga0209051_10109633 278
39 3300025304 Ga0209257_1000017 Ga0209257_1000017597 278
40 3300042157 Ga0439458_0047443 Ga0439458_0047443_205_1044 279
41 3300050496 nmdc:mga07m45_194694_c1 nmdc:mga07m45_194694_c1_27_866 279
42 3300006195 Ga0075366_10072758 Ga0075366_100727581 280
43 3300025304 Ga0209257_1024150 Ga0209257_10241503 280
44 3300037471 Ga0395905_0178674 Ga0395905_0178674_858_1724 280
45 3300050493 nmdc:mga0k408_24684_c1 nmdc:mga0k408_24684_c1_2400_3293 280
46 3300005353 Ga0070669_100082423 Ga0070669_1000824233 281
47 3300005441 Ga0070700_100018609 Ga0070700_1000186092 281
48 3300005456 Ga0070678_100322351 Ga0070678_1003223512 281
49 3300005459 Ga0068867_100002447 Ga0068867_1000024473 281
50 3300005617 Ga0068859_100453483 Ga0068859_1004534833 281
51 3300005718 Ga0068866_10218004 Ga0068866_102180042 281
52 3300005719 Ga0068861_100004823 Ga0068861_1000048233 281
53 3300005843 Ga0068860_100011586 Ga0068860_1000115863 281
54 3300006881 Ga0068865_100016331 Ga0068865_1000163314 281
55 3300006931 Ga0097620_100453462 Ga0097620_1004534623 281
56 3300009148 Ga0105243_10075641 Ga0105243_100756414 281
57 3300009553 Ga0105249_10005956 Ga0105249_100059566 281
58 3300013306 Ga0163162_10002995 Ga0163162_1000299517 281
59 3300013308 Ga0157375_10251130 Ga0157375_102511302 281
60 3300014326 Ga0157380_10038429 Ga0157380_100384293 281
61 3300014968 Ga0157379_10148959 Ga0157379_101489592 281
62 3300014969 Ga0157376_10379927 Ga0157376_103799272 281
63 3300017792 Ga0163161_10174345 Ga0163161_101743452 281
64 3300025935 Ga0207709_10185783 Ga0207709_101857832 281
65 3300025937 Ga0207669_10085614 Ga0207669_100856143 281
66 3300025938 Ga0207704_10188428 Ga0207704_101884282 281
67 3300025940 Ga0207691_10111776 Ga0207691_101117764 281
68 3300026089 Ga0207648_10002634 Ga0207648_1000263413 281
69 3300026118 Ga0207675_100003062 Ga0207675_1000030624 281
70 3300028381 Ga0268264_10002570 Ga0268264_100025703 281
71 3300031548 Ga0307408_100200356 Ga0307408_1002003562 281
72 3300031727 Ga0316576_10006300 Ga0316576_100063004 281
73 3300031731 Ga0307405_10011775 Ga0307405_100117753 281
74 3300031852 Ga0307410_10020161 Ga0307410_100201614 281
75 3300031901 Ga0307406_10028541 Ga0307406_100285414 281
76 3300031903 Ga0307407_10078395 Ga0307407_100783952 281
77 3300031911 Ga0307412_10006968 Ga0307412_100069684 281
78 3300031995 Ga0307409_100007440 Ga0307409_1000074402 281
79 3300032002 Ga0307416_100035298 Ga0307416_1000352984 281
80 3300032004 Ga0307414_10062189 Ga0307414_100621894 281
81 3300032005 Ga0307411_10005718 Ga0307411_100057182 281
82 3300036712 Ga0316584_0091968 Ga0316584_0091968_712_1611 281
83 3300049571 Ga0501034_0375546 Ga0501034_0375546_354_1223 282
84 iso_pu_bacteria 2585428057 2587728879 284
85 iso_pu_bacteria 2585428058 2587736480 284
86 iso_pu_bacteria 2588253510 2588294661 284
87 iso_pu_bacteria 2643221592 2643970512 284
88 iso_pu_bacteria 2643221625 2644142751 284
89 iso_pu_bacteria 2643221644 2644246335 284
90 iso_pu_bacteria 2643221648 2644272688 284
91 iso_pu_bacteria 2643221654 2644303951 284
92 iso_pu_bacteria 2643221660 2644340396 284
93 iso_pu_bacteria 2919704043 2919707233 284
94 iso_pu_bacteria 2831864461 2831869470 285
95 iso_pu_bacteria 2886848708 2886853728 285
96 3300053117 Ga0500593_001065 Ga0500593_001065_3262_4122 286
97 3300042876 Ga0451577_0000641 Ga0451577_0000641_15544_16434 287
98 3300044712 Ga0453684_0001818 Ga0453684_0001818_39735_40625 287
99 3300045051 Ga0451576_0002104 Ga0451576_0002104_25575_26483 287
100 3300002077 JGI24744J21845_10009695 JGI24744J21845_100096952 288
101 3300003215 JGI25153J46596_10010114 JGI25153J46596_100101143 288
102 3300003322 rootL2_10008947 rootL2_100089474 288
103 3300003322 rootL2_10011993 rootL2_100119933 288
104 3300003323 rootH1_10027651 rootH1_100276519 288
105 3300003759 Ga0055525_1000011 Ga0055525_1000011391 288
106 3300003771 Ga0055526_1002081 Ga0055526_10020816 288
107 3300003771 Ga0055526_1009068 Ga0055526_10090683 288
108 3300003775 Ga0055524_1000423 Ga0055524_10004236 288
109 3300003791 Ga0055530_10026604 Ga0055530_100266041 288
110 3300003791 Ga0055530_10032948 Ga0055530_100329482 288
111 3300003792 Ga0055540_1000015 Ga0055540_100001560 288
112 3300003794 Ga0055531_10012695 Ga0055531_100126953 288
113 3300003794 Ga0055531_10012745 Ga0055531_100127453 288
114 3300004625 Ga0055543_1002451 Ga0055543_10024514 288
115 3300004625 Ga0055543_1018468 Ga0055543_10184682 288
116 3300005262 Ga0065165_1000024 Ga0065165_100002448 288
117 3300005262 Ga0065165_1000401 Ga0065165_100040128 288
118 3300005262 Ga0065165_1007960 Ga0065165_10079604 288
119 3300005289 Ga0065704_10115258 Ga0065704_101152582 288
120 3300005295 Ga0065707_10086296 Ga0065707_100862964 288
121 3300005327 Ga0070658_10442350 Ga0070658_104423501 288
122 3300005328 Ga0070676_10002580 Ga0070676_100025803 288
123 3300005328 Ga0070676_10003107 Ga0070676_100031076 288
124 3300005328 Ga0070676_10176335 Ga0070676_101763351 288
125 3300005328 Ga0070676_10182727 Ga0070676_101827271 288
126 3300005329 Ga0070683_100001824 Ga0070683_1000018241 288
127 3300005330 Ga0070690_100015822 Ga0070690_1000158222 288
128 3300005330 Ga0070690_100027719 Ga0070690_1000277193 288
129 3300005331 Ga0070670_100000817 Ga0070670_1000008174 288
130 3300005331 Ga0070670_100030985 Ga0070670_1000309853 288
131 3300005331 Ga0070670_100113628 Ga0070670_1001136281 288
132 3300005331 Ga0070670_100120306 Ga0070670_1001203062 288
133 3300005333 Ga0070677_10011646 Ga0070677_100116463 288
134 3300005333 Ga0070677_10108708 Ga0070677_101087082 288
135 3300005333 Ga0070677_10119071 Ga0070677_101190711 288
136 3300005333 Ga0070677_10128255 Ga0070677_101282551 288
137 3300005334 Ga0068869_100008068 Ga0068869_1000080683 288
138 3300005334 Ga0068869_100011581 Ga0068869_1000115817 288
139 3300005334 Ga0068869_100049338 Ga0068869_1000493383 288
140 3300005334 Ga0068869_100315725 Ga0068869_1003157251 288
141 3300005335 Ga0070666_10000785 Ga0070666_1000078520 288
142 3300005337 Ga0070682_100195879 Ga0070682_1001958792 288
143 3300005338 Ga0068868_100007918 Ga0068868_1000079184 288
144 3300005338 Ga0068868_100047011 Ga0068868_1000470113 288
145 3300005338 Ga0068868_100063355 Ga0068868_1000633553 288
146 3300005338 Ga0068868_100095787 Ga0068868_1000957874 288
147 3300005338 Ga0068868_100345864 Ga0068868_1003458642 288
148 3300005339 Ga0070660_100285612 Ga0070660_1002856121 288
149 3300005340 Ga0070689_100036794 Ga0070689_1000367943 288
150 3300005343 Ga0070687_100024523 Ga0070687_1000245233 288
151 3300005343 Ga0070687_100035933 Ga0070687_1000359332 288
152 3300005344 Ga0070661_100001209 Ga0070661_10000120910 288
153 3300005344 Ga0070661_100044171 Ga0070661_1000441714 288
154 3300005344 Ga0070661_100236421 Ga0070661_1002364212 288
155 3300005347 Ga0070668_100020742 Ga0070668_1000207425 288
156 3300005347 Ga0070668_100024278 Ga0070668_1000242785 288
157 3300005347 Ga0070668_100028843 Ga0070668_1000288433 288
158 3300005347 Ga0070668_100039349 Ga0070668_1000393493 288
159 3300005353 Ga0070669_100031357 Ga0070669_1000313573 288
160 3300005353 Ga0070669_100072267 Ga0070669_1000722671 288
161 3300005353 Ga0070669_100130631 Ga0070669_1001306312 288
162 3300005353 Ga0070669_100153435 Ga0070669_1001534352 288
163 3300005354 Ga0070675_100000285 Ga0070675_10000028538 288
164 3300005354 Ga0070675_100003281 Ga0070675_1000032819 288
165 3300005354 Ga0070675_100035548 Ga0070675_1000355483 288
166 3300005354 Ga0070675_100045165 Ga0070675_1000451653 288
167 3300005354 Ga0070675_100172746 Ga0070675_1001727462 288
168 3300005355 Ga0070671_100002575 Ga0070671_10000257513 288
169 3300005355 Ga0070671_100011706 Ga0070671_1000117064 288
170 3300005355 Ga0070671_100015522 Ga0070671_1000155221 288
171 3300005355 Ga0070671_100019406 Ga0070671_1000194064 288
172 3300005355 Ga0070671_100049253 Ga0070671_1000492532 288
173 3300005355 Ga0070671_100074679 Ga0070671_1000746791 288
174 3300005355 Ga0070671_100083482 Ga0070671_1000834824 288
175 3300005355 Ga0070671_100090319 Ga0070671_1000903191 288
176 3300005355 Ga0070671_100134959 Ga0070671_1001349591 288
177 3300005355 Ga0070671_100349687 Ga0070671_1003496871 288
178 3300005356 Ga0070674_100032006 Ga0070674_1000320065 288
179 3300005356 Ga0070674_100046123 Ga0070674_1000461233 288
180 3300005364 Ga0070673_100001009 Ga0070673_1000010098 288
181 3300005364 Ga0070673_100013002 Ga0070673_1000130023 288
182 3300005364 Ga0070673_100058983 Ga0070673_1000589832 288
183 3300005364 Ga0070673_100159301 Ga0070673_1001593012 288
184 3300005364 Ga0070673_100178321 Ga0070673_1001783213 288
185 3300005364 Ga0070673_100230122 Ga0070673_1002301222 288
186 3300005366 Ga0070659_100005054 Ga0070659_1000050544 288
187 3300005366 Ga0070659_100014835 Ga0070659_1000148353 288
188 3300005366 Ga0070659_100097584 Ga0070659_1000975842 288
189 3300005367 Ga0070667_100002773 Ga0070667_1000027735 288
190 3300005367 Ga0070667_100003684 Ga0070667_10000368411 288
191 3300005367 Ga0070667_100004040 Ga0070667_1000040407 288
192 3300005367 Ga0070667_100028787 Ga0070667_1000287874 288
193 3300005367 Ga0070667_100052972 Ga0070667_1000529726 288
194 3300005367 Ga0070667_100105409 Ga0070667_1001054092 288
195 3300005367 Ga0070667_100236828 Ga0070667_1002368282 288
196 3300005367 Ga0070667_100306561 Ga0070667_1003065612 288
197 3300005367 Ga0070667_100459851 Ga0070667_1004598511 288
198 3300005455 Ga0070663_100000774 Ga0070663_10000077416 288
199 3300005455 Ga0070663_100004332 Ga0070663_10000433211 288
200 3300005455 Ga0070663_100180664 Ga0070663_1001806642 288
201 3300005456 Ga0070678_100013525 Ga0070678_1000135253 288
202 3300005456 Ga0070678_100027689 Ga0070678_1000276894 288
203 3300005456 Ga0070678_100119433 Ga0070678_1001194333 288
204 3300005456 Ga0070678_100409008 Ga0070678_1004090082 288
205 3300005457 Ga0070662_100069801 Ga0070662_1000698012 288
206 3300005457 Ga0070662_100164880 Ga0070662_1001648802 288
207 3300005459 Ga0068867_100000042 Ga0068867_10000004259 288
208 3300005459 Ga0068867_100004433 Ga0068867_10000443311 288
209 3300005459 Ga0068867_100007433 Ga0068867_1000074332 288
210 3300005459 Ga0068867_100023789 Ga0068867_1000237893 288
211 3300005459 Ga0068867_100038381 Ga0068867_1000383812 288
212 3300005459 Ga0068867_100050732 Ga0068867_1000507323 288
213 3300005459 Ga0068867_100193634 Ga0068867_1001936342 288
214 3300005467 Ga0070706_100006300 Ga0070706_1000063009 288
215 3300005468 Ga0070707_100365515 Ga0070707_1003655152 288
216 3300005468 Ga0070707_100626795 Ga0070707_1006267951 288
217 3300005471 Ga0070698_100136280 Ga0070698_1001362803 288
218 3300005518 Ga0070699_100565021 Ga0070699_1005650211 288
219 3300005539 Ga0068853_100043022 Ga0068853_1000430223 288
220 3300005539 Ga0068853_100146170 Ga0068853_1001461702 288
221 3300005543 Ga0070672_100001055 Ga0070672_10000105518 288
222 3300005543 Ga0070672_100003224 Ga0070672_1000032248 288
223 3300005543 Ga0070672_100005119 Ga0070672_1000051197 288
224 3300005543 Ga0070672_100037899 Ga0070672_1000378993 288
225 3300005543 Ga0070672_100060089 Ga0070672_1000600892 288
226 3300005543 Ga0070672_100069134 Ga0070672_1000691342 288
227 3300005543 Ga0070672_100088044 Ga0070672_1000880442 288
228 3300005548 Ga0070665_100189898 Ga0070665_1001898982 288
229 3300005548 Ga0070665_100243450 Ga0070665_1002434502 288
230 3300005563 Ga0068855_100056667 Ga0068855_1000566673 288
231 3300005564 Ga0070664_100018592 Ga0070664_1000185924 288
232 3300005564 Ga0070664_100097436 Ga0070664_1000974364 288
233 3300005564 Ga0070664_100691812 Ga0070664_1006918121 288
234 3300005577 Ga0068857_100054241 Ga0068857_1000542413 288
235 3300005577 Ga0068857_100462992 Ga0068857_1004629922 288
236 3300005578 Ga0068854_100081182 Ga0068854_1000811823 288
237 3300005578 Ga0068854_100103875 Ga0068854_1001038753 288
238 3300005614 Ga0068856_100030381 Ga0068856_1000303813 288
239 3300005614 Ga0068856_100046644 Ga0068856_1000466443 288
240 3300005614 Ga0068856_100071622 Ga0068856_1000716221 288
241 3300005614 Ga0068856_100261102 Ga0068856_1002611022 288
242 3300005615 Ga0070702_100041875 Ga0070702_1000418752 288
243 3300005616 Ga0068852_100005860 Ga0068852_10000586010 288
244 3300005616 Ga0068852_100042868 Ga0068852_1000428682 288
245 3300005616 Ga0068852_100059785 Ga0068852_1000597854 288
246 3300005616 Ga0068852_100094336 Ga0068852_1000943364 288
247 3300005616 Ga0068852_100102707 Ga0068852_1001027072 288
248 3300005616 Ga0068852_100103478 Ga0068852_1001034784 288
249 3300005616 Ga0068852_100177915 Ga0068852_1001779152 288
250 3300005617 Ga0068859_100006127 Ga0068859_10000612713 288
251 3300005617 Ga0068859_100046989 Ga0068859_1000469893 288
252 3300005617 Ga0068859_100055367 Ga0068859_1000553675 288
253 3300005617 Ga0068859_100076727 Ga0068859_1000767274 288
254 3300005617 Ga0068859_100263104 Ga0068859_1002631042 288
255 3300005618 Ga0068864_100008087 Ga0068864_1000080873 288
256 3300005618 Ga0068864_100016853 Ga0068864_1000168534 288
257 3300005618 Ga0068864_100023050 Ga0068864_1000230505 288
258 3300005618 Ga0068864_100079544 Ga0068864_1000795444 288
259 3300005618 Ga0068864_100273556 Ga0068864_1002735562 288
260 3300005718 Ga0068866_10009815 Ga0068866_100098153 288
261 3300005718 Ga0068866_10240878 Ga0068866_102408781 288
262 3300005719 Ga0068861_100003647 Ga0068861_1000036475 288
263 3300005719 Ga0068861_100092008 Ga0068861_1000920083 288
264 3300005719 Ga0068861_100115763 Ga0068861_1001157633 288
265 3300005719 Ga0068861_100425157 Ga0068861_1004251572 288
266 3300005834 Ga0068851_10021056 Ga0068851_100210565 288
267 3300005834 Ga0068851_10033511 Ga0068851_100335113 288
268 3300005834 Ga0068851_10055387 Ga0068851_100553872 288
269 3300005834 Ga0068851_10134934 Ga0068851_101349342 288
270 3300005840 Ga0068870_10085206 Ga0068870_100852062 288
271 3300005841 Ga0068863_100003799 Ga0068863_1000037996 288
272 3300005841 Ga0068863_100004935 Ga0068863_1000049353 288
273 3300005841 Ga0068863_100024370 Ga0068863_1000243703 288
274 3300005841 Ga0068863_100124200 Ga0068863_1001242002 288
275 3300005841 Ga0068863_100174157 Ga0068863_1001741572 288
276 3300005841 Ga0068863_100225772 Ga0068863_1002257722 288
277 3300005842 Ga0068858_100002240 Ga0068858_10000224013 288
278 3300005842 Ga0068858_100018725 Ga0068858_1000187252 288
279 3300005842 Ga0068858_100030676 Ga0068858_1000306764 288
280 3300005842 Ga0068858_100100687 Ga0068858_1001006873 288
281 3300005843 Ga0068860_100000445 Ga0068860_10000044516 288
282 3300005843 Ga0068860_100104553 Ga0068860_1001045534 288
283 3300005843 Ga0068860_100116222 Ga0068860_1001162223 288
284 3300005844 Ga0068862_100007883 Ga0068862_1000078833 288
285 3300005844 Ga0068862_100283482 Ga0068862_1002834822 288
286 3300006048 Ga0075363_100007306 Ga0075363_1000073063 288
287 3300006051 Ga0075364_10159044 Ga0075364_101590442 288
288 3300006177 Ga0075362_10012411 Ga0075362_100124115 288
289 3300006177 Ga0075362_10024479 Ga0075362_100244792 288
290 3300006178 Ga0075367_10003540 Ga0075367_1000354010 288
291 3300006178 Ga0075367_10010023 Ga0075367_100100233 288
292 3300006178 Ga0075367_10020279 Ga0075367_100202793 288
293 3300006178 Ga0075367_10100393 Ga0075367_101003932 288
294 3300006186 Ga0075369_10006310 Ga0075369_100063104 288
295 3300006195 Ga0075366_10004769 Ga0075366_100047697 288
296 3300006195 Ga0075366_10006048 Ga0075366_100060488 288
297 3300006195 Ga0075366_10008731 Ga0075366_100087314 288
298 3300006195 Ga0075366_10012069 Ga0075366_100120693 288
299 3300006195 Ga0075366_10087914 Ga0075366_100879142 288
300 3300006195 Ga0075366_10095865 Ga0075366_100958652 288
301 3300006195 Ga0075366_10111105 Ga0075366_101111052 288
302 3300006195 Ga0075366_10142635 Ga0075366_101426352 288
303 3300006195 Ga0075366_10145499 Ga0075366_101454992 288
304 3300006195 Ga0075366_10162681 Ga0075366_101626811 288
305 3300006237 Ga0097621_100010996 Ga0097621_1000109963 288
306 3300006237 Ga0097621_100011620 Ga0097621_1000116203 288
307 3300006237 Ga0097621_100035014 Ga0097621_1000350143 288
308 3300006237 Ga0097621_100065798 Ga0097621_1000657982 288
309 3300006237 Ga0097621_100125754 Ga0097621_1001257542 288
310 3300006237 Ga0097621_100138249 Ga0097621_1001382493 288
311 3300006353 Ga0075370_10000058 Ga0075370_100000583 288
312 3300006353 Ga0075370_10000309 Ga0075370_100003094 288
313 3300006353 Ga0075370_10001852 Ga0075370_1000185210 288
314 3300006353 Ga0075370_10005206 Ga0075370_100052064 288
315 3300006353 Ga0075370_10028537 Ga0075370_100285373 288
316 3300006353 Ga0075370_10049240 Ga0075370_100492404 288
317 3300006353 Ga0075370_10067197 Ga0075370_100671972 288
318 3300006353 Ga0075370_10094258 Ga0075370_100942581 288
319 3300006358 Ga0068871_100019544 Ga0068871_1000195443 288
320 3300006358 Ga0068871_100030326 Ga0068871_1000303263 288
321 3300006358 Ga0068871_100165884 Ga0068871_1001658841 288
322 3300006358 Ga0068871_100252060 Ga0068871_1002520602 288
323 3300006358 Ga0068871_100429821 Ga0068871_1004298212 288
324 3300006880 Ga0075429_100022073 Ga0075429_1000220733 288
325 3300006931 Ga0097620_100006126 Ga0097620_10000612613 288
326 3300006931 Ga0097620_100046990 Ga0097620_1000469903 288
327 3300006931 Ga0097620_100055369 Ga0097620_1000553693 288
328 3300006931 Ga0097620_100076724 Ga0097620_1000767242 288
329 3300006931 Ga0097620_100263110 Ga0097620_1002631102 288
330 3300006944 Ga0099823_1013910 Ga0099823_10139109 288
331 3300006946 Ga0079104_1000219 Ga0079104_100021927 288
332 3300009093 Ga0105240_10056490 Ga0105240_100564902 288
333 3300009098 Ga0105245_10019948 Ga0105245_100199487 288
334 3300009098 Ga0105245_10086804 Ga0105245_100868043 288
335 3300009098 Ga0105245_10177935 Ga0105245_101779352 288
336 3300009147 Ga0114129_10225999 Ga0114129_102259993 288
337 3300009148 Ga0105243_10005579 Ga0105243_100055793 288
338 3300009148 Ga0105243_10027205 Ga0105243_100272052 288
339 3300009148 Ga0105243_10076482 Ga0105243_100764822 288
340 3300009148 Ga0105243_10183478 Ga0105243_101834783 288
341 3300009148 Ga0105243_10254998 Ga0105243_102549981 288
342 3300009148 Ga0105243_10425451 Ga0105243_104254511 288
343 3300009174 Ga0105241_10392015 Ga0105241_103920152 288
344 3300009176 Ga0105242_10093683 Ga0105242_100936833 288
345 3300009176 Ga0105242_10108564 Ga0105242_101085644 288
346 3300009176 Ga0105242_10252702 Ga0105242_102527021 288
347 3300009177 Ga0105248_10059118 Ga0105248_100591183 288
348 3300009177 Ga0105248_10094534 Ga0105248_100945344 288
349 3300009177 Ga0105248_10102774 Ga0105248_101027742 288
350 3300009177 Ga0105248_10129449 Ga0105248_101294492 288
351 3300009177 Ga0105248_10143573 Ga0105248_101435734 288
352 3300009545 Ga0105237_10001461 Ga0105237_1000146114 288
353 3300009545 Ga0105237_10015735 Ga0105237_100157353 288
354 3300009545 Ga0105237_10029245 Ga0105237_100292459 288
355 3300009545 Ga0105237_10100294 Ga0105237_101002942 288
356 3300009551 Ga0105238_10041551 Ga0105238_100415515 288
357 3300009553 Ga0105249_10441764 Ga0105249_104417642 288
358 3300010375 Ga0105239_10000798 Ga0105239_1000079838 288
359 3300010375 Ga0105239_10389407 Ga0105239_103894073 288
360 3300010375 Ga0105239_10701336 Ga0105239_107013361 288
361 3300010375 Ga0105239_10776161 Ga0105239_107761611 288
362 3300012475 Ga0157317_1001003 Ga0157317_10010032 288
363 3300012497 Ga0157319_1000001 Ga0157319_100000181 288
364 3300013100 Ga0157373_10044395 Ga0157373_100443953 288
365 3300013105 Ga0157369_10246035 Ga0157369_102460352 288
366 3300013105 Ga0157369_10689220 Ga0157369_106892201 288
367 3300013296 Ga0157374_10034608 Ga0157374_100346082 288
368 3300013296 Ga0157374_10169179 Ga0157374_101691793 288
369 3300013297 Ga0157378_10026414 Ga0157378_100264144 288
370 3300013297 Ga0157378_10099437 Ga0157378_100994373 288
371 3300013297 Ga0157378_10343340 Ga0157378_103433401 288
372 3300013306 Ga0163162_10034726 Ga0163162_100347263 288
373 3300013306 Ga0163162_10052199 Ga0163162_100521993 288
374 3300013306 Ga0163162_10112573 Ga0163162_101125733 288
375 3300013307 Ga0157372_10988954 Ga0157372_109889541 288
376 3300013308 Ga0157375_10011447 Ga0157375_100114473 288
377 3300013308 Ga0157375_10022022 Ga0157375_100220224 288
378 3300013308 Ga0157375_10028630 Ga0157375_100286305 288
379 3300013308 Ga0157375_10066886 Ga0157375_100668862 288
380 3300013308 Ga0157375_10073701 Ga0157375_100737012 288
381 3300013308 Ga0157375_10201742 Ga0157375_102017422 288
382 3300013308 Ga0157375_10384036 Ga0157375_103840361 288
383 3300014325 Ga0163163_10045264 Ga0163163_100452644 288
384 3300014325 Ga0163163_10200494 Ga0163163_102004943 288
385 3300014326 Ga0157380_10024747 Ga0157380_100247472 288
386 3300014326 Ga0157380_10044937 Ga0157380_100449373 288
387 3300014326 Ga0157380_10145152 Ga0157380_101451524 288
388 3300014326 Ga0157380_10149420 Ga0157380_101494202 288
389 3300014326 Ga0157380_10184452 Ga0157380_101844522 288
390 3300014745 Ga0157377_10000038 Ga0157377_1000003858 288
391 3300014745 Ga0157377_10017418 Ga0157377_100174185 288
392 3300014968 Ga0157379_10008098 Ga0157379_100080983 288
393 3300014968 Ga0157379_10041068 Ga0157379_100410683 288
394 3300014968 Ga0157379_10064914 Ga0157379_100649143 288
395 3300014968 Ga0157379_10076979 Ga0157379_100769792 288
396 3300014969 Ga0157376_10016516 Ga0157376_100165165 288
397 3300014969 Ga0157376_10034451 Ga0157376_100344514 288
398 3300015262 Ga0182007_10021855 Ga0182007_100218552 288
399 3300017792 Ga0163161_10004047 Ga0163161_100040476 288
400 3300017792 Ga0163161_10023239 Ga0163161_100232392 288
401 3300017792 Ga0163161_10061561 Ga0163161_100615612 288
402 3300017792 Ga0163161_10428099 Ga0163161_104280991 288
403 3300021361 Ga0213872_10000003 Ga0213872_10000003306 288
404 3300021361 Ga0213872_10000046 Ga0213872_1000004681 288
405 3300021361 Ga0213872_10000124 Ga0213872_1000012416 288
406 3300021361 Ga0213872_10019223 Ga0213872_100192233 288
407 3300021361 Ga0213872_10025664 Ga0213872_100256642 288
408 3300021361 Ga0213872_10035777 Ga0213872_100357773 288
409 3300025230 Ga0209563_100005 Ga0209563_100005717 288
410 3300025245 Ga0207425_1000135 Ga0207425_100013539 288
411 3300025258 Ga0209129_1000043 Ga0209129_1000043247 288
412 3300025263 Ga0209565_1011977 Ga0209565_10119771 288
413 3300025271 Ga0207666_1001401 Ga0207666_10014013 288
414 3300025273 Ga0209673_1006841 Ga0209673_10068413 288
415 3300025273 Ga0209673_1016786 Ga0209673_10167863 288
416 3300025291 Ga0209675_1007084 Ga0209675_10070844 288
417 3300025295 Ga0209564_1000005 Ga0209564_1000005426 288
418 3300025295 Ga0209564_1000014 Ga0209564_1000014354 288
419 3300025297 Ga0209758_1000492 Ga0209758_100049231 288
420 3300025297 Ga0209758_1005135 Ga0209758_100513512 288
421 3300025298 Ga0209050_1000493 Ga0209050_100049336 288
422 3300025298 Ga0209050_1000543 Ga0209050_100054365 288
423 3300025298 Ga0209050_1003305 Ga0209050_10033051 288
424 3300025298 Ga0209050_1033582 Ga0209050_10335821 288
425 3300025299 Ga0209256_1000092 Ga0209256_100009232 288
426 3300025299 Ga0209256_1000213 Ga0209256_100021363 288
427 3300025299 Ga0209256_1005252 Ga0209256_10052521 288
428 3300025303 Ga0209051_1000020 Ga0209051_1000020308 288
429 3300025303 Ga0209051_1005067 Ga0209051_10050673 288
430 3300025304 Ga0209257_1000189 Ga0209257_100018942 288
431 3300025304 Ga0209257_1000805 Ga0209257_100080536 288
432 3300025304 Ga0209257_1000913 Ga0209257_100091332 288
433 3300025304 Ga0209257_1031534 Ga0209257_10315342 288
434 3300025315 Ga0207697_10027645 Ga0207697_100276452 288
435 3300025321 Ga0207656_10061537 Ga0207656_100615372 288
436 3300025321 Ga0207656_10063503 Ga0207656_100635032 288
437 3300025893 Ga0207682_10001133 Ga0207682_1000113313 288
438 3300025893 Ga0207682_10002990 Ga0207682_100029908 288
439 3300025893 Ga0207682_10013224 Ga0207682_100132242 288
440 3300025893 Ga0207682_10023137 Ga0207682_100231373 288
441 3300025893 Ga0207682_10038238 Ga0207682_100382382 288
442 3300025901 Ga0207688_10123877 Ga0207688_101238773 288
443 3300025903 Ga0207680_10020608 Ga0207680_100206082 288
444 3300025907 Ga0207645_10001485 Ga0207645_1000148512 288
445 3300025907 Ga0207645_10003455 Ga0207645_100034559 288
446 3300025908 Ga0207643_10043348 Ga0207643_100433481 288
447 3300025908 Ga0207643_10105249 Ga0207643_101052493 288
448 3300025909 Ga0207705_10035148 Ga0207705_100351484 288
449 3300025909 Ga0207705_10177492 Ga0207705_101774922 288
450 3300025910 Ga0207684_10018378 Ga0207684_100183783 288
451 3300025913 Ga0207695_10042429 Ga0207695_100424296 288
452 3300025914 Ga0207671_10010195 Ga0207671_100101954 288
453 3300025914 Ga0207671_10253053 Ga0207671_102530532 288
454 3300025918 Ga0207662_10033599 Ga0207662_100335993 288
455 3300025918 Ga0207662_10058170 Ga0207662_100581702 288
456 3300025919 Ga0207657_10056764 Ga0207657_100567643 288
457 3300025919 Ga0207657_10109249 Ga0207657_101092493 288
458 3300025919 Ga0207657_10151582 Ga0207657_101515822 288
459 3300025919 Ga0207657_10506731 Ga0207657_105067311 288
460 3300025920 Ga0207649_10001821 Ga0207649_100018212 288
461 3300025920 Ga0207649_10294009 Ga0207649_102940092 288
462 3300025922 Ga0207646_10180410 Ga0207646_101804102 288
463 3300025923 Ga0207681_10004618 Ga0207681_1000461810 288
464 3300025923 Ga0207681_10026584 Ga0207681_100265843 288
465 3300025923 Ga0207681_10403638 Ga0207681_104036382 288
466 3300025924 Ga0207694_10025174 Ga0207694_100251743 288
467 3300025924 Ga0207694_10418624 Ga0207694_104186242 288
468 3300025925 Ga0207650_10001149 Ga0207650_100011496 288
469 3300025925 Ga0207650_10003908 Ga0207650_100039085 288
470 3300025925 Ga0207650_10055912 Ga0207650_100559124 288
471 3300025925 Ga0207650_10378100 Ga0207650_103781001 288
472 3300025926 Ga0207659_10000477 Ga0207659_1000047728 288
473 3300025926 Ga0207659_10000691 Ga0207659_100006913 288
474 3300025926 Ga0207659_10032109 Ga0207659_100321093 288
475 3300025926 Ga0207659_10112447 Ga0207659_101124472 288
476 3300025927 Ga0207687_10007233 Ga0207687_100072333 288
477 3300025927 Ga0207687_10064103 Ga0207687_100641032 288
478 3300025927 Ga0207687_10110502 Ga0207687_101105022 288
479 3300025931 Ga0207644_10001362 Ga0207644_1000136211 288
480 3300025931 Ga0207644_10002098 Ga0207644_100020983 288
481 3300025931 Ga0207644_10006058 Ga0207644_100060583 288
482 3300025931 Ga0207644_10012856 Ga0207644_100128563 288
483 3300025931 Ga0207644_10034811 Ga0207644_100348113 288
484 3300025932 Ga0207690_10005130 Ga0207690_100051306 288
485 3300025933 Ga0207706_10000756 Ga0207706_100007563 288
486 3300025933 Ga0207706_10001466 Ga0207706_1000146614 288
487 3300025933 Ga0207706_10004450 Ga0207706_1000445016 288
488 3300025933 Ga0207706_10051089 Ga0207706_100510894 288
489 3300025933 Ga0207706_10120264 Ga0207706_101202643 288
490 3300025933 Ga0207706_10141138 Ga0207706_101411382 288
491 3300025933 Ga0207706_10159532 Ga0207706_101595323 288
492 3300025934 Ga0207686_10006958 Ga0207686_100069583 288
493 3300025934 Ga0207686_10262698 Ga0207686_102626982 288
494 3300025934 Ga0207686_10388882 Ga0207686_103888821 288
495 3300025935 Ga0207709_10003694 Ga0207709_100036948 288
496 3300025935 Ga0207709_10106040 Ga0207709_101060402 288
497 3300025936 Ga0207670_10025777 Ga0207670_100257773 288
498 3300025936 Ga0207670_10080473 Ga0207670_100804733 288
499 3300025937 Ga0207669_10005292 Ga0207669_100052924 288
500 3300025937 Ga0207669_10098013 Ga0207669_100980131 288
501 3300025938 Ga0207704_10085429 Ga0207704_100854292 288
502 3300025940 Ga0207691_10001243 Ga0207691_100012433 288
503 3300025940 Ga0207691_10003923 Ga0207691_100039234 288
504 3300025940 Ga0207691_10005630 Ga0207691_1000563010 288
505 3300025940 Ga0207691_10017263 Ga0207691_100172633 288
506 3300025940 Ga0207691_10039879 Ga0207691_100398793 288
507 3300025940 Ga0207691_10141115 Ga0207691_101411152 288
508 3300025940 Ga0207691_10244532 Ga0207691_102445322 288
509 3300025941 Ga0207711_10021174 Ga0207711_100211743 288
510 3300025941 Ga0207711_10087955 Ga0207711_100879554 288
511 3300025941 Ga0207711_10225169 Ga0207711_102251692 288
512 3300025941 Ga0207711_10332043 Ga0207711_103320432 288
513 3300025942 Ga0207689_10006829 Ga0207689_100068298 288
514 3300025942 Ga0207689_10012976 Ga0207689_100129763 288
515 3300025942 Ga0207689_10015924 Ga0207689_100159243 288
516 3300025942 Ga0207689_10207502 Ga0207689_102075022 288
517 3300025942 Ga0207689_10569822 Ga0207689_105698221 288
518 3300025944 Ga0207661_10109080 Ga0207661_101090804 288
519 3300025944 Ga0207661_10214944 Ga0207661_102149442 288
520 3300025945 Ga0207679_10000249 Ga0207679_1000024931 288
521 3300025945 Ga0207679_10024487 Ga0207679_100244873 288
522 3300025945 Ga0207679_10130780 Ga0207679_101307803 288
523 3300025945 Ga0207679_10554680 Ga0207679_105546801 288
524 3300025960 Ga0207651_10001278 Ga0207651_1000127812 288
525 3300025960 Ga0207651_10016116 Ga0207651_100161161 288
526 3300025960 Ga0207651_10175494 Ga0207651_101754942 288
527 3300025960 Ga0207651_10198323 Ga0207651_101983232 288
528 3300025960 Ga0207651_10249569 Ga0207651_102495692 288
529 3300025960 Ga0207651_10268485 Ga0207651_102684852 288
530 3300025960 Ga0207651_10325067 Ga0207651_103250672 288
531 3300025972 Ga0207668_10004912 Ga0207668_100049125 288
532 3300025986 Ga0207658_10001089 Ga0207658_1000108916 288
533 3300025986 Ga0207658_10018268 Ga0207658_100182683 288
534 3300025986 Ga0207658_10027241 Ga0207658_100272415 288
535 3300025986 Ga0207658_10064121 Ga0207658_100641211 288
536 3300025986 Ga0207658_10205475 Ga0207658_102054751 288
537 3300026023 Ga0207677_10003776 Ga0207677_100037764 288
538 3300026023 Ga0207677_10008741 Ga0207677_100087413 288
539 3300026023 Ga0207677_10032641 Ga0207677_100326412 288
540 3300026023 Ga0207677_10063934 Ga0207677_100639341 288
541 3300026023 Ga0207677_10069721 Ga0207677_100697213 288
542 3300026023 Ga0207677_10081795 Ga0207677_100817952 288
543 3300026035 Ga0207703_10000996 Ga0207703_1000099616 288
544 3300026035 Ga0207703_10011365 Ga0207703_100113654 288
545 3300026035 Ga0207703_10041270 Ga0207703_100412705 288
546 3300026035 Ga0207703_10085277 Ga0207703_100852774 288
547 3300026041 Ga0207639_10014119 Ga0207639_100141194 288
548 3300026041 Ga0207639_10026149 Ga0207639_100261494 288
549 3300026041 Ga0207639_10213351 Ga0207639_102133513 288
550 3300026041 Ga0207639_10599492 Ga0207639_105994922 288
551 3300026067 Ga0207678_10000966 Ga0207678_100009664 288
552 3300026067 Ga0207678_10022962 Ga0207678_100229622 288
553 3300026067 Ga0207678_10170485 Ga0207678_101704854 288
554 3300026067 Ga0207678_10182419 Ga0207678_101824193 288
555 3300026075 Ga0207708_10012827 Ga0207708_100128273 288
556 3300026078 Ga0207702_10039270 Ga0207702_100392704 288
557 3300026088 Ga0207641_10007488 Ga0207641_100074883 288
558 3300026088 Ga0207641_10014783 Ga0207641_100147832 288
559 3300026088 Ga0207641_10017054 Ga0207641_100170544 288
560 3300026088 Ga0207641_10387053 Ga0207641_103870532 288
561 3300026089 Ga0207648_10000118 Ga0207648_1000011858 288
562 3300026089 Ga0207648_10003767 Ga0207648_100037674 288
563 3300026089 Ga0207648_10028344 Ga0207648_100283443 288
564 3300026089 Ga0207648_10034335 Ga0207648_100343355 288
565 3300026089 Ga0207648_10048712 Ga0207648_100487123 288
566 3300026089 Ga0207648_10086378 Ga0207648_100863783 288
567 3300026089 Ga0207648_10144132 Ga0207648_101441324 288
568 3300026095 Ga0207676_10002837 Ga0207676_1000283711 288
569 3300026095 Ga0207676_10008453 Ga0207676_100084533 288
570 3300026095 Ga0207676_10024294 Ga0207676_100242947 288
571 3300026095 Ga0207676_10075841 Ga0207676_100758414 288
572 3300026095 Ga0207676_10171182 Ga0207676_101711823 288
573 3300026095 Ga0207676_10197356 Ga0207676_101973562 288
574 3300026116 Ga0207674_10053978 Ga0207674_100539782 288
575 3300026116 Ga0207674_10310100 Ga0207674_103101002 288
576 3300026116 Ga0207674_10346592 Ga0207674_103465922 288
577 3300026116 Ga0207674_10488682 Ga0207674_104886822 288
578 3300026118 Ga0207675_100002744 Ga0207675_10000274415 288
579 3300026118 Ga0207675_100003340 Ga0207675_1000033409 288
580 3300026118 Ga0207675_100054366 Ga0207675_1000543665 288
581 3300026121 Ga0207683_10004250 Ga0207683_100042503 288
582 3300026121 Ga0207683_10040254 Ga0207683_100402543 288
583 3300026121 Ga0207683_10070680 Ga0207683_100706803 288
584 3300026121 Ga0207683_10098580 Ga0207683_100985804 288
585 3300026121 Ga0207683_10123684 Ga0207683_101236842 288
586 3300026121 Ga0207683_10216173 Ga0207683_102161731 288
587 3300026142 Ga0207698_10002449 Ga0207698_100024493 288
588 3300026142 Ga0207698_10028828 Ga0207698_100288282 288
589 3300026142 Ga0207698_10044988 Ga0207698_100449881 288
590 3300026142 Ga0207698_10067441 Ga0207698_100674411 288
591 3300026142 Ga0207698_10080338 Ga0207698_100803382 288
592 3300027111 Ga0209281_1000074 Ga0209281_100007454 288
593 3300027296 Ga0209389_1029316 Ga0209389_10293163 288
594 3300027395 Ga0209996_1001245 Ga0209996_10012455 288
595 3300027526 Ga0209968_1000261 Ga0209968_10002614 288
596 3300027614 Ga0209970_1001467 Ga0209970_10014673 288
597 3300027695 Ga0209966_1000074 Ga0209966_100007418 288
598 3300027866 Ga0209813_10046708 Ga0209813_100467082 288
599 3300027876 Ga0209974_10038421 Ga0209974_100384212 288
600 3300027876 Ga0209974_10110227 Ga0209974_101102271 288
601 3300028379 Ga0268266_10038784 Ga0268266_100387843 288
602 3300028379 Ga0268266_10144301 Ga0268266_101443013 288
603 3300028380 Ga0268265_10598748 Ga0268265_105987481 288
604 3300028381 Ga0268264_10001857 Ga0268264_100018574 288
605 3300028381 Ga0268264_10005397 Ga0268264_100053974 288
606 3300028786 Ga0307517_10010725 Ga0307517_1001072510 288
607 3300028786 Ga0307517_10087776 Ga0307517_100877762 288
608 3300028794 Ga0307515_10000188 Ga0307515_1000018879 288
609 3300028794 Ga0307515_10005461 Ga0307515_100054614 288
610 3300028794 Ga0307515_10018969 Ga0307515_100189697 288
611 3300028794 Ga0307515_10029938 Ga0307515_100299386 288
612 3300028794 Ga0307515_10105203 Ga0307515_101052032 288
613 3300028794 Ga0307515_10178168 Ga0307515_101781682 288
614 3300030522 Ga0307512_10187295 Ga0307512_101872951 288
615 3300031239 Ga0265328_10009090 Ga0265328_100090902 288
616 3300031250 Ga0265331_10002493 Ga0265331_100024937 288
617 3300031251 Ga0265327_10000144 Ga0265327_1000014444 288
618 3300031251 Ga0265327_10000210 Ga0265327_1000021062 288
619 3300031456 Ga0307513_10001902 Ga0307513_1000190215 288
620 3300031456 Ga0307513_10008355 Ga0307513_100083556 288
621 3300031456 Ga0307513_10017436 Ga0307513_100174364 288
622 3300031456 Ga0307513_10138011 Ga0307513_101380112 288
623 3300031456 Ga0307513_10294259 Ga0307513_102942591 288
624 3300031456 Ga0307513_10318897 Ga0307513_103188972 288
625 3300031507 Ga0307509_10000234 Ga0307509_1000023467 288
626 3300031507 Ga0307509_10056928 Ga0307509_100569287 288
627 3300031548 Ga0307408_100000038 Ga0307408_100000038160 288
628 3300031548 Ga0307408_100064886 Ga0307408_1000648862 288
629 3300031548 Ga0307408_100300530 Ga0307408_1003005302 288
630 3300031616 Ga0307508_10044094 Ga0307508_100440943 288
631 3300031649 Ga0307514_10051134 Ga0307514_100511343 288
632 3300031649 Ga0307514_10072288 Ga0307514_100722882 288
633 3300031727 Ga0316576_10021087 Ga0316576_100210873 288
634 3300031728 Ga0316578_10000172 Ga0316578_100001724 288
635 3300031728 Ga0316578_10014111 Ga0316578_100141115 288
636 3300031730 Ga0307516_10000311 Ga0307516_1000031161 288
637 3300031730 Ga0307516_10000326 Ga0307516_100003267 288
638 3300031730 Ga0307516_10000897 Ga0307516_100008972 288
639 3300031730 Ga0307516_10446494 Ga0307516_104464941 288
640 3300031731 Ga0307405_10014690 Ga0307405_100146902 288
641 3300031731 Ga0307405_10109461 Ga0307405_101094612 288
642 3300031731 Ga0307405_10303706 Ga0307405_103037062 288
643 3300031838 Ga0307518_10292677 Ga0307518_102926771 288
644 3300031852 Ga0307410_10031911 Ga0307410_100319112 288
645 3300031852 Ga0307410_10052069 Ga0307410_100520693 288
646 3300031901 Ga0307406_10361782 Ga0307406_103617822 288
647 3300031911 Ga0307412_10017136 Ga0307412_100171364 288
648 3300031911 Ga0307412_10028415 Ga0307412_100284152 288
649 3300031911 Ga0307412_10315739 Ga0307412_103157391 288
650 3300031995 Ga0307409_100002191 Ga0307409_1000021917 288
651 3300032002 Ga0307416_100002040 Ga0307416_10000204011 288
652 3300032002 Ga0307416_100030437 Ga0307416_1000304373 288
653 3300032002 Ga0307416_100532570 Ga0307416_1005325702 288
654 3300032002 Ga0307416_100658449 Ga0307416_1006584491 288
655 3300032005 Ga0307411_10000111 Ga0307411_1000011110 288
656 3300032005 Ga0307411_10219080 Ga0307411_102190802 288
657 3300032126 Ga0307415_100012627 Ga0307415_1000126274 288
658 3300032168 Ga0316593_10007882 Ga0316593_100078823 288
659 3300033179 Ga0307507_10087111 Ga0307507_100871113 288
660 3300033180 Ga0307510_10003147 Ga0307510_1000314718 288
661 3300033180 Ga0307510_10022531 Ga0307510_100225314 288
662 3300033524 Ga0316592_1008210 Ga0316592_10082102 288
663 3300033524 Ga0316592_1047859 Ga0316592_10478591 288
664 3300033528 Ga0316588_1017053 Ga0316588_10170532 288
665 3300033541 Ga0316596_1005666 Ga0316596_10056664 288
666 3300033541 Ga0316596_1050199 Ga0316596_10501992 288
667 3300034816 Ga0373930_0018783 Ga0373930_0018783_387_1295 288
668 3300035088 Ga0373940_0011703 Ga0373940_0011703_1169_2035 288
669 3300035091 Ga0373951_0015495 Ga0373951_0015495_524_1417 288
670 3300035114 Ga0373939_0000004 Ga0373939_0000004_35216_36109 288
671 3300035114 Ga0373939_0060531 Ga0373939_0060531_304_1170 288
672 3300035119 Ga0373956_0059059 Ga0373956_0059059_461_1327 288
673 3300035121 Ga0373960_0006274 Ga0373960_0006274_407_1300 288
674 3300035170 Ga0373943_0050329 Ga0373943_0050329_947_1813 288
675 3300035171 Ga0373946_0040358 Ga0373946_0040358_267_1133 288
676 3300035242 Ga0373962_0006239 Ga0373962_0006239_360_1253 288
677 3300035410 Ga0373924_0034927 Ga0373924_0034927_554_1420 288
678 3300035691 Ga0373931_0000546 Ga0373931_0000546_6607_7500 288
679 3300035691 Ga0373931_0009953 Ga0373931_0009953_413_1321 288
680 3300035692 Ga0373935_0031345 Ga0373935_0031345_535_1401 288
681 3300035695 Ga0373927_0039242 Ga0373927_0039242_947_1813 288
682 3300036401 Ga0373937_0019374 Ga0373937_0019374_1058_1924 288
683 3300036401 Ga0373937_0097556 Ga0373937_0097556_1680_2546 288
684 3300036712 Ga0316584_0028137 Ga0316584_0028137_587_1459 288
685 3300037068 Ga0373925_0035960 Ga0373925_0035960_119_985 288
686 3300037068 Ga0373925_0094578 Ga0373925_0094578_606_1472 288
687 3300037068 Ga0373925_0210626 Ga0373925_0210626_308_1174 288
688 3300037068 Ga0373925_0267503 Ga0373925_0267503_10_876 288
689 3300037418 Ga0395900_0000355 Ga0395900_0000355_157_1023 288
690 3300037418 Ga0395900_0508785 Ga0395900_0508785_28_897 288
691 3300037471 Ga0395905_0000777 Ga0395905_0000777_9728_10621 288
692 3300037471 Ga0395905_0003411 Ga0395905_0003411_1309_2178 288
693 3300037471 Ga0395905_0004659 Ga0395905_0004659_4278_5144 288
694 3300037471 Ga0395905_0008552 Ga0395905_0008552_4214_5080 288
695 3300037471 Ga0395905_0009989 Ga0395905_0009989_1552_2421 288
696 3300037471 Ga0395905_0023405 Ga0395905_0023405_3013_3888 288
697 3300037471 Ga0395905_0328566 Ga0395905_0328566_77_946 288
698 3300039437 Ga0436365_0561202 Ga0436365_0561202_324_1190 288
699 3300039437 Ga0436365_0936688 Ga0436365_0936688_460_1326 288
700 3300039447 Ga0436361_0003822 Ga0436361_0003822_51922_52806 288
701 3300039447 Ga0436361_0633280 Ga0436361_0633280_23652_24548 288
702 3300039447 Ga0436361_0638016 Ga0436361_0638016_2247_3113 288
703 3300039447 Ga0436361_0895746 Ga0436361_0895746_218_1084 288
704 3300039447 Ga0436361_1079715 Ga0436361_1079715_2347_3231 288
705 3300041458 Ga0451798_0696078 Ga0451798_0696078_111_977 288
706 3300041460 Ga0451802_0574082 Ga0451802_0574082_753_1619 288
707 3300041486 Ga0451807_1744250 Ga0451807_1744250_21_887 288
708 3300041491 Ga0451833_1159483 Ga0451833_1159483_455_1321 288
709 3300041498 Ga0451841_0774662 Ga0451841_0774662_31_897 288
710 3300041509 Ga0451843_1695661 Ga0451843_1695661_56_922 288
711 3300041512 Ga0451853_2209517 Ga0451853_2209517_166_1032 288
712 3300041997 Ga0439431_0001589 Ga0439431_0001589_1970_2836 288
713 3300042007 Ga0439449_0083375 Ga0439449_0083375_262_1128 288
714 3300042008 Ga0439450_021953 Ga0439450_021953_101_973 288
715 3300042012 Ga0439455_0000995 Ga0439455_0000995_2395_3261 288
716 3300042127 Ga0450890_001964 Ga0450890_001964_1111_1980 288
717 3300042144 Ga0450889_001429 Ga0450889_001429_973_1866 288
718 3300042156 Ga0439446_0008764 Ga0439446_0008764_304_1170 288
719 3300042438 Ga0439459_0000191 Ga0439459_0000191_3390_4259 288
720 3300042461 Ga0439460_0010600 Ga0439460_0010600_641_1507 288
721 3300042530 Ga0450916_000815 Ga0450916_000815_1540_2433 288
722 3300042876 Ga0451577_0011912 Ga0451577_0011912_4226_5092 288
723 3300042876 Ga0451577_0015837 Ga0451577_0015837_1710_2576 288
724 3300042876 Ga0451577_0038688 Ga0451577_0038688_2778_3644 288
725 3300042876 Ga0451577_0077908 Ga0451577_0077908_1441_2307 288
726 3300042876 Ga0451577_0318412 Ga0451577_0318412_48_914 288
727 3300044656 Ga0466969_0000028 Ga0466969_0000028_14180_15046 288
728 3300044658 Ga0466972_0001085 Ga0466972_0001085_2199_3065 288
729 3300044658 Ga0466972_0029875 Ga0466972_0029875_595_1461 288
730 3300044684 Ga0466966_0008387 Ga0466966_0008387_3790_4656 288
731 3300044684 Ga0466966_0020086 Ga0466966_0020086_933_1799 288
732 3300044693 Ga0466961_0018744 Ga0466961_0018744_3038_3904 288
733 3300044694 Ga0466963_0000306 Ga0466963_0000306_5639_6505 288
734 3300044706 Ga0466964_0010048 Ga0466964_0010048_1691_2557 288
735 3300044706 Ga0466964_0178118 Ga0466964_0178118_66_932 288
736 3300044712 Ga0453684_0009747 Ga0453684_0009747_1227_2093 288
737 3300044712 Ga0453684_0137499 Ga0453684_0137499_1272_2138 288
738 3300044712 Ga0453684_0157052 Ga0453684_0157052_1229_2104 288
739 3300044712 Ga0453684_0195762 Ga0453684_0195762_359_1225 288
740 3300044712 Ga0453684_0314595 Ga0453684_0314595_55_921 288
741 3300044719 Ga0466971_0028647 Ga0466971_0028647_1471_2337 288
742 3300044735 Ga0466968_0050105 Ga0466968_0050105_479_1345 288
743 3300044765 Ga0466970_0038282 Ga0466970_0038282_1247_2113 288
744 3300044765 Ga0466970_0111191 Ga0466970_0111191_566_1432 288
745 3300044842 Ga0466957_0053737 Ga0466957_0053737_706_1572 288
746 3300045049 Ga0466959_0001676 Ga0466959_0001676_4100_4966 288
747 3300045049 Ga0466959_0082802 Ga0466959_0082802_491_1357 288
748 3300045051 Ga0451576_0015228 Ga0451576_0015228_390_1256 288
749 3300045051 Ga0451576_0019110 Ga0451576_0019110_4101_4967 288
750 3300045051 Ga0451576_0039970 Ga0451576_0039970_1869_2735 288
751 3300045051 Ga0451576_0237748 Ga0451576_0237748_781_1674 288
752 3300045051 Ga0451576_0432301 Ga0451576_0432301_49_915 288
753 3300045836 Ga0466958_0159955 Ga0466958_0159955_132_998 288
754 3300046454 Ga0495592_0012833 Ga0495592_0012833_3571_4437 288
755 3300046457 Ga0495590_0016223 Ga0495590_0016223_1433_2302 288
756 3300046457 Ga0495590_0039265 Ga0495590_0039265_77_943 288
757 3300046459 Ga0495629_0025312 Ga0495629_0025312_597_1463 288
758 3300046459 Ga0495629_0219417 Ga0495629_0219417_288_1154 288
759 3300046460 Ga0495638_0127217 Ga0495638_0127217_21_887 288
760 3300046460 Ga0495638_0216196 Ga0495638_0216196_32_898 288
761 3300046471 Ga0495650_0000976 Ga0495650_0000976_5667_6566 288
762 3300046472 Ga0495580_0125242 Ga0495580_0125242_244_1110 288
763 3300046506 Ga0495583_0042459 Ga0495583_0042459_152_1018 288
764 3300046507 Ga0495606_0184383 Ga0495606_0184383_160_1026 288
765 3300046516 Ga0495628_0301160 Ga0495628_0301160_31_897 288
766 3300046519 Ga0495632_0003074 Ga0495632_0003074_5035_5901 288
767 3300046519 Ga0495632_0006463 Ga0495632_0006463_4244_5110 288
768 3300046528 Ga0495642_0039547 Ga0495642_0039547_657_1523 288
769 3300046535 Ga0495586_0064987 Ga0495586_0064987_800_1666 288
770 3300046539 Ga0495621_0002740 Ga0495621_0002740_1863_2729 288
771 3300046542 Ga0495597_0022439 Ga0495597_0022439_956_1822 288
772 3300046660 Ga0495625_0053069 Ga0495625_0053069_153_1019 288
773 3300046660 Ga0495625_0079548 Ga0495625_0079548_795_1661 288
774 3300046683 Ga0495658_0016429 Ga0495658_0016429_1984_2850 288
775 3300046689 Ga0495613_0060723 Ga0495613_0060723_731_1597 288
776 3300046691 Ga0495670_0020117 Ga0495670_0020117_1605_2474 288
777 3300046694 Ga0495649_0001852 Ga0495649_0001852_6393_7259 288
778 3300047319 Ga0495674_0168034 Ga0495674_0168034_702_1568 288
779 3300047321 Ga0495676_0054670 Ga0495676_0054670_809_1675 288
780 3300047443 Ga0495687_000367 Ga0495687_000367_11511_12377 288
781 3300047443 Ga0495687_006395 Ga0495687_006395_2232_3098 288
782 3300047471 Ga0495684_0078731 Ga0495684_0078731_943_1809 288
783 3300047472 Ga0495686_0006531 Ga0495686_0006531_6508_7374 288
784 3300048905 Ga0496102_0005742 Ga0496102_0005742_8932_9798 288
785 3300048907 Ga0496104_0106712 Ga0496104_0106712_489_1355 288
786 3300048907 Ga0496104_0593837 Ga0496104_0593837_66_932 288
787 3300048909 Ga0496106_0012481 Ga0496106_0012481_3664_4530 288
788 3300048909 Ga0496106_0074237 Ga0496106_0074237_58_924 288
789 3300048909 Ga0496106_0121074 Ga0496106_0121074_1142_2008 288
790 3300048911 Ga0496108_0037095 Ga0496108_0037095_1175_2041 288
791 3300048911 Ga0496108_0115085 Ga0496108_0115085_730_1596 288
792 3300048912 Ga0496109_0258525 Ga0496109_0258525_449_1315 288
793 3300048913 Ga0496110_0096611 Ga0496110_0096611_1647_2555 288
794 3300048913 Ga0496110_0100048 Ga0496110_0100048_828_1697 288
795 3300048913 Ga0496110_0258867 Ga0496110_0258867_28_894 288
796 3300048913 Ga0496110_0542526 Ga0496110_0542526_73_939 288
797 3300048914 Ga0496111_0016712 Ga0496111_0016712_2404_3270 288
798 3300048915 Ga0496112_0043915 Ga0496112_0043915_2379_3245 288
799 3300048916 Ga0496113_0006211 Ga0496113_0006211_4409_5275 288
800 3300048916 Ga0496113_0203823 Ga0496113_0203823_689_1555 288
801 3300048917 Ga0496114_0007670 Ga0496114_0007670_2213_3079 288
802 3300048924 Ga0496121_0022834 Ga0496121_0022834_927_1793 288
803 3300048925 Ga0496122_0074566 Ga0496122_0074566_1015_1896 288
804 3300048927 Ga0496124_0000138 Ga0496124_0000138_122768_123634 288
805 3300048927 Ga0496124_0063527 Ga0496124_0063527_1492_2361 288
806 3300048927 Ga0496124_0123263 Ga0496124_0123263_37_903 288
807 3300048928 Ga0496125_0001189 Ga0496125_0001189_1185_2072 288
808 3300048928 Ga0496125_0197833 Ga0496125_0197833_438_1304 288
809 3300049128 Ga0501308_004681 Ga0501308_004681_221_1096 288
810 3300049160 Ga0501304_002933 Ga0501304_002933_192_1067 288
811 3300049515 Ga0501292_015918 Ga0501292_015918_157_1023 288
812 3300049523 Ga0501300_008168 Ga0501300_008168_604_1497 288
813 3300049530 Ga0501314_003951 Ga0501314_003951_219_1094 288
814 3300049579 Ga0501043_0000002 Ga0501043_0000002_86966_87832 288
815 3300049580 Ga0501046_0000008 Ga0501046_0000008_87049_87915 288
816 3300049581 Ga0501047_0000003 Ga0501047_0000003_110231_111097 288
817 3300049651 Ga0501201_004887 Ga0501201_004887_320_1213 288
818 3300049653 Ga0501206_008312 Ga0501206_008312_33_899 288
819 3300049658 Ga0501211_001618 Ga0501211_001618_25_924 288
820 3300049662 Ga0501222_001642 Ga0501222_001642_885_1778 288
821 3300049663 Ga0501223_004639 Ga0501223_004639_600_1493 288
822 3300049665 Ga0501227_002798 Ga0501227_002798_2690_3583 288
823 3300049668 Ga0501233_018737 Ga0501233_018737_378_1271 288
824 3300049669 Ga0501235_008379 Ga0501235_008379_1015_1908 288
825 3300049670 Ga0501236_013541 Ga0501236_013541_140_1033 288
826 3300049682 Ga0501252_003010 Ga0501252_003010_352_1221 288
827 3300049683 Ga0501253_008366 Ga0501253_008366_447_1313 288
828 3300049704 Ga0501221_002992 Ga0501221_002992_495_1388 288
829 3300049706 Ga0501229_000954 Ga0501229_000954_241_1134 288
830 3300049759 Ga0501262_003682 Ga0501262_003682_308_1174 288
831 3300049764 Ga0501267_001793 Ga0501267_001793_848_1741 288
832 3300049765 Ga0501268_004583 Ga0501268_004583_558_1451 288
833 3300049769 Ga0501272_001041 Ga0501272_001041_278_1171 288
834 3300049778 Ga0501282_004903 Ga0501282_004903_416_1309 288
835 3300049779 Ga0501283_001477 Ga0501283_001477_554_1447 288
836 3300049824 Ga0501045_0012726 Ga0501045_0012726_2820_3686 288
837 3300050491 nmdc:mga00v17_19912_c1 nmdc:mga00v17_19912_c1_2557_3438 288
838 3300050491 nmdc:mga00v17_36384_c1 nmdc:mga00v17_36384_c1_621_1487 288
839 3300050491 nmdc:mga00v17_90001_c1 nmdc:mga00v17_90001_c1_106_972 288
840 3300050493 nmdc:mga0k408_101548_c1 nmdc:mga0k408_101548_c1_83_949 288
841 3300050493 nmdc:mga0k408_104944_c1 nmdc:mga0k408_104944_c1_652_1518 288
842 3300050493 nmdc:mga0k408_111673_c1 nmdc:mga0k408_111673_c1_728_1594 288
843 3300050493 nmdc:mga0k408_137584_c1 nmdc:mga0k408_137584_c1_188_1054 288
844 3300050493 nmdc:mga0k408_17696_c1 nmdc:mga0k408_17696_c1_1117_1983 288
845 3300050493 nmdc:mga0k408_23013_c1 nmdc:mga0k408_23013_c1_339_1244 288
846 3300050493 nmdc:mga0k408_24559_c1 nmdc:mga0k408_24559_c1_591_1460 288
847 3300050493 nmdc:mga0k408_26432_c1 nmdc:mga0k408_26432_c1_1327_2193 288
848 3300050493 nmdc:mga0k408_4347_c1 nmdc:mga0k408_4347_c1_5837_6703 288
849 3300050493 nmdc:mga0k408_5357_c1 nmdc:mga0k408_5357_c1_644_1510 288
850 3300050493 nmdc:mga0k408_67349_c1 nmdc:mga0k408_67349_c1_225_1091 288
851 3300050493 nmdc:mga0k408_734_c1 nmdc:mga0k408_734_c1_14783_15649 288
852 3300050493 nmdc:mga0k408_7706_c1 nmdc:mga0k408_7706_c1_363_1229 288
853 3300050494 nmdc:mga06z11_32273_c1 nmdc:mga06z11_32273_c1_1304_2170 288
854 3300050494 nmdc:mga06z11_33419_c1 nmdc:mga06z11_33419_c1_396_1262 288
855 3300050495 nmdc:mga04h51_71035_c1 nmdc:mga04h51_71035_c1_190_1056 288
856 3300050496 nmdc:mga07m45_14178_c1 nmdc:mga07m45_14178_c1_1577_2443 288
857 3300050496 nmdc:mga07m45_19348_c1 nmdc:mga07m45_19348_c1_2323_3189 288
858 3300050496 nmdc:mga07m45_25391_c1 nmdc:mga07m45_25391_c1_555_1424 288
859 3300050496 nmdc:mga07m45_57_c1 nmdc:mga07m45_57_c1_14051_14917 288
860 3300050496 nmdc:mga07m45_7428_c1 nmdc:mga07m45_7428_c1_2172_3062 288
861 3300050496 nmdc:mga07m45_79116_c1 nmdc:mga07m45_79116_c1_959_1825 288
862 3300050496 nmdc:mga07m45_8433_c1 nmdc:mga07m45_8433_c1_123_989 288
863 3300050507 nmdc:mga05p37_351329_c1 nmdc:mga05p37_351329_c1_761_1627 288
864 3300050508 nmdc:mga09592_5629_c1 nmdc:mga09592_5629_c1_97_963 288
865 3300050516 nmdc:mga0sz30_29883_c1 nmdc:mga0sz30_29883_c1_656_1522 288
866 3300053085 Ga0495619_0028690 Ga0495619_0028690_2332_3198 288
867 3300053086 Ga0500578_0054149 Ga0500578_0054149_460_1326 288
868 3300053090 Ga0500646_0025159 Ga0500646_0025159_314_1180 288
869 3300053093 Ga0500651_0009126 Ga0500651_0009126_3296_4174 288
870 3300053093 Ga0500651_0019235 Ga0500651_0019235_2100_2966 288
871 3300053093 Ga0500651_0059450 Ga0500651_0059450_1435_2301 288
872 3300053127 Ga0500623_051234 Ga0500623_051234_382_1248 288
873 3300053130 Ga0500642_0003464 Ga0500642_0003464_1461_2327 288
874 3300053131 Ga0500652_000027 Ga0500652_000027_91339_92205 288
875 3300053133 Ga0500655_004171 Ga0500655_004171_207_1073 288
876 3300053134 Ga0500658_0091271 Ga0500658_0091271_137_1003 288
877 3300053134 Ga0500658_0115906 Ga0500658_0115906_288_1154 288
878 3300053136 Ga0500559_0000119 Ga0500559_0000119_24696_25562 288
879 3300053139 Ga0500568_0014139 Ga0500568_0014139_1269_2135 288
880 3300053139 Ga0500568_0049683 Ga0500568_0049683_301_1167 288
881 3300053140 Ga0500573_0133676 Ga0500573_0133676_486_1352 288
882 3300053148 Ga0500590_011236 Ga0500590_011236_1030_1917 288
883 3300053153 Ga0500616_0050411 Ga0500616_0050411_197_1063 288
884 3300053154 Ga0500619_000611 Ga0500619_000611_4102_4968 288
885 3300053156 Ga0500622_0000221 Ga0500622_0000221_52907_53773 288
886 3300053156 Ga0500622_0004359 Ga0500622_0004359_4193_5059 288
887 3300053156 Ga0500622_0005218 Ga0500622_0005218_6125_6994 288
888 3300053730 Ga0500645_006045 Ga0500645_006045_3323_4189 288
889 3300053730 Ga0500645_059627 Ga0500645_059627_169_1035 288
890 3300059421 Ga0590071_000370 Ga0590071_000370_4059_4934 288
891 3300060353 Ga0501082_0139543 Ga0501082_0139543_97_963 288
892 3300061719 Ga0466962_0026119 Ga0466962_0026119_1838_2704 288
893 iso_pu_bacteria 2643221544 2643745689 288
894 iso_pu_bacteria 2643221585 2643936756 288
895 iso_pu_bacteria 2643221639 2644221584 288
896 iso_pu_bacteria 2643221646 2644257651 288
897 iso_pu_bacteria 2643221656 2644318655 288
898 iso_pu_bacteria 2738541337 2739058635 288
899 iso_pu_bacteria 2842718218 2842721181 288
900 iso_pu_bacteria 2904479285 2904479591 288
901 iso_pu_bacteria 2945945610 2945949363 288
902 iso_pu_bacteria 2974320154 2974324069 288

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00483

NTP_transferase

Nucleotidyl transferase

27

293

0.88

PF12804

NTP_transf_3

MobA-like NTP transferase domain

28

191

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
5i1f-assembly1.cif.gz_A-2 crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia vietnamiensis in complex with uridine-5'-diphosphate-glucose 0.9625 1 285
5ve7-assembly1.cif.gz_A crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia ambifaria in complex with utp 0.9586 1 286
5ve7-assembly1.cif.gz_A crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia ambifaria in complex with utp 0.9553 1 286
5j49-assembly1.cif.gz_A crystal structure of udp-glucose pyrophosporylase / utp-glucose-1-phosphate uridylyltransferase from burkholderia xenovorans 0.9496 1 287
5i1f-assembly1.cif.gz_A-2 crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia vietnamiensis in complex with uridine-5'-diphosphate-glucose 0.9495 1 285
ID Description Score Start End Superfamily
af_Q2G1T6_1_286_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9553 1 286 3.90.550.10
af_Q2G1T6_1_286_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9488 1 286 3.90.550.10
af_Q58730_1_282_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9464 3 285 3.90.550.10
af_Q58730_1_282_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9399 3 285 3.90.550.10
2ux8B00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9371 3 284 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A2S5LAR8-F1-model_v4 UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9) (Alpha-D-glucosyl-1-phosphate uridylyltransferase) (UDP-glucose pyrophosphorylase) (Uridine diphosphoglucose pyrophosphorylase) 0.9913 126 288 GO:0003983
GO:0006011
GO:0009058
AF-A0A3D4LJV5-F1-model_v4 UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9) 0.9895 106 258 GO:0003983
GO:0006011
GO:0009058
AF-A0A4Q3QDS7-F1-model_v4 deleted 0.9888 103 288
AF-A0A353Y6T5-F1-model_v4 UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9) (Alpha-D-glucosyl-1-phosphate uridylyltransferase) (UDP-glucose pyrophosphorylase) (Uridine diphosphoglucose pyrophosphorylase) 0.9884 172 288 GO:0003983
GO:0006011
GO:0009058
AF-T0XS77-F1-model_v4 UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9) 0.9868 98 286 GO:0003983
GO:0006011
GO:0009058

Feature Viewer

pLDDT pTM Quality
88.1 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map