F485080
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 898 | 554 | 787 | 159 |
Family's Representative Sequence
| Representative Sequence | 3300028800|Ga0265338_10246572|Ga0265338_102465721 |
| Length | 190 |
| Sequence | MLARLYANGILAGIFNAIFASHNHRAGTNRMTQPTIRLTVNGRIHQVDAAADTALLYVLRNDLELNGPKYGCGLGECGTCTVLIDGVAARSCVIPISGCIGRDILTLEGLGSRSDPDPVQAAFIAEQAAQCGYCLNGMIMSTKALLLRNPHPSEAEVVEALRYHLCRCGAHVEIMRAAMRAAGHLAEALD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501071 | Serratia proteamaculans S4 | Isolate | Rhizosphere |
| 2 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 3 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 4 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 5 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 6 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 7 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 8 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 9 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 10 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 11 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 12 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 13 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 14 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 15 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 16 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 17 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 18 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 19 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 20 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 21 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 22 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 23 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 24 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 25 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 26 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 27 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 28 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 29 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 30 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 31 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 32 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 33 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 34 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 35 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 36 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 37 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 38 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 39 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 40 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 41 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 42 | 2888366609 | Serratia sp. NGAS9 | Isolate | Rhizosphere |
| 43 | 2888373701 | Serratia rhizosphaerae KUDC3025 | Isolate | Rhizosphere |
| 44 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 45 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 46 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 47 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 48 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 49 | 2922368715 | |||
| 50 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 51 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 52 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 53 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 54 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 55 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 56 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 57 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 58 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 59 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 60 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 61 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 62 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 63 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 64 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 65 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 66 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 67 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 68 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 69 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 70 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 71 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 72 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 73 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 74 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 75 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 76 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 77 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 78 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 79 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 80 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 81 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 82 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 83 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 84 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 85 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 86 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 87 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 88 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 89 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 90 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 91 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 92 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 93 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 94 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 95 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 96 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 97 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 98 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 99 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 100 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 101 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 102 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 103 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 104 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 105 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 106 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 109 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 110 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 112 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 113 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 115 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 116 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 118 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 123 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 124 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 125 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 127 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 128 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 129 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 130 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 131 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 132 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 133 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 134 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 135 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 136 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 137 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 138 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 139 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 140 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 141 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 142 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 143 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 144 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 145 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 146 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 147 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 148 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 149 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 150 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 151 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 152 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 153 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 154 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 155 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 156 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 157 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 158 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 159 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 160 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 161 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 162 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 163 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 164 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 165 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 166 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 167 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 168 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 169 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 170 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 171 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 172 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 173 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 174 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 175 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 176 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 177 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 178 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 179 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 180 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 181 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 183 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 184 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 185 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 186 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 187 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 189 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 191 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 192 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 193 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 194 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 195 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 196 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 197 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 198 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 199 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 200 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 201 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 202 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 203 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 204 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 205 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 206 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 207 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 208 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 209 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 210 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 211 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 212 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 213 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 214 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 215 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 216 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 217 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 218 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 219 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 220 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 221 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 222 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 223 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 224 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 225 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 226 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 227 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 288 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 291 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 295 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 296 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 297 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 298 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 299 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 300 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 301 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 302 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 303 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 304 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 305 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 306 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 307 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 308 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 309 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 310 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 311 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 312 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 313 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 314 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 315 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 316 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 317 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 318 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 319 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 320 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 321 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 322 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 323 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 324 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 325 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 326 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 327 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 328 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 329 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 330 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 331 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 332 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 333 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 334 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 335 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 336 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 337 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 338 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 339 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 340 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 341 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 342 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 343 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 344 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 345 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 346 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 347 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 348 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 349 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 350 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 351 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 352 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 353 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 354 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 355 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 356 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 357 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 358 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 359 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 431 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 432 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 433 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 434 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 435 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 436 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 437 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 438 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 439 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 440 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 441 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 442 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 443 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 444 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 445 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 446 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 447 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 448 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 451 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 452 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 453 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 454 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 455 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 456 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 457 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 458 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 459 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 460 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 461 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 462 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 463 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 464 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 465 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 466 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 467 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 468 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 469 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 470 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 471 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 472 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 473 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 474 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 475 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 476 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 477 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 478 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 479 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 480 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 481 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 482 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 483 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 484 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 485 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 486 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 487 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 488 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 491 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 493 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 494 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 495 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 496 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 497 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 498 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 499 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 500 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 501 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 502 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 503 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 504 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 505 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 506 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 507 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 508 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 509 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 510 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 511 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 512 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 513 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 514 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 515 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 516 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 517 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 518 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 519 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 520 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 521 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 522 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 523 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 524 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 525 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 526 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 527 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 528 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 529 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 530 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 531 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 532 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 533 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 534 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 535 | 640753048 | Serratia proteamaculans 568 | Isolate | Endosphere |
| 536 | 8004592986 | Serratia sp. S119 | Isolate | Unclassified |
| 537 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 538 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 539 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 540 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 541 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 542 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 543 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 544 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 545 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 546 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 547 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 548 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 549 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 550 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 551 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 552 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 553 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 554 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.51 |
| Metatranscriptomes | 0.22 |
| Isolates | 12.26 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.8 |
| Nodule | 8.24 |
| Rhizoplane | 1.67 |
| Rhizosphere | 73.72 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24750J21931_1047247 | 3300002070 | Bacteria | 665 |
| 2 | JGI25153J46596_10000613 | 3300003215 | Bacteria | 21789 |
| 3 | rootL2_10070718 | 3300003322 | Bacteria | 2115 |
| 4 | JGI25160J50197_1008566 | 3300003354 | Bacteria | 3886 |
| 5 | Ga0006562J51391_1184272 | 3300003578 | Bacteria | 790 |
| 6 | Ga0055542_1004636 | 3300003762 | Bacteria | 3281 |
| 7 | Ga0055531_10020681 | 3300003794 | Bacteria | 2591 |
| 8 | JGI25405J52794_10009591 | 3300003911 | Bacteria | 1829 |
| 9 | Ga0055543_1014268 | 3300004625 | Bacteria | 1552 |
| 10 | Ga0065165_1002156 | 3300005262 | Bacteria | 17812 |
| 11 | Ga0065165_1006009 | 3300005262 | Bacteria | 6544 |
| 12 | Ga0065714_10075630 | 3300005288 | Bacteria | 2883 |
| 13 | Ga0065712_10167116 | 3300005290 | Bacteria | 1266 |
| 14 | Ga0065715_10417651 | 3300005293 | Bacteria | 862 |
| 15 | Ga0065707_10204026 | 3300005295 | Bacteria | 1297 |
| 16 | Ga0065707_10567551 | 3300005295 | Bacteria | 710 |
| 17 | Ga0070658_10106333 | 3300005327 | Bacteria | 2321 |
| 18 | Ga0070658_10493920 | 3300005327 | Bacteria | 1057 |
| 19 | Ga0070658_10654571 | 3300005327 | Bacteria | 911 |
| 20 | Ga0070676_10002228 | 3300005328 | Bacteria | 9892 |
| 21 | Ga0070683_100020341 | 3300005329 | Bacteria | 5906 |
| 22 | Ga0070683_100051714 | 3300005329 | Bacteria | 3804 |
| 23 | Ga0070683_100376225 | 3300005329 | Bacteria | 1353 |
| 24 | Ga0070683_100874358 | 3300005329 | Bacteria | 862 |
| 25 | Ga0070690_100284386 | 3300005330 | Bacteria | 1181 |
| 26 | Ga0070670_100083010 | 3300005331 | Bacteria | 2753 |
| 27 | Ga0068869_100063887 | 3300005334 | Bacteria | 2706 |
| 28 | Ga0068869_100168853 | 3300005334 | Bacteria | 1708 |
| 29 | Ga0068868_100049271 | 3300005338 | Bacteria | 3306 |
| 30 | Ga0070660_100053333 | 3300005339 | Bacteria | 3119 |
| 31 | Ga0070660_100090985 | 3300005339 | Bacteria | 2406 |
| 32 | Ga0070660_100156222 | 3300005339 | Bacteria | 1836 |
| 33 | Ga0070660_100215308 | 3300005339 | Bacteria | 1560 |
| 34 | Ga0070689_100816931 | 3300005340 | Bacteria | 821 |
| 35 | Ga0070687_100393483 | 3300005343 | Bacteria | 907 |
| 36 | Ga0070661_100026905 | 3300005344 | Bacteria | 4140 |
| 37 | Ga0070692_10093497 | 3300005345 | Bacteria | 1637 |
| 38 | Ga0070668_100013869 | 3300005347 | Bacteria | 6025 |
| 39 | Ga0070668_100021312 | 3300005347 | Bacteria | 4899 |
| 40 | Ga0070669_100014943 | 3300005353 | Bacteria | 5532 |
| 41 | Ga0070669_101289508 | 3300005353 | Bacteria | 632 |
| 42 | Ga0070675_100021193 | 3300005354 | Bacteria | 5191 |
| 43 | Ga0070674_100547834 | 3300005356 | Bacteria | 970 |
| 44 | Ga0070673_100324007 | 3300005364 | Bacteria | 1362 |
| 45 | Ga0070688_100127895 | 3300005365 | Bacteria | 1710 |
| 46 | Ga0070659_100022073 | 3300005366 | Bacteria | 4857 |
| 47 | Ga0070659_100217668 | 3300005366 | Bacteria | 1575 |
| 48 | Ga0070667_100642436 | 3300005367 | Bacteria | 979 |
| 49 | Ga0070709_10001083 | 3300005434 | Bacteria | 15083 |
| 50 | Ga0070709_10002717 | 3300005434 | Bacteria | 9561 |
| 51 | Ga0070714_100053651 | 3300005435 | Bacteria | 3442 |
| 52 | Ga0070714_100104965 | 3300005435 | Bacteria | 2494 |
| 53 | Ga0070714_100389508 | 3300005435 | Bacteria | 1315 |
| 54 | Ga0070713_100016049 | 3300005436 | Bacteria | 5623 |
| 55 | Ga0070713_100064023 | 3300005436 | Bacteria | 3085 |
| 56 | Ga0070713_100718211 | 3300005436 | Bacteria | 955 |
| 57 | Ga0070710_10000726 | 3300005437 | Bacteria | 15703 |
| 58 | Ga0070710_10021146 | 3300005437 | Bacteria | 3386 |
| 59 | Ga0070701_10005863 | 3300005438 | Bacteria | 5124 |
| 60 | Ga0070701_10014733 | 3300005438 | Bacteria | 3591 |
| 61 | Ga0070701_10196734 | 3300005438 | Bacteria | 1189 |
| 62 | Ga0070711_100003099 | 3300005439 | Bacteria | 9616 |
| 63 | Ga0070711_100029718 | 3300005439 | Bacteria | 3610 |
| 64 | Ga0070711_100479552 | 3300005439 | Bacteria | 1022 |
| 65 | Ga0070700_100024131 | 3300005441 | Bacteria | 3567 |
| 66 | Ga0070694_100034752 | 3300005444 | Bacteria | 3327 |
| 67 | Ga0070694_100074662 | 3300005444 | Bacteria | 2344 |
| 68 | Ga0070708_100198840 | 3300005445 | Unclassified | 1876 |
| 69 | Ga0070708_100886245 | 3300005445 | Bacteria | 838 |
| 70 | Ga0070663_100060738 | 3300005455 | Bacteria | 2720 |
| 71 | Ga0070663_100090802 | 3300005455 | Bacteria | 2262 |
| 72 | Ga0070663_100293268 | 3300005455 | Bacteria | 1300 |
| 73 | Ga0070663_100332415 | 3300005455 | Bacteria | 1225 |
| 74 | Ga0070678_100171997 | 3300005456 | Bacteria | 1765 |
| 75 | Ga0070662_100027569 | 3300005457 | Bacteria | 3944 |
| 76 | Ga0070681_10171454 | 3300005458 | Bacteria | 2091 |
| 77 | Ga0070681_10442025 | 3300005458 | Bacteria | 1212 |
| 78 | Ga0068867_101494775 | 3300005459 | Bacteria | 629 |
| 79 | Ga0070685_10699082 | 3300005466 | Bacteria | 739 |
| 80 | Ga0070706_100234072 | 3300005467 | Unclassified | 1715 |
| 81 | Ga0070706_100259970 | 3300005467 | Bacteria | 1621 |
| 82 | Ga0070706_100275742 | 3300005467 | Bacteria | 1569 |
| 83 | Ga0070706_100317743 | 3300005467 | Bacteria | 1452 |
| 84 | Ga0070706_100539350 | 3300005467 | Bacteria | 1085 |
| 85 | Ga0070707_100087209 | 3300005468 | Unclassified | 3019 |
| 86 | Ga0070707_100125773 | 3300005468 | Bacteria | 2491 |
| 87 | Ga0070707_100462391 | 3300005468 | Bacteria | 1230 |
| 88 | Ga0070698_100245559 | 3300005471 | Bacteria | 1723 |
| 89 | Ga0070698_100459540 | 3300005471 | Bacteria | 1209 |
| 90 | Ga0070698_100999025 | 3300005471 | Bacteria | 784 |
| 91 | Ga0070699_100531427 | 3300005518 | Bacteria | 1070 |
| 92 | Ga0070699_100970954 | 3300005518 | Bacteria | 779 |
| 93 | Ga0070679_100133390 | 3300005530 | Bacteria | 2465 |
| 94 | Ga0070679_100191574 | 3300005530 | Bacteria | 2013 |
| 95 | Ga0070679_100490188 | 3300005530 | Bacteria | 1173 |
| 96 | Ga0070679_101092814 | 3300005530 | Bacteria | 742 |
| 97 | Ga0070684_100005863 | 3300005535 | Bacteria | 9454 |
| 98 | Ga0070684_100067578 | 3300005535 | Bacteria | 3140 |
| 99 | Ga0070684_100248225 | 3300005535 | Bacteria | 1626 |
| 100 | Ga0070684_100441545 | 3300005535 | Bacteria | 1202 |
| 101 | Ga0070697_100010932 | 3300005536 | Bacteria | 7090 |
| 102 | Ga0070697_100128756 | 3300005536 | Unclassified | 2122 |
| 103 | Ga0070697_100273394 | 3300005536 | Unclassified | 1449 |
| 104 | Ga0070697_100291053 | 3300005536 | Bacteria | 1403 |
| 105 | Ga0070697_101557026 | 3300005536 | Bacteria | 591 |
| 106 | Ga0068853_101606809 | 3300005539 | Bacteria | 630 |
| 107 | Ga0070672_100043937 | 3300005543 | Bacteria | 3449 |
| 108 | Ga0070686_101019078 | 3300005544 | Bacteria | 680 |
| 109 | Ga0068855_100129894 | 3300005563 | Bacteria | 2878 |
| 110 | Ga0068855_100150597 | 3300005563 | Bacteria | 2646 |
| 111 | Ga0070664_100024422 | 3300005564 | Bacteria | 4999 |
| 112 | Ga0070664_100334299 | 3300005564 | Bacteria | 1375 |
| 113 | Ga0070664_100662985 | 3300005564 | Bacteria | 970 |
| 114 | Ga0068857_100019190 | 3300005577 | Bacteria | 6002 |
| 115 | Ga0068857_100190545 | 3300005577 | Bacteria | 1868 |
| 116 | Ga0068857_100273225 | 3300005577 | Bacteria | 1553 |
| 117 | Ga0068854_100195086 | 3300005578 | Bacteria | 1589 |
| 118 | Ga0068854_100906999 | 3300005578 | Bacteria | 775 |
| 119 | Ga0068852_100021960 | 3300005616 | Bacteria | 5108 |
| 120 | Ga0068852_100146939 | 3300005616 | Bacteria | 2188 |
| 121 | Ga0068859_100148657 | 3300005617 | Bacteria | 2418 |
| 122 | Ga0068864_100158941 | 3300005618 | Bacteria | 2053 |
| 123 | Ga0068861_100011932 | 3300005719 | Bacteria | 6050 |
| 124 | Ga0068861_100246469 | 3300005719 | Bacteria | 1522 |
| 125 | Ga0068861_101160840 | 3300005719 | Bacteria | 745 |
| 126 | Ga0068851_10022349 | 3300005834 | Bacteria | 3080 |
| 127 | Ga0068851_10206071 | 3300005834 | Bacteria | 1099 |
| 128 | Ga0068870_10009642 | 3300005840 | Bacteria | 4400 |
| 129 | Ga0068870_10881406 | 3300005840 | Bacteria | 631 |
| 130 | Ga0068863_100779003 | 3300005841 | Bacteria | 953 |
| 131 | Ga0068858_100039931 | 3300005842 | Bacteria | 4351 |
| 132 | Ga0068860_100000213 | 3300005843 | Bacteria | 91105 |
| 133 | Ga0068860_100059712 | 3300005843 | Bacteria | 3625 |
| 134 | Ga0068860_100235462 | 3300005843 | Bacteria | 1780 |
| 135 | Ga0068862_100010749 | 3300005844 | Bacteria | 7557 |
| 136 | Ga0068862_100106989 | 3300005844 | Bacteria | 2452 |
| 137 | Ga0068862_100761542 | 3300005844 | Bacteria | 943 |
| 138 | Ga0081455_10000152 | 3300005937 | Bacteria | 83354 |
| 139 | Ga0081455_10212798 | 3300005937 | Bacteria | 1439 |
| 140 | Ga0081540_1229679 | 3300005983 | Bacteria | 656 |
| 141 | Ga0075364_10065139 | 3300006051 | Bacteria | 2392 |
| 142 | Ga0075432_10046546 | 3300006058 | Bacteria | 1523 |
| 143 | Ga0070715_10009691 | 3300006163 | Bacteria | 3405 |
| 144 | Ga0070715_10015245 | 3300006163 | Bacteria | 2862 |
| 145 | Ga0070716_100006597 | 3300006173 | Bacteria | 5674 |
| 146 | Ga0070716_100124164 | 3300006173 | Unclassified | 1621 |
| 147 | Ga0070716_100126237 | 3300006173 | Unclassified | 1610 |
| 148 | Ga0070716_100181147 | 3300006173 | Bacteria | 1383 |
| 149 | Ga0070716_100279036 | 3300006173 | Bacteria | 1152 |
| 150 | Ga0070712_100002958 | 3300006175 | Bacteria | 10518 |
| 151 | Ga0070712_100149387 | 3300006175 | Bacteria | 1792 |
| 152 | Ga0070712_100313919 | 3300006175 | Bacteria | 1273 |
| 153 | Ga0070712_100518369 | 3300006175 | Bacteria | 1001 |
| 154 | Ga0075367_10459810 | 3300006178 | Bacteria | 807 |
| 155 | Ga0075428_100058444 | 3300006844 | Bacteria | 4222 |
| 156 | Ga0075428_100089310 | 3300006844 | Bacteria | 3361 |
| 157 | Ga0075428_101118892 | 3300006844 | Bacteria | 831 |
| 158 | Ga0075428_101657837 | 3300006844 | Bacteria | 668 |
| 159 | Ga0075430_100060688 | 3300006846 | Bacteria | 3177 |
| 160 | Ga0075430_100927030 | 3300006846 | Bacteria | 718 |
| 161 | Ga0075431_100033812 | 3300006847 | Bacteria | 5267 |
| 162 | Ga0075431_100085525 | 3300006847 | Bacteria | 3255 |
| 163 | Ga0075431_100094645 | 3300006847 | Bacteria | 3083 |
| 164 | Ga0075431_100545968 | 3300006847 | Bacteria | 1147 |
| 165 | Ga0075431_100588489 | 3300006847 | Bacteria | 1097 |
| 166 | Ga0075433_10131502 | 3300006852 | Bacteria | 2223 |
| 167 | Ga0075433_10185973 | 3300006852 | Unclassified | 1848 |
| 168 | Ga0075433_10234279 | 3300006852 | Bacteria | 1630 |
| 169 | Ga0075434_100008890 | 3300006871 | Bacteria | 9350 |
| 170 | Ga0075434_100066668 | 3300006871 | Bacteria | 3586 |
| 171 | Ga0075434_100066726 | 3300006871 | Bacteria | 3584 |
| 172 | Ga0075434_100069272 | 3300006871 | Bacteria | 3517 |
| 173 | Ga0075434_100075437 | 3300006871 | Unclassified | 3365 |
| 174 | Ga0075434_100108629 | 3300006871 | Bacteria | 2784 |
| 175 | Ga0075434_100150545 | 3300006871 | Bacteria | 2347 |
| 176 | Ga0075434_100187341 | 3300006871 | Bacteria | 2090 |
| 177 | Ga0075434_100328397 | 3300006871 | Bacteria | 1550 |
| 178 | Ga0075434_100488732 | 3300006871 | Bacteria | 1252 |
| 179 | Ga0075429_100057259 | 3300006880 | Bacteria | 3393 |
| 180 | Ga0075429_100076099 | 3300006880 | Bacteria | 2923 |
| 181 | Ga0075429_100230909 | 3300006880 | Bacteria | 1621 |
| 182 | Ga0075429_100356555 | 3300006880 | Bacteria | 1281 |
| 183 | Ga0068865_100010434 | 3300006881 | Bacteria | 5782 |
| 184 | Ga0075436_100421161 | 3300006914 | Bacteria | 970 |
| 185 | Ga0075436_100745994 | 3300006914 | Bacteria | 727 |
| 186 | Ga0097620_100148653 | 3300006931 | Bacteria | 2418 |
| 187 | Ga0075435_100048354 | 3300007076 | Bacteria | 3417 |
| 188 | Ga0075435_100097876 | 3300007076 | Bacteria | 2428 |
| 189 | Ga0075435_100218517 | 3300007076 | Bacteria | 1618 |
| 190 | Ga0099795_10016192 | 3300007788 | Bacteria | 2353 |
| 191 | Ga0099795_10322051 | 3300007788 | Bacteria | 685 |
| 192 | Ga0105251_10000002 | 3300009011 | Bacteria | 350843 |
| 193 | Ga0105251_10003561 | 3300009011 | Bacteria | 11238 |
| 194 | Ga0105244_10004680 | 3300009036 | Bacteria | 9323 |
| 195 | Ga0105240_10006904 | 3300009093 | Bacteria | 16585 |
| 196 | Ga0105240_10105669 | 3300009093 | Bacteria | 3417 |
| 197 | Ga0105240_10508133 | 3300009093 | Bacteria | 1339 |
| 198 | Ga0111539_10120950 | 3300009094 | Bacteria | 3068 |
| 199 | Ga0111539_10131263 | 3300009094 | Bacteria | 2933 |
| 200 | Ga0111539_11170488 | 3300009094 | Bacteria | 893 |
| 201 | Ga0111539_11377376 | 3300009094 | Bacteria | 818 |
| 202 | Ga0111539_11866261 | 3300009094 | Bacteria | 697 |
| 203 | Ga0105245_10204091 | 3300009098 | Bacteria | 1900 |
| 204 | Ga0105245_10600271 | 3300009098 | Bacteria | 1127 |
| 205 | Ga0114129_10054350 | 3300009147 | Bacteria | 5614 |
| 206 | Ga0114129_10112170 | 3300009147 | Bacteria | 3761 |
| 207 | Ga0114129_10146894 | 3300009147 | Bacteria | 3229 |
| 208 | Ga0114129_10181073 | 3300009147 | Bacteria | 2867 |
| 209 | Ga0114129_10257433 | 3300009147 | Bacteria | 2341 |
| 210 | Ga0114129_10302298 | 3300009147 | Bacteria | 2132 |
| 211 | Ga0114129_10336723 | 3300009147 | Bacteria | 2002 |
| 212 | Ga0114129_12205911 | 3300009147 | Bacteria | 663 |
| 213 | Ga0105241_10000002 | 3300009174 | Bacteria | 869480 |
| 214 | Ga0105241_10159581 | 3300009174 | Bacteria | 1852 |
| 215 | Ga0105241_10406706 | 3300009174 | Bacteria | 1195 |
| 216 | Ga0105242_10437207 | 3300009176 | Unclassified | 1230 |
| 217 | Ga0105248_10189369 | 3300009177 | Bacteria | 2318 |
| 218 | Ga0105237_10003966 | 3300009545 | Bacteria | 17317 |
| 219 | Ga0105237_10021235 | 3300009545 | Bacteria | 6678 |
| 220 | Ga0105237_10110204 | 3300009545 | Bacteria | 2744 |
| 221 | Ga0105237_10198900 | 3300009545 | Bacteria | 2004 |
| 222 | Ga0105238_10044446 | 3300009551 | Bacteria | 4490 |
| 223 | Ga0105238_10340831 | 3300009551 | Bacteria | 1487 |
| 224 | Ga0105238_10742246 | 3300009551 | Bacteria | 995 |
| 225 | Ga0105249_10001807 | 3300009553 | Bacteria | 18607 |
| 226 | Ga0105249_10007552 | 3300009553 | Bacteria | 9483 |
| 227 | Ga0099796_10082217 | 3300010159 | Bacteria | 1183 |
| 228 | Ga0099796_10094046 | 3300010159 | Bacteria | 1118 |
| 229 | Ga0099796_10120550 | 3300010159 | Bacteria | 1007 |
| 230 | Ga0099796_10139070 | 3300010159 | Bacteria | 948 |
| 231 | Ga0105239_10043084 | 3300010375 | Bacteria | 4945 |
| 232 | Ga0105239_10080432 | 3300010375 | Bacteria | 3585 |
| 233 | Ga0105239_10130525 | 3300010375 | Bacteria | 2795 |
| 234 | Ga0105246_10180317 | 3300011119 | Bacteria | 1626 |
| 235 | Ga0105246_10631435 | 3300011119 | Bacteria | 930 |
| 236 | Ga0157316_1012136 | 3300012510 | Bacteria | 820 |
| 237 | Ga0157316_1019734 | 3300012510 | Bacteria | 726 |
| 238 | Ga0157373_10004988 | 3300013100 | Bacteria | 9971 |
| 239 | Ga0157373_10006552 | 3300013100 | Bacteria | 8689 |
| 240 | Ga0157373_10110078 | 3300013100 | Bacteria | 1936 |
| 241 | Ga0157373_11029918 | 3300013100 | Bacteria | 615 |
| 242 | Ga0157371_10037904 | 3300013102 | Bacteria | 3450 |
| 243 | Ga0157369_10002009 | 3300013105 | Bacteria | 24521 |
| 244 | Ga0157369_10481821 | 3300013105 | Bacteria | 1284 |
| 245 | Ga0157374_11756236 | 3300013296 | Bacteria | 645 |
| 246 | Ga0157378_10049726 | 3300013297 | Unclassified | 3730 |
| 247 | Ga0163162_10096710 | 3300013306 | Bacteria | 3041 |
| 248 | Ga0163162_10585177 | 3300013306 | Bacteria | 1243 |
| 249 | Ga0163162_10717558 | 3300013306 | Bacteria | 1121 |
| 250 | Ga0163162_11710688 | 3300013306 | Bacteria | 718 |
| 251 | Ga0157372_10244395 | 3300013307 | Bacteria | 2083 |
| 252 | Ga0157372_10490646 | 3300013307 | Bacteria | 1432 |
| 253 | Ga0157375_10032410 | 3300013308 | Bacteria | 4956 |
| 254 | Ga0157375_10044327 | 3300013308 | Bacteria | 4321 |
| 255 | Ga0157375_10504172 | 3300013308 | Bacteria | 1374 |
| 256 | Ga0163163_10258351 | 3300014325 | Bacteria | 1793 |
| 257 | Ga0163163_10283150 | 3300014325 | Bacteria | 1709 |
| 258 | Ga0157380_10004824 | 3300014326 | Bacteria | 9397 |
| 259 | Ga0157380_10201592 | 3300014326 | Bacteria | 1766 |
| 260 | Ga0157380_10286219 | 3300014326 | Bacteria | 1511 |
| 261 | Ga0182008_10029819 | 3300014497 | Bacteria | 2754 |
| 262 | Ga0182008_10312079 | 3300014497 | Bacteria | 825 |
| 263 | Ga0157377_10019271 | 3300014745 | Bacteria | 3563 |
| 264 | Ga0157379_10009268 | 3300014968 | Bacteria | 8572 |
| 265 | Ga0182007_10007254 | 3300015262 | Bacteria | 4665 |
| 266 | Ga0182005_1000979 | 3300015265 | Bacteria | 12386 |
| 267 | Ga0163161_10036989 | 3300017792 | Bacteria | 3498 |
| 268 | Ga0206353_11943815 | 3300020082 | Bacteria | 842 |
| 269 | Ga0213872_10010765 | 3300021361 | Bacteria | 4344 |
| 270 | Ga0207425_1003455 | 3300025245 | Bacteria | 5053 |
| 271 | Ga0209677_102108 | 3300025253 | Bacteria | 7820 |
| 272 | Ga0209148_1000500 | 3300025254 | Bacteria | 39994 |
| 273 | Ga0209233_1003604 | 3300025261 | Bacteria | 5428 |
| 274 | Ga0209233_1013528 | 3300025261 | Bacteria | 2328 |
| 275 | Ga0209455_1004034 | 3300025272 | Bacteria | 4967 |
| 276 | Ga0209455_1007029 | 3300025272 | Bacteria | 3236 |
| 277 | Ga0209758_1000024 | 3300025297 | Bacteria | 591966 |
| 278 | Ga0209758_1011950 | 3300025297 | Bacteria | 4938 |
| 279 | Ga0209256_1051868 | 3300025299 | Bacteria | 988 |
| 280 | Ga0207426_1002351 | 3300025302 | Bacteria | 12330 |
| 281 | Ga0207426_1006588 | 3300025302 | Bacteria | 5011 |
| 282 | Ga0209257_1001699 | 3300025304 | Bacteria | 24723 |
| 283 | Ga0207697_10027785 | 3300025315 | Bacteria | 2313 |
| 284 | Ga0207656_10024927 | 3300025321 | Bacteria | 2424 |
| 285 | Ga0207656_10052124 | 3300025321 | Bacteria | 1771 |
| 286 | Ga0207655_1020689 | 3300025728 | Bacteria | 3370 |
| 287 | Ga0207713_1000008 | 3300025735 | Bacteria | 553952 |
| 288 | Ga0207713_1001897 | 3300025735 | Bacteria | 15855 |
| 289 | Ga0207692_10000763 | 3300025898 | Bacteria | 11404 |
| 290 | Ga0207692_10006941 | 3300025898 | Bacteria | 4616 |
| 291 | Ga0207688_10023474 | 3300025901 | Bacteria | 3378 |
| 292 | Ga0207688_10438048 | 3300025901 | Bacteria | 814 |
| 293 | Ga0207688_10710688 | 3300025901 | Bacteria | 636 |
| 294 | Ga0207647_10479813 | 3300025904 | Bacteria | 695 |
| 295 | Ga0207685_10006305 | 3300025905 | Bacteria | 3218 |
| 296 | Ga0207685_10007289 | 3300025905 | Bacteria | 3073 |
| 297 | Ga0207685_10291977 | 3300025905 | Bacteria | 804 |
| 298 | Ga0207699_10000406 | 3300025906 | Bacteria | 22137 |
| 299 | Ga0207699_10002096 | 3300025906 | Bacteria | 9428 |
| 300 | Ga0207699_10641957 | 3300025906 | Unclassified | 775 |
| 301 | Ga0207645_10000746 | 3300025907 | Bacteria | 27094 |
| 302 | Ga0207643_10010821 | 3300025908 | Bacteria | 4920 |
| 303 | Ga0207705_10275653 | 3300025909 | Bacteria | 1287 |
| 304 | Ga0207705_10802605 | 3300025909 | Bacteria | 730 |
| 305 | Ga0207684_10277914 | 3300025910 | Unclassified | 1444 |
| 306 | Ga0207684_10341262 | 3300025910 | Bacteria | 1290 |
| 307 | Ga0207684_10541026 | 3300025910 | Bacteria | 997 |
| 308 | Ga0207654_10000005 | 3300025911 | Bacteria | 869492 |
| 309 | Ga0207654_10070925 | 3300025911 | Bacteria | 2070 |
| 310 | Ga0207707_10007856 | 3300025912 | Bacteria | 9275 |
| 311 | Ga0207695_10000008 | 3300025913 | Bacteria | 1058268 |
| 312 | Ga0207695_10150817 | 3300025913 | Bacteria | 2264 |
| 313 | Ga0207671_10011165 | 3300025914 | Bacteria | 7335 |
| 314 | Ga0207671_10075491 | 3300025914 | Bacteria | 2521 |
| 315 | Ga0207693_10001388 | 3300025915 | Bacteria | 21472 |
| 316 | Ga0207693_10002846 | 3300025915 | Bacteria | 14982 |
| 317 | Ga0207693_10370147 | 3300025915 | Bacteria | 1121 |
| 318 | Ga0207663_10016183 | 3300025916 | Bacteria | 4128 |
| 319 | Ga0207663_10022293 | 3300025916 | Bacteria | 3618 |
| 320 | Ga0207660_10077967 | 3300025917 | Bacteria | 2427 |
| 321 | Ga0207660_10559623 | 3300025917 | Bacteria | 930 |
| 322 | Ga0207662_10016645 | 3300025918 | Bacteria | 4151 |
| 323 | Ga0207662_10054305 | 3300025918 | Bacteria | 2388 |
| 324 | Ga0207657_10000942 | 3300025919 | Bacteria | 30819 |
| 325 | Ga0207657_10004866 | 3300025919 | Bacteria | 14133 |
| 326 | Ga0207657_10026433 | 3300025919 | Bacteria | 5336 |
| 327 | Ga0207649_10025156 | 3300025920 | Bacteria | 3468 |
| 328 | Ga0207652_10092210 | 3300025921 | Bacteria | 2664 |
| 329 | Ga0207652_10190699 | 3300025921 | Bacteria | 1844 |
| 330 | Ga0207646_10306064 | 3300025922 | Unclassified | 1436 |
| 331 | Ga0207646_10316555 | 3300025922 | Bacteria | 1410 |
| 332 | Ga0207681_10004668 | 3300025923 | Bacteria | 8427 |
| 333 | Ga0207681_10023787 | 3300025923 | Bacteria | 3923 |
| 334 | Ga0207650_10023587 | 3300025925 | Bacteria | 4365 |
| 335 | Ga0207659_10069822 | 3300025926 | Bacteria | 2560 |
| 336 | Ga0207659_10382781 | 3300025926 | Bacteria | 1173 |
| 337 | Ga0207687_10113775 | 3300025927 | Bacteria | 2013 |
| 338 | Ga0207700_10011931 | 3300025928 | Bacteria | 5571 |
| 339 | Ga0207700_10057293 | 3300025928 | Bacteria | 2937 |
| 340 | Ga0207664_10044437 | 3300025929 | Bacteria | 3479 |
| 341 | Ga0207664_10115358 | 3300025929 | Bacteria | 2239 |
| 342 | Ga0207690_10062647 | 3300025932 | Bacteria | 2533 |
| 343 | Ga0207690_10147613 | 3300025932 | Bacteria | 1740 |
| 344 | Ga0207690_10190044 | 3300025932 | Bacteria | 1552 |
| 345 | Ga0207706_10000761 | 3300025933 | Bacteria | 33470 |
| 346 | Ga0207686_10071666 | 3300025934 | Bacteria | 2231 |
| 347 | Ga0207709_10087998 | 3300025935 | Bacteria | 2021 |
| 348 | Ga0207709_10384580 | 3300025935 | Bacteria | 1069 |
| 349 | Ga0207670_10050670 | 3300025936 | Bacteria | 2784 |
| 350 | Ga0207704_10146614 | 3300025938 | Bacteria | 1659 |
| 351 | Ga0207665_10000874 | 3300025939 | Bacteria | 20343 |
| 352 | Ga0207665_10007378 | 3300025939 | Bacteria | 7268 |
| 353 | Ga0207665_10055254 | 3300025939 | Bacteria | 2678 |
| 354 | Ga0207665_10292349 | 3300025939 | Bacteria | 1216 |
| 355 | Ga0207665_10298552 | 3300025939 | Bacteria | 1203 |
| 356 | Ga0207691_10017636 | 3300025940 | Bacteria | 6765 |
| 357 | Ga0207711_10102153 | 3300025941 | Bacteria | 2538 |
| 358 | Ga0207689_10005497 | 3300025942 | Bacteria | 11332 |
| 359 | Ga0207689_10021149 | 3300025942 | Bacteria | 5469 |
| 360 | Ga0207661_10000210 | 3300025944 | Bacteria | 37700 |
| 361 | Ga0207661_10023101 | 3300025944 | Bacteria | 4695 |
| 362 | Ga0207661_10353394 | 3300025944 | Bacteria | 1326 |
| 363 | Ga0207661_11008913 | 3300025944 | Bacteria | 767 |
| 364 | Ga0207679_10031886 | 3300025945 | Bacteria | 3693 |
| 365 | Ga0207667_10044596 | 3300025949 | Bacteria | 4698 |
| 366 | Ga0207667_10126377 | 3300025949 | Bacteria | 2634 |
| 367 | Ga0207651_10992050 | 3300025960 | Bacteria | 750 |
| 368 | Ga0207712_10013250 | 3300025961 | Bacteria | 5285 |
| 369 | Ga0207712_10051370 | 3300025961 | Bacteria | 2883 |
| 370 | Ga0207668_10009741 | 3300025972 | Bacteria | 5769 |
| 371 | Ga0207668_10975298 | 3300025972 | Bacteria | 757 |
| 372 | Ga0207640_10389694 | 3300025981 | Bacteria | 1131 |
| 373 | Ga0207640_10634409 | 3300025981 | Bacteria | 908 |
| 374 | Ga0207658_10115507 | 3300025986 | Bacteria | 2130 |
| 375 | Ga0207703_10075337 | 3300026035 | Bacteria | 2796 |
| 376 | Ga0207703_10208683 | 3300026035 | Bacteria | 1740 |
| 377 | Ga0207678_10018357 | 3300026067 | Bacteria | 6144 |
| 378 | Ga0207678_10130984 | 3300026067 | Bacteria | 2139 |
| 379 | Ga0207708_10059942 | 3300026075 | Bacteria | 2905 |
| 380 | Ga0207708_10137849 | 3300026075 | Bacteria | 1912 |
| 381 | Ga0207702_11135512 | 3300026078 | Bacteria | 775 |
| 382 | Ga0207641_10151335 | 3300026088 | Bacteria | 2102 |
| 383 | Ga0207648_10012512 | 3300026089 | Bacteria | 7943 |
| 384 | Ga0207648_11334790 | 3300026089 | Bacteria | 674 |
| 385 | Ga0207676_10079917 | 3300026095 | Bacteria | 2653 |
| 386 | Ga0207674_10002712 | 3300026116 | Bacteria | 22094 |
| 387 | Ga0207674_10006034 | 3300026116 | Bacteria | 14332 |
| 388 | Ga0207674_10042222 | 3300026116 | Bacteria | 4712 |
| 389 | Ga0207675_100020256 | 3300026118 | Bacteria | 6201 |
| 390 | Ga0207675_100071151 | 3300026118 | Bacteria | 3251 |
| 391 | Ga0207683_10176466 | 3300026121 | Bacteria | 1936 |
| 392 | Ga0207698_10144600 | 3300026142 | Bacteria | 2054 |
| 393 | Ga0207698_10250125 | 3300026142 | Bacteria | 1621 |
| 394 | Ga0209281_1000003 | 3300027111 | Bacteria | 1260089 |
| 395 | Ga0209179_1001115 | 3300027512 | Bacteria | 3132 |
| 396 | Ga0209179_1008979 | 3300027512 | Bacteria | 1700 |
| 397 | Ga0209588_1061138 | 3300027671 | Bacteria | 1218 |
| 398 | Ga0207428_10727441 | 3300027907 | Bacteria | 708 |
| 399 | Ga0268266_10041524 | 3300028379 | Bacteria | 3925 |
| 400 | Ga0268266_10246751 | 3300028379 | Bacteria | 1650 |
| 401 | Ga0268265_10002435 | 3300028380 | Bacteria | 14042 |
| 402 | Ga0268265_10128893 | 3300028380 | Bacteria | 2098 |
| 403 | Ga0268265_10589955 | 3300028380 | Bacteria | 1060 |
| 404 | Ga0268264_10000065 | 3300028381 | Bacteria | 298403 |
| 405 | Ga0268264_10109587 | 3300028381 | Bacteria | 2416 |
| 406 | Ga0268264_10222339 | 3300028381 | Bacteria | 1739 |
| 407 | Ga0307517_10044761 | 3300028786 | Bacteria | 4671 |
| 408 | Ga0307517_10078415 | 3300028786 | Bacteria | 2856 |
| 409 | Ga0307515_10000043 | 3300028794 | Bacteria | 304612 |
| 410 | Ga0307515_10130022 | 3300028794 | Bacteria | 2781 |
| 411 | Ga0265338_10246572 | 3300028800 | Bacteria | 1320 |
| 412 | Ga0265338_10262165 | 3300028800 | Bacteria | 1270 |
| 413 | Ga0307511_10000934 | 3300030521 | Bacteria | 30890 |
| 414 | Ga0265330_10008848 | 3300031235 | Bacteria | 4816 |
| 415 | Ga0265330_10024415 | 3300031235 | Bacteria | 2742 |
| 416 | Ga0265330_10103312 | 3300031235 | Bacteria | 1219 |
| 417 | Ga0265330_10160680 | 3300031235 | Bacteria | 954 |
| 418 | Ga0265328_10015383 | 3300031239 | Bacteria | 2998 |
| 419 | Ga0265325_10010622 | 3300031241 | Bacteria | 5322 |
| 420 | Ga0265340_10001234 | 3300031247 | Bacteria | 14646 |
| 421 | Ga0265339_10010858 | 3300031249 | Bacteria | 5633 |
| 422 | Ga0265331_10008999 | 3300031250 | Bacteria | 5642 |
| 423 | Ga0265316_10104493 | 3300031344 | Bacteria | 2150 |
| 424 | Ga0307513_10009006 | 3300031456 | Bacteria | 12664 |
| 425 | Ga0307513_10475523 | 3300031456 | Bacteria | 970 |
| 426 | Ga0307509_10291590 | 3300031507 | Bacteria | 1386 |
| 427 | Ga0307509_10386389 | 3300031507 | Bacteria | 1111 |
| 428 | Ga0307408_100020366 | 3300031548 | Bacteria | 4476 |
| 429 | Ga0307408_100672331 | 3300031548 | Bacteria | 928 |
| 430 | Ga0307508_10064350 | 3300031616 | Bacteria | 3233 |
| 431 | Ga0265342_10120660 | 3300031712 | Bacteria | 1477 |
| 432 | Ga0265342_10328158 | 3300031712 | Bacteria | 800 |
| 433 | Ga0307516_10017791 | 3300031730 | Bacteria | 7403 |
| 434 | Ga0307516_10028044 | 3300031730 | Bacteria | 5703 |
| 435 | Ga0307516_10654132 | 3300031730 | Bacteria | 706 |
| 436 | Ga0307405_10004594 | 3300031731 | Bacteria | 6550 |
| 437 | Ga0307405_10562709 | 3300031731 | Bacteria | 924 |
| 438 | Ga0307413_10016347 | 3300031824 | Bacteria | 3830 |
| 439 | Ga0307413_10091174 | 3300031824 | Bacteria | 1985 |
| 440 | Ga0307413_10166997 | 3300031824 | Bacteria | 1553 |
| 441 | Ga0307410_10008878 | 3300031852 | Bacteria | 5606 |
| 442 | Ga0307410_10634933 | 3300031852 | Bacteria | 894 |
| 443 | Ga0307406_10024062 | 3300031901 | Bacteria | 3633 |
| 444 | Ga0307406_10796293 | 3300031901 | Bacteria | 797 |
| 445 | Ga0307407_10354477 | 3300031903 | Bacteria | 1040 |
| 446 | Ga0307407_10662964 | 3300031903 | Bacteria | 783 |
| 447 | Ga0307416_100019872 | 3300032002 | Bacteria | 4774 |
| 448 | Ga0307416_100025085 | 3300032002 | Bacteria | 4365 |
| 449 | Ga0307416_100062039 | 3300032002 | Bacteria | 3054 |
| 450 | Ga0307416_100255597 | 3300032002 | Bacteria | 1708 |
| 451 | Ga0307414_10008571 | 3300032004 | Bacteria | 5810 |
| 452 | Ga0307411_10070290 | 3300032005 | Bacteria | 2368 |
| 453 | Ga0307411_10114610 | 3300032005 | Bacteria | 1937 |
| 454 | Ga0307415_100498191 | 3300032126 | Bacteria | 1064 |
| 455 | Ga0307507_10025563 | 3300033179 | Bacteria | 6400 |
| 456 | Ga0307510_10150721 | 3300033180 | Bacteria | 1945 |
| 457 | Ga0373923_0055994 | 3300035111 | Bacteria | 1664 |
| 458 | Ga0373953_0035533 | 3300035117 | Bacteria | 1959 |
| 459 | Ga0373954_0029385 | 3300035118 | Bacteria | 2530 |
| 460 | Ga0373956_0065328 | 3300035119 | Bacteria | 1653 |
| 461 | Ga0373957_0207667 | 3300035120 | Bacteria | 817 |
| 462 | Ga0373957_0220578 | 3300035120 | Bacteria | 794 |
| 463 | Ga0373955_0108242 | 3300035172 | Bacteria | 1604 |
| 464 | Ga0373942_0070485 | 3300035207 | Bacteria | 1020 |
| 465 | Ga0373942_0255186 | 3300035207 | Bacteria | 597 |
| 466 | Ga0373931_0138709 | 3300035691 | Bacteria | 1406 |
| 467 | Ga0373931_1177757 | 3300035691 | Bacteria | 524 |
| 468 | Ga0373935_0045380 | 3300035692 | Bacteria | 2773 |
| 469 | Ga0373933_0000751 | 3300035724 | Bacteria | 19833 |
| 470 | Ga0373933_0228728 | 3300035724 | Bacteria | 1194 |
| 471 | Ga0373937_0757474 | 3300036401 | Bacteria | 918 |
| 472 | Ga0395898_1206376 | 3300037466 | Bacteria | 688 |
| 473 | Ga0395905_0195402 | 3300037471 | Bacteria | 1897 |
| 474 | Ga0395905_0651432 | 3300037471 | Bacteria | 955 |
| 475 | Ga0395905_1415850 | 3300037471 | Bacteria | 599 |
| 476 | Ga0436364_0733950 | 3300037853 | Bacteria | 1105 |
| 477 | Ga0395901_0006629 | 3300038443 | Bacteria | 11698 |
| 478 | Ga0436365_0220668 | 3300039437 | Bacteria | 2864 |
| 479 | Ga0436365_0425979 | 3300039437 | Bacteria | 1005 |
| 480 | Ga0436365_0475914 | 3300039437 | Bacteria | 1357 |
| 481 | Ga0436360_1119210 | 3300039438 | Bacteria | 2268 |
| 482 | Ga0436361_0858840 | 3300039447 | Bacteria | 5016 |
| 483 | Ga0436361_1186555 | 3300039447 | Bacteria | 3438 |
| 484 | Ga0436363_0946951 | 3300039450 | Bacteria | 733 |
| 485 | Ga0439453_0095510 | 3300041408 | Bacteria | 657 |
| 486 | Ga0439466_0026090 | 3300041411 | Bacteria | 2035 |
| 487 | Ga0439465_0091987 | 3300041413 | Bacteria | 1039 |
| 488 | Ga0451802_1972998 | 3300041460 | Bacteria | 530 |
| 489 | Ga0451807_1368907 | 3300041486 | Bacteria | 1065 |
| 490 | Ga0451853_2663894 | 3300041512 | Bacteria | 1118 |
| 491 | Ga0439432_018209 | 3300042006 | Bacteria | 2350 |
| 492 | Ga0439455_0073321 | 3300042012 | Bacteria | 923 |
| 493 | Ga0439435_0039578 | 3300042436 | Bacteria | 1314 |
| 494 | Ga0439435_0056989 | 3300042436 | Bacteria | 1130 |
| 495 | Ga0451577_0643199 | 3300042876 | Bacteria | 962 |
| 496 | Ga0466972_0059513 | 3300044658 | Bacteria | 1833 |
| 497 | Ga0466972_0166145 | 3300044658 | Bacteria | 1036 |
| 498 | Ga0466966_0015338 | 3300044684 | Bacteria | 5066 |
| 499 | Ga0466961_0000038 | 3300044693 | Bacteria | 80721 |
| 500 | Ga0466961_0510267 | 3300044693 | Bacteria | 726 |
| 501 | Ga0466964_0199735 | 3300044706 | Bacteria | 959 |
| 502 | Ga0466957_0064845 | 3300044842 | Bacteria | 2248 |
| 503 | Ga0466960_0246905 | 3300044901 | Bacteria | 990 |
| 504 | Ga0451576_1220302 | 3300045051 | Bacteria | 785 |
| 505 | Ga0466967_0448552 | 3300045976 | Bacteria | 1261 |
| 506 | Ga0466967_0643111 | 3300045976 | Bacteria | 1048 |
| 507 | Ga0495617_081815 | 3300046452 | Bacteria | 1057 |
| 508 | Ga0495617_127437 | 3300046452 | Bacteria | 818 |
| 509 | Ga0495592_0145537 | 3300046454 | Bacteria | 1643 |
| 510 | Ga0495603_0110794 | 3300046455 | Bacteria | 1601 |
| 511 | Ga0495590_0017508 | 3300046457 | Bacteria | 2578 |
| 512 | Ga0495590_0055693 | 3300046457 | Bacteria | 1382 |
| 513 | Ga0495591_005495 | 3300046458 | Bacteria | 5851 |
| 514 | Ga0495629_0127283 | 3300046459 | Bacteria | 1775 |
| 515 | Ga0495638_0006936 | 3300046460 | Bacteria | 8173 |
| 516 | Ga0495638_0188268 | 3300046460 | Bacteria | 1172 |
| 517 | Ga0495651_0040765 | 3300046462 | Bacteria | 3608 |
| 518 | Ga0495651_0312885 | 3300046462 | Bacteria | 1049 |
| 519 | Ga0495651_0842703 | 3300046462 | Bacteria | 563 |
| 520 | Ga0495653_0025533 | 3300046463 | Bacteria | 4745 |
| 521 | Ga0495650_0005684 | 3300046471 | Bacteria | 7998 |
| 522 | Ga0495650_0025895 | 3300046471 | Bacteria | 2739 |
| 523 | Ga0495580_0018170 | 3300046472 | Bacteria | 5239 |
| 524 | Ga0495605_0022067 | 3300046474 | Bacteria | 3366 |
| 525 | Ga0495662_0055440 | 3300046476 | Bacteria | 1915 |
| 526 | Ga0495664_0070883 | 3300046477 | Bacteria | 2081 |
| 527 | Ga0495664_0131782 | 3300046477 | Bacteria | 1514 |
| 528 | Ga0495584_0004182 | 3300046491 | Bacteria | 7788 |
| 529 | Ga0495584_0118141 | 3300046491 | Bacteria | 1343 |
| 530 | Ga0495584_0154576 | 3300046491 | Bacteria | 1165 |
| 531 | Ga0495585_0000300 | 3300046492 | Bacteria | 49530 |
| 532 | Ga0495585_0021453 | 3300046492 | Bacteria | 3707 |
| 533 | Ga0495585_0043795 | 3300046492 | Bacteria | 2502 |
| 534 | Ga0495607_0023970 | 3300046501 | Bacteria | 3811 |
| 535 | Ga0495607_0170972 | 3300046501 | Bacteria | 1097 |
| 536 | Ga0495583_0000467 | 3300046506 | Bacteria | 59823 |
| 537 | Ga0495583_0115306 | 3300046506 | Bacteria | 1135 |
| 538 | Ga0495606_0104463 | 3300046507 | Bacteria | 1719 |
| 539 | Ga0495608_0032385 | 3300046511 | Bacteria | 3533 |
| 540 | Ga0495610_0000842 | 3300046512 | Bacteria | 28591 |
| 541 | Ga0495616_0016823 | 3300046513 | Bacteria | 4040 |
| 542 | Ga0495616_0238869 | 3300046513 | Bacteria | 784 |
| 543 | Ga0495618_0279955 | 3300046514 | Bacteria | 1040 |
| 544 | Ga0495628_0154334 | 3300046516 | Bacteria | 1747 |
| 545 | Ga0495631_0014826 | 3300046518 | Bacteria | 3752 |
| 546 | Ga0495631_0233904 | 3300046518 | Bacteria | 784 |
| 547 | Ga0495632_0005512 | 3300046519 | Bacteria | 8346 |
| 548 | Ga0495632_0033164 | 3300046519 | Bacteria | 2653 |
| 549 | Ga0495637_0004162 | 3300046520 | Bacteria | 7528 |
| 550 | Ga0495637_0018744 | 3300046520 | Bacteria | 3206 |
| 551 | Ga0495643_0021610 | 3300046522 | Bacteria | 3688 |
| 552 | Ga0495644_0028570 | 3300046523 | Bacteria | 2110 |
| 553 | Ga0495648_0000010 | 3300046524 | Bacteria | 307259 |
| 554 | Ga0495648_0052470 | 3300046524 | Bacteria | 2476 |
| 555 | Ga0495642_0000011 | 3300046528 | Bacteria | 128280 |
| 556 | Ga0495642_0187531 | 3300046528 | Bacteria | 901 |
| 557 | Ga0495652_0041116 | 3300046529 | Bacteria | 3992 |
| 558 | Ga0495652_0076698 | 3300046529 | Bacteria | 2772 |
| 559 | Ga0495652_0792718 | 3300046529 | Bacteria | 631 |
| 560 | Ga0495654_0005466 | 3300046530 | Bacteria | 7375 |
| 561 | Ga0495587_0468239 | 3300046536 | Bacteria | 697 |
| 562 | Ga0495609_0000212 | 3300046538 | Bacteria | 57886 |
| 563 | Ga0495597_0007896 | 3300046542 | Bacteria | 5364 |
| 564 | Ga0495597_0216643 | 3300046542 | Bacteria | 761 |
| 565 | Ga0495645_0021359 | 3300046543 | Bacteria | 4679 |
| 566 | Ga0495622_0003121 | 3300046557 | Bacteria | 7856 |
| 567 | Ga0495622_0021138 | 3300046557 | Bacteria | 3032 |
| 568 | Ga0495667_0086546 | 3300046559 | Bacteria | 2032 |
| 569 | Ga0495656_0017001 | 3300046615 | Bacteria | 2769 |
| 570 | Ga0495656_0128268 | 3300046615 | Bacteria | 1205 |
| 571 | Ga0495668_0005919 | 3300046616 | Bacteria | 8137 |
| 572 | Ga0495668_0073287 | 3300046616 | Bacteria | 1881 |
| 573 | Ga0495611_0159656 | 3300046648 | Bacteria | 1053 |
| 574 | Ga0495625_0111494 | 3300046660 | Bacteria | 1869 |
| 575 | Ga0495625_0302255 | 3300046660 | Bacteria | 1023 |
| 576 | Ga0495659_0003417 | 3300046664 | Bacteria | 5074 |
| 577 | Ga0495661_0125130 | 3300046665 | Bacteria | 1415 |
| 578 | Ga0495588_0007286 | 3300046674 | Bacteria | 5027 |
| 579 | Ga0495657_0066730 | 3300046675 | Bacteria | 2363 |
| 580 | Ga0495599_0072044 | 3300046678 | Bacteria | 2156 |
| 581 | Ga0495623_0178224 | 3300046679 | Bacteria | 1236 |
| 582 | Ga0495623_0292010 | 3300046679 | Bacteria | 903 |
| 583 | Ga0495669_0015203 | 3300046684 | Bacteria | 3294 |
| 584 | Ga0495669_0409723 | 3300046684 | Bacteria | 657 |
| 585 | Ga0495613_0170777 | 3300046689 | Bacteria | 1543 |
| 586 | Ga0495613_0558392 | 3300046689 | Bacteria | 765 |
| 587 | Ga0495670_0166565 | 3300046691 | Bacteria | 1159 |
| 588 | Ga0495671_0008444 | 3300046692 | Bacteria | 5797 |
| 589 | Ga0495671_0090877 | 3300046692 | Bacteria | 1494 |
| 590 | Ga0495671_0161029 | 3300046692 | Bacteria | 1091 |
| 591 | Ga0495671_0325723 | 3300046692 | Bacteria | 737 |
| 592 | Ga0495589_0000001 | 3300046794 | Bacteria | 888100 |
| 593 | Ga0495589_0017858 | 3300046794 | Bacteria | 3639 |
| 594 | Ga0495581_0061677 | 3300047315 | Bacteria | 2167 |
| 595 | Ga0495604_0034015 | 3300047317 | Bacteria | 4033 |
| 596 | Ga0495636_0010138 | 3300047318 | Bacteria | 3716 |
| 597 | Ga0495636_0054289 | 3300047318 | Bacteria | 1683 |
| 598 | Ga0495636_0096662 | 3300047318 | Bacteria | 1288 |
| 599 | Ga0495674_0216328 | 3300047319 | Bacteria | 1585 |
| 600 | Ga0495672_0011154 | 3300047320 | Bacteria | 6355 |
| 601 | Ga0495672_0012658 | 3300047320 | Bacteria | 5871 |
| 602 | Ga0495680_0445112 | 3300047322 | Bacteria | 887 |
| 603 | Ga0495683_0062744 | 3300047323 | Bacteria | 1837 |
| 604 | Ga0495687_101327 | 3300047443 | Bacteria | 1079 |
| 605 | Ga0495677_0000578 | 3300047445 | Bacteria | 15061 |
| 606 | Ga0495673_0027172 | 3300047469 | Bacteria | 2726 |
| 607 | Ga0495673_0032637 | 3300047469 | Bacteria | 2424 |
| 608 | Ga0495673_0037481 | 3300047469 | Bacteria | 2213 |
| 609 | Ga0495673_0280541 | 3300047469 | Bacteria | 601 |
| 610 | Ga0495681_0066516 | 3300047470 | Bacteria | 1644 |
| 611 | Ga0495684_0090955 | 3300047471 | Bacteria | 2311 |
| 612 | Ga0495686_0006923 | 3300047472 | Bacteria | 8576 |
| 613 | Ga0495686_0246712 | 3300047472 | Bacteria | 1005 |
| 614 | Ga0495686_0338481 | 3300047472 | Bacteria | 821 |
| 615 | Ga0495593_0181901 | 3300047673 | Bacteria | 1059 |
| 616 | Ga0495602_0231828 | 3300048088 | Bacteria | 1386 |
| 617 | Ga0495602_0394128 | 3300048088 | Bacteria | 989 |
| 618 | Ga0495614_0093311 | 3300048089 | Bacteria | 1311 |
| 619 | Ga0495626_0022514 | 3300048091 | Bacteria | 3109 |
| 620 | Ga0496101_0336013 | 3300048904 | Bacteria | 1186 |
| 621 | Ga0496102_0142139 | 3300048905 | Bacteria | 2251 |
| 622 | Ga0496104_0229148 | 3300048907 | Bacteria | 1770 |
| 623 | Ga0496104_0364953 | 3300048907 | Bacteria | 1356 |
| 624 | Ga0496106_0296209 | 3300048909 | Bacteria | 1297 |
| 625 | Ga0496107_0309573 | 3300048910 | Bacteria | 1176 |
| 626 | Ga0496108_0288365 | 3300048911 | Bacteria | 1429 |
| 627 | Ga0496108_0817456 | 3300048911 | Bacteria | 803 |
| 628 | Ga0496109_0082524 | 3300048912 | Bacteria | 2962 |
| 629 | Ga0496111_0515464 | 3300048914 | Bacteria | 879 |
| 630 | Ga0496112_0146529 | 3300048915 | Bacteria | 2329 |
| 631 | Ga0496112_1484541 | 3300048915 | Bacteria | 592 |
| 632 | Ga0496113_0425297 | 3300048916 | Bacteria | 1067 |
| 633 | Ga0496117_0099368 | 3300048920 | Bacteria | 1846 |
| 634 | Ga0496118_0288749 | 3300048921 | Bacteria | 908 |
| 635 | Ga0496119_0000909 | 3300048922 | Bacteria | 38357 |
| 636 | Ga0496119_0258852 | 3300048922 | Bacteria | 874 |
| 637 | Ga0496120_0000159 | 3300048923 | Bacteria | 112577 |
| 638 | Ga0496121_0103376 | 3300048924 | Bacteria | 2192 |
| 639 | Ga0496121_0474364 | 3300048924 | Bacteria | 800 |
| 640 | Ga0496124_0000008 | 3300048927 | Bacteria | 864372 |
| 641 | Ga0496125_0026112 | 3300048928 | Bacteria | 5333 |
| 642 | Ga0496125_0097725 | 3300048928 | Bacteria | 2175 |
| 643 | Ga0496126_0009184 | 3300048929 | Bacteria | 10547 |
| 644 | Ga0496126_0037704 | 3300048929 | Bacteria | 4507 |
| 645 | Ga0496126_0060967 | 3300048929 | Bacteria | 3390 |
| 646 | Ga0496126_0508934 | 3300048929 | Bacteria | 961 |
| 647 | Ga0495678_000944 | 3300049459 | Bacteria | 25200 |
| 648 | Ga0495678_151121 | 3300049459 | Bacteria | 750 |
| 649 | Ga0495682_0021575 | 3300049460 | Bacteria | 2412 |
| 650 | Ga0501291_069496 | 3300049514 | Bacteria | 679 |
| 651 | Ga0501298_019514 | 3300049521 | Bacteria | 1256 |
| 652 | Ga0501298_113475 | 3300049521 | Bacteria | 631 |
| 653 | Ga0501034_0000969 | 3300049571 | Bacteria | 41330 |
| 654 | Ga0501034_0667225 | 3300049571 | Bacteria | 940 |
| 655 | Ga0501036_0616520 | 3300049572 | Bacteria | 899 |
| 656 | Ga0501037_0143926 | 3300049573 | Bacteria | 1705 |
| 657 | Ga0501043_0093533 | 3300049579 | Bacteria | 2363 |
| 658 | Ga0501046_0094978 | 3300049580 | Bacteria | 2291 |
| 659 | Ga0501046_0678291 | 3300049580 | Bacteria | 727 |
| 660 | Ga0501067_0337538 | 3300049583 | Bacteria | 840 |
| 661 | Ga0501068_0468687 | 3300049584 | Bacteria | 816 |
| 662 | Ga0501070_0046019 | 3300049586 | Bacteria | 3628 |
| 663 | Ga0501073_0117847 | 3300049589 | Bacteria | 1840 |
| 664 | Ga0501074_0164633 | 3300049590 | Bacteria | 1583 |
| 665 | Ga0501076_0657033 | 3300049592 | Bacteria | 865 |
| 666 | Ga0501077_0932264 | 3300049593 | Bacteria | 559 |
| 667 | Ga0501207_060029 | 3300049654 | Bacteria | 695 |
| 668 | Ga0501217_028268 | 3300049661 | Bacteria | 1365 |
| 669 | Ga0501233_065100 | 3300049668 | Bacteria | 913 |
| 670 | Ga0501235_024826 | 3300049669 | Bacteria | 1340 |
| 671 | Ga0501246_042093 | 3300049676 | Bacteria | 549 |
| 672 | Ga0501257_178896 | 3300049686 | Bacteria | 599 |
| 673 | Ga0501261_081421 | 3300049690 | Bacteria | 586 |
| 674 | Ga0501225_0017249 | 3300049705 | Bacteria | 2004 |
| 675 | Ga0501229_054517 | 3300049706 | Bacteria | 597 |
| 676 | Ga0501080_0074660 | 3300049742 | Bacteria | 3154 |
| 677 | Ga0501080_0264742 | 3300049742 | Bacteria | 1565 |
| 678 | Ga0501279_048842 | 3300049775 | Bacteria | 667 |
| 679 | Ga0501283_032227 | 3300049779 | Bacteria | 883 |
| 680 | Ga0501035_0071669 | 3300049822 | Bacteria | 3067 |
| 681 | Ga0501035_0308717 | 3300049822 | Bacteria | 1331 |
| 682 | Ga0501044_0052312 | 3300049823 | Bacteria | 4209 |
| 683 | Ga0501044_0145576 | 3300049823 | Bacteria | 2355 |
| 684 | nmdc:mga0yw44_125034_c1 | 3300050492 | Bacteria | 1660 |
| 685 | nmdc:mga05p37_117954_c1 | 3300050507 | Bacteria | 3261 |
| 686 | nmdc:mga05p37_174501_c1 | 3300050507 | Bacteria | 2173 |
| 687 | nmdc:mga05p37_228183_c1 | 3300050507 | Bacteria | 2245 |
| 688 | nmdc:mga05p37_272961_c1 | 3300050507 | Bacteria | 2020 |
| 689 | nmdc:mga05p37_292968_c1 | 3300050507 | Bacteria | 1937 |
| 690 | nmdc:mga05p37_487742_c1 | 3300050507 | Bacteria | 1418 |
| 691 | nmdc:mga05p37_640828_c1 | 3300050507 | Bacteria | 1192 |
| 692 | nmdc:mga05p37_652398_c1 | 3300050507 | Bacteria | 1178 |
| 693 | nmdc:mga05p37_9465_c1 | 3300050507 | Bacteria | 11534 |
| 694 | nmdc:mga05p37_959732_c1 | 3300050507 | Bacteria | 914 |
| 695 | nmdc:mga09592_21472_c1 | 3300050508 | Bacteria | 5319 |
| 696 | nmdc:mga09592_240528_c1 | 3300050508 | Bacteria | 1568 |
| 697 | nmdc:mga09592_260609_c1 | 3300050508 | Bacteria | 1503 |
| 698 | nmdc:mga09592_582564_c1 | 3300050508 | Bacteria | 960 |
| 699 | nmdc:mga0qj67_207064_c1 | 3300050509 | Bacteria | 1593 |
| 700 | nmdc:mga0qj67_859410_c1 | 3300050509 | Bacteria | 716 |
| 701 | nmdc:mga06r32_111829_c1 | 3300050510 | Bacteria | 2688 |
| 702 | nmdc:mga06r32_1166057_c1 | 3300050510 | Bacteria | 718 |
| 703 | nmdc:mga06r32_125174_c1 | 3300050510 | Unclassified | 2538 |
| 704 | nmdc:mga06r32_1283615_c1 | 3300050510 | Bacteria | 676 |
| 705 | nmdc:mga06r32_24540_c1 | 3300050510 | Bacteria | 5599 |
| 706 | nmdc:mga08y16_347669_c1 | 3300050511 | Bacteria | 1524 |
| 707 | nmdc:mga08y16_530729_c1 | 3300050511 | Bacteria | 1193 |
| 708 | nmdc:mga08y16_709824_c1 | 3300050511 | Bacteria | 1005 |
| 709 | nmdc:mga0n895_1044676_c1 | 3300050512 | Bacteria | 796 |
| 710 | nmdc:mga0n895_128795_c1 | 3300050512 | Bacteria | 2555 |
| 711 | nmdc:mga0n895_144054_c1 | 3300050512 | Bacteria | 2412 |
| 712 | nmdc:mga0n895_183376_c1 | 3300050512 | Bacteria | 2125 |
| 713 | nmdc:mga0n895_330853_c1 | 3300050512 | Bacteria | 1544 |
| 714 | nmdc:mga0n895_473759_c1 | 3300050512 | Bacteria | 1263 |
| 715 | nmdc:mga0n895_9753_c1 | 3300050512 | Bacteria | 8425 |
| 716 | nmdc:mga0rr50_133228_c1 | 3300050513 | Bacteria | 1992 |
| 717 | nmdc:mga0rr50_17170_c1 | 3300050513 | Bacteria | 4825 |
| 718 | nmdc:mga0rr50_233282_c1 | 3300050513 | Bacteria | 1523 |
| 719 | nmdc:mga0rr50_72840_c1 | 3300050513 | Bacteria | 2625 |
| 720 | nmdc:mga0a205_127390_c1 | 3300050515 | Bacteria | 2446 |
| 721 | nmdc:mga0a205_138220_c1 | 3300050515 | Bacteria | 2336 |
| 722 | nmdc:mga0a205_168082_c1 | 3300050515 | Bacteria | 2089 |
| 723 | nmdc:mga0a205_175432_c1 | 3300050515 | Bacteria | 2039 |
| 724 | nmdc:mga0a205_181822_c1 | 3300050515 | Bacteria | 1997 |
| 725 | nmdc:mga0a205_411166_c1 | 3300050515 | Bacteria | 1216 |
| 726 | nmdc:mga0a205_55699_c1 | 3300050515 | Unclassified | 3819 |
| 727 | nmdc:mga0sz30_238167_c1 | 3300050516 | Bacteria | 810 |
| 728 | Ga0495601_0184484 | 3300053077 | Bacteria | 1364 |
| 729 | Ga0495612_0019908 | 3300053078 | Bacteria | 2689 |
| 730 | Ga0495612_0077954 | 3300053078 | Bacteria | 1389 |
| 731 | Ga0500635_0001194 | 3300053080 | Bacteria | 6219 |
| 732 | Ga0500635_0114002 | 3300053080 | Bacteria | 1006 |
| 733 | Ga0495595_0229364 | 3300053084 | Bacteria | 927 |
| 734 | Ga0500643_000007 | 3300053087 | Bacteria | 462836 |
| 735 | Ga0500646_0006139 | 3300053090 | Bacteria | 3053 |
| 736 | Ga0500647_0006809 | 3300053091 | Bacteria | 4865 |
| 737 | Ga0500647_0274777 | 3300053091 | Bacteria | 730 |
| 738 | Ga0500583_0237606 | 3300053092 | Bacteria | 901 |
| 739 | Ga0500566_0000003 | 3300053094 | Bacteria | 166820 |
| 740 | Ga0500566_0034843 | 3300053094 | Bacteria | 2927 |
| 741 | Ga0500566_0043006 | 3300053094 | Bacteria | 2604 |
| 742 | Ga0500640_000579 | 3300053095 | Bacteria | 9420 |
| 743 | Ga0500648_204553 | 3300053097 | Bacteria | 987 |
| 744 | Ga0500650_0125875 | 3300053098 | Bacteria | 1193 |
| 745 | Ga0500554_004996 | 3300053102 | Bacteria | 2858 |
| 746 | Ga0500555_001725 | 3300053103 | Bacteria | 6562 |
| 747 | Ga0500556_0066417 | 3300053104 | Bacteria | 1339 |
| 748 | Ga0500557_000052 | 3300053105 | Bacteria | 50636 |
| 749 | Ga0500569_094412 | 3300053109 | Bacteria | 973 |
| 750 | Ga0500572_000215 | 3300053111 | Bacteria | 20456 |
| 751 | Ga0500591_037062 | 3300053115 | Bacteria | 2337 |
| 752 | Ga0500595_022872 | 3300053119 | Bacteria | 2203 |
| 753 | Ga0500607_012093 | 3300053121 | Bacteria | 5081 |
| 754 | Ga0500608_236962 | 3300053122 | Bacteria | 723 |
| 755 | Ga0500614_016295 | 3300053123 | Bacteria | 1666 |
| 756 | Ga0500642_0000306 | 3300053130 | Bacteria | 17531 |
| 757 | Ga0500642_0022000 | 3300053130 | Bacteria | 2535 |
| 758 | Ga0500655_001084 | 3300053133 | Bacteria | 5215 |
| 759 | Ga0500559_0002862 | 3300053136 | Bacteria | 8721 |
| 760 | Ga0500568_0036717 | 3300053139 | Bacteria | 1992 |
| 761 | Ga0500573_0008281 | 3300053140 | Bacteria | 5722 |
| 762 | Ga0500577_0237576 | 3300053142 | Bacteria | 790 |
| 763 | Ga0500586_044375 | 3300053145 | Bacteria | 1518 |
| 764 | Ga0500590_100392 | 3300053148 | Bacteria | 1390 |
| 765 | Ga0500590_134119 | 3300053148 | Bacteria | 1141 |
| 766 | Ga0500603_000184 | 3300053150 | Bacteria | 16166 |
| 767 | Ga0500603_002547 | 3300053150 | Bacteria | 3986 |
| 768 | Ga0500604_0003204 | 3300053151 | Bacteria | 4398 |
| 769 | Ga0500616_0080109 | 3300053153 | Bacteria | 1643 |
| 770 | Ga0500620_097226 | 3300053155 | Bacteria | 1029 |
| 771 | Ga0500622_0237636 | 3300053156 | Bacteria | 807 |
| 772 | Ga0500630_001089 | 3300053159 | Bacteria | 12674 |
| 773 | Ga0500638_047699 | 3300053162 | Bacteria | 2073 |
| 774 | Ga0500638_166551 | 3300053162 | Bacteria | 964 |
| 775 | Ga0500639_000033 | 3300053163 | Bacteria | 68969 |
| 776 | Ga0500639_045546 | 3300053163 | Bacteria | 2295 |
| 777 | Ga0500636_0059198 | 3300053177 | Bacteria | 2238 |
| 778 | Ga0500637_0041913 | 3300053178 | Bacteria | 2586 |
| 779 | Ga0500637_0119103 | 3300053178 | Bacteria | 1531 |
| 780 | Ga0500637_0356937 | 3300053178 | Bacteria | 775 |
| 781 | Ga0500625_000139 | 3300053729 | Bacteria | 14808 |
| 782 | Ga0500552_007174 | 3300053733 | Bacteria | 1277 |
| 783 | Ga0500596_001166 | 3300053735 | Bacteria | 5292 |
| 784 | Ga0500596_016028 | 3300053735 | Bacteria | 1126 |
| 785 | Ga0501084_0574098 | 3300054114 | Bacteria | 953 |
| 786 | Ga0500661_033874 | 3300055283 | Bacteria | 902 |
| 787 | Ga0466962_0136991 | 3300061719 | Bacteria | 1185 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049580 | Ga0501046_0678291 | Ga0501046_0678291_128_631 | 145 |
| 2 | 3300049586 | Ga0501070_0046019 | Ga0501070_0046019_947_1450 | 145 |
| 3 | 3300049589 | Ga0501073_0117847 | Ga0501073_0117847_1188_1691 | 145 |
| 4 | 3300049590 | Ga0501074_0164633 | Ga0501074_0164633_1035_1538 | 145 |
| 5 | 3300049742 | Ga0501080_0264742 | Ga0501080_0264742_345_848 | 145 |
| 6 | 3300049823 | Ga0501044_0052312 | Ga0501044_0052312_3038_3541 | 145 |
| 7 | 3300005719 | Ga0068861_101160840 | Ga0068861_1011608401 | 146 |
| 8 | 3300025901 | Ga0207688_10438048 | Ga0207688_104380482 | 147 |
| 9 | 3300005844 | Ga0068862_100761542 | Ga0068862_1007615422 | 150 |
| 10 | 3300009147 | Ga0114129_10257433 | Ga0114129_102574332 | 150 |
| 11 | 3300049571 | Ga0501034_0667225 | Ga0501034_0667225_171_686 | 150 |
| 12 | iso_pu_bacteria | 2508501071 | 2508852514 | 150 |
| 13 | iso_pu_bacteria | 2888366609 | 2888369126 | 150 |
| 14 | iso_pu_bacteria | 2888373701 | 2888374040 | 150 |
| 15 | iso_pu_bacteria | 3007395558 | 3007396963 | 150 |
| 16 | iso_pu_bacteria | 640753048 | 640938031 | 150 |
| 17 | iso_pu_bacteria | 8004592986 | 8004597290 | 150 |
| 18 | 3300005339 | Ga0070660_100215308 | Ga0070660_1002153082 | 151 |
| 19 | 3300005353 | Ga0070669_101289508 | Ga0070669_1012895081 | 151 |
| 20 | 3300005438 | Ga0070701_10196734 | Ga0070701_101967341 | 151 |
| 21 | 3300005466 | Ga0070685_10699082 | Ga0070685_106990822 | 151 |
| 22 | 3300005535 | Ga0070684_100441545 | Ga0070684_1004415452 | 151 |
| 23 | 3300005564 | Ga0070664_100662985 | Ga0070664_1006629852 | 151 |
| 24 | 3300005618 | Ga0068864_100158941 | Ga0068864_1001589412 | 151 |
| 25 | 3300005840 | Ga0068870_10881406 | Ga0068870_108814062 | 151 |
| 26 | 3300009094 | Ga0111539_10120950 | Ga0111539_101209502 | 151 |
| 27 | 3300009174 | Ga0105241_10159581 | Ga0105241_101595812 | 151 |
| 28 | 3300011119 | Ga0105246_10180317 | Ga0105246_101803172 | 151 |
| 29 | 3300014325 | Ga0163163_10283150 | Ga0163163_102831501 | 151 |
| 30 | 3300025972 | Ga0207668_10975298 | Ga0207668_109752982 | 151 |
| 31 | 3300031548 | Ga0307408_100020366 | Ga0307408_1000203662 | 151 |
| 32 | 3300031730 | Ga0307516_10654132 | Ga0307516_106541322 | 151 |
| 33 | 3300031731 | Ga0307405_10562709 | Ga0307405_105627092 | 151 |
| 34 | 3300031824 | Ga0307413_10166997 | Ga0307413_101669972 | 151 |
| 35 | 3300031901 | Ga0307406_10024062 | Ga0307406_100240622 | 151 |
| 36 | 3300031903 | Ga0307407_10662964 | Ga0307407_106629641 | 151 |
| 37 | 3300032002 | Ga0307416_100255597 | Ga0307416_1002555972 | 151 |
| 38 | 3300032005 | Ga0307411_10070290 | Ga0307411_100702901 | 151 |
| 39 | 3300032126 | Ga0307415_100498191 | Ga0307415_1004981912 | 151 |
| 40 | 3300042436 | Ga0439435_0056989 | Ga0439435_0056989_219_680 | 151 |
| 41 | 3300048915 | Ga0496112_1484541 | Ga0496112_1484541_64_531 | 151 |
| 42 | 3300049514 | Ga0501291_069496 | Ga0501291_069496_25_486 | 151 |
| 43 | 3300049661 | Ga0501217_028268 | Ga0501217_028268_812_1273 | 151 |
| 44 | 3300049686 | Ga0501257_178896 | Ga0501257_178896_70_531 | 151 |
| 45 | 3300049690 | Ga0501261_081421 | Ga0501261_081421_51_509 | 151 |
| 46 | 3300049775 | Ga0501279_048842 | Ga0501279_048842_44_505 | 151 |
| 47 | 3300049779 | Ga0501283_032227 | Ga0501283_032227_186_647 | 151 |
| 48 | 3300050511 | nmdc:mga08y16_347669_c1 | nmdc:mga08y16_347669_c1_861_1319 | 151 |
| 49 | 3300014325 | Ga0163163_10258351 | Ga0163163_102583512 | 152 |
| 50 | 3300025932 | Ga0207690_10062647 | Ga0207690_100626472 | 152 |
| 51 | 3300025981 | Ga0207640_10634409 | Ga0207640_106344092 | 152 |
| 52 | 3300028794 | Ga0307515_10000043 | Ga0307515_100000435 | 152 |
| 53 | 3300028800 | Ga0265338_10262165 | Ga0265338_102621652 | 152 |
| 54 | 3300046616 | Ga0495668_0005919 | Ga0495668_0005919_6368_6832 | 152 |
| 55 | 3300048905 | Ga0496102_0142139 | Ga0496102_0142139_1048_1512 | 152 |
| 56 | 3300048907 | Ga0496104_0364953 | Ga0496104_0364953_169_633 | 152 |
| 57 | 3300050509 | nmdc:mga0qj67_207064_c1 | nmdc:mga0qj67_207064_c1_856_1317 | 152 |
| 58 | 3300003911 | JGI25405J52794_10009591 | JGI25405J52794_100095912 | 153 |
| 59 | 3300005293 | Ga0065715_10417651 | Ga0065715_104176512 | 153 |
| 60 | 3300005295 | Ga0065707_10204026 | Ga0065707_102040262 | 153 |
| 61 | 3300005445 | Ga0070708_100198840 | Ga0070708_1001988402 | 153 |
| 62 | 3300005445 | Ga0070708_100886245 | Ga0070708_1008862452 | 153 |
| 63 | 3300005467 | Ga0070706_100275742 | Ga0070706_1002757422 | 153 |
| 64 | 3300005467 | Ga0070706_100317743 | Ga0070706_1003177432 | 153 |
| 65 | 3300005467 | Ga0070706_100539350 | Ga0070706_1005393502 | 153 |
| 66 | 3300005468 | Ga0070707_100087209 | Ga0070707_1000872093 | 153 |
| 67 | 3300005468 | Ga0070707_100125773 | Ga0070707_1001257733 | 153 |
| 68 | 3300005468 | Ga0070707_100462391 | Ga0070707_1004623912 | 153 |
| 69 | 3300005471 | Ga0070698_100459540 | Ga0070698_1004595402 | 153 |
| 70 | 3300005471 | Ga0070698_100999025 | Ga0070698_1009990251 | 153 |
| 71 | 3300005518 | Ga0070699_100531427 | Ga0070699_1005314272 | 153 |
| 72 | 3300005536 | Ga0070697_100010932 | Ga0070697_1000109324 | 153 |
| 73 | 3300005536 | Ga0070697_100128756 | Ga0070697_1001287562 | 153 |
| 74 | 3300005536 | Ga0070697_100291053 | Ga0070697_1002910532 | 153 |
| 75 | 3300005536 | Ga0070697_101557026 | Ga0070697_1015570261 | 153 |
| 76 | 3300005841 | Ga0068863_100779003 | Ga0068863_1007790032 | 153 |
| 77 | 3300005937 | Ga0081455_10000152 | Ga0081455_1000015218 | 153 |
| 78 | 3300005937 | Ga0081455_10212798 | Ga0081455_102127982 | 153 |
| 79 | 3300005983 | Ga0081540_1229679 | Ga0081540_12296791 | 153 |
| 80 | 3300006058 | Ga0075432_10046546 | Ga0075432_100465462 | 153 |
| 81 | 3300006173 | Ga0070716_100126237 | Ga0070716_1001262372 | 153 |
| 82 | 3300006173 | Ga0070716_100181147 | Ga0070716_1001811472 | 153 |
| 83 | 3300006173 | Ga0070716_100279036 | Ga0070716_1002790362 | 153 |
| 84 | 3300006175 | Ga0070712_100518369 | Ga0070712_1005183692 | 153 |
| 85 | 3300006844 | Ga0075428_100058444 | Ga0075428_1000584443 | 153 |
| 86 | 3300006844 | Ga0075428_100089310 | Ga0075428_1000893103 | 153 |
| 87 | 3300006844 | Ga0075428_101118892 | Ga0075428_1011188921 | 153 |
| 88 | 3300006844 | Ga0075428_101657837 | Ga0075428_1016578371 | 153 |
| 89 | 3300006846 | Ga0075430_100060688 | Ga0075430_1000606882 | 153 |
| 90 | 3300006846 | Ga0075430_100927030 | Ga0075430_1009270302 | 153 |
| 91 | 3300006847 | Ga0075431_100033812 | Ga0075431_1000338123 | 153 |
| 92 | 3300006847 | Ga0075431_100085525 | Ga0075431_1000855254 | 153 |
| 93 | 3300006847 | Ga0075431_100094645 | Ga0075431_1000946452 | 153 |
| 94 | 3300006847 | Ga0075431_100545968 | Ga0075431_1005459682 | 153 |
| 95 | 3300006847 | Ga0075431_100588489 | Ga0075431_1005884892 | 153 |
| 96 | 3300006852 | Ga0075433_10131502 | Ga0075433_101315022 | 153 |
| 97 | 3300006852 | Ga0075433_10185973 | Ga0075433_101859732 | 153 |
| 98 | 3300006852 | Ga0075433_10234279 | Ga0075433_102342792 | 153 |
| 99 | 3300006871 | Ga0075434_100069272 | Ga0075434_1000692721 | 153 |
| 100 | 3300006871 | Ga0075434_100075437 | Ga0075434_1000754373 | 153 |
| 101 | 3300006871 | Ga0075434_100108629 | Ga0075434_1001086293 | 153 |
| 102 | 3300006871 | Ga0075434_100150545 | Ga0075434_1001505452 | 153 |
| 103 | 3300006871 | Ga0075434_100187341 | Ga0075434_1001873413 | 153 |
| 104 | 3300006871 | Ga0075434_100488732 | Ga0075434_1004887322 | 153 |
| 105 | 3300006880 | Ga0075429_100057259 | Ga0075429_1000572593 | 153 |
| 106 | 3300006880 | Ga0075429_100076099 | Ga0075429_1000760992 | 153 |
| 107 | 3300006880 | Ga0075429_100230909 | Ga0075429_1002309092 | 153 |
| 108 | 3300006880 | Ga0075429_100356555 | Ga0075429_1003565552 | 153 |
| 109 | 3300006914 | Ga0075436_100421161 | Ga0075436_1004211612 | 153 |
| 110 | 3300007076 | Ga0075435_100048354 | Ga0075435_1000483542 | 153 |
| 111 | 3300007076 | Ga0075435_100097876 | Ga0075435_1000978763 | 153 |
| 112 | 3300009094 | Ga0111539_11170488 | Ga0111539_111704882 | 153 |
| 113 | 3300009147 | Ga0114129_10054350 | Ga0114129_100543505 | 153 |
| 114 | 3300009147 | Ga0114129_10112170 | Ga0114129_101121704 | 153 |
| 115 | 3300009147 | Ga0114129_10146894 | Ga0114129_101468941 | 153 |
| 116 | 3300009147 | Ga0114129_10181073 | Ga0114129_101810732 | 153 |
| 117 | 3300009147 | Ga0114129_10302298 | Ga0114129_103022983 | 153 |
| 118 | 3300009147 | Ga0114129_10336723 | Ga0114129_103367233 | 153 |
| 119 | 3300009147 | Ga0114129_12205911 | Ga0114129_122059112 | 153 |
| 120 | 3300009176 | Ga0105242_10437207 | Ga0105242_104372072 | 153 |
| 121 | 3300010159 | Ga0099796_10120550 | Ga0099796_101205502 | 153 |
| 122 | 3300010159 | Ga0099796_10139070 | Ga0099796_101390702 | 153 |
| 123 | 3300012510 | Ga0157316_1012136 | Ga0157316_10121362 | 153 |
| 124 | 3300013297 | Ga0157378_10049726 | Ga0157378_100497262 | 153 |
| 125 | 3300013306 | Ga0163162_10717558 | Ga0163162_107175582 | 153 |
| 126 | 3300014326 | Ga0157380_10201592 | Ga0157380_102015921 | 153 |
| 127 | 3300025910 | Ga0207684_10541026 | Ga0207684_105410262 | 153 |
| 128 | 3300025922 | Ga0207646_10306064 | Ga0207646_103060642 | 153 |
| 129 | 3300025922 | Ga0207646_10316555 | Ga0207646_103165552 | 153 |
| 130 | 3300025934 | Ga0207686_10071666 | Ga0207686_100716662 | 153 |
| 131 | 3300025935 | Ga0207709_10087998 | Ga0207709_100879982 | 153 |
| 132 | 3300025939 | Ga0207665_10055254 | Ga0207665_100552542 | 153 |
| 133 | 3300028786 | Ga0307517_10078415 | Ga0307517_100784152 | 153 |
| 134 | 3300028794 | Ga0307515_10130022 | Ga0307515_101300222 | 153 |
| 135 | 3300031548 | Ga0307408_100672331 | Ga0307408_1006723312 | 153 |
| 136 | 3300031730 | Ga0307516_10028044 | Ga0307516_100280442 | 153 |
| 137 | 3300031731 | Ga0307405_10004594 | Ga0307405_100045942 | 153 |
| 138 | 3300031824 | Ga0307413_10016347 | Ga0307413_100163473 | 153 |
| 139 | 3300031824 | Ga0307413_10091174 | Ga0307413_100911742 | 153 |
| 140 | 3300031852 | Ga0307410_10008878 | Ga0307410_100088783 | 153 |
| 141 | 3300031901 | Ga0307406_10796293 | Ga0307406_107962932 | 153 |
| 142 | 3300031903 | Ga0307407_10354477 | Ga0307407_103544772 | 153 |
| 143 | 3300032002 | Ga0307416_100019872 | Ga0307416_1000198722 | 153 |
| 144 | 3300032002 | Ga0307416_100062039 | Ga0307416_1000620392 | 153 |
| 145 | 3300032004 | Ga0307414_10008571 | Ga0307414_100085712 | 153 |
| 146 | 3300035120 | Ga0373957_0220578 | Ga0373957_0220578_21_485 | 153 |
| 147 | 3300035207 | Ga0373942_0255186 | Ga0373942_0255186_121_585 | 153 |
| 148 | 3300035691 | Ga0373931_1177757 | Ga0373931_1177757_20_484 | 153 |
| 149 | 3300041408 | Ga0439453_0095510 | Ga0439453_0095510_138_605 | 153 |
| 150 | 3300041460 | Ga0451802_1972998 | Ga0451802_1972998_17_481 | 153 |
| 151 | 3300042436 | Ga0439435_0039578 | Ga0439435_0039578_585_1052 | 153 |
| 152 | 3300042876 | Ga0451577_0643199 | Ga0451577_0643199_247_711 | 153 |
| 153 | 3300045051 | Ga0451576_1220302 | Ga0451576_1220302_103_567 | 153 |
| 154 | 3300046472 | Ga0495580_0018170 | Ga0495580_0018170_3787_4251 | 153 |
| 155 | 3300046615 | Ga0495656_0128268 | Ga0495656_0128268_547_1014 | 153 |
| 156 | 3300046684 | Ga0495669_0409723 | Ga0495669_0409723_156_620 | 153 |
| 157 | 3300046689 | Ga0495613_0170777 | Ga0495613_0170777_157_621 | 153 |
| 158 | 3300047318 | Ga0495636_0010138 | Ga0495636_0010138_2248_2715 | 153 |
| 159 | 3300047318 | Ga0495636_0096662 | Ga0495636_0096662_556_1020 | 153 |
| 160 | 3300048089 | Ga0495614_0093311 | Ga0495614_0093311_63_527 | 153 |
| 161 | 3300049521 | Ga0501298_019514 | Ga0501298_019514_726_1190 | 153 |
| 162 | 3300049593 | Ga0501077_0932264 | Ga0501077_0932264_82_546 | 153 |
| 163 | 3300049668 | Ga0501233_065100 | Ga0501233_065100_330_794 | 153 |
| 164 | 3300049669 | Ga0501235_024826 | Ga0501235_024826_294_758 | 153 |
| 165 | 3300049676 | Ga0501246_042093 | Ga0501246_042093_68_532 | 153 |
| 166 | 3300049705 | Ga0501225_0017249 | Ga0501225_0017249_82_546 | 153 |
| 167 | 3300049706 | Ga0501229_054517 | Ga0501229_054517_64_528 | 153 |
| 168 | 3300050507 | nmdc:mga05p37_117954_c1 | nmdc:mga05p37_117954_c1_1785_2249 | 153 |
| 169 | 3300050507 | nmdc:mga05p37_174501_c1 | nmdc:mga05p37_174501_c1_946_1410 | 153 |
| 170 | 3300050507 | nmdc:mga05p37_228183_c1 | nmdc:mga05p37_228183_c1_1084_1548 | 153 |
| 171 | 3300050507 | nmdc:mga05p37_272961_c1 | nmdc:mga05p37_272961_c1_250_714 | 153 |
| 172 | 3300050507 | nmdc:mga05p37_292968_c1 | nmdc:mga05p37_292968_c1_734_1198 | 153 |
| 173 | 3300050507 | nmdc:mga05p37_487742_c1 | nmdc:mga05p37_487742_c1_435_899 | 153 |
| 174 | 3300050507 | nmdc:mga05p37_640828_c1 | nmdc:mga05p37_640828_c1_438_902 | 153 |
| 175 | 3300050507 | nmdc:mga05p37_652398_c1 | nmdc:mga05p37_652398_c1_195_659 | 153 |
| 176 | 3300050507 | nmdc:mga05p37_9465_c1 | nmdc:mga05p37_9465_c1_5668_6132 | 153 |
| 177 | 3300050507 | nmdc:mga05p37_959732_c1 | nmdc:mga05p37_959732_c1_349_813 | 153 |
| 178 | 3300050508 | nmdc:mga09592_21472_c1 | nmdc:mga09592_21472_c1_2058_2522 | 153 |
| 179 | 3300050508 | nmdc:mga09592_240528_c1 | nmdc:mga09592_240528_c1_827_1291 | 153 |
| 180 | 3300050508 | nmdc:mga09592_260609_c1 | nmdc:mga09592_260609_c1_862_1326 | 153 |
| 181 | 3300050508 | nmdc:mga09592_582564_c1 | nmdc:mga09592_582564_c1_82_546 | 153 |
| 182 | 3300050509 | nmdc:mga0qj67_859410_c1 | nmdc:mga0qj67_859410_c1_141_605 | 153 |
| 183 | 3300050510 | nmdc:mga06r32_111829_c1 | nmdc:mga06r32_111829_c1_1285_1749 | 153 |
| 184 | 3300050510 | nmdc:mga06r32_1166057_c1 | nmdc:mga06r32_1166057_c1_223_687 | 153 |
| 185 | 3300050510 | nmdc:mga06r32_125174_c1 | nmdc:mga06r32_125174_c1_437_901 | 153 |
| 186 | 3300050510 | nmdc:mga06r32_24540_c1 | nmdc:mga06r32_24540_c1_4037_4501 | 153 |
| 187 | 3300050511 | nmdc:mga08y16_709824_c1 | nmdc:mga08y16_709824_c1_212_676 | 153 |
| 188 | 3300050512 | nmdc:mga0n895_1044676_c1 | nmdc:mga0n895_1044676_c1_58_522 | 153 |
| 189 | 3300050512 | nmdc:mga0n895_128795_c1 | nmdc:mga0n895_128795_c1_245_709 | 153 |
| 190 | 3300050512 | nmdc:mga0n895_144054_c1 | nmdc:mga0n895_144054_c1_1116_1580 | 153 |
| 191 | 3300050512 | nmdc:mga0n895_183376_c1 | nmdc:mga0n895_183376_c1_887_1351 | 153 |
| 192 | 3300050512 | nmdc:mga0n895_330853_c1 | nmdc:mga0n895_330853_c1_115_579 | 153 |
| 193 | 3300050513 | nmdc:mga0rr50_133228_c1 | nmdc:mga0rr50_133228_c1_227_691 | 153 |
| 194 | 3300050513 | nmdc:mga0rr50_233282_c1 | nmdc:mga0rr50_233282_c1_808_1272 | 153 |
| 195 | 3300050513 | nmdc:mga0rr50_72840_c1 | nmdc:mga0rr50_72840_c1_1220_1684 | 153 |
| 196 | 3300050515 | nmdc:mga0a205_127390_c1 | nmdc:mga0a205_127390_c1_615_1079 | 153 |
| 197 | 3300050515 | nmdc:mga0a205_138220_c1 | nmdc:mga0a205_138220_c1_47_511 | 153 |
| 198 | 3300050515 | nmdc:mga0a205_168082_c1 | nmdc:mga0a205_168082_c1_758_1222 | 153 |
| 199 | 3300050515 | nmdc:mga0a205_175432_c1 | nmdc:mga0a205_175432_c1_739_1203 | 153 |
| 200 | 3300050515 | nmdc:mga0a205_181822_c1 | nmdc:mga0a205_181822_c1_29_493 | 153 |
| 201 | 3300050515 | nmdc:mga0a205_411166_c1 | nmdc:mga0a205_411166_c1_250_714 | 153 |
| 202 | 3300050515 | nmdc:mga0a205_55699_c1 | nmdc:mga0a205_55699_c1_930_1394 | 153 |
| 203 | 3300053145 | Ga0500586_044375 | Ga0500586_044375_429_893 | 153 |
| 204 | 3300053148 | Ga0500590_134119 | Ga0500590_134119_17_481 | 153 |
| 205 | iso_pu_bacteria | 2643221633 | 2644185257 | 153 |
| 206 | iso_pu_bacteria | 8056177738 | 8056178369 | 153 |
| 207 | 3300003578 | Ga0006562J51391_1184272 | Ga0006562J51391_11842722 | 154 |
| 208 | 3300005290 | Ga0065712_10167116 | Ga0065712_101671162 | 154 |
| 209 | 3300005329 | Ga0070683_100376225 | Ga0070683_1003762252 | 154 |
| 210 | 3300005330 | Ga0070690_100284386 | Ga0070690_1002843862 | 154 |
| 211 | 3300005334 | Ga0068869_100168853 | Ga0068869_1001688532 | 154 |
| 212 | 3300005535 | Ga0070684_100067578 | Ga0070684_1000675781 | 154 |
| 213 | 3300006871 | Ga0075434_100066668 | Ga0075434_1000666685 | 154 |
| 214 | 3300009011 | Ga0105251_10000002 | Ga0105251_1000000242 | 154 |
| 215 | 3300009174 | Ga0105241_10000002 | Ga0105241_10000002228 | 154 |
| 216 | 3300009545 | Ga0105237_10110204 | Ga0105237_101102042 | 154 |
| 217 | 3300009551 | Ga0105238_10044446 | Ga0105238_100444462 | 154 |
| 218 | 3300013100 | Ga0157373_10004988 | Ga0157373_100049884 | 154 |
| 219 | 3300025735 | Ga0207713_1000008 | Ga0207713_1000008303 | 154 |
| 220 | 3300025911 | Ga0207654_10000005 | Ga0207654_10000005228 | 154 |
| 221 | 3300025918 | Ga0207662_10054305 | Ga0207662_100543052 | 154 |
| 222 | 3300025926 | Ga0207659_10382781 | Ga0207659_103827811 | 154 |
| 223 | 3300025935 | Ga0207709_10384580 | Ga0207709_103845802 | 154 |
| 224 | 3300025939 | Ga0207665_10292349 | Ga0207665_102923492 | 154 |
| 225 | 3300025942 | Ga0207689_10021149 | Ga0207689_100211494 | 154 |
| 226 | 3300025944 | Ga0207661_10353394 | Ga0207661_103533942 | 154 |
| 227 | 3300027111 | Ga0209281_1000003 | Ga0209281_1000003482 | 154 |
| 228 | 3300028380 | Ga0268265_10589955 | Ga0268265_105899552 | 154 |
| 229 | 3300031456 | Ga0307513_10009006 | Ga0307513_1000900610 | 154 |
| 230 | 3300031616 | Ga0307508_10064350 | Ga0307508_100643502 | 154 |
| 231 | 3300035207 | Ga0373942_0070485 | Ga0373942_0070485_543_1010 | 154 |
| 232 | 3300037471 | Ga0395905_1415850 | Ga0395905_1415850_75_545 | 154 |
| 233 | 3300041411 | Ga0439466_0026090 | Ga0439466_0026090_641_1114 | 154 |
| 234 | 3300042006 | Ga0439432_018209 | Ga0439432_018209_1062_1535 | 154 |
| 235 | 3300046524 | Ga0495648_0000010 | Ga0495648_0000010_134587_135057 | 154 |
| 236 | 3300046530 | Ga0495654_0005466 | Ga0495654_0005466_1449_1922 | 154 |
| 237 | 3300046794 | Ga0495589_0000001 | Ga0495589_0000001_594570_595043 | 154 |
| 238 | 3300048916 | Ga0496113_0425297 | Ga0496113_0425297_468_965 | 154 |
| 239 | 3300048922 | Ga0496119_0000909 | Ga0496119_0000909_11846_12319 | 154 |
| 240 | 3300048923 | Ga0496120_0000159 | Ga0496120_0000159_93686_94159 | 154 |
| 241 | 3300048927 | Ga0496124_0000008 | Ga0496124_0000008_161298_161771 | 154 |
| 242 | 3300049459 | Ga0495678_000944 | Ga0495678_000944_6813_7283 | 154 |
| 243 | iso_pu_bacteria | 2818991467 | 2819718476 | 154 |
| 244 | 3300005435 | Ga0070714_100389508 | Ga0070714_1003895082 | 155 |
| 245 | 3300009094 | Ga0111539_11866261 | Ga0111539_118662611 | 155 |
| 246 | 3300011119 | Ga0105246_10631435 | Ga0105246_106314351 | 155 |
| 247 | 3300028786 | Ga0307517_10044761 | Ga0307517_100447614 | 155 |
| 248 | 3300031239 | Ga0265328_10015383 | Ga0265328_100153832 | 155 |
| 249 | 3300049571 | Ga0501034_0000969 | Ga0501034_0000969_25591_26064 | 155 |
| 250 | 3300049592 | Ga0501076_0657033 | Ga0501076_0657033_78_554 | 155 |
| 251 | 3300054114 | Ga0501084_0574098 | Ga0501084_0574098_144_620 | 155 |
| 252 | iso_pu_bacteria | 2513237092 | 2513622349 | 155 |
| 253 | iso_pu_bacteria | 2513237094 | 2513640526 | 155 |
| 254 | iso_pu_bacteria | 2513237095 | 2513645444 | 155 |
| 255 | iso_pu_bacteria | 2513237102 | 2513701720 | 155 |
| 256 | iso_pu_bacteria | 2513237104 | 2513718392 | 155 |
| 257 | iso_pu_bacteria | 2517093001 | 2517102623 | 155 |
| 258 | iso_pu_bacteria | 2524023205 | 2524437737 | 155 |
| 259 | iso_pu_bacteria | 2528768022 | 2528848706 | 155 |
| 260 | iso_pu_bacteria | 2617270735 | 2617346993 | 155 |
| 261 | iso_pu_bacteria | 2744054633 | 2745081204 | 155 |
| 262 | iso_pu_bacteria | 2791355196 | 2793062595 | 155 |
| 263 | iso_pu_bacteria | 2816332527 | 2818239671 | 155 |
| 264 | iso_pu_bacteria | 2824600985 | 2824602353 | 155 |
| 265 | iso_pu_bacteria | 2824609381 | 2824610553 | 155 |
| 266 | iso_pu_bacteria | 2824617872 | 2824618113 | 155 |
| 267 | iso_pu_bacteria | 2824626560 | 2824626781 | 155 |
| 268 | iso_pu_bacteria | 2824635225 | 2824636584 | 155 |
| 269 | iso_pu_bacteria | 2824644064 | 2824645118 | 155 |
| 270 | iso_pu_bacteria | 2824653114 | 2824654322 | 155 |
| 271 | iso_pu_bacteria | 2824661429 | 2824661593 | 155 |
| 272 | iso_pu_bacteria | 2824714736 | 2824715721 | 155 |
| 273 | iso_pu_bacteria | 2824723954 | 2824725204 | 155 |
| 274 | iso_pu_bacteria | 2824773399 | 2824775249 | 155 |
| 275 | iso_pu_bacteria | 2841974524 | 2841974612 | 155 |
| 276 | iso_pu_bacteria | 2842038055 | 2842040185 | 155 |
| 277 | iso_pu_bacteria | 2842045827 | 2842046870 | 155 |
| 278 | iso_pu_bacteria | 2847930680 | 2847936585 | 155 |
| 279 | iso_pu_bacteria | 2849076700 | 2849078960 | 155 |
| 280 | iso_pu_bacteria | 2857509624 | 2857515915 | 155 |
| 281 | iso_pu_bacteria | 2874612657 | 2874619375 | 155 |
| 282 | iso_pu_bacteria | 2874620515 | 2874626410 | 155 |
| 283 | iso_pu_bacteria | 2876761206 | 2876764959 | 155 |
| 284 | iso_pu_bacteria | 2879099564 | 2879108346 | 155 |
| 285 | iso_pu_bacteria | 2881665667 | 2881672529 | 155 |
| 286 | iso_pu_bacteria | 2885409591 | 2885413313 | 155 |
| 287 | iso_pu_bacteria | 2888378607 | 2888384478 | 155 |
| 288 | iso_pu_bacteria | 2888388044 | 2888393432 | 155 |
| 289 | iso_pu_bacteria | 2888419890 | 2888424928 | 155 |
| 290 | iso_pu_bacteria | 2904666416 | 2904671749 | 155 |
| 291 | iso_pu_bacteria | 2906643746 | 2906646191 | 155 |
| 292 | iso_pu_bacteria | 2922368715 | 2922374890 | 155 |
| 293 | iso_pu_bacteria | 2932784394 | 2932788801 | 155 |
| 294 | iso_pu_bacteria | 2932794094 | 2932797994 | 155 |
| 295 | iso_pu_bacteria | 2932801729 | 2932807164 | 155 |
| 296 | iso_pu_bacteria | 2932809354 | 2932812775 | 155 |
| 297 | iso_pu_bacteria | 2932818245 | 2932819133 | 155 |
| 298 | iso_pu_bacteria | 2932828146 | 2932830467 | 155 |
| 299 | iso_pu_bacteria | 2935616580 | 2935616761 | 155 |
| 300 | iso_pu_bacteria | 2935638405 | 2935641909 | 155 |
| 301 | iso_pu_bacteria | 2935665750 | 2935673040 | 155 |
| 302 | iso_pu_bacteria | 2935675223 | 2935675845 | 155 |
| 303 | iso_pu_bacteria | 2935684952 | 2935685842 | 155 |
| 304 | iso_pu_bacteria | 2935694250 | 2935697912 | 155 |
| 305 | iso_pu_bacteria | 2935703347 | 2935705682 | 155 |
| 306 | iso_pu_bacteria | 2935713505 | 2935714394 | 155 |
| 307 | iso_pu_bacteria | 2935722832 | 2935725013 | 155 |
| 308 | iso_pu_bacteria | 2935732158 | 2935732628 | 155 |
| 309 | iso_pu_bacteria | 2935741537 | 2935742007 | 155 |
| 310 | iso_pu_bacteria | 2935750917 | 2935751807 | 155 |
| 311 | iso_pu_bacteria | 2935760218 | 2935765064 | 155 |
| 312 | iso_pu_bacteria | 2935769743 | 2935771679 | 155 |
| 313 | iso_pu_bacteria | 2935785616 | 2935791173 | 155 |
| 314 | iso_pu_bacteria | 2935793552 | 2935795498 | 155 |
| 315 | iso_pu_bacteria | 2935801545 | 2935802660 | 155 |
| 316 | iso_pu_bacteria | 2935810662 | 2935813510 | 155 |
| 317 | iso_pu_bacteria | 2935827899 | 2935830076 | 155 |
| 318 | iso_pu_bacteria | 2935837841 | 2935837994 | 155 |
| 319 | iso_pu_bacteria | 2935855204 | 2935855385 | 155 |
| 320 | iso_pu_bacteria | 2935864058 | 2935867371 | 155 |
| 321 | iso_pu_bacteria | 2935873716 | 2935875810 | 155 |
| 322 | iso_pu_bacteria | 2935883170 | 2935886721 | 155 |
| 323 | iso_pu_bacteria | 2935959822 | 2935960790 | 155 |
| 324 | iso_pu_bacteria | 2935992306 | 2935996474 | 155 |
| 325 | iso_pu_bacteria | 2936002035 | 2936003754 | 155 |
| 326 | iso_pu_bacteria | 2936037263 | 2936042459 | 155 |
| 327 | iso_pu_bacteria | 2940556831 | 2940557390 | 155 |
| 328 | iso_pu_bacteria | 2941531003 | 2941533181 | 155 |
| 329 | iso_pu_bacteria | 2941538514 | 2941539340 | 155 |
| 330 | iso_pu_bacteria | 3005506211 | 3005510673 | 155 |
| 331 | iso_pu_bacteria | 3005587118 | 3005587688 | 155 |
| 332 | iso_pu_bacteria | 3005594810 | 3005599610 | 155 |
| 333 | iso_pu_bacteria | 3005710791 | 3005715267 | 155 |
| 334 | iso_pu_bacteria | 8006926726 | 8006933116 | 155 |
| 335 | iso_pu_bacteria | 8016511872 | 8016521826 | 155 |
| 336 | iso_pu_bacteria | 8016522445 | 8016529234 | 155 |
| 337 | iso_pu_bacteria | 8016539877 | 8016547668 | 155 |
| 338 | iso_pu_bacteria | 8016557553 | 8016562843 | 155 |
| 339 | iso_pu_bacteria | 8016566248 | 8016572787 | 155 |
| 340 | iso_pu_bacteria | 8016583857 | 8016593273 | 155 |
| 341 | iso_pu_bacteria | 8016595262 | 8016600618 | 155 |
| 342 | iso_pu_bacteria | 8016622563 | 8016626162 | 155 |
| 343 | iso_pu_bacteria | 8017057580 | 8017063828 | 155 |
| 344 | iso_pu_bacteria | 8019530166 | 8019534207 | 155 |
| 345 | iso_pu_bacteria | 8019547302 | 8019553258 | 155 |
| 346 | iso_pu_bacteria | 8019576017 | 8019583177 | 155 |
| 347 | iso_pu_bacteria | 8019597564 | 8019600365 | 155 |
| 348 | iso_pu_bacteria | 8019608314 | 8019618179 | 155 |
| 349 | iso_pu_bacteria | 8019648815 | 8019658932 | 155 |
| 350 | iso_pu_bacteria | 8056967851 | 8056968398 | 155 |
| 351 | 3300030521 | Ga0307511_10000934 | Ga0307511_1000093419 | 156 |
| 352 | 3300031456 | Ga0307513_10475523 | Ga0307513_104755232 | 156 |
| 353 | 3300053090 | Ga0500646_0006139 | Ga0500646_0006139_1827_2303 | 156 |
| 354 | 3300053091 | Ga0500647_0006809 | Ga0500647_0006809_534_1007 | 156 |
| 355 | 3300053092 | Ga0500583_0237606 | Ga0500583_0237606_225_701 | 156 |
| 356 | 3300053094 | Ga0500566_0000003 | Ga0500566_0000003_123291_123764 | 156 |
| 357 | 3300053095 | Ga0500640_000579 | Ga0500640_000579_3408_3881 | 156 |
| 358 | 3300053098 | Ga0500650_0125875 | Ga0500650_0125875_18_494 | 156 |
| 359 | 3300053111 | Ga0500572_000215 | Ga0500572_000215_19749_20222 | 156 |
| 360 | 3300053115 | Ga0500591_037062 | Ga0500591_037062_128_601 | 156 |
| 361 | 3300053123 | Ga0500614_016295 | Ga0500614_016295_597_1070 | 156 |
| 362 | 3300053133 | Ga0500655_001084 | Ga0500655_001084_59_535 | 156 |
| 363 | 3300053136 | Ga0500559_0002862 | Ga0500559_0002862_7978_8451 | 156 |
| 364 | 3300053150 | Ga0500603_000184 | Ga0500603_000184_2210_2683 | 156 |
| 365 | 3300053151 | Ga0500604_0003204 | Ga0500604_0003204_2298_2774 | 156 |
| 366 | 3300053159 | Ga0500630_001089 | Ga0500630_001089_4569_5042 | 156 |
| 367 | 3300053162 | Ga0500638_047699 | Ga0500638_047699_1351_1824 | 156 |
| 368 | 3300053163 | Ga0500639_000033 | Ga0500639_000033_25558_26031 | 156 |
| 369 | 3300053178 | Ga0500637_0356937 | Ga0500637_0356937_256_729 | 156 |
| 370 | 3300053735 | Ga0500596_016028 | Ga0500596_016028_405_878 | 156 |
| 371 | iso_pu_bacteria | 2513237087 | 2513589231 | 156 |
| 372 | 3300005288 | Ga0065714_10075630 | Ga0065714_100756302 | 157 |
| 373 | 3300005459 | Ga0068867_101494775 | Ga0068867_1014947751 | 157 |
| 374 | 3300005719 | Ga0068861_100246469 | Ga0068861_1002464693 | 157 |
| 375 | 3300006914 | Ga0075436_100745994 | Ga0075436_1007459941 | 157 |
| 376 | 3300009011 | Ga0105251_10003561 | Ga0105251_100035614 | 157 |
| 377 | 3300009036 | Ga0105244_10004680 | Ga0105244_100046804 | 157 |
| 378 | 3300013100 | Ga0157373_10006552 | Ga0157373_100065524 | 157 |
| 379 | 3300013102 | Ga0157371_10037904 | Ga0157371_100379042 | 157 |
| 380 | 3300013306 | Ga0163162_10585177 | Ga0163162_105851771 | 157 |
| 381 | 3300013308 | Ga0157375_10504172 | Ga0157375_105041722 | 157 |
| 382 | 3300014497 | Ga0182008_10029819 | Ga0182008_100298191 | 157 |
| 383 | 3300015262 | Ga0182007_10007254 | Ga0182007_100072542 | 157 |
| 384 | 3300015265 | Ga0182005_1000979 | Ga0182005_10009794 | 157 |
| 385 | 3300025728 | Ga0207655_1020689 | Ga0207655_10206892 | 157 |
| 386 | 3300025735 | Ga0207713_1001897 | Ga0207713_100189711 | 157 |
| 387 | 3300046452 | Ga0495617_081815 | Ga0495617_081815_58_534 | 157 |
| 388 | 3300046457 | Ga0495590_0017508 | Ga0495590_0017508_570_1046 | 157 |
| 389 | 3300046457 | Ga0495590_0055693 | Ga0495590_0055693_853_1329 | 157 |
| 390 | 3300046458 | Ga0495591_005495 | Ga0495591_005495_4662_5138 | 157 |
| 391 | 3300046460 | Ga0495638_0006936 | Ga0495638_0006936_3100_3576 | 157 |
| 392 | 3300046460 | Ga0495638_0188268 | Ga0495638_0188268_651_1127 | 157 |
| 393 | 3300046471 | Ga0495650_0005684 | Ga0495650_0005684_4725_5201 | 157 |
| 394 | 3300046474 | Ga0495605_0022067 | Ga0495605_0022067_718_1194 | 157 |
| 395 | 3300046491 | Ga0495584_0004182 | Ga0495584_0004182_2950_3426 | 157 |
| 396 | 3300046491 | Ga0495584_0154576 | Ga0495584_0154576_188_664 | 157 |
| 397 | 3300046492 | Ga0495585_0000300 | Ga0495585_0000300_14358_14834 | 157 |
| 398 | 3300046492 | Ga0495585_0021453 | Ga0495585_0021453_698_1174 | 157 |
| 399 | 3300046501 | Ga0495607_0023970 | Ga0495607_0023970_718_1194 | 157 |
| 400 | 3300046501 | Ga0495607_0170972 | Ga0495607_0170972_460_936 | 157 |
| 401 | 3300046506 | Ga0495583_0000467 | Ga0495583_0000467_40525_41001 | 157 |
| 402 | 3300046506 | Ga0495583_0115306 | Ga0495583_0115306_131_607 | 157 |
| 403 | 3300046512 | Ga0495610_0000842 | Ga0495610_0000842_25_501 | 157 |
| 404 | 3300046513 | Ga0495616_0016823 | Ga0495616_0016823_698_1174 | 157 |
| 405 | 3300046513 | Ga0495616_0238869 | Ga0495616_0238869_175_651 | 157 |
| 406 | 3300046518 | Ga0495631_0014826 | Ga0495631_0014826_566_1042 | 157 |
| 407 | 3300046519 | Ga0495632_0005512 | Ga0495632_0005512_2926_3402 | 157 |
| 408 | 3300046519 | Ga0495632_0033164 | Ga0495632_0033164_745_1221 | 157 |
| 409 | 3300046520 | Ga0495637_0004162 | Ga0495637_0004162_4821_5297 | 157 |
| 410 | 3300046520 | Ga0495637_0018744 | Ga0495637_0018744_1420_1896 | 157 |
| 411 | 3300046522 | Ga0495643_0021610 | Ga0495643_0021610_2305_2781 | 157 |
| 412 | 3300046523 | Ga0495644_0028570 | Ga0495644_0028570_446_922 | 157 |
| 413 | 3300046524 | Ga0495648_0052470 | Ga0495648_0052470_197_673 | 157 |
| 414 | 3300046528 | Ga0495642_0000011 | Ga0495642_0000011_87061_87537 | 157 |
| 415 | 3300046538 | Ga0495609_0000212 | Ga0495609_0000212_18201_18677 | 157 |
| 416 | 3300046542 | Ga0495597_0007896 | Ga0495597_0007896_4140_4616 | 157 |
| 417 | 3300046542 | Ga0495597_0216643 | Ga0495597_0216643_141_617 | 157 |
| 418 | 3300046557 | Ga0495622_0003121 | Ga0495622_0003121_4597_5073 | 157 |
| 419 | 3300046615 | Ga0495656_0017001 | Ga0495656_0017001_566_1042 | 157 |
| 420 | 3300046616 | Ga0495668_0073287 | Ga0495668_0073287_637_1113 | 157 |
| 421 | 3300046660 | Ga0495625_0111494 | Ga0495625_0111494_437_913 | 157 |
| 422 | 3300046660 | Ga0495625_0302255 | Ga0495625_0302255_414_890 | 157 |
| 423 | 3300046664 | Ga0495659_0003417 | Ga0495659_0003417_422_898 | 157 |
| 424 | 3300046665 | Ga0495661_0125130 | Ga0495661_0125130_207_683 | 157 |
| 425 | 3300046674 | Ga0495588_0007286 | Ga0495588_0007286_1911_2387 | 157 |
| 426 | 3300046684 | Ga0495669_0015203 | Ga0495669_0015203_1534_2010 | 157 |
| 427 | 3300046691 | Ga0495670_0166565 | Ga0495670_0166565_183_659 | 157 |
| 428 | 3300046692 | Ga0495671_0008444 | Ga0495671_0008444_2828_3304 | 157 |
| 429 | 3300046692 | Ga0495671_0090877 | Ga0495671_0090877_603_1079 | 157 |
| 430 | 3300046692 | Ga0495671_0161029 | Ga0495671_0161029_104_580 | 157 |
| 431 | 3300046692 | Ga0495671_0325723 | Ga0495671_0325723_197_673 | 157 |
| 432 | 3300047318 | Ga0495636_0054289 | Ga0495636_0054289_963_1439 | 157 |
| 433 | 3300047320 | Ga0495672_0011154 | Ga0495672_0011154_3429_3917 | 157 |
| 434 | 3300047320 | Ga0495672_0012658 | Ga0495672_0012658_4980_5456 | 157 |
| 435 | 3300047323 | Ga0495683_0062744 | Ga0495683_0062744_739_1215 | 157 |
| 436 | 3300047443 | Ga0495687_101327 | Ga0495687_101327_519_995 | 157 |
| 437 | 3300047445 | Ga0495677_0000578 | Ga0495677_0000578_4192_4668 | 157 |
| 438 | 3300047469 | Ga0495673_0027172 | Ga0495673_0027172_2142_2618 | 157 |
| 439 | 3300047469 | Ga0495673_0032637 | Ga0495673_0032637_1412_1888 | 157 |
| 440 | 3300047469 | Ga0495673_0037481 | Ga0495673_0037481_1042_1518 | 157 |
| 441 | 3300047469 | Ga0495673_0280541 | Ga0495673_0280541_26_502 | 157 |
| 442 | 3300047470 | Ga0495681_0066516 | Ga0495681_0066516_778_1254 | 157 |
| 443 | 3300047472 | Ga0495686_0006923 | Ga0495686_0006923_3400_3876 | 157 |
| 444 | 3300048091 | Ga0495626_0022514 | Ga0495626_0022514_1031_1507 | 157 |
| 445 | 3300048928 | Ga0496125_0026112 | Ga0496125_0026112_2083_2559 | 157 |
| 446 | 3300049460 | Ga0495682_0021575 | Ga0495682_0021575_677_1153 | 157 |
| 447 | iso_pu_bacteria | 2582581866 | 2585393655 | 157 |
| 448 | 3300003322 | rootL2_10070718 | rootL2_100707182 | 158 |
| 449 | 3300048929 | Ga0496126_0508934 | Ga0496126_0508934_411_890 | 158 |
| 450 | 3300049822 | Ga0501035_0308717 | Ga0501035_0308717_807_1289 | 158 |
| 451 | 3300003215 | JGI25153J46596_10000613 | JGI25153J46596_100006135 | 159 |
| 452 | 3300003354 | JGI25160J50197_1008566 | JGI25160J50197_10085664 | 159 |
| 453 | 3300003762 | Ga0055542_1004636 | Ga0055542_10046362 | 159 |
| 454 | 3300003794 | Ga0055531_10020681 | Ga0055531_100206812 | 159 |
| 455 | 3300004625 | Ga0055543_1014268 | Ga0055543_10142682 | 159 |
| 456 | 3300005262 | Ga0065165_1002156 | Ga0065165_100215612 | 159 |
| 457 | 3300005262 | Ga0065165_1006009 | Ga0065165_10060093 | 159 |
| 458 | 3300005327 | Ga0070658_10106333 | Ga0070658_101063332 | 159 |
| 459 | 3300005327 | Ga0070658_10493920 | Ga0070658_104939201 | 159 |
| 460 | 3300005329 | Ga0070683_100051714 | Ga0070683_1000517143 | 159 |
| 461 | 3300005329 | Ga0070683_100874358 | Ga0070683_1008743582 | 159 |
| 462 | 3300005434 | Ga0070709_10001083 | Ga0070709_1000108311 | 159 |
| 463 | 3300005434 | Ga0070709_10002717 | Ga0070709_100027175 | 159 |
| 464 | 3300005435 | Ga0070714_100053651 | Ga0070714_1000536511 | 159 |
| 465 | 3300005435 | Ga0070714_100104965 | Ga0070714_1001049651 | 159 |
| 466 | 3300005436 | Ga0070713_100016049 | Ga0070713_1000160492 | 159 |
| 467 | 3300005436 | Ga0070713_100064023 | Ga0070713_1000640232 | 159 |
| 468 | 3300005436 | Ga0070713_100718211 | Ga0070713_1007182111 | 159 |
| 469 | 3300005437 | Ga0070710_10000726 | Ga0070710_1000072614 | 159 |
| 470 | 3300005437 | Ga0070710_10021146 | Ga0070710_100211462 | 159 |
| 471 | 3300005439 | Ga0070711_100003099 | Ga0070711_1000030994 | 159 |
| 472 | 3300005439 | Ga0070711_100029718 | Ga0070711_1000297182 | 159 |
| 473 | 3300005455 | Ga0070663_100293268 | Ga0070663_1002932682 | 159 |
| 474 | 3300005456 | Ga0070678_100171997 | Ga0070678_1001719972 | 159 |
| 475 | 3300005458 | Ga0070681_10442025 | Ga0070681_104420252 | 159 |
| 476 | 3300005467 | Ga0070706_100234072 | Ga0070706_1002340723 | 159 |
| 477 | 3300005467 | Ga0070706_100259970 | Ga0070706_1002599702 | 159 |
| 478 | 3300005471 | Ga0070698_100245559 | Ga0070698_1002455592 | 159 |
| 479 | 3300005518 | Ga0070699_100970954 | Ga0070699_1009709541 | 159 |
| 480 | 3300005530 | Ga0070679_100133390 | Ga0070679_1001333902 | 159 |
| 481 | 3300005530 | Ga0070679_100191574 | Ga0070679_1001915742 | 159 |
| 482 | 3300005530 | Ga0070679_100490188 | Ga0070679_1004901882 | 159 |
| 483 | 3300005535 | Ga0070684_100248225 | Ga0070684_1002482252 | 159 |
| 484 | 3300005577 | Ga0068857_100190545 | Ga0068857_1001905452 | 159 |
| 485 | 3300005578 | Ga0068854_100906999 | Ga0068854_1009069991 | 159 |
| 486 | 3300005616 | Ga0068852_100146939 | Ga0068852_1001469392 | 159 |
| 487 | 3300005834 | Ga0068851_10206071 | Ga0068851_102060712 | 159 |
| 488 | 3300005843 | Ga0068860_100000213 | Ga0068860_10000021349 | 159 |
| 489 | 3300006051 | Ga0075364_10065139 | Ga0075364_100651392 | 159 |
| 490 | 3300006163 | Ga0070715_10009691 | Ga0070715_100096912 | 159 |
| 491 | 3300006163 | Ga0070715_10015245 | Ga0070715_100152452 | 159 |
| 492 | 3300006173 | Ga0070716_100006597 | Ga0070716_1000065975 | 159 |
| 493 | 3300006173 | Ga0070716_100124164 | Ga0070716_1001241642 | 159 |
| 494 | 3300006175 | Ga0070712_100002958 | Ga0070712_1000029589 | 159 |
| 495 | 3300006175 | Ga0070712_100149387 | Ga0070712_1001493872 | 159 |
| 496 | 3300006175 | Ga0070712_100313919 | Ga0070712_1003139191 | 159 |
| 497 | 3300006178 | Ga0075367_10459810 | Ga0075367_104598101 | 159 |
| 498 | 3300006871 | Ga0075434_100008890 | Ga0075434_1000088906 | 159 |
| 499 | 3300006871 | Ga0075434_100328397 | Ga0075434_1003283972 | 159 |
| 500 | 3300007076 | Ga0075435_100218517 | Ga0075435_1002185172 | 159 |
| 501 | 3300007788 | Ga0099795_10016192 | Ga0099795_100161922 | 159 |
| 502 | 3300009093 | Ga0105240_10006904 | Ga0105240_1000690420 | 159 |
| 503 | 3300009093 | Ga0105240_10105669 | Ga0105240_101056692 | 159 |
| 504 | 3300009094 | Ga0111539_11377376 | Ga0111539_113773761 | 159 |
| 505 | 3300009098 | Ga0105245_10204091 | Ga0105245_102040912 | 159 |
| 506 | 3300009174 | Ga0105241_10406706 | Ga0105241_104067061 | 159 |
| 507 | 3300009545 | Ga0105237_10003966 | Ga0105237_1000396616 | 159 |
| 508 | 3300009545 | Ga0105237_10021235 | Ga0105237_100212354 | 159 |
| 509 | 3300009545 | Ga0105237_10198900 | Ga0105237_101989002 | 159 |
| 510 | 3300009551 | Ga0105238_10742246 | Ga0105238_107422462 | 159 |
| 511 | 3300010159 | Ga0099796_10082217 | Ga0099796_100822171 | 159 |
| 512 | 3300010159 | Ga0099796_10094046 | Ga0099796_100940462 | 159 |
| 513 | 3300010375 | Ga0105239_10080432 | Ga0105239_100804322 | 159 |
| 514 | 3300010375 | Ga0105239_10130525 | Ga0105239_101305252 | 159 |
| 515 | 3300013100 | Ga0157373_11029918 | Ga0157373_110299181 | 159 |
| 516 | 3300013105 | Ga0157369_10002009 | Ga0157369_1000200914 | 159 |
| 517 | 3300014497 | Ga0182008_10312079 | Ga0182008_103120791 | 159 |
| 518 | 3300020082 | Ga0206353_11943815 | Ga0206353_119438152 | 159 |
| 519 | 3300021361 | Ga0213872_10010765 | Ga0213872_100107652 | 159 |
| 520 | 3300025245 | Ga0207425_1003455 | Ga0207425_10034555 | 159 |
| 521 | 3300025254 | Ga0209148_1000500 | Ga0209148_100050029 | 159 |
| 522 | 3300025261 | Ga0209233_1013528 | Ga0209233_10135282 | 159 |
| 523 | 3300025272 | Ga0209455_1004034 | Ga0209455_10040345 | 159 |
| 524 | 3300025297 | Ga0209758_1000024 | Ga0209758_100002487 | 159 |
| 525 | 3300025297 | Ga0209758_1011950 | Ga0209758_10119502 | 159 |
| 526 | 3300025299 | Ga0209256_1051868 | Ga0209256_10518682 | 159 |
| 527 | 3300025302 | Ga0207426_1002351 | Ga0207426_10023513 | 159 |
| 528 | 3300025302 | Ga0207426_1006588 | Ga0207426_10065883 | 159 |
| 529 | 3300025304 | Ga0209257_1001699 | Ga0209257_100169915 | 159 |
| 530 | 3300025321 | Ga0207656_10052124 | Ga0207656_100521242 | 159 |
| 531 | 3300025898 | Ga0207692_10000763 | Ga0207692_100007637 | 159 |
| 532 | 3300025898 | Ga0207692_10006941 | Ga0207692_100069411 | 159 |
| 533 | 3300025905 | Ga0207685_10006305 | Ga0207685_100063052 | 159 |
| 534 | 3300025905 | Ga0207685_10007289 | Ga0207685_100072892 | 159 |
| 535 | 3300025905 | Ga0207685_10291977 | Ga0207685_102919771 | 159 |
| 536 | 3300025906 | Ga0207699_10000406 | Ga0207699_1000040611 | 159 |
| 537 | 3300025906 | Ga0207699_10002096 | Ga0207699_100020963 | 159 |
| 538 | 3300025906 | Ga0207699_10641957 | Ga0207699_106419572 | 159 |
| 539 | 3300025909 | Ga0207705_10275653 | Ga0207705_102756531 | 159 |
| 540 | 3300025909 | Ga0207705_10802605 | Ga0207705_108026052 | 159 |
| 541 | 3300025910 | Ga0207684_10277914 | Ga0207684_102779142 | 159 |
| 542 | 3300025910 | Ga0207684_10341262 | Ga0207684_103412621 | 159 |
| 543 | 3300025911 | Ga0207654_10070925 | Ga0207654_100709252 | 159 |
| 544 | 3300025912 | Ga0207707_10007856 | Ga0207707_100078567 | 159 |
| 545 | 3300025913 | Ga0207695_10000008 | Ga0207695_10000008161 | 159 |
| 546 | 3300025913 | Ga0207695_10150817 | Ga0207695_101508172 | 159 |
| 547 | 3300025914 | Ga0207671_10011165 | Ga0207671_100111652 | 159 |
| 548 | 3300025914 | Ga0207671_10075491 | Ga0207671_100754912 | 159 |
| 549 | 3300025915 | Ga0207693_10001388 | Ga0207693_1000138814 | 159 |
| 550 | 3300025915 | Ga0207693_10002846 | Ga0207693_100028465 | 159 |
| 551 | 3300025915 | Ga0207693_10370147 | Ga0207693_103701472 | 159 |
| 552 | 3300025916 | Ga0207663_10016183 | Ga0207663_100161832 | 159 |
| 553 | 3300025916 | Ga0207663_10022293 | Ga0207663_100222932 | 159 |
| 554 | 3300025917 | Ga0207660_10077967 | Ga0207660_100779672 | 159 |
| 555 | 3300025919 | Ga0207657_10000942 | Ga0207657_100009424 | 159 |
| 556 | 3300025921 | Ga0207652_10092210 | Ga0207652_100922102 | 159 |
| 557 | 3300025921 | Ga0207652_10190699 | Ga0207652_101906992 | 159 |
| 558 | 3300025927 | Ga0207687_10113775 | Ga0207687_101137752 | 159 |
| 559 | 3300025928 | Ga0207700_10011931 | Ga0207700_100119312 | 159 |
| 560 | 3300025928 | Ga0207700_10057293 | Ga0207700_100572932 | 159 |
| 561 | 3300025929 | Ga0207664_10044437 | Ga0207664_100444372 | 159 |
| 562 | 3300025929 | Ga0207664_10115358 | Ga0207664_101153582 | 159 |
| 563 | 3300025939 | Ga0207665_10000874 | Ga0207665_1000087413 | 159 |
| 564 | 3300025939 | Ga0207665_10007378 | Ga0207665_100073783 | 159 |
| 565 | 3300025939 | Ga0207665_10298552 | Ga0207665_102985522 | 159 |
| 566 | 3300025944 | Ga0207661_10000210 | Ga0207661_1000021037 | 159 |
| 567 | 3300025944 | Ga0207661_11008913 | Ga0207661_110089132 | 159 |
| 568 | 3300025949 | Ga0207667_10126377 | Ga0207667_101263772 | 159 |
| 569 | 3300026088 | Ga0207641_10151335 | Ga0207641_101513352 | 159 |
| 570 | 3300026116 | Ga0207674_10042222 | Ga0207674_100422222 | 159 |
| 571 | 3300026121 | Ga0207683_10176466 | Ga0207683_101764662 | 159 |
| 572 | 3300026142 | Ga0207698_10250125 | Ga0207698_102501251 | 159 |
| 573 | 3300027512 | Ga0209179_1001115 | Ga0209179_10011152 | 159 |
| 574 | 3300027512 | Ga0209179_1008979 | Ga0209179_10089792 | 159 |
| 575 | 3300027671 | Ga0209588_1061138 | Ga0209588_10611382 | 159 |
| 576 | 3300028379 | Ga0268266_10041524 | Ga0268266_100415243 | 159 |
| 577 | 3300028381 | Ga0268264_10000065 | Ga0268264_10000065182 | 159 |
| 578 | 3300028800 | Ga0265338_10246572 | Ga0265338_102465721 | 159 |
| 579 | 3300031235 | Ga0265330_10008848 | Ga0265330_100088482 | 159 |
| 580 | 3300031235 | Ga0265330_10024415 | Ga0265330_100244152 | 159 |
| 581 | 3300031235 | Ga0265330_10103312 | Ga0265330_101033121 | 159 |
| 582 | 3300031235 | Ga0265330_10160680 | Ga0265330_101606802 | 159 |
| 583 | 3300031241 | Ga0265325_10010622 | Ga0265325_100106222 | 159 |
| 584 | 3300031247 | Ga0265340_10001234 | Ga0265340_100012349 | 159 |
| 585 | 3300031249 | Ga0265339_10010858 | Ga0265339_100108584 | 159 |
| 586 | 3300031250 | Ga0265331_10008999 | Ga0265331_100089992 | 159 |
| 587 | 3300031344 | Ga0265316_10104493 | Ga0265316_101044932 | 159 |
| 588 | 3300031507 | Ga0307509_10291590 | Ga0307509_102915902 | 159 |
| 589 | 3300031507 | Ga0307509_10386389 | Ga0307509_103863891 | 159 |
| 590 | 3300031712 | Ga0265342_10120660 | Ga0265342_101206602 | 159 |
| 591 | 3300031712 | Ga0265342_10328158 | Ga0265342_103281581 | 159 |
| 592 | 3300031730 | Ga0307516_10017791 | Ga0307516_100177916 | 159 |
| 593 | 3300033179 | Ga0307507_10025563 | Ga0307507_100255632 | 159 |
| 594 | 3300033180 | Ga0307510_10150721 | Ga0307510_101507212 | 159 |
| 595 | 3300035111 | Ga0373923_0055994 | Ga0373923_0055994_700_1188 | 159 |
| 596 | 3300035117 | Ga0373953_0035533 | Ga0373953_0035533_1386_1874 | 159 |
| 597 | 3300035118 | Ga0373954_0029385 | Ga0373954_0029385_1836_2324 | 159 |
| 598 | 3300035119 | Ga0373956_0065328 | Ga0373956_0065328_811_1299 | 159 |
| 599 | 3300035120 | Ga0373957_0207667 | Ga0373957_0207667_250_732 | 159 |
| 600 | 3300035172 | Ga0373955_0108242 | Ga0373955_0108242_261_749 | 159 |
| 601 | 3300035691 | Ga0373931_0138709 | Ga0373931_0138709_778_1332 | 159 |
| 602 | 3300035692 | Ga0373935_0045380 | Ga0373935_0045380_1041_1523 | 159 |
| 603 | 3300035724 | Ga0373933_0000751 | Ga0373933_0000751_14986_15468 | 159 |
| 604 | 3300035724 | Ga0373933_0228728 | Ga0373933_0228728_588_1076 | 159 |
| 605 | 3300036401 | Ga0373937_0757474 | Ga0373937_0757474_38_526 | 159 |
| 606 | 3300037466 | Ga0395898_1206376 | Ga0395898_1206376_13_495 | 159 |
| 607 | 3300037471 | Ga0395905_0195402 | Ga0395905_0195402_699_1181 | 159 |
| 608 | 3300037471 | Ga0395905_0651432 | Ga0395905_0651432_210_692 | 159 |
| 609 | 3300037853 | Ga0436364_0733950 | Ga0436364_0733950_225_707 | 159 |
| 610 | 3300039437 | Ga0436365_0220668 | Ga0436365_0220668_2286_2768 | 159 |
| 611 | 3300039437 | Ga0436365_0425979 | Ga0436365_0425979_486_968 | 159 |
| 612 | 3300039447 | Ga0436361_0858840 | Ga0436361_0858840_3183_3665 | 159 |
| 613 | 3300039447 | Ga0436361_1186555 | Ga0436361_1186555_1297_1803 | 159 |
| 614 | 3300039450 | Ga0436363_0946951 | Ga0436363_0946951_134_655 | 159 |
| 615 | 3300041413 | Ga0439465_0091987 | Ga0439465_0091987_177_659 | 159 |
| 616 | 3300041486 | Ga0451807_1368907 | Ga0451807_1368907_446_928 | 159 |
| 617 | 3300041512 | Ga0451853_2663894 | Ga0451853_2663894_54_536 | 159 |
| 618 | 3300044658 | Ga0466972_0059513 | Ga0466972_0059513_726_1208 | 159 |
| 619 | 3300044658 | Ga0466972_0166145 | Ga0466972_0166145_388_870 | 159 |
| 620 | 3300044684 | Ga0466966_0015338 | Ga0466966_0015338_680_1162 | 159 |
| 621 | 3300044693 | Ga0466961_0000038 | Ga0466961_0000038_69615_70097 | 159 |
| 622 | 3300044693 | Ga0466961_0510267 | Ga0466961_0510267_176_658 | 159 |
| 623 | 3300044706 | Ga0466964_0199735 | Ga0466964_0199735_347_829 | 159 |
| 624 | 3300044842 | Ga0466957_0064845 | Ga0466957_0064845_994_1476 | 159 |
| 625 | 3300044901 | Ga0466960_0246905 | Ga0466960_0246905_135_617 | 159 |
| 626 | 3300045976 | Ga0466967_0448552 | Ga0466967_0448552_169_651 | 159 |
| 627 | 3300045976 | Ga0466967_0643111 | Ga0466967_0643111_94_576 | 159 |
| 628 | 3300046452 | Ga0495617_127437 | Ga0495617_127437_160_642 | 159 |
| 629 | 3300046454 | Ga0495592_0145537 | Ga0495592_0145537_130_618 | 159 |
| 630 | 3300046455 | Ga0495603_0110794 | Ga0495603_0110794_588_1070 | 159 |
| 631 | 3300046459 | Ga0495629_0127283 | Ga0495629_0127283_38_559 | 159 |
| 632 | 3300046462 | Ga0495651_0040765 | Ga0495651_0040765_228_716 | 159 |
| 633 | 3300046462 | Ga0495651_0842703 | Ga0495651_0842703_19_501 | 159 |
| 634 | 3300046463 | Ga0495653_0025533 | Ga0495653_0025533_3321_3809 | 159 |
| 635 | 3300046476 | Ga0495662_0055440 | Ga0495662_0055440_385_873 | 159 |
| 636 | 3300046477 | Ga0495664_0070883 | Ga0495664_0070883_1054_1542 | 159 |
| 637 | 3300046477 | Ga0495664_0131782 | Ga0495664_0131782_373_855 | 159 |
| 638 | 3300046491 | Ga0495584_0118141 | Ga0495584_0118141_145_627 | 159 |
| 639 | 3300046492 | Ga0495585_0043795 | Ga0495585_0043795_207_689 | 159 |
| 640 | 3300046507 | Ga0495606_0104463 | Ga0495606_0104463_67_549 | 159 |
| 641 | 3300046511 | Ga0495608_0032385 | Ga0495608_0032385_2553_3041 | 159 |
| 642 | 3300046514 | Ga0495618_0279955 | Ga0495618_0279955_217_705 | 159 |
| 643 | 3300046516 | Ga0495628_0154334 | Ga0495628_0154334_171_659 | 159 |
| 644 | 3300046518 | Ga0495631_0233904 | Ga0495631_0233904_57_539 | 159 |
| 645 | 3300046528 | Ga0495642_0187531 | Ga0495642_0187531_76_558 | 159 |
| 646 | 3300046529 | Ga0495652_0041116 | Ga0495652_0041116_932_1414 | 159 |
| 647 | 3300046529 | Ga0495652_0076698 | Ga0495652_0076698_1836_2324 | 159 |
| 648 | 3300046529 | Ga0495652_0792718 | Ga0495652_0792718_103_585 | 159 |
| 649 | 3300046536 | Ga0495587_0468239 | Ga0495587_0468239_127_615 | 159 |
| 650 | 3300046543 | Ga0495645_0021359 | Ga0495645_0021359_2064_2552 | 159 |
| 651 | 3300046557 | Ga0495622_0021138 | Ga0495622_0021138_1233_1715 | 159 |
| 652 | 3300046559 | Ga0495667_0086546 | Ga0495667_0086546_1025_1513 | 159 |
| 653 | 3300046648 | Ga0495611_0159656 | Ga0495611_0159656_15_497 | 159 |
| 654 | 3300046675 | Ga0495657_0066730 | Ga0495657_0066730_197_685 | 159 |
| 655 | 3300046678 | Ga0495599_0072044 | Ga0495599_0072044_176_664 | 159 |
| 656 | 3300046679 | Ga0495623_0178224 | Ga0495623_0178224_219_707 | 159 |
| 657 | 3300046679 | Ga0495623_0292010 | Ga0495623_0292010_381_863 | 159 |
| 658 | 3300046689 | Ga0495613_0558392 | Ga0495613_0558392_249_731 | 159 |
| 659 | 3300047315 | Ga0495581_0061677 | Ga0495581_0061677_1529_2011 | 159 |
| 660 | 3300047317 | Ga0495604_0034015 | Ga0495604_0034015_2520_3008 | 159 |
| 661 | 3300047319 | Ga0495674_0216328 | Ga0495674_0216328_678_1166 | 159 |
| 662 | 3300047322 | Ga0495680_0445112 | Ga0495680_0445112_143_631 | 159 |
| 663 | 3300047471 | Ga0495684_0090955 | Ga0495684_0090955_623_1111 | 159 |
| 664 | 3300047472 | Ga0495686_0246712 | Ga0495686_0246712_385_867 | 159 |
| 665 | 3300047472 | Ga0495686_0338481 | Ga0495686_0338481_213_695 | 159 |
| 666 | 3300047673 | Ga0495593_0181901 | Ga0495593_0181901_207_695 | 159 |
| 667 | 3300048088 | Ga0495602_0231828 | Ga0495602_0231828_372_860 | 159 |
| 668 | 3300048088 | Ga0495602_0394128 | Ga0495602_0394128_435_917 | 159 |
| 669 | 3300048904 | Ga0496101_0336013 | Ga0496101_0336013_690_1172 | 159 |
| 670 | 3300048907 | Ga0496104_0229148 | Ga0496104_0229148_616_1098 | 159 |
| 671 | 3300048909 | Ga0496106_0296209 | Ga0496106_0296209_513_995 | 159 |
| 672 | 3300048910 | Ga0496107_0309573 | Ga0496107_0309573_168_650 | 159 |
| 673 | 3300048911 | Ga0496108_0288365 | Ga0496108_0288365_803_1285 | 159 |
| 674 | 3300048912 | Ga0496109_0082524 | Ga0496109_0082524_582_1136 | 159 |
| 675 | 3300048914 | Ga0496111_0515464 | Ga0496111_0515464_314_868 | 159 |
| 676 | 3300048915 | Ga0496112_0146529 | Ga0496112_0146529_790_1344 | 159 |
| 677 | 3300048920 | Ga0496117_0099368 | Ga0496117_0099368_121_603 | 159 |
| 678 | 3300048921 | Ga0496118_0288749 | Ga0496118_0288749_158_640 | 159 |
| 679 | 3300048922 | Ga0496119_0258852 | Ga0496119_0258852_344_826 | 159 |
| 680 | 3300048924 | Ga0496121_0103376 | Ga0496121_0103376_627_1109 | 159 |
| 681 | 3300048929 | Ga0496126_0009184 | Ga0496126_0009184_802_1284 | 159 |
| 682 | 3300048929 | Ga0496126_0037704 | Ga0496126_0037704_2573_3055 | 159 |
| 683 | 3300048929 | Ga0496126_0060967 | Ga0496126_0060967_242_724 | 159 |
| 684 | 3300049459 | Ga0495678_151121 | Ga0495678_151121_175_657 | 159 |
| 685 | 3300050492 | nmdc:mga0yw44_125034_c1 | nmdc:mga0yw44_125034_c1_593_1291 | 159 |
| 686 | 3300050512 | nmdc:mga0n895_473759_c1 | nmdc:mga0n895_473759_c1_429_911 | 159 |
| 687 | 3300050512 | nmdc:mga0n895_9753_c1 | nmdc:mga0n895_9753_c1_2782_3264 | 159 |
| 688 | 3300050513 | nmdc:mga0rr50_17170_c1 | nmdc:mga0rr50_17170_c1_4306_4788 | 159 |
| 689 | 3300050516 | nmdc:mga0sz30_238167_c1 | nmdc:mga0sz30_238167_c1_16_498 | 159 |
| 690 | 3300053077 | Ga0495601_0184484 | Ga0495601_0184484_222_704 | 159 |
| 691 | 3300053078 | Ga0495612_0019908 | Ga0495612_0019908_695_1183 | 159 |
| 692 | 3300053078 | Ga0495612_0077954 | Ga0495612_0077954_418_900 | 159 |
| 693 | 3300053080 | Ga0500635_0001194 | Ga0500635_0001194_1251_1733 | 159 |
| 694 | 3300053080 | Ga0500635_0114002 | Ga0500635_0114002_276_758 | 159 |
| 695 | 3300053084 | Ga0495595_0229364 | Ga0495595_0229364_138_626 | 159 |
| 696 | 3300053087 | Ga0500643_000007 | Ga0500643_000007_8624_9106 | 159 |
| 697 | 3300053091 | Ga0500647_0274777 | Ga0500647_0274777_36_518 | 159 |
| 698 | 3300053094 | Ga0500566_0034843 | Ga0500566_0034843_1466_1948 | 159 |
| 699 | 3300053094 | Ga0500566_0043006 | Ga0500566_0043006_853_1335 | 159 |
| 700 | 3300053097 | Ga0500648_204553 | Ga0500648_204553_256_738 | 159 |
| 701 | 3300053102 | Ga0500554_004996 | Ga0500554_004996_2227_2709 | 159 |
| 702 | 3300053103 | Ga0500555_001725 | Ga0500555_001725_4747_5229 | 159 |
| 703 | 3300053104 | Ga0500556_0066417 | Ga0500556_0066417_655_1137 | 159 |
| 704 | 3300053105 | Ga0500557_000052 | Ga0500557_000052_25196_25678 | 159 |
| 705 | 3300053119 | Ga0500595_022872 | Ga0500595_022872_765_1247 | 159 |
| 706 | 3300053121 | Ga0500607_012093 | Ga0500607_012093_1372_1854 | 159 |
| 707 | 3300053122 | Ga0500608_236962 | Ga0500608_236962_184_666 | 159 |
| 708 | 3300053130 | Ga0500642_0000306 | Ga0500642_0000306_4495_4977 | 159 |
| 709 | 3300053130 | Ga0500642_0022000 | Ga0500642_0022000_1031_1513 | 159 |
| 710 | 3300053139 | Ga0500568_0036717 | Ga0500568_0036717_572_1054 | 159 |
| 711 | 3300053140 | Ga0500573_0008281 | Ga0500573_0008281_1098_1580 | 159 |
| 712 | 3300053142 | Ga0500577_0237576 | Ga0500577_0237576_87_569 | 159 |
| 713 | 3300053148 | Ga0500590_100392 | Ga0500590_100392_174_656 | 159 |
| 714 | 3300053150 | Ga0500603_002547 | Ga0500603_002547_172_654 | 159 |
| 715 | 3300053153 | Ga0500616_0080109 | Ga0500616_0080109_1121_1603 | 159 |
| 716 | 3300053155 | Ga0500620_097226 | Ga0500620_097226_535_1017 | 159 |
| 717 | 3300053156 | Ga0500622_0237636 | Ga0500622_0237636_156_638 | 159 |
| 718 | 3300053162 | Ga0500638_166551 | Ga0500638_166551_157_639 | 159 |
| 719 | 3300053163 | Ga0500639_045546 | Ga0500639_045546_285_767 | 159 |
| 720 | 3300053177 | Ga0500636_0059198 | Ga0500636_0059198_942_1424 | 159 |
| 721 | 3300053178 | Ga0500637_0041913 | Ga0500637_0041913_894_1376 | 159 |
| 722 | 3300053178 | Ga0500637_0119103 | Ga0500637_0119103_721_1203 | 159 |
| 723 | 3300053729 | Ga0500625_000139 | Ga0500625_000139_11727_12209 | 159 |
| 724 | 3300053733 | Ga0500552_007174 | Ga0500552_007174_650_1132 | 159 |
| 725 | 3300053735 | Ga0500596_001166 | Ga0500596_001166_2341_2823 | 159 |
| 726 | 3300055283 | Ga0500661_033874 | Ga0500661_033874_66_548 | 159 |
| 727 | iso_pu_bacteria | 2643221603 | 2644029507 | 159 |
| 728 | 3300005339 | Ga0070660_100156222 | Ga0070660_1001562223 | 160 |
| 729 | 3300005455 | Ga0070663_100090802 | Ga0070663_1000908022 | 160 |
| 730 | 3300005530 | Ga0070679_101092814 | Ga0070679_1010928141 | 160 |
| 731 | 3300005536 | Ga0070697_100273394 | Ga0070697_1002733942 | 160 |
| 732 | 3300007788 | Ga0099795_10322051 | Ga0099795_103220511 | 160 |
| 733 | 3300025253 | Ga0209677_102108 | Ga0209677_1021086 | 160 |
| 734 | 3300025261 | Ga0209233_1003604 | Ga0209233_10036042 | 160 |
| 735 | 3300025272 | Ga0209455_1007029 | Ga0209455_10070293 | 160 |
| 736 | 3300026067 | Ga0207678_10130984 | Ga0207678_101309842 | 160 |
| 737 | 3300038443 | Ga0395901_0006629 | Ga0395901_0006629_6624_7109 | 160 |
| 738 | 3300039437 | Ga0436365_0475914 | Ga0436365_0475914_534_1019 | 160 |
| 739 | 3300046471 | Ga0495650_0025895 | Ga0495650_0025895_2152_2652 | 160 |
| 740 | 3300048924 | Ga0496121_0474364 | Ga0496121_0474364_239_724 | 160 |
| 741 | 3300048928 | Ga0496125_0097725 | Ga0496125_0097725_903_1388 | 160 |
| 742 | 3300061719 | Ga0466962_0136991 | Ga0466962_0136991_25_510 | 160 |
| 743 | 3300005327 | Ga0070658_10654571 | Ga0070658_106545712 | 161 |
| 744 | 3300005339 | Ga0070660_100090985 | Ga0070660_1000909852 | 161 |
| 745 | 3300005366 | Ga0070659_100217668 | Ga0070659_1002176682 | 161 |
| 746 | 3300005458 | Ga0070681_10171454 | Ga0070681_101714542 | 161 |
| 747 | 3300005563 | Ga0068855_100150597 | Ga0068855_1001505972 | 161 |
| 748 | 3300009551 | Ga0105238_10340831 | Ga0105238_103408312 | 161 |
| 749 | 3300012510 | Ga0157316_1019734 | Ga0157316_10197342 | 161 |
| 750 | 3300013100 | Ga0157373_10110078 | Ga0157373_101100782 | 161 |
| 751 | 3300013105 | Ga0157369_10481821 | Ga0157369_104818212 | 161 |
| 752 | 3300013307 | Ga0157372_10490646 | Ga0157372_104906461 | 161 |
| 753 | 3300025917 | Ga0207660_10559623 | Ga0207660_105596232 | 161 |
| 754 | 3300025919 | Ga0207657_10004866 | Ga0207657_100048667 | 161 |
| 755 | 3300025932 | Ga0207690_10147613 | Ga0207690_101476132 | 161 |
| 756 | 3300026078 | Ga0207702_11135512 | Ga0207702_111355121 | 161 |
| 757 | 3300028379 | Ga0268266_10246751 | Ga0268266_102467511 | 161 |
| 758 | 3300049572 | Ga0501036_0616520 | Ga0501036_0616520_194_691 | 161 |
| 759 | 3300049573 | Ga0501037_0143926 | Ga0501037_0143926_665_1162 | 161 |
| 760 | 3300049579 | Ga0501043_0093533 | Ga0501043_0093533_66_563 | 161 |
| 761 | 3300049580 | Ga0501046_0094978 | Ga0501046_0094978_25_522 | 161 |
| 762 | 3300049583 | Ga0501067_0337538 | Ga0501067_0337538_100_597 | 161 |
| 763 | 3300049584 | Ga0501068_0468687 | Ga0501068_0468687_65_562 | 161 |
| 764 | 3300049742 | Ga0501080_0074660 | Ga0501080_0074660_2164_2661 | 161 |
| 765 | 3300049822 | Ga0501035_0071669 | Ga0501035_0071669_182_679 | 161 |
| 766 | 3300049823 | Ga0501044_0145576 | Ga0501044_0145576_197_694 | 161 |
| 767 | 3300053109 | Ga0500569_094412 | Ga0500569_094412_195_740 | 161 |
| 768 | 3300005347 | Ga0070668_100021312 | Ga0070668_1000213122 | 162 |
| 769 | 3300005438 | Ga0070701_10005863 | Ga0070701_100058634 | 162 |
| 770 | 3300005444 | Ga0070694_100034752 | Ga0070694_1000347522 | 162 |
| 771 | 3300005455 | Ga0070663_100332415 | Ga0070663_1003324152 | 162 |
| 772 | 3300005564 | Ga0070664_100334299 | Ga0070664_1003342992 | 162 |
| 773 | 3300005577 | Ga0068857_100019190 | Ga0068857_1000191905 | 162 |
| 774 | 3300005840 | Ga0068870_10009642 | Ga0068870_100096422 | 162 |
| 775 | 3300005843 | Ga0068860_100235462 | Ga0068860_1002354623 | 162 |
| 776 | 3300005844 | Ga0068862_100010749 | Ga0068862_1000107492 | 162 |
| 777 | 3300009094 | Ga0111539_10131263 | Ga0111539_101312632 | 162 |
| 778 | 3300009553 | Ga0105249_10001807 | Ga0105249_100018078 | 162 |
| 779 | 3300013306 | Ga0163162_11710688 | Ga0163162_117106881 | 162 |
| 780 | 3300013308 | Ga0157375_10032410 | Ga0157375_100324107 | 162 |
| 781 | 3300014326 | Ga0157380_10004824 | Ga0157380_100048249 | 162 |
| 782 | 3300025901 | Ga0207688_10710688 | Ga0207688_107106882 | 162 |
| 783 | 3300025908 | Ga0207643_10010821 | Ga0207643_100108218 | 162 |
| 784 | 3300025923 | Ga0207681_10004668 | Ga0207681_100046687 | 162 |
| 785 | 3300025961 | Ga0207712_10013250 | Ga0207712_100132508 | 162 |
| 786 | 3300026075 | Ga0207708_10137849 | Ga0207708_101378492 | 162 |
| 787 | 3300026089 | Ga0207648_10012512 | Ga0207648_100125122 | 162 |
| 788 | 3300026095 | Ga0207676_10079917 | Ga0207676_100799174 | 162 |
| 789 | 3300026116 | Ga0207674_10006034 | Ga0207674_100060342 | 162 |
| 790 | 3300026118 | Ga0207675_100071151 | Ga0207675_1000711513 | 162 |
| 791 | 3300027907 | Ga0207428_10727441 | Ga0207428_107274411 | 162 |
| 792 | 3300028380 | Ga0268265_10002435 | Ga0268265_1000243510 | 162 |
| 793 | 3300028381 | Ga0268264_10222339 | Ga0268264_102223392 | 162 |
| 794 | 3300031852 | Ga0307410_10634933 | Ga0307410_106349332 | 162 |
| 795 | 3300032002 | Ga0307416_100025085 | Ga0307416_1000250852 | 162 |
| 796 | 3300032005 | Ga0307411_10114610 | Ga0307411_101146102 | 162 |
| 797 | 3300039438 | Ga0436360_1119210 | Ga0436360_1119210_480_992 | 162 |
| 798 | 3300046794 | Ga0495589_0017858 | Ga0495589_0017858_2069_2575 | 162 |
| 799 | 3300049521 | Ga0501298_113475 | Ga0501298_113475_51_539 | 162 |
| 800 | 3300049654 | Ga0501207_060029 | Ga0501207_060029_34_522 | 162 |
| 801 | 3300050510 | nmdc:mga06r32_1283615_c1 | nmdc:mga06r32_1283615_c1_158_646 | 162 |
| 802 | 3300050511 | nmdc:mga08y16_530729_c1 | nmdc:mga08y16_530729_c1_81_569 | 162 |
| 803 | 3300046462 | Ga0495651_0312885 | Ga0495651_0312885_63_590 | 164 |
| 804 | 3300002070 | JGI24750J21931_1047247 | JGI24750J21931_10472471 | 166 |
| 805 | 3300005295 | Ga0065707_10567551 | Ga0065707_105675511 | 166 |
| 806 | 3300005328 | Ga0070676_10002228 | Ga0070676_100022287 | 166 |
| 807 | 3300005329 | Ga0070683_100020341 | Ga0070683_1000203413 | 166 |
| 808 | 3300005331 | Ga0070670_100083010 | Ga0070670_1000830102 | 166 |
| 809 | 3300005334 | Ga0068869_100063887 | Ga0068869_1000638871 | 166 |
| 810 | 3300005338 | Ga0068868_100049271 | Ga0068868_1000492712 | 166 |
| 811 | 3300005339 | Ga0070660_100053333 | Ga0070660_1000533332 | 166 |
| 812 | 3300005340 | Ga0070689_100816931 | Ga0070689_1008169311 | 166 |
| 813 | 3300005343 | Ga0070687_100393483 | Ga0070687_1003934831 | 166 |
| 814 | 3300005344 | Ga0070661_100026905 | Ga0070661_1000269052 | 166 |
| 815 | 3300005345 | Ga0070692_10093497 | Ga0070692_100934972 | 166 |
| 816 | 3300005347 | Ga0070668_100013869 | Ga0070668_1000138692 | 166 |
| 817 | 3300005353 | Ga0070669_100014943 | Ga0070669_1000149432 | 166 |
| 818 | 3300005354 | Ga0070675_100021193 | Ga0070675_1000211932 | 166 |
| 819 | 3300005356 | Ga0070674_100547834 | Ga0070674_1005478342 | 166 |
| 820 | 3300005364 | Ga0070673_100324007 | Ga0070673_1003240072 | 166 |
| 821 | 3300005365 | Ga0070688_100127895 | Ga0070688_1001278952 | 166 |
| 822 | 3300005366 | Ga0070659_100022073 | Ga0070659_1000220733 | 166 |
| 823 | 3300005367 | Ga0070667_100642436 | Ga0070667_1006424362 | 166 |
| 824 | 3300005438 | Ga0070701_10014733 | Ga0070701_100147332 | 166 |
| 825 | 3300005439 | Ga0070711_100479552 | Ga0070711_1004795521 | 166 |
| 826 | 3300005441 | Ga0070700_100024131 | Ga0070700_1000241313 | 166 |
| 827 | 3300005444 | Ga0070694_100074662 | Ga0070694_1000746621 | 166 |
| 828 | 3300005455 | Ga0070663_100060738 | Ga0070663_1000607381 | 166 |
| 829 | 3300005457 | Ga0070662_100027569 | Ga0070662_1000275692 | 166 |
| 830 | 3300005535 | Ga0070684_100005863 | Ga0070684_1000058632 | 166 |
| 831 | 3300005539 | Ga0068853_101606809 | Ga0068853_1016068091 | 166 |
| 832 | 3300005543 | Ga0070672_100043937 | Ga0070672_1000439372 | 166 |
| 833 | 3300005544 | Ga0070686_101019078 | Ga0070686_1010190781 | 166 |
| 834 | 3300005563 | Ga0068855_100129894 | Ga0068855_1001298942 | 166 |
| 835 | 3300005564 | Ga0070664_100024422 | Ga0070664_1000244223 | 166 |
| 836 | 3300005577 | Ga0068857_100273225 | Ga0068857_1002732251 | 166 |
| 837 | 3300005578 | Ga0068854_100195086 | Ga0068854_1001950861 | 166 |
| 838 | 3300005616 | Ga0068852_100021960 | Ga0068852_1000219602 | 166 |
| 839 | 3300005617 | Ga0068859_100148657 | Ga0068859_1001486572 | 166 |
| 840 | 3300005719 | Ga0068861_100011932 | Ga0068861_1000119322 | 166 |
| 841 | 3300005834 | Ga0068851_10022349 | Ga0068851_100223492 | 166 |
| 842 | 3300005842 | Ga0068858_100039931 | Ga0068858_1000399312 | 166 |
| 843 | 3300005843 | Ga0068860_100059712 | Ga0068860_1000597122 | 166 |
| 844 | 3300005844 | Ga0068862_100106989 | Ga0068862_1001069892 | 166 |
| 845 | 3300006871 | Ga0075434_100066726 | Ga0075434_1000667262 | 166 |
| 846 | 3300006881 | Ga0068865_100010434 | Ga0068865_1000104343 | 166 |
| 847 | 3300006931 | Ga0097620_100148653 | Ga0097620_1001486532 | 166 |
| 848 | 3300009093 | Ga0105240_10508133 | Ga0105240_105081331 | 166 |
| 849 | 3300009098 | Ga0105245_10600271 | Ga0105245_106002712 | 166 |
| 850 | 3300009177 | Ga0105248_10189369 | Ga0105248_101893692 | 166 |
| 851 | 3300009553 | Ga0105249_10007552 | Ga0105249_100075522 | 166 |
| 852 | 3300010375 | Ga0105239_10043084 | Ga0105239_100430842 | 166 |
| 853 | 3300013296 | Ga0157374_11756236 | Ga0157374_117562361 | 166 |
| 854 | 3300013306 | Ga0163162_10096710 | Ga0163162_100967102 | 166 |
| 855 | 3300013307 | Ga0157372_10244395 | Ga0157372_102443952 | 166 |
| 856 | 3300013308 | Ga0157375_10044327 | Ga0157375_100443275 | 166 |
| 857 | 3300014326 | Ga0157380_10286219 | Ga0157380_102862192 | 166 |
| 858 | 3300014745 | Ga0157377_10019271 | Ga0157377_100192713 | 166 |
| 859 | 3300014968 | Ga0157379_10009268 | Ga0157379_100092683 | 166 |
| 860 | 3300017792 | Ga0163161_10036989 | Ga0163161_100369893 | 166 |
| 861 | 3300025315 | Ga0207697_10027785 | Ga0207697_100277852 | 166 |
| 862 | 3300025321 | Ga0207656_10024927 | Ga0207656_100249272 | 166 |
| 863 | 3300025901 | Ga0207688_10023474 | Ga0207688_100234742 | 166 |
| 864 | 3300025904 | Ga0207647_10479813 | Ga0207647_104798132 | 166 |
| 865 | 3300025907 | Ga0207645_10000746 | Ga0207645_1000074612 | 166 |
| 866 | 3300025918 | Ga0207662_10016645 | Ga0207662_100166451 | 166 |
| 867 | 3300025919 | Ga0207657_10026433 | Ga0207657_100264332 | 166 |
| 868 | 3300025920 | Ga0207649_10025156 | Ga0207649_100251562 | 166 |
| 869 | 3300025923 | Ga0207681_10023787 | Ga0207681_100237873 | 166 |
| 870 | 3300025925 | Ga0207650_10023587 | Ga0207650_100235872 | 166 |
| 871 | 3300025926 | Ga0207659_10069822 | Ga0207659_100698222 | 166 |
| 872 | 3300025932 | Ga0207690_10190044 | Ga0207690_101900442 | 166 |
| 873 | 3300025933 | Ga0207706_10000761 | Ga0207706_1000076114 | 166 |
| 874 | 3300025936 | Ga0207670_10050670 | Ga0207670_100506702 | 166 |
| 875 | 3300025938 | Ga0207704_10146614 | Ga0207704_101466142 | 166 |
| 876 | 3300025940 | Ga0207691_10017636 | Ga0207691_100176363 | 166 |
| 877 | 3300025941 | Ga0207711_10102153 | Ga0207711_101021533 | 166 |
| 878 | 3300025942 | Ga0207689_10005497 | Ga0207689_100054973 | 166 |
| 879 | 3300025944 | Ga0207661_10023101 | Ga0207661_100231012 | 166 |
| 880 | 3300025945 | Ga0207679_10031886 | Ga0207679_100318862 | 166 |
| 881 | 3300025949 | Ga0207667_10044596 | Ga0207667_100445962 | 166 |
| 882 | 3300025960 | Ga0207651_10992050 | Ga0207651_109920501 | 166 |
| 883 | 3300025961 | Ga0207712_10051370 | Ga0207712_100513701 | 166 |
| 884 | 3300025972 | Ga0207668_10009741 | Ga0207668_100097415 | 166 |
| 885 | 3300025981 | Ga0207640_10389694 | Ga0207640_103896942 | 166 |
| 886 | 3300025986 | Ga0207658_10115507 | Ga0207658_101155072 | 166 |
| 887 | 3300026035 | Ga0207703_10075337 | Ga0207703_100753374 | 166 |
| 888 | 3300026035 | Ga0207703_10208683 | Ga0207703_102086832 | 166 |
| 889 | 3300026067 | Ga0207678_10018357 | Ga0207678_100183572 | 166 |
| 890 | 3300026075 | Ga0207708_10059942 | Ga0207708_100599422 | 166 |
| 891 | 3300026089 | Ga0207648_11334790 | Ga0207648_113347901 | 166 |
| 892 | 3300026116 | Ga0207674_10002712 | Ga0207674_100027129 | 166 |
| 893 | 3300026118 | Ga0207675_100020256 | Ga0207675_1000202563 | 166 |
| 894 | 3300026142 | Ga0207698_10144600 | Ga0207698_101446001 | 166 |
| 895 | 3300028380 | Ga0268265_10128893 | Ga0268265_101288931 | 166 |
| 896 | 3300028381 | Ga0268264_10109587 | Ga0268264_101095872 | 166 |
| 897 | 3300042012 | Ga0439455_0073321 | Ga0439455_0073321_372_872 | 166 |
| 898 | 3300048911 | Ga0496108_0817456 | Ga0496108_0817456_51_551 | 166 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1dgj-assembly1.cif.gz_A | crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774 | 0.9617 | 7 | 155 |
| 1rm6-assembly1.cif.gz_C | structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica | 0.9584 | 5 | 156 |
| 8gy3-assembly1.cif.gz_B | cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans | 0.9578 | 6 | 155 |
| 4c7y-assembly1.cif.gz_A | aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with sodium dithionite and sodium sulfide | 0.9567 | 6 | 155 |
| 1ffv-assembly1.cif.gz_A | carbon monoxide dehydrogenase from hydrogenophaga pseudoflava | 0.9525 | 6 | 156 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1alo002 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain | 0.9663 | 78 | 155 | 1.10.150.120 |
| 4zohC02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain | 0.9464 | 83 | 156 | 1.10.150.120 |
| 3hrdH02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain | 0.9453 | 83 | 155 | 1.10.150.120 |
| 5y6qA01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.94 | 5 | 80 | 3.10.20.30 |
| 1sb3F01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9374 | 5 | 80 | 3.10.20.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8I7C9-F1-model_v4 | (2Fe-2S)-binding protein | 0.9945 | 6 | 154 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A2G0VS79-F1-model_v4 | (2Fe-2S)-binding protein | 0.9937 | 5 | 156 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A2V8NWD2-F1-model_v4 | (2Fe-2S)-binding protein | 0.9937 | 6 | 154 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A1W6Z9M6-F1-model_v4 | (2Fe-2S)-binding protein | 0.9931 | 6 | 155 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A370NBK9-F1-model_v4 | (2Fe-2S)-binding protein | 0.9924 | 4 | 155 |
GO:0016491
GO:0046872 GO:0051537 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar