F485080

General Info

Members Datasets Scaffolds Average Seq Length
898 554 787 159

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10246572|Ga0265338_102465721
Length 190
Sequence MLARLYANGILAGIFNAIFASHNHRAGTNRMTQPTIRLTVNGRIHQVDAAADTALLYVLRNDLELNGPKYGCGLGECGTCTVLIDGVAARSCVIPISGCIGRDILTLEGLGSRSDPDPVQAAFIAEQAAQCGYCLNGMIMSTKALLLRNPHPSEAEVVEALRYHLCRCGAHVEIMRAAMRAAGHLAEALD

Samples

Sample ID Description Type Environment
1 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
2 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
3 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
4 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
5 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
6 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
7 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
8 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
9 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
10 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
11 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
12 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
13 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
14 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
15 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
16 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
17 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
18 2818991467 Bosea vestrisii 3192 Isolate Unclassified
19 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
20 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
21 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
22 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
23 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
24 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
25 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
26 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
27 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
28 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
29 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
30 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
31 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
32 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
33 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
34 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
35 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
36 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
37 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
38 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
39 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
40 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
41 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
42 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
43 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
44 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
45 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
46 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
47 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
48 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
49 2922368715
50 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
51 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
52 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
53 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
54 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
55 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
56 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
57 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
58 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
59 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
60 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
61 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
62 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
63 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
64 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
65 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
66 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
67 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
68 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
69 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
70 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
71 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
72 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
73 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
74 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
75 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
76 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
77 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
78 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
79 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
80 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
81 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
82 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
83 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
84 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
85 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
86 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
87 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
88 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
89 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
90 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
91 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
92 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
93 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
94 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
95 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
96 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
97 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
98 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
99 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
100 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
101 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
102 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
103 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
104 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
105 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
106 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
107 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
108 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
109 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
110 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
111 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
112 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
113 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
114 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
115 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
116 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
117 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
118 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
119 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
120 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
121 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
122 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
123 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
124 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
125 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
126 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
127 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
128 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
129 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
130 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
131 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
132 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
133 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
134 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
135 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
136 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
137 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
138 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
139 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
140 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
141 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
142 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
143 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
144 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
145 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
146 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
147 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
148 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
149 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
150 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
151 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
152 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
153 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
154 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
155 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
156 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
157 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
158 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
159 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
160 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
161 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
162 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
163 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
164 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
165 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
166 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
167 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
168 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
169 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
170 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
171 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
172 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
173 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
174 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
175 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
176 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
177 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
178 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
179 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
180 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
181 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
182 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
183 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
184 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
185 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
186 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
187 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
188 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
189 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
190 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
191 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
192 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
193 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
194 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
195 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
196 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
197 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
198 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
199 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
200 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
201 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
202 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
203 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
204 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
205 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
206 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
207 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
208 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
209 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
210 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
211 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
212 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
213 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
214 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
215 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
216 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
217 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
218 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
219 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
220 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
221 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
222 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
223 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
224 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
225 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
226 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
227 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
285 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
287 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
288 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
290 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
291 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
293 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
295 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
296 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
297 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
298 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
299 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
300 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
301 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
302 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
303 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
304 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
305 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
306 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
307 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
308 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
309 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
310 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
311 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
312 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
313 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
314 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
315 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
316 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
317 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
318 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
319 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
320 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
321 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
322 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
323 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
324 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
325 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
326 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
327 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
328 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
329 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
330 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
331 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
332 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
333 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
334 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
335 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
336 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
337 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
338 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
339 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
340 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
341 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
342 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
343 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
344 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
345 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
346 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
347 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
348 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
349 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
350 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
351 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
352 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
353 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
354 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
355 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
356 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
357 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
358 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
359 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
360 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
361 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
362 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
363 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
364 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
365 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
366 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
367 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
368 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
369 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
370 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
371 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
372 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
373 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
374 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
375 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
376 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
377 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
378 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
379 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
380 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
381 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
382 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
383 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
384 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
385 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
386 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
387 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
388 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
389 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
390 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
391 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
392 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
393 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
394 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
395 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
396 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
397 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
398 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
399 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
400 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
401 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
402 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
403 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
404 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
405 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
406 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
407 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
408 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
409 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
410 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
411 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
412 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
413 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
414 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
415 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
416 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
417 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
418 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
419 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
420 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
421 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
422 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
423 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
424 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
425 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
426 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
427 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
428 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
429 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
430 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
431 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
432 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
433 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
434 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
435 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
436 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
437 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
438 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
439 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
440 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
441 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
442 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
443 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
444 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
445 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
446 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
447 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
448 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
449 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
450 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
451 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
452 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
453 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
454 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
455 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
456 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
457 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
458 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
459 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
460 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
461 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
462 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
463 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
464 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
465 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
466 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
467 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
468 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
469 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
470 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
471 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
472 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
473 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
474 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
475 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
476 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
477 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
478 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
479 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
480 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
481 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
482 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
483 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
484 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
485 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
486 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
487 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
488 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
489 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
490 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
491 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
492 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
493 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
494 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
495 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
496 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
497 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
498 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
499 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
500 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
501 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
502 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
503 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
504 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
505 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
506 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
507 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
508 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
509 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
510 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
511 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
512 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
513 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
514 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
515 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
516 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
517 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
518 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
519 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
520 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
521 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
522 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
523 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
524 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
525 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
526 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
527 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
528 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
529 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
530 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
531 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
532 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
533 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
534 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
535 640753048 Serratia proteamaculans 568 Isolate Endosphere
536 8004592986 Serratia sp. S119 Isolate Unclassified
537 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
538 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
539 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
540 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
541 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
542 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
543 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
544 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
545 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
546 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
547 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
548 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
549 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
550 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
551 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
552 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
553 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
554 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.51
Metatranscriptomes 0.22
Isolates 12.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.8
Nodule 8.24
Rhizoplane 1.67
Rhizosphere 73.72
Stem 0
Stem Tuber 0
Unclassified 7.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24750J21931_1047247 3300002070 Bacteria 665
2 JGI25153J46596_10000613 3300003215 Bacteria 21789
3 rootL2_10070718 3300003322 Bacteria 2115
4 JGI25160J50197_1008566 3300003354 Bacteria 3886
5 Ga0006562J51391_1184272 3300003578 Bacteria 790
6 Ga0055542_1004636 3300003762 Bacteria 3281
7 Ga0055531_10020681 3300003794 Bacteria 2591
8 JGI25405J52794_10009591 3300003911 Bacteria 1829
9 Ga0055543_1014268 3300004625 Bacteria 1552
10 Ga0065165_1002156 3300005262 Bacteria 17812
11 Ga0065165_1006009 3300005262 Bacteria 6544
12 Ga0065714_10075630 3300005288 Bacteria 2883
13 Ga0065712_10167116 3300005290 Bacteria 1266
14 Ga0065715_10417651 3300005293 Bacteria 862
15 Ga0065707_10204026 3300005295 Bacteria 1297
16 Ga0065707_10567551 3300005295 Bacteria 710
17 Ga0070658_10106333 3300005327 Bacteria 2321
18 Ga0070658_10493920 3300005327 Bacteria 1057
19 Ga0070658_10654571 3300005327 Bacteria 911
20 Ga0070676_10002228 3300005328 Bacteria 9892
21 Ga0070683_100020341 3300005329 Bacteria 5906
22 Ga0070683_100051714 3300005329 Bacteria 3804
23 Ga0070683_100376225 3300005329 Bacteria 1353
24 Ga0070683_100874358 3300005329 Bacteria 862
25 Ga0070690_100284386 3300005330 Bacteria 1181
26 Ga0070670_100083010 3300005331 Bacteria 2753
27 Ga0068869_100063887 3300005334 Bacteria 2706
28 Ga0068869_100168853 3300005334 Bacteria 1708
29 Ga0068868_100049271 3300005338 Bacteria 3306
30 Ga0070660_100053333 3300005339 Bacteria 3119
31 Ga0070660_100090985 3300005339 Bacteria 2406
32 Ga0070660_100156222 3300005339 Bacteria 1836
33 Ga0070660_100215308 3300005339 Bacteria 1560
34 Ga0070689_100816931 3300005340 Bacteria 821
35 Ga0070687_100393483 3300005343 Bacteria 907
36 Ga0070661_100026905 3300005344 Bacteria 4140
37 Ga0070692_10093497 3300005345 Bacteria 1637
38 Ga0070668_100013869 3300005347 Bacteria 6025
39 Ga0070668_100021312 3300005347 Bacteria 4899
40 Ga0070669_100014943 3300005353 Bacteria 5532
41 Ga0070669_101289508 3300005353 Bacteria 632
42 Ga0070675_100021193 3300005354 Bacteria 5191
43 Ga0070674_100547834 3300005356 Bacteria 970
44 Ga0070673_100324007 3300005364 Bacteria 1362
45 Ga0070688_100127895 3300005365 Bacteria 1710
46 Ga0070659_100022073 3300005366 Bacteria 4857
47 Ga0070659_100217668 3300005366 Bacteria 1575
48 Ga0070667_100642436 3300005367 Bacteria 979
49 Ga0070709_10001083 3300005434 Bacteria 15083
50 Ga0070709_10002717 3300005434 Bacteria 9561
51 Ga0070714_100053651 3300005435 Bacteria 3442
52 Ga0070714_100104965 3300005435 Bacteria 2494
53 Ga0070714_100389508 3300005435 Bacteria 1315
54 Ga0070713_100016049 3300005436 Bacteria 5623
55 Ga0070713_100064023 3300005436 Bacteria 3085
56 Ga0070713_100718211 3300005436 Bacteria 955
57 Ga0070710_10000726 3300005437 Bacteria 15703
58 Ga0070710_10021146 3300005437 Bacteria 3386
59 Ga0070701_10005863 3300005438 Bacteria 5124
60 Ga0070701_10014733 3300005438 Bacteria 3591
61 Ga0070701_10196734 3300005438 Bacteria 1189
62 Ga0070711_100003099 3300005439 Bacteria 9616
63 Ga0070711_100029718 3300005439 Bacteria 3610
64 Ga0070711_100479552 3300005439 Bacteria 1022
65 Ga0070700_100024131 3300005441 Bacteria 3567
66 Ga0070694_100034752 3300005444 Bacteria 3327
67 Ga0070694_100074662 3300005444 Bacteria 2344
68 Ga0070708_100198840 3300005445 Unclassified 1876
69 Ga0070708_100886245 3300005445 Bacteria 838
70 Ga0070663_100060738 3300005455 Bacteria 2720
71 Ga0070663_100090802 3300005455 Bacteria 2262
72 Ga0070663_100293268 3300005455 Bacteria 1300
73 Ga0070663_100332415 3300005455 Bacteria 1225
74 Ga0070678_100171997 3300005456 Bacteria 1765
75 Ga0070662_100027569 3300005457 Bacteria 3944
76 Ga0070681_10171454 3300005458 Bacteria 2091
77 Ga0070681_10442025 3300005458 Bacteria 1212
78 Ga0068867_101494775 3300005459 Bacteria 629
79 Ga0070685_10699082 3300005466 Bacteria 739
80 Ga0070706_100234072 3300005467 Unclassified 1715
81 Ga0070706_100259970 3300005467 Bacteria 1621
82 Ga0070706_100275742 3300005467 Bacteria 1569
83 Ga0070706_100317743 3300005467 Bacteria 1452
84 Ga0070706_100539350 3300005467 Bacteria 1085
85 Ga0070707_100087209 3300005468 Unclassified 3019
86 Ga0070707_100125773 3300005468 Bacteria 2491
87 Ga0070707_100462391 3300005468 Bacteria 1230
88 Ga0070698_100245559 3300005471 Bacteria 1723
89 Ga0070698_100459540 3300005471 Bacteria 1209
90 Ga0070698_100999025 3300005471 Bacteria 784
91 Ga0070699_100531427 3300005518 Bacteria 1070
92 Ga0070699_100970954 3300005518 Bacteria 779
93 Ga0070679_100133390 3300005530 Bacteria 2465
94 Ga0070679_100191574 3300005530 Bacteria 2013
95 Ga0070679_100490188 3300005530 Bacteria 1173
96 Ga0070679_101092814 3300005530 Bacteria 742
97 Ga0070684_100005863 3300005535 Bacteria 9454
98 Ga0070684_100067578 3300005535 Bacteria 3140
99 Ga0070684_100248225 3300005535 Bacteria 1626
100 Ga0070684_100441545 3300005535 Bacteria 1202
101 Ga0070697_100010932 3300005536 Bacteria 7090
102 Ga0070697_100128756 3300005536 Unclassified 2122
103 Ga0070697_100273394 3300005536 Unclassified 1449
104 Ga0070697_100291053 3300005536 Bacteria 1403
105 Ga0070697_101557026 3300005536 Bacteria 591
106 Ga0068853_101606809 3300005539 Bacteria 630
107 Ga0070672_100043937 3300005543 Bacteria 3449
108 Ga0070686_101019078 3300005544 Bacteria 680
109 Ga0068855_100129894 3300005563 Bacteria 2878
110 Ga0068855_100150597 3300005563 Bacteria 2646
111 Ga0070664_100024422 3300005564 Bacteria 4999
112 Ga0070664_100334299 3300005564 Bacteria 1375
113 Ga0070664_100662985 3300005564 Bacteria 970
114 Ga0068857_100019190 3300005577 Bacteria 6002
115 Ga0068857_100190545 3300005577 Bacteria 1868
116 Ga0068857_100273225 3300005577 Bacteria 1553
117 Ga0068854_100195086 3300005578 Bacteria 1589
118 Ga0068854_100906999 3300005578 Bacteria 775
119 Ga0068852_100021960 3300005616 Bacteria 5108
120 Ga0068852_100146939 3300005616 Bacteria 2188
121 Ga0068859_100148657 3300005617 Bacteria 2418
122 Ga0068864_100158941 3300005618 Bacteria 2053
123 Ga0068861_100011932 3300005719 Bacteria 6050
124 Ga0068861_100246469 3300005719 Bacteria 1522
125 Ga0068861_101160840 3300005719 Bacteria 745
126 Ga0068851_10022349 3300005834 Bacteria 3080
127 Ga0068851_10206071 3300005834 Bacteria 1099
128 Ga0068870_10009642 3300005840 Bacteria 4400
129 Ga0068870_10881406 3300005840 Bacteria 631
130 Ga0068863_100779003 3300005841 Bacteria 953
131 Ga0068858_100039931 3300005842 Bacteria 4351
132 Ga0068860_100000213 3300005843 Bacteria 91105
133 Ga0068860_100059712 3300005843 Bacteria 3625
134 Ga0068860_100235462 3300005843 Bacteria 1780
135 Ga0068862_100010749 3300005844 Bacteria 7557
136 Ga0068862_100106989 3300005844 Bacteria 2452
137 Ga0068862_100761542 3300005844 Bacteria 943
138 Ga0081455_10000152 3300005937 Bacteria 83354
139 Ga0081455_10212798 3300005937 Bacteria 1439
140 Ga0081540_1229679 3300005983 Bacteria 656
141 Ga0075364_10065139 3300006051 Bacteria 2392
142 Ga0075432_10046546 3300006058 Bacteria 1523
143 Ga0070715_10009691 3300006163 Bacteria 3405
144 Ga0070715_10015245 3300006163 Bacteria 2862
145 Ga0070716_100006597 3300006173 Bacteria 5674
146 Ga0070716_100124164 3300006173 Unclassified 1621
147 Ga0070716_100126237 3300006173 Unclassified 1610
148 Ga0070716_100181147 3300006173 Bacteria 1383
149 Ga0070716_100279036 3300006173 Bacteria 1152
150 Ga0070712_100002958 3300006175 Bacteria 10518
151 Ga0070712_100149387 3300006175 Bacteria 1792
152 Ga0070712_100313919 3300006175 Bacteria 1273
153 Ga0070712_100518369 3300006175 Bacteria 1001
154 Ga0075367_10459810 3300006178 Bacteria 807
155 Ga0075428_100058444 3300006844 Bacteria 4222
156 Ga0075428_100089310 3300006844 Bacteria 3361
157 Ga0075428_101118892 3300006844 Bacteria 831
158 Ga0075428_101657837 3300006844 Bacteria 668
159 Ga0075430_100060688 3300006846 Bacteria 3177
160 Ga0075430_100927030 3300006846 Bacteria 718
161 Ga0075431_100033812 3300006847 Bacteria 5267
162 Ga0075431_100085525 3300006847 Bacteria 3255
163 Ga0075431_100094645 3300006847 Bacteria 3083
164 Ga0075431_100545968 3300006847 Bacteria 1147
165 Ga0075431_100588489 3300006847 Bacteria 1097
166 Ga0075433_10131502 3300006852 Bacteria 2223
167 Ga0075433_10185973 3300006852 Unclassified 1848
168 Ga0075433_10234279 3300006852 Bacteria 1630
169 Ga0075434_100008890 3300006871 Bacteria 9350
170 Ga0075434_100066668 3300006871 Bacteria 3586
171 Ga0075434_100066726 3300006871 Bacteria 3584
172 Ga0075434_100069272 3300006871 Bacteria 3517
173 Ga0075434_100075437 3300006871 Unclassified 3365
174 Ga0075434_100108629 3300006871 Bacteria 2784
175 Ga0075434_100150545 3300006871 Bacteria 2347
176 Ga0075434_100187341 3300006871 Bacteria 2090
177 Ga0075434_100328397 3300006871 Bacteria 1550
178 Ga0075434_100488732 3300006871 Bacteria 1252
179 Ga0075429_100057259 3300006880 Bacteria 3393
180 Ga0075429_100076099 3300006880 Bacteria 2923
181 Ga0075429_100230909 3300006880 Bacteria 1621
182 Ga0075429_100356555 3300006880 Bacteria 1281
183 Ga0068865_100010434 3300006881 Bacteria 5782
184 Ga0075436_100421161 3300006914 Bacteria 970
185 Ga0075436_100745994 3300006914 Bacteria 727
186 Ga0097620_100148653 3300006931 Bacteria 2418
187 Ga0075435_100048354 3300007076 Bacteria 3417
188 Ga0075435_100097876 3300007076 Bacteria 2428
189 Ga0075435_100218517 3300007076 Bacteria 1618
190 Ga0099795_10016192 3300007788 Bacteria 2353
191 Ga0099795_10322051 3300007788 Bacteria 685
192 Ga0105251_10000002 3300009011 Bacteria 350843
193 Ga0105251_10003561 3300009011 Bacteria 11238
194 Ga0105244_10004680 3300009036 Bacteria 9323
195 Ga0105240_10006904 3300009093 Bacteria 16585
196 Ga0105240_10105669 3300009093 Bacteria 3417
197 Ga0105240_10508133 3300009093 Bacteria 1339
198 Ga0111539_10120950 3300009094 Bacteria 3068
199 Ga0111539_10131263 3300009094 Bacteria 2933
200 Ga0111539_11170488 3300009094 Bacteria 893
201 Ga0111539_11377376 3300009094 Bacteria 818
202 Ga0111539_11866261 3300009094 Bacteria 697
203 Ga0105245_10204091 3300009098 Bacteria 1900
204 Ga0105245_10600271 3300009098 Bacteria 1127
205 Ga0114129_10054350 3300009147 Bacteria 5614
206 Ga0114129_10112170 3300009147 Bacteria 3761
207 Ga0114129_10146894 3300009147 Bacteria 3229
208 Ga0114129_10181073 3300009147 Bacteria 2867
209 Ga0114129_10257433 3300009147 Bacteria 2341
210 Ga0114129_10302298 3300009147 Bacteria 2132
211 Ga0114129_10336723 3300009147 Bacteria 2002
212 Ga0114129_12205911 3300009147 Bacteria 663
213 Ga0105241_10000002 3300009174 Bacteria 869480
214 Ga0105241_10159581 3300009174 Bacteria 1852
215 Ga0105241_10406706 3300009174 Bacteria 1195
216 Ga0105242_10437207 3300009176 Unclassified 1230
217 Ga0105248_10189369 3300009177 Bacteria 2318
218 Ga0105237_10003966 3300009545 Bacteria 17317
219 Ga0105237_10021235 3300009545 Bacteria 6678
220 Ga0105237_10110204 3300009545 Bacteria 2744
221 Ga0105237_10198900 3300009545 Bacteria 2004
222 Ga0105238_10044446 3300009551 Bacteria 4490
223 Ga0105238_10340831 3300009551 Bacteria 1487
224 Ga0105238_10742246 3300009551 Bacteria 995
225 Ga0105249_10001807 3300009553 Bacteria 18607
226 Ga0105249_10007552 3300009553 Bacteria 9483
227 Ga0099796_10082217 3300010159 Bacteria 1183
228 Ga0099796_10094046 3300010159 Bacteria 1118
229 Ga0099796_10120550 3300010159 Bacteria 1007
230 Ga0099796_10139070 3300010159 Bacteria 948
231 Ga0105239_10043084 3300010375 Bacteria 4945
232 Ga0105239_10080432 3300010375 Bacteria 3585
233 Ga0105239_10130525 3300010375 Bacteria 2795
234 Ga0105246_10180317 3300011119 Bacteria 1626
235 Ga0105246_10631435 3300011119 Bacteria 930
236 Ga0157316_1012136 3300012510 Bacteria 820
237 Ga0157316_1019734 3300012510 Bacteria 726
238 Ga0157373_10004988 3300013100 Bacteria 9971
239 Ga0157373_10006552 3300013100 Bacteria 8689
240 Ga0157373_10110078 3300013100 Bacteria 1936
241 Ga0157373_11029918 3300013100 Bacteria 615
242 Ga0157371_10037904 3300013102 Bacteria 3450
243 Ga0157369_10002009 3300013105 Bacteria 24521
244 Ga0157369_10481821 3300013105 Bacteria 1284
245 Ga0157374_11756236 3300013296 Bacteria 645
246 Ga0157378_10049726 3300013297 Unclassified 3730
247 Ga0163162_10096710 3300013306 Bacteria 3041
248 Ga0163162_10585177 3300013306 Bacteria 1243
249 Ga0163162_10717558 3300013306 Bacteria 1121
250 Ga0163162_11710688 3300013306 Bacteria 718
251 Ga0157372_10244395 3300013307 Bacteria 2083
252 Ga0157372_10490646 3300013307 Bacteria 1432
253 Ga0157375_10032410 3300013308 Bacteria 4956
254 Ga0157375_10044327 3300013308 Bacteria 4321
255 Ga0157375_10504172 3300013308 Bacteria 1374
256 Ga0163163_10258351 3300014325 Bacteria 1793
257 Ga0163163_10283150 3300014325 Bacteria 1709
258 Ga0157380_10004824 3300014326 Bacteria 9397
259 Ga0157380_10201592 3300014326 Bacteria 1766
260 Ga0157380_10286219 3300014326 Bacteria 1511
261 Ga0182008_10029819 3300014497 Bacteria 2754
262 Ga0182008_10312079 3300014497 Bacteria 825
263 Ga0157377_10019271 3300014745 Bacteria 3563
264 Ga0157379_10009268 3300014968 Bacteria 8572
265 Ga0182007_10007254 3300015262 Bacteria 4665
266 Ga0182005_1000979 3300015265 Bacteria 12386
267 Ga0163161_10036989 3300017792 Bacteria 3498
268 Ga0206353_11943815 3300020082 Bacteria 842
269 Ga0213872_10010765 3300021361 Bacteria 4344
270 Ga0207425_1003455 3300025245 Bacteria 5053
271 Ga0209677_102108 3300025253 Bacteria 7820
272 Ga0209148_1000500 3300025254 Bacteria 39994
273 Ga0209233_1003604 3300025261 Bacteria 5428
274 Ga0209233_1013528 3300025261 Bacteria 2328
275 Ga0209455_1004034 3300025272 Bacteria 4967
276 Ga0209455_1007029 3300025272 Bacteria 3236
277 Ga0209758_1000024 3300025297 Bacteria 591966
278 Ga0209758_1011950 3300025297 Bacteria 4938
279 Ga0209256_1051868 3300025299 Bacteria 988
280 Ga0207426_1002351 3300025302 Bacteria 12330
281 Ga0207426_1006588 3300025302 Bacteria 5011
282 Ga0209257_1001699 3300025304 Bacteria 24723
283 Ga0207697_10027785 3300025315 Bacteria 2313
284 Ga0207656_10024927 3300025321 Bacteria 2424
285 Ga0207656_10052124 3300025321 Bacteria 1771
286 Ga0207655_1020689 3300025728 Bacteria 3370
287 Ga0207713_1000008 3300025735 Bacteria 553952
288 Ga0207713_1001897 3300025735 Bacteria 15855
289 Ga0207692_10000763 3300025898 Bacteria 11404
290 Ga0207692_10006941 3300025898 Bacteria 4616
291 Ga0207688_10023474 3300025901 Bacteria 3378
292 Ga0207688_10438048 3300025901 Bacteria 814
293 Ga0207688_10710688 3300025901 Bacteria 636
294 Ga0207647_10479813 3300025904 Bacteria 695
295 Ga0207685_10006305 3300025905 Bacteria 3218
296 Ga0207685_10007289 3300025905 Bacteria 3073
297 Ga0207685_10291977 3300025905 Bacteria 804
298 Ga0207699_10000406 3300025906 Bacteria 22137
299 Ga0207699_10002096 3300025906 Bacteria 9428
300 Ga0207699_10641957 3300025906 Unclassified 775
301 Ga0207645_10000746 3300025907 Bacteria 27094
302 Ga0207643_10010821 3300025908 Bacteria 4920
303 Ga0207705_10275653 3300025909 Bacteria 1287
304 Ga0207705_10802605 3300025909 Bacteria 730
305 Ga0207684_10277914 3300025910 Unclassified 1444
306 Ga0207684_10341262 3300025910 Bacteria 1290
307 Ga0207684_10541026 3300025910 Bacteria 997
308 Ga0207654_10000005 3300025911 Bacteria 869492
309 Ga0207654_10070925 3300025911 Bacteria 2070
310 Ga0207707_10007856 3300025912 Bacteria 9275
311 Ga0207695_10000008 3300025913 Bacteria 1058268
312 Ga0207695_10150817 3300025913 Bacteria 2264
313 Ga0207671_10011165 3300025914 Bacteria 7335
314 Ga0207671_10075491 3300025914 Bacteria 2521
315 Ga0207693_10001388 3300025915 Bacteria 21472
316 Ga0207693_10002846 3300025915 Bacteria 14982
317 Ga0207693_10370147 3300025915 Bacteria 1121
318 Ga0207663_10016183 3300025916 Bacteria 4128
319 Ga0207663_10022293 3300025916 Bacteria 3618
320 Ga0207660_10077967 3300025917 Bacteria 2427
321 Ga0207660_10559623 3300025917 Bacteria 930
322 Ga0207662_10016645 3300025918 Bacteria 4151
323 Ga0207662_10054305 3300025918 Bacteria 2388
324 Ga0207657_10000942 3300025919 Bacteria 30819
325 Ga0207657_10004866 3300025919 Bacteria 14133
326 Ga0207657_10026433 3300025919 Bacteria 5336
327 Ga0207649_10025156 3300025920 Bacteria 3468
328 Ga0207652_10092210 3300025921 Bacteria 2664
329 Ga0207652_10190699 3300025921 Bacteria 1844
330 Ga0207646_10306064 3300025922 Unclassified 1436
331 Ga0207646_10316555 3300025922 Bacteria 1410
332 Ga0207681_10004668 3300025923 Bacteria 8427
333 Ga0207681_10023787 3300025923 Bacteria 3923
334 Ga0207650_10023587 3300025925 Bacteria 4365
335 Ga0207659_10069822 3300025926 Bacteria 2560
336 Ga0207659_10382781 3300025926 Bacteria 1173
337 Ga0207687_10113775 3300025927 Bacteria 2013
338 Ga0207700_10011931 3300025928 Bacteria 5571
339 Ga0207700_10057293 3300025928 Bacteria 2937
340 Ga0207664_10044437 3300025929 Bacteria 3479
341 Ga0207664_10115358 3300025929 Bacteria 2239
342 Ga0207690_10062647 3300025932 Bacteria 2533
343 Ga0207690_10147613 3300025932 Bacteria 1740
344 Ga0207690_10190044 3300025932 Bacteria 1552
345 Ga0207706_10000761 3300025933 Bacteria 33470
346 Ga0207686_10071666 3300025934 Bacteria 2231
347 Ga0207709_10087998 3300025935 Bacteria 2021
348 Ga0207709_10384580 3300025935 Bacteria 1069
349 Ga0207670_10050670 3300025936 Bacteria 2784
350 Ga0207704_10146614 3300025938 Bacteria 1659
351 Ga0207665_10000874 3300025939 Bacteria 20343
352 Ga0207665_10007378 3300025939 Bacteria 7268
353 Ga0207665_10055254 3300025939 Bacteria 2678
354 Ga0207665_10292349 3300025939 Bacteria 1216
355 Ga0207665_10298552 3300025939 Bacteria 1203
356 Ga0207691_10017636 3300025940 Bacteria 6765
357 Ga0207711_10102153 3300025941 Bacteria 2538
358 Ga0207689_10005497 3300025942 Bacteria 11332
359 Ga0207689_10021149 3300025942 Bacteria 5469
360 Ga0207661_10000210 3300025944 Bacteria 37700
361 Ga0207661_10023101 3300025944 Bacteria 4695
362 Ga0207661_10353394 3300025944 Bacteria 1326
363 Ga0207661_11008913 3300025944 Bacteria 767
364 Ga0207679_10031886 3300025945 Bacteria 3693
365 Ga0207667_10044596 3300025949 Bacteria 4698
366 Ga0207667_10126377 3300025949 Bacteria 2634
367 Ga0207651_10992050 3300025960 Bacteria 750
368 Ga0207712_10013250 3300025961 Bacteria 5285
369 Ga0207712_10051370 3300025961 Bacteria 2883
370 Ga0207668_10009741 3300025972 Bacteria 5769
371 Ga0207668_10975298 3300025972 Bacteria 757
372 Ga0207640_10389694 3300025981 Bacteria 1131
373 Ga0207640_10634409 3300025981 Bacteria 908
374 Ga0207658_10115507 3300025986 Bacteria 2130
375 Ga0207703_10075337 3300026035 Bacteria 2796
376 Ga0207703_10208683 3300026035 Bacteria 1740
377 Ga0207678_10018357 3300026067 Bacteria 6144
378 Ga0207678_10130984 3300026067 Bacteria 2139
379 Ga0207708_10059942 3300026075 Bacteria 2905
380 Ga0207708_10137849 3300026075 Bacteria 1912
381 Ga0207702_11135512 3300026078 Bacteria 775
382 Ga0207641_10151335 3300026088 Bacteria 2102
383 Ga0207648_10012512 3300026089 Bacteria 7943
384 Ga0207648_11334790 3300026089 Bacteria 674
385 Ga0207676_10079917 3300026095 Bacteria 2653
386 Ga0207674_10002712 3300026116 Bacteria 22094
387 Ga0207674_10006034 3300026116 Bacteria 14332
388 Ga0207674_10042222 3300026116 Bacteria 4712
389 Ga0207675_100020256 3300026118 Bacteria 6201
390 Ga0207675_100071151 3300026118 Bacteria 3251
391 Ga0207683_10176466 3300026121 Bacteria 1936
392 Ga0207698_10144600 3300026142 Bacteria 2054
393 Ga0207698_10250125 3300026142 Bacteria 1621
394 Ga0209281_1000003 3300027111 Bacteria 1260089
395 Ga0209179_1001115 3300027512 Bacteria 3132
396 Ga0209179_1008979 3300027512 Bacteria 1700
397 Ga0209588_1061138 3300027671 Bacteria 1218
398 Ga0207428_10727441 3300027907 Bacteria 708
399 Ga0268266_10041524 3300028379 Bacteria 3925
400 Ga0268266_10246751 3300028379 Bacteria 1650
401 Ga0268265_10002435 3300028380 Bacteria 14042
402 Ga0268265_10128893 3300028380 Bacteria 2098
403 Ga0268265_10589955 3300028380 Bacteria 1060
404 Ga0268264_10000065 3300028381 Bacteria 298403
405 Ga0268264_10109587 3300028381 Bacteria 2416
406 Ga0268264_10222339 3300028381 Bacteria 1739
407 Ga0307517_10044761 3300028786 Bacteria 4671
408 Ga0307517_10078415 3300028786 Bacteria 2856
409 Ga0307515_10000043 3300028794 Bacteria 304612
410 Ga0307515_10130022 3300028794 Bacteria 2781
411 Ga0265338_10246572 3300028800 Bacteria 1320
412 Ga0265338_10262165 3300028800 Bacteria 1270
413 Ga0307511_10000934 3300030521 Bacteria 30890
414 Ga0265330_10008848 3300031235 Bacteria 4816
415 Ga0265330_10024415 3300031235 Bacteria 2742
416 Ga0265330_10103312 3300031235 Bacteria 1219
417 Ga0265330_10160680 3300031235 Bacteria 954
418 Ga0265328_10015383 3300031239 Bacteria 2998
419 Ga0265325_10010622 3300031241 Bacteria 5322
420 Ga0265340_10001234 3300031247 Bacteria 14646
421 Ga0265339_10010858 3300031249 Bacteria 5633
422 Ga0265331_10008999 3300031250 Bacteria 5642
423 Ga0265316_10104493 3300031344 Bacteria 2150
424 Ga0307513_10009006 3300031456 Bacteria 12664
425 Ga0307513_10475523 3300031456 Bacteria 970
426 Ga0307509_10291590 3300031507 Bacteria 1386
427 Ga0307509_10386389 3300031507 Bacteria 1111
428 Ga0307408_100020366 3300031548 Bacteria 4476
429 Ga0307408_100672331 3300031548 Bacteria 928
430 Ga0307508_10064350 3300031616 Bacteria 3233
431 Ga0265342_10120660 3300031712 Bacteria 1477
432 Ga0265342_10328158 3300031712 Bacteria 800
433 Ga0307516_10017791 3300031730 Bacteria 7403
434 Ga0307516_10028044 3300031730 Bacteria 5703
435 Ga0307516_10654132 3300031730 Bacteria 706
436 Ga0307405_10004594 3300031731 Bacteria 6550
437 Ga0307405_10562709 3300031731 Bacteria 924
438 Ga0307413_10016347 3300031824 Bacteria 3830
439 Ga0307413_10091174 3300031824 Bacteria 1985
440 Ga0307413_10166997 3300031824 Bacteria 1553
441 Ga0307410_10008878 3300031852 Bacteria 5606
442 Ga0307410_10634933 3300031852 Bacteria 894
443 Ga0307406_10024062 3300031901 Bacteria 3633
444 Ga0307406_10796293 3300031901 Bacteria 797
445 Ga0307407_10354477 3300031903 Bacteria 1040
446 Ga0307407_10662964 3300031903 Bacteria 783
447 Ga0307416_100019872 3300032002 Bacteria 4774
448 Ga0307416_100025085 3300032002 Bacteria 4365
449 Ga0307416_100062039 3300032002 Bacteria 3054
450 Ga0307416_100255597 3300032002 Bacteria 1708
451 Ga0307414_10008571 3300032004 Bacteria 5810
452 Ga0307411_10070290 3300032005 Bacteria 2368
453 Ga0307411_10114610 3300032005 Bacteria 1937
454 Ga0307415_100498191 3300032126 Bacteria 1064
455 Ga0307507_10025563 3300033179 Bacteria 6400
456 Ga0307510_10150721 3300033180 Bacteria 1945
457 Ga0373923_0055994 3300035111 Bacteria 1664
458 Ga0373953_0035533 3300035117 Bacteria 1959
459 Ga0373954_0029385 3300035118 Bacteria 2530
460 Ga0373956_0065328 3300035119 Bacteria 1653
461 Ga0373957_0207667 3300035120 Bacteria 817
462 Ga0373957_0220578 3300035120 Bacteria 794
463 Ga0373955_0108242 3300035172 Bacteria 1604
464 Ga0373942_0070485 3300035207 Bacteria 1020
465 Ga0373942_0255186 3300035207 Bacteria 597
466 Ga0373931_0138709 3300035691 Bacteria 1406
467 Ga0373931_1177757 3300035691 Bacteria 524
468 Ga0373935_0045380 3300035692 Bacteria 2773
469 Ga0373933_0000751 3300035724 Bacteria 19833
470 Ga0373933_0228728 3300035724 Bacteria 1194
471 Ga0373937_0757474 3300036401 Bacteria 918
472 Ga0395898_1206376 3300037466 Bacteria 688
473 Ga0395905_0195402 3300037471 Bacteria 1897
474 Ga0395905_0651432 3300037471 Bacteria 955
475 Ga0395905_1415850 3300037471 Bacteria 599
476 Ga0436364_0733950 3300037853 Bacteria 1105
477 Ga0395901_0006629 3300038443 Bacteria 11698
478 Ga0436365_0220668 3300039437 Bacteria 2864
479 Ga0436365_0425979 3300039437 Bacteria 1005
480 Ga0436365_0475914 3300039437 Bacteria 1357
481 Ga0436360_1119210 3300039438 Bacteria 2268
482 Ga0436361_0858840 3300039447 Bacteria 5016
483 Ga0436361_1186555 3300039447 Bacteria 3438
484 Ga0436363_0946951 3300039450 Bacteria 733
485 Ga0439453_0095510 3300041408 Bacteria 657
486 Ga0439466_0026090 3300041411 Bacteria 2035
487 Ga0439465_0091987 3300041413 Bacteria 1039
488 Ga0451802_1972998 3300041460 Bacteria 530
489 Ga0451807_1368907 3300041486 Bacteria 1065
490 Ga0451853_2663894 3300041512 Bacteria 1118
491 Ga0439432_018209 3300042006 Bacteria 2350
492 Ga0439455_0073321 3300042012 Bacteria 923
493 Ga0439435_0039578 3300042436 Bacteria 1314
494 Ga0439435_0056989 3300042436 Bacteria 1130
495 Ga0451577_0643199 3300042876 Bacteria 962
496 Ga0466972_0059513 3300044658 Bacteria 1833
497 Ga0466972_0166145 3300044658 Bacteria 1036
498 Ga0466966_0015338 3300044684 Bacteria 5066
499 Ga0466961_0000038 3300044693 Bacteria 80721
500 Ga0466961_0510267 3300044693 Bacteria 726
501 Ga0466964_0199735 3300044706 Bacteria 959
502 Ga0466957_0064845 3300044842 Bacteria 2248
503 Ga0466960_0246905 3300044901 Bacteria 990
504 Ga0451576_1220302 3300045051 Bacteria 785
505 Ga0466967_0448552 3300045976 Bacteria 1261
506 Ga0466967_0643111 3300045976 Bacteria 1048
507 Ga0495617_081815 3300046452 Bacteria 1057
508 Ga0495617_127437 3300046452 Bacteria 818
509 Ga0495592_0145537 3300046454 Bacteria 1643
510 Ga0495603_0110794 3300046455 Bacteria 1601
511 Ga0495590_0017508 3300046457 Bacteria 2578
512 Ga0495590_0055693 3300046457 Bacteria 1382
513 Ga0495591_005495 3300046458 Bacteria 5851
514 Ga0495629_0127283 3300046459 Bacteria 1775
515 Ga0495638_0006936 3300046460 Bacteria 8173
516 Ga0495638_0188268 3300046460 Bacteria 1172
517 Ga0495651_0040765 3300046462 Bacteria 3608
518 Ga0495651_0312885 3300046462 Bacteria 1049
519 Ga0495651_0842703 3300046462 Bacteria 563
520 Ga0495653_0025533 3300046463 Bacteria 4745
521 Ga0495650_0005684 3300046471 Bacteria 7998
522 Ga0495650_0025895 3300046471 Bacteria 2739
523 Ga0495580_0018170 3300046472 Bacteria 5239
524 Ga0495605_0022067 3300046474 Bacteria 3366
525 Ga0495662_0055440 3300046476 Bacteria 1915
526 Ga0495664_0070883 3300046477 Bacteria 2081
527 Ga0495664_0131782 3300046477 Bacteria 1514
528 Ga0495584_0004182 3300046491 Bacteria 7788
529 Ga0495584_0118141 3300046491 Bacteria 1343
530 Ga0495584_0154576 3300046491 Bacteria 1165
531 Ga0495585_0000300 3300046492 Bacteria 49530
532 Ga0495585_0021453 3300046492 Bacteria 3707
533 Ga0495585_0043795 3300046492 Bacteria 2502
534 Ga0495607_0023970 3300046501 Bacteria 3811
535 Ga0495607_0170972 3300046501 Bacteria 1097
536 Ga0495583_0000467 3300046506 Bacteria 59823
537 Ga0495583_0115306 3300046506 Bacteria 1135
538 Ga0495606_0104463 3300046507 Bacteria 1719
539 Ga0495608_0032385 3300046511 Bacteria 3533
540 Ga0495610_0000842 3300046512 Bacteria 28591
541 Ga0495616_0016823 3300046513 Bacteria 4040
542 Ga0495616_0238869 3300046513 Bacteria 784
543 Ga0495618_0279955 3300046514 Bacteria 1040
544 Ga0495628_0154334 3300046516 Bacteria 1747
545 Ga0495631_0014826 3300046518 Bacteria 3752
546 Ga0495631_0233904 3300046518 Bacteria 784
547 Ga0495632_0005512 3300046519 Bacteria 8346
548 Ga0495632_0033164 3300046519 Bacteria 2653
549 Ga0495637_0004162 3300046520 Bacteria 7528
550 Ga0495637_0018744 3300046520 Bacteria 3206
551 Ga0495643_0021610 3300046522 Bacteria 3688
552 Ga0495644_0028570 3300046523 Bacteria 2110
553 Ga0495648_0000010 3300046524 Bacteria 307259
554 Ga0495648_0052470 3300046524 Bacteria 2476
555 Ga0495642_0000011 3300046528 Bacteria 128280
556 Ga0495642_0187531 3300046528 Bacteria 901
557 Ga0495652_0041116 3300046529 Bacteria 3992
558 Ga0495652_0076698 3300046529 Bacteria 2772
559 Ga0495652_0792718 3300046529 Bacteria 631
560 Ga0495654_0005466 3300046530 Bacteria 7375
561 Ga0495587_0468239 3300046536 Bacteria 697
562 Ga0495609_0000212 3300046538 Bacteria 57886
563 Ga0495597_0007896 3300046542 Bacteria 5364
564 Ga0495597_0216643 3300046542 Bacteria 761
565 Ga0495645_0021359 3300046543 Bacteria 4679
566 Ga0495622_0003121 3300046557 Bacteria 7856
567 Ga0495622_0021138 3300046557 Bacteria 3032
568 Ga0495667_0086546 3300046559 Bacteria 2032
569 Ga0495656_0017001 3300046615 Bacteria 2769
570 Ga0495656_0128268 3300046615 Bacteria 1205
571 Ga0495668_0005919 3300046616 Bacteria 8137
572 Ga0495668_0073287 3300046616 Bacteria 1881
573 Ga0495611_0159656 3300046648 Bacteria 1053
574 Ga0495625_0111494 3300046660 Bacteria 1869
575 Ga0495625_0302255 3300046660 Bacteria 1023
576 Ga0495659_0003417 3300046664 Bacteria 5074
577 Ga0495661_0125130 3300046665 Bacteria 1415
578 Ga0495588_0007286 3300046674 Bacteria 5027
579 Ga0495657_0066730 3300046675 Bacteria 2363
580 Ga0495599_0072044 3300046678 Bacteria 2156
581 Ga0495623_0178224 3300046679 Bacteria 1236
582 Ga0495623_0292010 3300046679 Bacteria 903
583 Ga0495669_0015203 3300046684 Bacteria 3294
584 Ga0495669_0409723 3300046684 Bacteria 657
585 Ga0495613_0170777 3300046689 Bacteria 1543
586 Ga0495613_0558392 3300046689 Bacteria 765
587 Ga0495670_0166565 3300046691 Bacteria 1159
588 Ga0495671_0008444 3300046692 Bacteria 5797
589 Ga0495671_0090877 3300046692 Bacteria 1494
590 Ga0495671_0161029 3300046692 Bacteria 1091
591 Ga0495671_0325723 3300046692 Bacteria 737
592 Ga0495589_0000001 3300046794 Bacteria 888100
593 Ga0495589_0017858 3300046794 Bacteria 3639
594 Ga0495581_0061677 3300047315 Bacteria 2167
595 Ga0495604_0034015 3300047317 Bacteria 4033
596 Ga0495636_0010138 3300047318 Bacteria 3716
597 Ga0495636_0054289 3300047318 Bacteria 1683
598 Ga0495636_0096662 3300047318 Bacteria 1288
599 Ga0495674_0216328 3300047319 Bacteria 1585
600 Ga0495672_0011154 3300047320 Bacteria 6355
601 Ga0495672_0012658 3300047320 Bacteria 5871
602 Ga0495680_0445112 3300047322 Bacteria 887
603 Ga0495683_0062744 3300047323 Bacteria 1837
604 Ga0495687_101327 3300047443 Bacteria 1079
605 Ga0495677_0000578 3300047445 Bacteria 15061
606 Ga0495673_0027172 3300047469 Bacteria 2726
607 Ga0495673_0032637 3300047469 Bacteria 2424
608 Ga0495673_0037481 3300047469 Bacteria 2213
609 Ga0495673_0280541 3300047469 Bacteria 601
610 Ga0495681_0066516 3300047470 Bacteria 1644
611 Ga0495684_0090955 3300047471 Bacteria 2311
612 Ga0495686_0006923 3300047472 Bacteria 8576
613 Ga0495686_0246712 3300047472 Bacteria 1005
614 Ga0495686_0338481 3300047472 Bacteria 821
615 Ga0495593_0181901 3300047673 Bacteria 1059
616 Ga0495602_0231828 3300048088 Bacteria 1386
617 Ga0495602_0394128 3300048088 Bacteria 989
618 Ga0495614_0093311 3300048089 Bacteria 1311
619 Ga0495626_0022514 3300048091 Bacteria 3109
620 Ga0496101_0336013 3300048904 Bacteria 1186
621 Ga0496102_0142139 3300048905 Bacteria 2251
622 Ga0496104_0229148 3300048907 Bacteria 1770
623 Ga0496104_0364953 3300048907 Bacteria 1356
624 Ga0496106_0296209 3300048909 Bacteria 1297
625 Ga0496107_0309573 3300048910 Bacteria 1176
626 Ga0496108_0288365 3300048911 Bacteria 1429
627 Ga0496108_0817456 3300048911 Bacteria 803
628 Ga0496109_0082524 3300048912 Bacteria 2962
629 Ga0496111_0515464 3300048914 Bacteria 879
630 Ga0496112_0146529 3300048915 Bacteria 2329
631 Ga0496112_1484541 3300048915 Bacteria 592
632 Ga0496113_0425297 3300048916 Bacteria 1067
633 Ga0496117_0099368 3300048920 Bacteria 1846
634 Ga0496118_0288749 3300048921 Bacteria 908
635 Ga0496119_0000909 3300048922 Bacteria 38357
636 Ga0496119_0258852 3300048922 Bacteria 874
637 Ga0496120_0000159 3300048923 Bacteria 112577
638 Ga0496121_0103376 3300048924 Bacteria 2192
639 Ga0496121_0474364 3300048924 Bacteria 800
640 Ga0496124_0000008 3300048927 Bacteria 864372
641 Ga0496125_0026112 3300048928 Bacteria 5333
642 Ga0496125_0097725 3300048928 Bacteria 2175
643 Ga0496126_0009184 3300048929 Bacteria 10547
644 Ga0496126_0037704 3300048929 Bacteria 4507
645 Ga0496126_0060967 3300048929 Bacteria 3390
646 Ga0496126_0508934 3300048929 Bacteria 961
647 Ga0495678_000944 3300049459 Bacteria 25200
648 Ga0495678_151121 3300049459 Bacteria 750
649 Ga0495682_0021575 3300049460 Bacteria 2412
650 Ga0501291_069496 3300049514 Bacteria 679
651 Ga0501298_019514 3300049521 Bacteria 1256
652 Ga0501298_113475 3300049521 Bacteria 631
653 Ga0501034_0000969 3300049571 Bacteria 41330
654 Ga0501034_0667225 3300049571 Bacteria 940
655 Ga0501036_0616520 3300049572 Bacteria 899
656 Ga0501037_0143926 3300049573 Bacteria 1705
657 Ga0501043_0093533 3300049579 Bacteria 2363
658 Ga0501046_0094978 3300049580 Bacteria 2291
659 Ga0501046_0678291 3300049580 Bacteria 727
660 Ga0501067_0337538 3300049583 Bacteria 840
661 Ga0501068_0468687 3300049584 Bacteria 816
662 Ga0501070_0046019 3300049586 Bacteria 3628
663 Ga0501073_0117847 3300049589 Bacteria 1840
664 Ga0501074_0164633 3300049590 Bacteria 1583
665 Ga0501076_0657033 3300049592 Bacteria 865
666 Ga0501077_0932264 3300049593 Bacteria 559
667 Ga0501207_060029 3300049654 Bacteria 695
668 Ga0501217_028268 3300049661 Bacteria 1365
669 Ga0501233_065100 3300049668 Bacteria 913
670 Ga0501235_024826 3300049669 Bacteria 1340
671 Ga0501246_042093 3300049676 Bacteria 549
672 Ga0501257_178896 3300049686 Bacteria 599
673 Ga0501261_081421 3300049690 Bacteria 586
674 Ga0501225_0017249 3300049705 Bacteria 2004
675 Ga0501229_054517 3300049706 Bacteria 597
676 Ga0501080_0074660 3300049742 Bacteria 3154
677 Ga0501080_0264742 3300049742 Bacteria 1565
678 Ga0501279_048842 3300049775 Bacteria 667
679 Ga0501283_032227 3300049779 Bacteria 883
680 Ga0501035_0071669 3300049822 Bacteria 3067
681 Ga0501035_0308717 3300049822 Bacteria 1331
682 Ga0501044_0052312 3300049823 Bacteria 4209
683 Ga0501044_0145576 3300049823 Bacteria 2355
684 nmdc:mga0yw44_125034_c1 3300050492 Bacteria 1660
685 nmdc:mga05p37_117954_c1 3300050507 Bacteria 3261
686 nmdc:mga05p37_174501_c1 3300050507 Bacteria 2173
687 nmdc:mga05p37_228183_c1 3300050507 Bacteria 2245
688 nmdc:mga05p37_272961_c1 3300050507 Bacteria 2020
689 nmdc:mga05p37_292968_c1 3300050507 Bacteria 1937
690 nmdc:mga05p37_487742_c1 3300050507 Bacteria 1418
691 nmdc:mga05p37_640828_c1 3300050507 Bacteria 1192
692 nmdc:mga05p37_652398_c1 3300050507 Bacteria 1178
693 nmdc:mga05p37_9465_c1 3300050507 Bacteria 11534
694 nmdc:mga05p37_959732_c1 3300050507 Bacteria 914
695 nmdc:mga09592_21472_c1 3300050508 Bacteria 5319
696 nmdc:mga09592_240528_c1 3300050508 Bacteria 1568
697 nmdc:mga09592_260609_c1 3300050508 Bacteria 1503
698 nmdc:mga09592_582564_c1 3300050508 Bacteria 960
699 nmdc:mga0qj67_207064_c1 3300050509 Bacteria 1593
700 nmdc:mga0qj67_859410_c1 3300050509 Bacteria 716
701 nmdc:mga06r32_111829_c1 3300050510 Bacteria 2688
702 nmdc:mga06r32_1166057_c1 3300050510 Bacteria 718
703 nmdc:mga06r32_125174_c1 3300050510 Unclassified 2538
704 nmdc:mga06r32_1283615_c1 3300050510 Bacteria 676
705 nmdc:mga06r32_24540_c1 3300050510 Bacteria 5599
706 nmdc:mga08y16_347669_c1 3300050511 Bacteria 1524
707 nmdc:mga08y16_530729_c1 3300050511 Bacteria 1193
708 nmdc:mga08y16_709824_c1 3300050511 Bacteria 1005
709 nmdc:mga0n895_1044676_c1 3300050512 Bacteria 796
710 nmdc:mga0n895_128795_c1 3300050512 Bacteria 2555
711 nmdc:mga0n895_144054_c1 3300050512 Bacteria 2412
712 nmdc:mga0n895_183376_c1 3300050512 Bacteria 2125
713 nmdc:mga0n895_330853_c1 3300050512 Bacteria 1544
714 nmdc:mga0n895_473759_c1 3300050512 Bacteria 1263
715 nmdc:mga0n895_9753_c1 3300050512 Bacteria 8425
716 nmdc:mga0rr50_133228_c1 3300050513 Bacteria 1992
717 nmdc:mga0rr50_17170_c1 3300050513 Bacteria 4825
718 nmdc:mga0rr50_233282_c1 3300050513 Bacteria 1523
719 nmdc:mga0rr50_72840_c1 3300050513 Bacteria 2625
720 nmdc:mga0a205_127390_c1 3300050515 Bacteria 2446
721 nmdc:mga0a205_138220_c1 3300050515 Bacteria 2336
722 nmdc:mga0a205_168082_c1 3300050515 Bacteria 2089
723 nmdc:mga0a205_175432_c1 3300050515 Bacteria 2039
724 nmdc:mga0a205_181822_c1 3300050515 Bacteria 1997
725 nmdc:mga0a205_411166_c1 3300050515 Bacteria 1216
726 nmdc:mga0a205_55699_c1 3300050515 Unclassified 3819
727 nmdc:mga0sz30_238167_c1 3300050516 Bacteria 810
728 Ga0495601_0184484 3300053077 Bacteria 1364
729 Ga0495612_0019908 3300053078 Bacteria 2689
730 Ga0495612_0077954 3300053078 Bacteria 1389
731 Ga0500635_0001194 3300053080 Bacteria 6219
732 Ga0500635_0114002 3300053080 Bacteria 1006
733 Ga0495595_0229364 3300053084 Bacteria 927
734 Ga0500643_000007 3300053087 Bacteria 462836
735 Ga0500646_0006139 3300053090 Bacteria 3053
736 Ga0500647_0006809 3300053091 Bacteria 4865
737 Ga0500647_0274777 3300053091 Bacteria 730
738 Ga0500583_0237606 3300053092 Bacteria 901
739 Ga0500566_0000003 3300053094 Bacteria 166820
740 Ga0500566_0034843 3300053094 Bacteria 2927
741 Ga0500566_0043006 3300053094 Bacteria 2604
742 Ga0500640_000579 3300053095 Bacteria 9420
743 Ga0500648_204553 3300053097 Bacteria 987
744 Ga0500650_0125875 3300053098 Bacteria 1193
745 Ga0500554_004996 3300053102 Bacteria 2858
746 Ga0500555_001725 3300053103 Bacteria 6562
747 Ga0500556_0066417 3300053104 Bacteria 1339
748 Ga0500557_000052 3300053105 Bacteria 50636
749 Ga0500569_094412 3300053109 Bacteria 973
750 Ga0500572_000215 3300053111 Bacteria 20456
751 Ga0500591_037062 3300053115 Bacteria 2337
752 Ga0500595_022872 3300053119 Bacteria 2203
753 Ga0500607_012093 3300053121 Bacteria 5081
754 Ga0500608_236962 3300053122 Bacteria 723
755 Ga0500614_016295 3300053123 Bacteria 1666
756 Ga0500642_0000306 3300053130 Bacteria 17531
757 Ga0500642_0022000 3300053130 Bacteria 2535
758 Ga0500655_001084 3300053133 Bacteria 5215
759 Ga0500559_0002862 3300053136 Bacteria 8721
760 Ga0500568_0036717 3300053139 Bacteria 1992
761 Ga0500573_0008281 3300053140 Bacteria 5722
762 Ga0500577_0237576 3300053142 Bacteria 790
763 Ga0500586_044375 3300053145 Bacteria 1518
764 Ga0500590_100392 3300053148 Bacteria 1390
765 Ga0500590_134119 3300053148 Bacteria 1141
766 Ga0500603_000184 3300053150 Bacteria 16166
767 Ga0500603_002547 3300053150 Bacteria 3986
768 Ga0500604_0003204 3300053151 Bacteria 4398
769 Ga0500616_0080109 3300053153 Bacteria 1643
770 Ga0500620_097226 3300053155 Bacteria 1029
771 Ga0500622_0237636 3300053156 Bacteria 807
772 Ga0500630_001089 3300053159 Bacteria 12674
773 Ga0500638_047699 3300053162 Bacteria 2073
774 Ga0500638_166551 3300053162 Bacteria 964
775 Ga0500639_000033 3300053163 Bacteria 68969
776 Ga0500639_045546 3300053163 Bacteria 2295
777 Ga0500636_0059198 3300053177 Bacteria 2238
778 Ga0500637_0041913 3300053178 Bacteria 2586
779 Ga0500637_0119103 3300053178 Bacteria 1531
780 Ga0500637_0356937 3300053178 Bacteria 775
781 Ga0500625_000139 3300053729 Bacteria 14808
782 Ga0500552_007174 3300053733 Bacteria 1277
783 Ga0500596_001166 3300053735 Bacteria 5292
784 Ga0500596_016028 3300053735 Bacteria 1126
785 Ga0501084_0574098 3300054114 Bacteria 953
786 Ga0500661_033874 3300055283 Bacteria 902
787 Ga0466962_0136991 3300061719 Bacteria 1185

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049580 Ga0501046_0678291 Ga0501046_0678291_128_631 145
2 3300049586 Ga0501070_0046019 Ga0501070_0046019_947_1450 145
3 3300049589 Ga0501073_0117847 Ga0501073_0117847_1188_1691 145
4 3300049590 Ga0501074_0164633 Ga0501074_0164633_1035_1538 145
5 3300049742 Ga0501080_0264742 Ga0501080_0264742_345_848 145
6 3300049823 Ga0501044_0052312 Ga0501044_0052312_3038_3541 145
7 3300005719 Ga0068861_101160840 Ga0068861_1011608401 146
8 3300025901 Ga0207688_10438048 Ga0207688_104380482 147
9 3300005844 Ga0068862_100761542 Ga0068862_1007615422 150
10 3300009147 Ga0114129_10257433 Ga0114129_102574332 150
11 3300049571 Ga0501034_0667225 Ga0501034_0667225_171_686 150
12 iso_pu_bacteria 2508501071 2508852514 150
13 iso_pu_bacteria 2888366609 2888369126 150
14 iso_pu_bacteria 2888373701 2888374040 150
15 iso_pu_bacteria 3007395558 3007396963 150
16 iso_pu_bacteria 640753048 640938031 150
17 iso_pu_bacteria 8004592986 8004597290 150
18 3300005339 Ga0070660_100215308 Ga0070660_1002153082 151
19 3300005353 Ga0070669_101289508 Ga0070669_1012895081 151
20 3300005438 Ga0070701_10196734 Ga0070701_101967341 151
21 3300005466 Ga0070685_10699082 Ga0070685_106990822 151
22 3300005535 Ga0070684_100441545 Ga0070684_1004415452 151
23 3300005564 Ga0070664_100662985 Ga0070664_1006629852 151
24 3300005618 Ga0068864_100158941 Ga0068864_1001589412 151
25 3300005840 Ga0068870_10881406 Ga0068870_108814062 151
26 3300009094 Ga0111539_10120950 Ga0111539_101209502 151
27 3300009174 Ga0105241_10159581 Ga0105241_101595812 151
28 3300011119 Ga0105246_10180317 Ga0105246_101803172 151
29 3300014325 Ga0163163_10283150 Ga0163163_102831501 151
30 3300025972 Ga0207668_10975298 Ga0207668_109752982 151
31 3300031548 Ga0307408_100020366 Ga0307408_1000203662 151
32 3300031730 Ga0307516_10654132 Ga0307516_106541322 151
33 3300031731 Ga0307405_10562709 Ga0307405_105627092 151
34 3300031824 Ga0307413_10166997 Ga0307413_101669972 151
35 3300031901 Ga0307406_10024062 Ga0307406_100240622 151
36 3300031903 Ga0307407_10662964 Ga0307407_106629641 151
37 3300032002 Ga0307416_100255597 Ga0307416_1002555972 151
38 3300032005 Ga0307411_10070290 Ga0307411_100702901 151
39 3300032126 Ga0307415_100498191 Ga0307415_1004981912 151
40 3300042436 Ga0439435_0056989 Ga0439435_0056989_219_680 151
41 3300048915 Ga0496112_1484541 Ga0496112_1484541_64_531 151
42 3300049514 Ga0501291_069496 Ga0501291_069496_25_486 151
43 3300049661 Ga0501217_028268 Ga0501217_028268_812_1273 151
44 3300049686 Ga0501257_178896 Ga0501257_178896_70_531 151
45 3300049690 Ga0501261_081421 Ga0501261_081421_51_509 151
46 3300049775 Ga0501279_048842 Ga0501279_048842_44_505 151
47 3300049779 Ga0501283_032227 Ga0501283_032227_186_647 151
48 3300050511 nmdc:mga08y16_347669_c1 nmdc:mga08y16_347669_c1_861_1319 151
49 3300014325 Ga0163163_10258351 Ga0163163_102583512 152
50 3300025932 Ga0207690_10062647 Ga0207690_100626472 152
51 3300025981 Ga0207640_10634409 Ga0207640_106344092 152
52 3300028794 Ga0307515_10000043 Ga0307515_100000435 152
53 3300028800 Ga0265338_10262165 Ga0265338_102621652 152
54 3300046616 Ga0495668_0005919 Ga0495668_0005919_6368_6832 152
55 3300048905 Ga0496102_0142139 Ga0496102_0142139_1048_1512 152
56 3300048907 Ga0496104_0364953 Ga0496104_0364953_169_633 152
57 3300050509 nmdc:mga0qj67_207064_c1 nmdc:mga0qj67_207064_c1_856_1317 152
58 3300003911 JGI25405J52794_10009591 JGI25405J52794_100095912 153
59 3300005293 Ga0065715_10417651 Ga0065715_104176512 153
60 3300005295 Ga0065707_10204026 Ga0065707_102040262 153
61 3300005445 Ga0070708_100198840 Ga0070708_1001988402 153
62 3300005445 Ga0070708_100886245 Ga0070708_1008862452 153
63 3300005467 Ga0070706_100275742 Ga0070706_1002757422 153
64 3300005467 Ga0070706_100317743 Ga0070706_1003177432 153
65 3300005467 Ga0070706_100539350 Ga0070706_1005393502 153
66 3300005468 Ga0070707_100087209 Ga0070707_1000872093 153
67 3300005468 Ga0070707_100125773 Ga0070707_1001257733 153
68 3300005468 Ga0070707_100462391 Ga0070707_1004623912 153
69 3300005471 Ga0070698_100459540 Ga0070698_1004595402 153
70 3300005471 Ga0070698_100999025 Ga0070698_1009990251 153
71 3300005518 Ga0070699_100531427 Ga0070699_1005314272 153
72 3300005536 Ga0070697_100010932 Ga0070697_1000109324 153
73 3300005536 Ga0070697_100128756 Ga0070697_1001287562 153
74 3300005536 Ga0070697_100291053 Ga0070697_1002910532 153
75 3300005536 Ga0070697_101557026 Ga0070697_1015570261 153
76 3300005841 Ga0068863_100779003 Ga0068863_1007790032 153
77 3300005937 Ga0081455_10000152 Ga0081455_1000015218 153
78 3300005937 Ga0081455_10212798 Ga0081455_102127982 153
79 3300005983 Ga0081540_1229679 Ga0081540_12296791 153
80 3300006058 Ga0075432_10046546 Ga0075432_100465462 153
81 3300006173 Ga0070716_100126237 Ga0070716_1001262372 153
82 3300006173 Ga0070716_100181147 Ga0070716_1001811472 153
83 3300006173 Ga0070716_100279036 Ga0070716_1002790362 153
84 3300006175 Ga0070712_100518369 Ga0070712_1005183692 153
85 3300006844 Ga0075428_100058444 Ga0075428_1000584443 153
86 3300006844 Ga0075428_100089310 Ga0075428_1000893103 153
87 3300006844 Ga0075428_101118892 Ga0075428_1011188921 153
88 3300006844 Ga0075428_101657837 Ga0075428_1016578371 153
89 3300006846 Ga0075430_100060688 Ga0075430_1000606882 153
90 3300006846 Ga0075430_100927030 Ga0075430_1009270302 153
91 3300006847 Ga0075431_100033812 Ga0075431_1000338123 153
92 3300006847 Ga0075431_100085525 Ga0075431_1000855254 153
93 3300006847 Ga0075431_100094645 Ga0075431_1000946452 153
94 3300006847 Ga0075431_100545968 Ga0075431_1005459682 153
95 3300006847 Ga0075431_100588489 Ga0075431_1005884892 153
96 3300006852 Ga0075433_10131502 Ga0075433_101315022 153
97 3300006852 Ga0075433_10185973 Ga0075433_101859732 153
98 3300006852 Ga0075433_10234279 Ga0075433_102342792 153
99 3300006871 Ga0075434_100069272 Ga0075434_1000692721 153
100 3300006871 Ga0075434_100075437 Ga0075434_1000754373 153
101 3300006871 Ga0075434_100108629 Ga0075434_1001086293 153
102 3300006871 Ga0075434_100150545 Ga0075434_1001505452 153
103 3300006871 Ga0075434_100187341 Ga0075434_1001873413 153
104 3300006871 Ga0075434_100488732 Ga0075434_1004887322 153
105 3300006880 Ga0075429_100057259 Ga0075429_1000572593 153
106 3300006880 Ga0075429_100076099 Ga0075429_1000760992 153
107 3300006880 Ga0075429_100230909 Ga0075429_1002309092 153
108 3300006880 Ga0075429_100356555 Ga0075429_1003565552 153
109 3300006914 Ga0075436_100421161 Ga0075436_1004211612 153
110 3300007076 Ga0075435_100048354 Ga0075435_1000483542 153
111 3300007076 Ga0075435_100097876 Ga0075435_1000978763 153
112 3300009094 Ga0111539_11170488 Ga0111539_111704882 153
113 3300009147 Ga0114129_10054350 Ga0114129_100543505 153
114 3300009147 Ga0114129_10112170 Ga0114129_101121704 153
115 3300009147 Ga0114129_10146894 Ga0114129_101468941 153
116 3300009147 Ga0114129_10181073 Ga0114129_101810732 153
117 3300009147 Ga0114129_10302298 Ga0114129_103022983 153
118 3300009147 Ga0114129_10336723 Ga0114129_103367233 153
119 3300009147 Ga0114129_12205911 Ga0114129_122059112 153
120 3300009176 Ga0105242_10437207 Ga0105242_104372072 153
121 3300010159 Ga0099796_10120550 Ga0099796_101205502 153
122 3300010159 Ga0099796_10139070 Ga0099796_101390702 153
123 3300012510 Ga0157316_1012136 Ga0157316_10121362 153
124 3300013297 Ga0157378_10049726 Ga0157378_100497262 153
125 3300013306 Ga0163162_10717558 Ga0163162_107175582 153
126 3300014326 Ga0157380_10201592 Ga0157380_102015921 153
127 3300025910 Ga0207684_10541026 Ga0207684_105410262 153
128 3300025922 Ga0207646_10306064 Ga0207646_103060642 153
129 3300025922 Ga0207646_10316555 Ga0207646_103165552 153
130 3300025934 Ga0207686_10071666 Ga0207686_100716662 153
131 3300025935 Ga0207709_10087998 Ga0207709_100879982 153
132 3300025939 Ga0207665_10055254 Ga0207665_100552542 153
133 3300028786 Ga0307517_10078415 Ga0307517_100784152 153
134 3300028794 Ga0307515_10130022 Ga0307515_101300222 153
135 3300031548 Ga0307408_100672331 Ga0307408_1006723312 153
136 3300031730 Ga0307516_10028044 Ga0307516_100280442 153
137 3300031731 Ga0307405_10004594 Ga0307405_100045942 153
138 3300031824 Ga0307413_10016347 Ga0307413_100163473 153
139 3300031824 Ga0307413_10091174 Ga0307413_100911742 153
140 3300031852 Ga0307410_10008878 Ga0307410_100088783 153
141 3300031901 Ga0307406_10796293 Ga0307406_107962932 153
142 3300031903 Ga0307407_10354477 Ga0307407_103544772 153
143 3300032002 Ga0307416_100019872 Ga0307416_1000198722 153
144 3300032002 Ga0307416_100062039 Ga0307416_1000620392 153
145 3300032004 Ga0307414_10008571 Ga0307414_100085712 153
146 3300035120 Ga0373957_0220578 Ga0373957_0220578_21_485 153
147 3300035207 Ga0373942_0255186 Ga0373942_0255186_121_585 153
148 3300035691 Ga0373931_1177757 Ga0373931_1177757_20_484 153
149 3300041408 Ga0439453_0095510 Ga0439453_0095510_138_605 153
150 3300041460 Ga0451802_1972998 Ga0451802_1972998_17_481 153
151 3300042436 Ga0439435_0039578 Ga0439435_0039578_585_1052 153
152 3300042876 Ga0451577_0643199 Ga0451577_0643199_247_711 153
153 3300045051 Ga0451576_1220302 Ga0451576_1220302_103_567 153
154 3300046472 Ga0495580_0018170 Ga0495580_0018170_3787_4251 153
155 3300046615 Ga0495656_0128268 Ga0495656_0128268_547_1014 153
156 3300046684 Ga0495669_0409723 Ga0495669_0409723_156_620 153
157 3300046689 Ga0495613_0170777 Ga0495613_0170777_157_621 153
158 3300047318 Ga0495636_0010138 Ga0495636_0010138_2248_2715 153
159 3300047318 Ga0495636_0096662 Ga0495636_0096662_556_1020 153
160 3300048089 Ga0495614_0093311 Ga0495614_0093311_63_527 153
161 3300049521 Ga0501298_019514 Ga0501298_019514_726_1190 153
162 3300049593 Ga0501077_0932264 Ga0501077_0932264_82_546 153
163 3300049668 Ga0501233_065100 Ga0501233_065100_330_794 153
164 3300049669 Ga0501235_024826 Ga0501235_024826_294_758 153
165 3300049676 Ga0501246_042093 Ga0501246_042093_68_532 153
166 3300049705 Ga0501225_0017249 Ga0501225_0017249_82_546 153
167 3300049706 Ga0501229_054517 Ga0501229_054517_64_528 153
168 3300050507 nmdc:mga05p37_117954_c1 nmdc:mga05p37_117954_c1_1785_2249 153
169 3300050507 nmdc:mga05p37_174501_c1 nmdc:mga05p37_174501_c1_946_1410 153
170 3300050507 nmdc:mga05p37_228183_c1 nmdc:mga05p37_228183_c1_1084_1548 153
171 3300050507 nmdc:mga05p37_272961_c1 nmdc:mga05p37_272961_c1_250_714 153
172 3300050507 nmdc:mga05p37_292968_c1 nmdc:mga05p37_292968_c1_734_1198 153
173 3300050507 nmdc:mga05p37_487742_c1 nmdc:mga05p37_487742_c1_435_899 153
174 3300050507 nmdc:mga05p37_640828_c1 nmdc:mga05p37_640828_c1_438_902 153
175 3300050507 nmdc:mga05p37_652398_c1 nmdc:mga05p37_652398_c1_195_659 153
176 3300050507 nmdc:mga05p37_9465_c1 nmdc:mga05p37_9465_c1_5668_6132 153
177 3300050507 nmdc:mga05p37_959732_c1 nmdc:mga05p37_959732_c1_349_813 153
178 3300050508 nmdc:mga09592_21472_c1 nmdc:mga09592_21472_c1_2058_2522 153
179 3300050508 nmdc:mga09592_240528_c1 nmdc:mga09592_240528_c1_827_1291 153
180 3300050508 nmdc:mga09592_260609_c1 nmdc:mga09592_260609_c1_862_1326 153
181 3300050508 nmdc:mga09592_582564_c1 nmdc:mga09592_582564_c1_82_546 153
182 3300050509 nmdc:mga0qj67_859410_c1 nmdc:mga0qj67_859410_c1_141_605 153
183 3300050510 nmdc:mga06r32_111829_c1 nmdc:mga06r32_111829_c1_1285_1749 153
184 3300050510 nmdc:mga06r32_1166057_c1 nmdc:mga06r32_1166057_c1_223_687 153
185 3300050510 nmdc:mga06r32_125174_c1 nmdc:mga06r32_125174_c1_437_901 153
186 3300050510 nmdc:mga06r32_24540_c1 nmdc:mga06r32_24540_c1_4037_4501 153
187 3300050511 nmdc:mga08y16_709824_c1 nmdc:mga08y16_709824_c1_212_676 153
188 3300050512 nmdc:mga0n895_1044676_c1 nmdc:mga0n895_1044676_c1_58_522 153
189 3300050512 nmdc:mga0n895_128795_c1 nmdc:mga0n895_128795_c1_245_709 153
190 3300050512 nmdc:mga0n895_144054_c1 nmdc:mga0n895_144054_c1_1116_1580 153
191 3300050512 nmdc:mga0n895_183376_c1 nmdc:mga0n895_183376_c1_887_1351 153
192 3300050512 nmdc:mga0n895_330853_c1 nmdc:mga0n895_330853_c1_115_579 153
193 3300050513 nmdc:mga0rr50_133228_c1 nmdc:mga0rr50_133228_c1_227_691 153
194 3300050513 nmdc:mga0rr50_233282_c1 nmdc:mga0rr50_233282_c1_808_1272 153
195 3300050513 nmdc:mga0rr50_72840_c1 nmdc:mga0rr50_72840_c1_1220_1684 153
196 3300050515 nmdc:mga0a205_127390_c1 nmdc:mga0a205_127390_c1_615_1079 153
197 3300050515 nmdc:mga0a205_138220_c1 nmdc:mga0a205_138220_c1_47_511 153
198 3300050515 nmdc:mga0a205_168082_c1 nmdc:mga0a205_168082_c1_758_1222 153
199 3300050515 nmdc:mga0a205_175432_c1 nmdc:mga0a205_175432_c1_739_1203 153
200 3300050515 nmdc:mga0a205_181822_c1 nmdc:mga0a205_181822_c1_29_493 153
201 3300050515 nmdc:mga0a205_411166_c1 nmdc:mga0a205_411166_c1_250_714 153
202 3300050515 nmdc:mga0a205_55699_c1 nmdc:mga0a205_55699_c1_930_1394 153
203 3300053145 Ga0500586_044375 Ga0500586_044375_429_893 153
204 3300053148 Ga0500590_134119 Ga0500590_134119_17_481 153
205 iso_pu_bacteria 2643221633 2644185257 153
206 iso_pu_bacteria 8056177738 8056178369 153
207 3300003578 Ga0006562J51391_1184272 Ga0006562J51391_11842722 154
208 3300005290 Ga0065712_10167116 Ga0065712_101671162 154
209 3300005329 Ga0070683_100376225 Ga0070683_1003762252 154
210 3300005330 Ga0070690_100284386 Ga0070690_1002843862 154
211 3300005334 Ga0068869_100168853 Ga0068869_1001688532 154
212 3300005535 Ga0070684_100067578 Ga0070684_1000675781 154
213 3300006871 Ga0075434_100066668 Ga0075434_1000666685 154
214 3300009011 Ga0105251_10000002 Ga0105251_1000000242 154
215 3300009174 Ga0105241_10000002 Ga0105241_10000002228 154
216 3300009545 Ga0105237_10110204 Ga0105237_101102042 154
217 3300009551 Ga0105238_10044446 Ga0105238_100444462 154
218 3300013100 Ga0157373_10004988 Ga0157373_100049884 154
219 3300025735 Ga0207713_1000008 Ga0207713_1000008303 154
220 3300025911 Ga0207654_10000005 Ga0207654_10000005228 154
221 3300025918 Ga0207662_10054305 Ga0207662_100543052 154
222 3300025926 Ga0207659_10382781 Ga0207659_103827811 154
223 3300025935 Ga0207709_10384580 Ga0207709_103845802 154
224 3300025939 Ga0207665_10292349 Ga0207665_102923492 154
225 3300025942 Ga0207689_10021149 Ga0207689_100211494 154
226 3300025944 Ga0207661_10353394 Ga0207661_103533942 154
227 3300027111 Ga0209281_1000003 Ga0209281_1000003482 154
228 3300028380 Ga0268265_10589955 Ga0268265_105899552 154
229 3300031456 Ga0307513_10009006 Ga0307513_1000900610 154
230 3300031616 Ga0307508_10064350 Ga0307508_100643502 154
231 3300035207 Ga0373942_0070485 Ga0373942_0070485_543_1010 154
232 3300037471 Ga0395905_1415850 Ga0395905_1415850_75_545 154
233 3300041411 Ga0439466_0026090 Ga0439466_0026090_641_1114 154
234 3300042006 Ga0439432_018209 Ga0439432_018209_1062_1535 154
235 3300046524 Ga0495648_0000010 Ga0495648_0000010_134587_135057 154
236 3300046530 Ga0495654_0005466 Ga0495654_0005466_1449_1922 154
237 3300046794 Ga0495589_0000001 Ga0495589_0000001_594570_595043 154
238 3300048916 Ga0496113_0425297 Ga0496113_0425297_468_965 154
239 3300048922 Ga0496119_0000909 Ga0496119_0000909_11846_12319 154
240 3300048923 Ga0496120_0000159 Ga0496120_0000159_93686_94159 154
241 3300048927 Ga0496124_0000008 Ga0496124_0000008_161298_161771 154
242 3300049459 Ga0495678_000944 Ga0495678_000944_6813_7283 154
243 iso_pu_bacteria 2818991467 2819718476 154
244 3300005435 Ga0070714_100389508 Ga0070714_1003895082 155
245 3300009094 Ga0111539_11866261 Ga0111539_118662611 155
246 3300011119 Ga0105246_10631435 Ga0105246_106314351 155
247 3300028786 Ga0307517_10044761 Ga0307517_100447614 155
248 3300031239 Ga0265328_10015383 Ga0265328_100153832 155
249 3300049571 Ga0501034_0000969 Ga0501034_0000969_25591_26064 155
250 3300049592 Ga0501076_0657033 Ga0501076_0657033_78_554 155
251 3300054114 Ga0501084_0574098 Ga0501084_0574098_144_620 155
252 iso_pu_bacteria 2513237092 2513622349 155
253 iso_pu_bacteria 2513237094 2513640526 155
254 iso_pu_bacteria 2513237095 2513645444 155
255 iso_pu_bacteria 2513237102 2513701720 155
256 iso_pu_bacteria 2513237104 2513718392 155
257 iso_pu_bacteria 2517093001 2517102623 155
258 iso_pu_bacteria 2524023205 2524437737 155
259 iso_pu_bacteria 2528768022 2528848706 155
260 iso_pu_bacteria 2617270735 2617346993 155
261 iso_pu_bacteria 2744054633 2745081204 155
262 iso_pu_bacteria 2791355196 2793062595 155
263 iso_pu_bacteria 2816332527 2818239671 155
264 iso_pu_bacteria 2824600985 2824602353 155
265 iso_pu_bacteria 2824609381 2824610553 155
266 iso_pu_bacteria 2824617872 2824618113 155
267 iso_pu_bacteria 2824626560 2824626781 155
268 iso_pu_bacteria 2824635225 2824636584 155
269 iso_pu_bacteria 2824644064 2824645118 155
270 iso_pu_bacteria 2824653114 2824654322 155
271 iso_pu_bacteria 2824661429 2824661593 155
272 iso_pu_bacteria 2824714736 2824715721 155
273 iso_pu_bacteria 2824723954 2824725204 155
274 iso_pu_bacteria 2824773399 2824775249 155
275 iso_pu_bacteria 2841974524 2841974612 155
276 iso_pu_bacteria 2842038055 2842040185 155
277 iso_pu_bacteria 2842045827 2842046870 155
278 iso_pu_bacteria 2847930680 2847936585 155
279 iso_pu_bacteria 2849076700 2849078960 155
280 iso_pu_bacteria 2857509624 2857515915 155
281 iso_pu_bacteria 2874612657 2874619375 155
282 iso_pu_bacteria 2874620515 2874626410 155
283 iso_pu_bacteria 2876761206 2876764959 155
284 iso_pu_bacteria 2879099564 2879108346 155
285 iso_pu_bacteria 2881665667 2881672529 155
286 iso_pu_bacteria 2885409591 2885413313 155
287 iso_pu_bacteria 2888378607 2888384478 155
288 iso_pu_bacteria 2888388044 2888393432 155
289 iso_pu_bacteria 2888419890 2888424928 155
290 iso_pu_bacteria 2904666416 2904671749 155
291 iso_pu_bacteria 2906643746 2906646191 155
292 iso_pu_bacteria 2922368715 2922374890 155
293 iso_pu_bacteria 2932784394 2932788801 155
294 iso_pu_bacteria 2932794094 2932797994 155
295 iso_pu_bacteria 2932801729 2932807164 155
296 iso_pu_bacteria 2932809354 2932812775 155
297 iso_pu_bacteria 2932818245 2932819133 155
298 iso_pu_bacteria 2932828146 2932830467 155
299 iso_pu_bacteria 2935616580 2935616761 155
300 iso_pu_bacteria 2935638405 2935641909 155
301 iso_pu_bacteria 2935665750 2935673040 155
302 iso_pu_bacteria 2935675223 2935675845 155
303 iso_pu_bacteria 2935684952 2935685842 155
304 iso_pu_bacteria 2935694250 2935697912 155
305 iso_pu_bacteria 2935703347 2935705682 155
306 iso_pu_bacteria 2935713505 2935714394 155
307 iso_pu_bacteria 2935722832 2935725013 155
308 iso_pu_bacteria 2935732158 2935732628 155
309 iso_pu_bacteria 2935741537 2935742007 155
310 iso_pu_bacteria 2935750917 2935751807 155
311 iso_pu_bacteria 2935760218 2935765064 155
312 iso_pu_bacteria 2935769743 2935771679 155
313 iso_pu_bacteria 2935785616 2935791173 155
314 iso_pu_bacteria 2935793552 2935795498 155
315 iso_pu_bacteria 2935801545 2935802660 155
316 iso_pu_bacteria 2935810662 2935813510 155
317 iso_pu_bacteria 2935827899 2935830076 155
318 iso_pu_bacteria 2935837841 2935837994 155
319 iso_pu_bacteria 2935855204 2935855385 155
320 iso_pu_bacteria 2935864058 2935867371 155
321 iso_pu_bacteria 2935873716 2935875810 155
322 iso_pu_bacteria 2935883170 2935886721 155
323 iso_pu_bacteria 2935959822 2935960790 155
324 iso_pu_bacteria 2935992306 2935996474 155
325 iso_pu_bacteria 2936002035 2936003754 155
326 iso_pu_bacteria 2936037263 2936042459 155
327 iso_pu_bacteria 2940556831 2940557390 155
328 iso_pu_bacteria 2941531003 2941533181 155
329 iso_pu_bacteria 2941538514 2941539340 155
330 iso_pu_bacteria 3005506211 3005510673 155
331 iso_pu_bacteria 3005587118 3005587688 155
332 iso_pu_bacteria 3005594810 3005599610 155
333 iso_pu_bacteria 3005710791 3005715267 155
334 iso_pu_bacteria 8006926726 8006933116 155
335 iso_pu_bacteria 8016511872 8016521826 155
336 iso_pu_bacteria 8016522445 8016529234 155
337 iso_pu_bacteria 8016539877 8016547668 155
338 iso_pu_bacteria 8016557553 8016562843 155
339 iso_pu_bacteria 8016566248 8016572787 155
340 iso_pu_bacteria 8016583857 8016593273 155
341 iso_pu_bacteria 8016595262 8016600618 155
342 iso_pu_bacteria 8016622563 8016626162 155
343 iso_pu_bacteria 8017057580 8017063828 155
344 iso_pu_bacteria 8019530166 8019534207 155
345 iso_pu_bacteria 8019547302 8019553258 155
346 iso_pu_bacteria 8019576017 8019583177 155
347 iso_pu_bacteria 8019597564 8019600365 155
348 iso_pu_bacteria 8019608314 8019618179 155
349 iso_pu_bacteria 8019648815 8019658932 155
350 iso_pu_bacteria 8056967851 8056968398 155
351 3300030521 Ga0307511_10000934 Ga0307511_1000093419 156
352 3300031456 Ga0307513_10475523 Ga0307513_104755232 156
353 3300053090 Ga0500646_0006139 Ga0500646_0006139_1827_2303 156
354 3300053091 Ga0500647_0006809 Ga0500647_0006809_534_1007 156
355 3300053092 Ga0500583_0237606 Ga0500583_0237606_225_701 156
356 3300053094 Ga0500566_0000003 Ga0500566_0000003_123291_123764 156
357 3300053095 Ga0500640_000579 Ga0500640_000579_3408_3881 156
358 3300053098 Ga0500650_0125875 Ga0500650_0125875_18_494 156
359 3300053111 Ga0500572_000215 Ga0500572_000215_19749_20222 156
360 3300053115 Ga0500591_037062 Ga0500591_037062_128_601 156
361 3300053123 Ga0500614_016295 Ga0500614_016295_597_1070 156
362 3300053133 Ga0500655_001084 Ga0500655_001084_59_535 156
363 3300053136 Ga0500559_0002862 Ga0500559_0002862_7978_8451 156
364 3300053150 Ga0500603_000184 Ga0500603_000184_2210_2683 156
365 3300053151 Ga0500604_0003204 Ga0500604_0003204_2298_2774 156
366 3300053159 Ga0500630_001089 Ga0500630_001089_4569_5042 156
367 3300053162 Ga0500638_047699 Ga0500638_047699_1351_1824 156
368 3300053163 Ga0500639_000033 Ga0500639_000033_25558_26031 156
369 3300053178 Ga0500637_0356937 Ga0500637_0356937_256_729 156
370 3300053735 Ga0500596_016028 Ga0500596_016028_405_878 156
371 iso_pu_bacteria 2513237087 2513589231 156
372 3300005288 Ga0065714_10075630 Ga0065714_100756302 157
373 3300005459 Ga0068867_101494775 Ga0068867_1014947751 157
374 3300005719 Ga0068861_100246469 Ga0068861_1002464693 157
375 3300006914 Ga0075436_100745994 Ga0075436_1007459941 157
376 3300009011 Ga0105251_10003561 Ga0105251_100035614 157
377 3300009036 Ga0105244_10004680 Ga0105244_100046804 157
378 3300013100 Ga0157373_10006552 Ga0157373_100065524 157
379 3300013102 Ga0157371_10037904 Ga0157371_100379042 157
380 3300013306 Ga0163162_10585177 Ga0163162_105851771 157
381 3300013308 Ga0157375_10504172 Ga0157375_105041722 157
382 3300014497 Ga0182008_10029819 Ga0182008_100298191 157
383 3300015262 Ga0182007_10007254 Ga0182007_100072542 157
384 3300015265 Ga0182005_1000979 Ga0182005_10009794 157
385 3300025728 Ga0207655_1020689 Ga0207655_10206892 157
386 3300025735 Ga0207713_1001897 Ga0207713_100189711 157
387 3300046452 Ga0495617_081815 Ga0495617_081815_58_534 157
388 3300046457 Ga0495590_0017508 Ga0495590_0017508_570_1046 157
389 3300046457 Ga0495590_0055693 Ga0495590_0055693_853_1329 157
390 3300046458 Ga0495591_005495 Ga0495591_005495_4662_5138 157
391 3300046460 Ga0495638_0006936 Ga0495638_0006936_3100_3576 157
392 3300046460 Ga0495638_0188268 Ga0495638_0188268_651_1127 157
393 3300046471 Ga0495650_0005684 Ga0495650_0005684_4725_5201 157
394 3300046474 Ga0495605_0022067 Ga0495605_0022067_718_1194 157
395 3300046491 Ga0495584_0004182 Ga0495584_0004182_2950_3426 157
396 3300046491 Ga0495584_0154576 Ga0495584_0154576_188_664 157
397 3300046492 Ga0495585_0000300 Ga0495585_0000300_14358_14834 157
398 3300046492 Ga0495585_0021453 Ga0495585_0021453_698_1174 157
399 3300046501 Ga0495607_0023970 Ga0495607_0023970_718_1194 157
400 3300046501 Ga0495607_0170972 Ga0495607_0170972_460_936 157
401 3300046506 Ga0495583_0000467 Ga0495583_0000467_40525_41001 157
402 3300046506 Ga0495583_0115306 Ga0495583_0115306_131_607 157
403 3300046512 Ga0495610_0000842 Ga0495610_0000842_25_501 157
404 3300046513 Ga0495616_0016823 Ga0495616_0016823_698_1174 157
405 3300046513 Ga0495616_0238869 Ga0495616_0238869_175_651 157
406 3300046518 Ga0495631_0014826 Ga0495631_0014826_566_1042 157
407 3300046519 Ga0495632_0005512 Ga0495632_0005512_2926_3402 157
408 3300046519 Ga0495632_0033164 Ga0495632_0033164_745_1221 157
409 3300046520 Ga0495637_0004162 Ga0495637_0004162_4821_5297 157
410 3300046520 Ga0495637_0018744 Ga0495637_0018744_1420_1896 157
411 3300046522 Ga0495643_0021610 Ga0495643_0021610_2305_2781 157
412 3300046523 Ga0495644_0028570 Ga0495644_0028570_446_922 157
413 3300046524 Ga0495648_0052470 Ga0495648_0052470_197_673 157
414 3300046528 Ga0495642_0000011 Ga0495642_0000011_87061_87537 157
415 3300046538 Ga0495609_0000212 Ga0495609_0000212_18201_18677 157
416 3300046542 Ga0495597_0007896 Ga0495597_0007896_4140_4616 157
417 3300046542 Ga0495597_0216643 Ga0495597_0216643_141_617 157
418 3300046557 Ga0495622_0003121 Ga0495622_0003121_4597_5073 157
419 3300046615 Ga0495656_0017001 Ga0495656_0017001_566_1042 157
420 3300046616 Ga0495668_0073287 Ga0495668_0073287_637_1113 157
421 3300046660 Ga0495625_0111494 Ga0495625_0111494_437_913 157
422 3300046660 Ga0495625_0302255 Ga0495625_0302255_414_890 157
423 3300046664 Ga0495659_0003417 Ga0495659_0003417_422_898 157
424 3300046665 Ga0495661_0125130 Ga0495661_0125130_207_683 157
425 3300046674 Ga0495588_0007286 Ga0495588_0007286_1911_2387 157
426 3300046684 Ga0495669_0015203 Ga0495669_0015203_1534_2010 157
427 3300046691 Ga0495670_0166565 Ga0495670_0166565_183_659 157
428 3300046692 Ga0495671_0008444 Ga0495671_0008444_2828_3304 157
429 3300046692 Ga0495671_0090877 Ga0495671_0090877_603_1079 157
430 3300046692 Ga0495671_0161029 Ga0495671_0161029_104_580 157
431 3300046692 Ga0495671_0325723 Ga0495671_0325723_197_673 157
432 3300047318 Ga0495636_0054289 Ga0495636_0054289_963_1439 157
433 3300047320 Ga0495672_0011154 Ga0495672_0011154_3429_3917 157
434 3300047320 Ga0495672_0012658 Ga0495672_0012658_4980_5456 157
435 3300047323 Ga0495683_0062744 Ga0495683_0062744_739_1215 157
436 3300047443 Ga0495687_101327 Ga0495687_101327_519_995 157
437 3300047445 Ga0495677_0000578 Ga0495677_0000578_4192_4668 157
438 3300047469 Ga0495673_0027172 Ga0495673_0027172_2142_2618 157
439 3300047469 Ga0495673_0032637 Ga0495673_0032637_1412_1888 157
440 3300047469 Ga0495673_0037481 Ga0495673_0037481_1042_1518 157
441 3300047469 Ga0495673_0280541 Ga0495673_0280541_26_502 157
442 3300047470 Ga0495681_0066516 Ga0495681_0066516_778_1254 157
443 3300047472 Ga0495686_0006923 Ga0495686_0006923_3400_3876 157
444 3300048091 Ga0495626_0022514 Ga0495626_0022514_1031_1507 157
445 3300048928 Ga0496125_0026112 Ga0496125_0026112_2083_2559 157
446 3300049460 Ga0495682_0021575 Ga0495682_0021575_677_1153 157
447 iso_pu_bacteria 2582581866 2585393655 157
448 3300003322 rootL2_10070718 rootL2_100707182 158
449 3300048929 Ga0496126_0508934 Ga0496126_0508934_411_890 158
450 3300049822 Ga0501035_0308717 Ga0501035_0308717_807_1289 158
451 3300003215 JGI25153J46596_10000613 JGI25153J46596_100006135 159
452 3300003354 JGI25160J50197_1008566 JGI25160J50197_10085664 159
453 3300003762 Ga0055542_1004636 Ga0055542_10046362 159
454 3300003794 Ga0055531_10020681 Ga0055531_100206812 159
455 3300004625 Ga0055543_1014268 Ga0055543_10142682 159
456 3300005262 Ga0065165_1002156 Ga0065165_100215612 159
457 3300005262 Ga0065165_1006009 Ga0065165_10060093 159
458 3300005327 Ga0070658_10106333 Ga0070658_101063332 159
459 3300005327 Ga0070658_10493920 Ga0070658_104939201 159
460 3300005329 Ga0070683_100051714 Ga0070683_1000517143 159
461 3300005329 Ga0070683_100874358 Ga0070683_1008743582 159
462 3300005434 Ga0070709_10001083 Ga0070709_1000108311 159
463 3300005434 Ga0070709_10002717 Ga0070709_100027175 159
464 3300005435 Ga0070714_100053651 Ga0070714_1000536511 159
465 3300005435 Ga0070714_100104965 Ga0070714_1001049651 159
466 3300005436 Ga0070713_100016049 Ga0070713_1000160492 159
467 3300005436 Ga0070713_100064023 Ga0070713_1000640232 159
468 3300005436 Ga0070713_100718211 Ga0070713_1007182111 159
469 3300005437 Ga0070710_10000726 Ga0070710_1000072614 159
470 3300005437 Ga0070710_10021146 Ga0070710_100211462 159
471 3300005439 Ga0070711_100003099 Ga0070711_1000030994 159
472 3300005439 Ga0070711_100029718 Ga0070711_1000297182 159
473 3300005455 Ga0070663_100293268 Ga0070663_1002932682 159
474 3300005456 Ga0070678_100171997 Ga0070678_1001719972 159
475 3300005458 Ga0070681_10442025 Ga0070681_104420252 159
476 3300005467 Ga0070706_100234072 Ga0070706_1002340723 159
477 3300005467 Ga0070706_100259970 Ga0070706_1002599702 159
478 3300005471 Ga0070698_100245559 Ga0070698_1002455592 159
479 3300005518 Ga0070699_100970954 Ga0070699_1009709541 159
480 3300005530 Ga0070679_100133390 Ga0070679_1001333902 159
481 3300005530 Ga0070679_100191574 Ga0070679_1001915742 159
482 3300005530 Ga0070679_100490188 Ga0070679_1004901882 159
483 3300005535 Ga0070684_100248225 Ga0070684_1002482252 159
484 3300005577 Ga0068857_100190545 Ga0068857_1001905452 159
485 3300005578 Ga0068854_100906999 Ga0068854_1009069991 159
486 3300005616 Ga0068852_100146939 Ga0068852_1001469392 159
487 3300005834 Ga0068851_10206071 Ga0068851_102060712 159
488 3300005843 Ga0068860_100000213 Ga0068860_10000021349 159
489 3300006051 Ga0075364_10065139 Ga0075364_100651392 159
490 3300006163 Ga0070715_10009691 Ga0070715_100096912 159
491 3300006163 Ga0070715_10015245 Ga0070715_100152452 159
492 3300006173 Ga0070716_100006597 Ga0070716_1000065975 159
493 3300006173 Ga0070716_100124164 Ga0070716_1001241642 159
494 3300006175 Ga0070712_100002958 Ga0070712_1000029589 159
495 3300006175 Ga0070712_100149387 Ga0070712_1001493872 159
496 3300006175 Ga0070712_100313919 Ga0070712_1003139191 159
497 3300006178 Ga0075367_10459810 Ga0075367_104598101 159
498 3300006871 Ga0075434_100008890 Ga0075434_1000088906 159
499 3300006871 Ga0075434_100328397 Ga0075434_1003283972 159
500 3300007076 Ga0075435_100218517 Ga0075435_1002185172 159
501 3300007788 Ga0099795_10016192 Ga0099795_100161922 159
502 3300009093 Ga0105240_10006904 Ga0105240_1000690420 159
503 3300009093 Ga0105240_10105669 Ga0105240_101056692 159
504 3300009094 Ga0111539_11377376 Ga0111539_113773761 159
505 3300009098 Ga0105245_10204091 Ga0105245_102040912 159
506 3300009174 Ga0105241_10406706 Ga0105241_104067061 159
507 3300009545 Ga0105237_10003966 Ga0105237_1000396616 159
508 3300009545 Ga0105237_10021235 Ga0105237_100212354 159
509 3300009545 Ga0105237_10198900 Ga0105237_101989002 159
510 3300009551 Ga0105238_10742246 Ga0105238_107422462 159
511 3300010159 Ga0099796_10082217 Ga0099796_100822171 159
512 3300010159 Ga0099796_10094046 Ga0099796_100940462 159
513 3300010375 Ga0105239_10080432 Ga0105239_100804322 159
514 3300010375 Ga0105239_10130525 Ga0105239_101305252 159
515 3300013100 Ga0157373_11029918 Ga0157373_110299181 159
516 3300013105 Ga0157369_10002009 Ga0157369_1000200914 159
517 3300014497 Ga0182008_10312079 Ga0182008_103120791 159
518 3300020082 Ga0206353_11943815 Ga0206353_119438152 159
519 3300021361 Ga0213872_10010765 Ga0213872_100107652 159
520 3300025245 Ga0207425_1003455 Ga0207425_10034555 159
521 3300025254 Ga0209148_1000500 Ga0209148_100050029 159
522 3300025261 Ga0209233_1013528 Ga0209233_10135282 159
523 3300025272 Ga0209455_1004034 Ga0209455_10040345 159
524 3300025297 Ga0209758_1000024 Ga0209758_100002487 159
525 3300025297 Ga0209758_1011950 Ga0209758_10119502 159
526 3300025299 Ga0209256_1051868 Ga0209256_10518682 159
527 3300025302 Ga0207426_1002351 Ga0207426_10023513 159
528 3300025302 Ga0207426_1006588 Ga0207426_10065883 159
529 3300025304 Ga0209257_1001699 Ga0209257_100169915 159
530 3300025321 Ga0207656_10052124 Ga0207656_100521242 159
531 3300025898 Ga0207692_10000763 Ga0207692_100007637 159
532 3300025898 Ga0207692_10006941 Ga0207692_100069411 159
533 3300025905 Ga0207685_10006305 Ga0207685_100063052 159
534 3300025905 Ga0207685_10007289 Ga0207685_100072892 159
535 3300025905 Ga0207685_10291977 Ga0207685_102919771 159
536 3300025906 Ga0207699_10000406 Ga0207699_1000040611 159
537 3300025906 Ga0207699_10002096 Ga0207699_100020963 159
538 3300025906 Ga0207699_10641957 Ga0207699_106419572 159
539 3300025909 Ga0207705_10275653 Ga0207705_102756531 159
540 3300025909 Ga0207705_10802605 Ga0207705_108026052 159
541 3300025910 Ga0207684_10277914 Ga0207684_102779142 159
542 3300025910 Ga0207684_10341262 Ga0207684_103412621 159
543 3300025911 Ga0207654_10070925 Ga0207654_100709252 159
544 3300025912 Ga0207707_10007856 Ga0207707_100078567 159
545 3300025913 Ga0207695_10000008 Ga0207695_10000008161 159
546 3300025913 Ga0207695_10150817 Ga0207695_101508172 159
547 3300025914 Ga0207671_10011165 Ga0207671_100111652 159
548 3300025914 Ga0207671_10075491 Ga0207671_100754912 159
549 3300025915 Ga0207693_10001388 Ga0207693_1000138814 159
550 3300025915 Ga0207693_10002846 Ga0207693_100028465 159
551 3300025915 Ga0207693_10370147 Ga0207693_103701472 159
552 3300025916 Ga0207663_10016183 Ga0207663_100161832 159
553 3300025916 Ga0207663_10022293 Ga0207663_100222932 159
554 3300025917 Ga0207660_10077967 Ga0207660_100779672 159
555 3300025919 Ga0207657_10000942 Ga0207657_100009424 159
556 3300025921 Ga0207652_10092210 Ga0207652_100922102 159
557 3300025921 Ga0207652_10190699 Ga0207652_101906992 159
558 3300025927 Ga0207687_10113775 Ga0207687_101137752 159
559 3300025928 Ga0207700_10011931 Ga0207700_100119312 159
560 3300025928 Ga0207700_10057293 Ga0207700_100572932 159
561 3300025929 Ga0207664_10044437 Ga0207664_100444372 159
562 3300025929 Ga0207664_10115358 Ga0207664_101153582 159
563 3300025939 Ga0207665_10000874 Ga0207665_1000087413 159
564 3300025939 Ga0207665_10007378 Ga0207665_100073783 159
565 3300025939 Ga0207665_10298552 Ga0207665_102985522 159
566 3300025944 Ga0207661_10000210 Ga0207661_1000021037 159
567 3300025944 Ga0207661_11008913 Ga0207661_110089132 159
568 3300025949 Ga0207667_10126377 Ga0207667_101263772 159
569 3300026088 Ga0207641_10151335 Ga0207641_101513352 159
570 3300026116 Ga0207674_10042222 Ga0207674_100422222 159
571 3300026121 Ga0207683_10176466 Ga0207683_101764662 159
572 3300026142 Ga0207698_10250125 Ga0207698_102501251 159
573 3300027512 Ga0209179_1001115 Ga0209179_10011152 159
574 3300027512 Ga0209179_1008979 Ga0209179_10089792 159
575 3300027671 Ga0209588_1061138 Ga0209588_10611382 159
576 3300028379 Ga0268266_10041524 Ga0268266_100415243 159
577 3300028381 Ga0268264_10000065 Ga0268264_10000065182 159
578 3300028800 Ga0265338_10246572 Ga0265338_102465721 159
579 3300031235 Ga0265330_10008848 Ga0265330_100088482 159
580 3300031235 Ga0265330_10024415 Ga0265330_100244152 159
581 3300031235 Ga0265330_10103312 Ga0265330_101033121 159
582 3300031235 Ga0265330_10160680 Ga0265330_101606802 159
583 3300031241 Ga0265325_10010622 Ga0265325_100106222 159
584 3300031247 Ga0265340_10001234 Ga0265340_100012349 159
585 3300031249 Ga0265339_10010858 Ga0265339_100108584 159
586 3300031250 Ga0265331_10008999 Ga0265331_100089992 159
587 3300031344 Ga0265316_10104493 Ga0265316_101044932 159
588 3300031507 Ga0307509_10291590 Ga0307509_102915902 159
589 3300031507 Ga0307509_10386389 Ga0307509_103863891 159
590 3300031712 Ga0265342_10120660 Ga0265342_101206602 159
591 3300031712 Ga0265342_10328158 Ga0265342_103281581 159
592 3300031730 Ga0307516_10017791 Ga0307516_100177916 159
593 3300033179 Ga0307507_10025563 Ga0307507_100255632 159
594 3300033180 Ga0307510_10150721 Ga0307510_101507212 159
595 3300035111 Ga0373923_0055994 Ga0373923_0055994_700_1188 159
596 3300035117 Ga0373953_0035533 Ga0373953_0035533_1386_1874 159
597 3300035118 Ga0373954_0029385 Ga0373954_0029385_1836_2324 159
598 3300035119 Ga0373956_0065328 Ga0373956_0065328_811_1299 159
599 3300035120 Ga0373957_0207667 Ga0373957_0207667_250_732 159
600 3300035172 Ga0373955_0108242 Ga0373955_0108242_261_749 159
601 3300035691 Ga0373931_0138709 Ga0373931_0138709_778_1332 159
602 3300035692 Ga0373935_0045380 Ga0373935_0045380_1041_1523 159
603 3300035724 Ga0373933_0000751 Ga0373933_0000751_14986_15468 159
604 3300035724 Ga0373933_0228728 Ga0373933_0228728_588_1076 159
605 3300036401 Ga0373937_0757474 Ga0373937_0757474_38_526 159
606 3300037466 Ga0395898_1206376 Ga0395898_1206376_13_495 159
607 3300037471 Ga0395905_0195402 Ga0395905_0195402_699_1181 159
608 3300037471 Ga0395905_0651432 Ga0395905_0651432_210_692 159
609 3300037853 Ga0436364_0733950 Ga0436364_0733950_225_707 159
610 3300039437 Ga0436365_0220668 Ga0436365_0220668_2286_2768 159
611 3300039437 Ga0436365_0425979 Ga0436365_0425979_486_968 159
612 3300039447 Ga0436361_0858840 Ga0436361_0858840_3183_3665 159
613 3300039447 Ga0436361_1186555 Ga0436361_1186555_1297_1803 159
614 3300039450 Ga0436363_0946951 Ga0436363_0946951_134_655 159
615 3300041413 Ga0439465_0091987 Ga0439465_0091987_177_659 159
616 3300041486 Ga0451807_1368907 Ga0451807_1368907_446_928 159
617 3300041512 Ga0451853_2663894 Ga0451853_2663894_54_536 159
618 3300044658 Ga0466972_0059513 Ga0466972_0059513_726_1208 159
619 3300044658 Ga0466972_0166145 Ga0466972_0166145_388_870 159
620 3300044684 Ga0466966_0015338 Ga0466966_0015338_680_1162 159
621 3300044693 Ga0466961_0000038 Ga0466961_0000038_69615_70097 159
622 3300044693 Ga0466961_0510267 Ga0466961_0510267_176_658 159
623 3300044706 Ga0466964_0199735 Ga0466964_0199735_347_829 159
624 3300044842 Ga0466957_0064845 Ga0466957_0064845_994_1476 159
625 3300044901 Ga0466960_0246905 Ga0466960_0246905_135_617 159
626 3300045976 Ga0466967_0448552 Ga0466967_0448552_169_651 159
627 3300045976 Ga0466967_0643111 Ga0466967_0643111_94_576 159
628 3300046452 Ga0495617_127437 Ga0495617_127437_160_642 159
629 3300046454 Ga0495592_0145537 Ga0495592_0145537_130_618 159
630 3300046455 Ga0495603_0110794 Ga0495603_0110794_588_1070 159
631 3300046459 Ga0495629_0127283 Ga0495629_0127283_38_559 159
632 3300046462 Ga0495651_0040765 Ga0495651_0040765_228_716 159
633 3300046462 Ga0495651_0842703 Ga0495651_0842703_19_501 159
634 3300046463 Ga0495653_0025533 Ga0495653_0025533_3321_3809 159
635 3300046476 Ga0495662_0055440 Ga0495662_0055440_385_873 159
636 3300046477 Ga0495664_0070883 Ga0495664_0070883_1054_1542 159
637 3300046477 Ga0495664_0131782 Ga0495664_0131782_373_855 159
638 3300046491 Ga0495584_0118141 Ga0495584_0118141_145_627 159
639 3300046492 Ga0495585_0043795 Ga0495585_0043795_207_689 159
640 3300046507 Ga0495606_0104463 Ga0495606_0104463_67_549 159
641 3300046511 Ga0495608_0032385 Ga0495608_0032385_2553_3041 159
642 3300046514 Ga0495618_0279955 Ga0495618_0279955_217_705 159
643 3300046516 Ga0495628_0154334 Ga0495628_0154334_171_659 159
644 3300046518 Ga0495631_0233904 Ga0495631_0233904_57_539 159
645 3300046528 Ga0495642_0187531 Ga0495642_0187531_76_558 159
646 3300046529 Ga0495652_0041116 Ga0495652_0041116_932_1414 159
647 3300046529 Ga0495652_0076698 Ga0495652_0076698_1836_2324 159
648 3300046529 Ga0495652_0792718 Ga0495652_0792718_103_585 159
649 3300046536 Ga0495587_0468239 Ga0495587_0468239_127_615 159
650 3300046543 Ga0495645_0021359 Ga0495645_0021359_2064_2552 159
651 3300046557 Ga0495622_0021138 Ga0495622_0021138_1233_1715 159
652 3300046559 Ga0495667_0086546 Ga0495667_0086546_1025_1513 159
653 3300046648 Ga0495611_0159656 Ga0495611_0159656_15_497 159
654 3300046675 Ga0495657_0066730 Ga0495657_0066730_197_685 159
655 3300046678 Ga0495599_0072044 Ga0495599_0072044_176_664 159
656 3300046679 Ga0495623_0178224 Ga0495623_0178224_219_707 159
657 3300046679 Ga0495623_0292010 Ga0495623_0292010_381_863 159
658 3300046689 Ga0495613_0558392 Ga0495613_0558392_249_731 159
659 3300047315 Ga0495581_0061677 Ga0495581_0061677_1529_2011 159
660 3300047317 Ga0495604_0034015 Ga0495604_0034015_2520_3008 159
661 3300047319 Ga0495674_0216328 Ga0495674_0216328_678_1166 159
662 3300047322 Ga0495680_0445112 Ga0495680_0445112_143_631 159
663 3300047471 Ga0495684_0090955 Ga0495684_0090955_623_1111 159
664 3300047472 Ga0495686_0246712 Ga0495686_0246712_385_867 159
665 3300047472 Ga0495686_0338481 Ga0495686_0338481_213_695 159
666 3300047673 Ga0495593_0181901 Ga0495593_0181901_207_695 159
667 3300048088 Ga0495602_0231828 Ga0495602_0231828_372_860 159
668 3300048088 Ga0495602_0394128 Ga0495602_0394128_435_917 159
669 3300048904 Ga0496101_0336013 Ga0496101_0336013_690_1172 159
670 3300048907 Ga0496104_0229148 Ga0496104_0229148_616_1098 159
671 3300048909 Ga0496106_0296209 Ga0496106_0296209_513_995 159
672 3300048910 Ga0496107_0309573 Ga0496107_0309573_168_650 159
673 3300048911 Ga0496108_0288365 Ga0496108_0288365_803_1285 159
674 3300048912 Ga0496109_0082524 Ga0496109_0082524_582_1136 159
675 3300048914 Ga0496111_0515464 Ga0496111_0515464_314_868 159
676 3300048915 Ga0496112_0146529 Ga0496112_0146529_790_1344 159
677 3300048920 Ga0496117_0099368 Ga0496117_0099368_121_603 159
678 3300048921 Ga0496118_0288749 Ga0496118_0288749_158_640 159
679 3300048922 Ga0496119_0258852 Ga0496119_0258852_344_826 159
680 3300048924 Ga0496121_0103376 Ga0496121_0103376_627_1109 159
681 3300048929 Ga0496126_0009184 Ga0496126_0009184_802_1284 159
682 3300048929 Ga0496126_0037704 Ga0496126_0037704_2573_3055 159
683 3300048929 Ga0496126_0060967 Ga0496126_0060967_242_724 159
684 3300049459 Ga0495678_151121 Ga0495678_151121_175_657 159
685 3300050492 nmdc:mga0yw44_125034_c1 nmdc:mga0yw44_125034_c1_593_1291 159
686 3300050512 nmdc:mga0n895_473759_c1 nmdc:mga0n895_473759_c1_429_911 159
687 3300050512 nmdc:mga0n895_9753_c1 nmdc:mga0n895_9753_c1_2782_3264 159
688 3300050513 nmdc:mga0rr50_17170_c1 nmdc:mga0rr50_17170_c1_4306_4788 159
689 3300050516 nmdc:mga0sz30_238167_c1 nmdc:mga0sz30_238167_c1_16_498 159
690 3300053077 Ga0495601_0184484 Ga0495601_0184484_222_704 159
691 3300053078 Ga0495612_0019908 Ga0495612_0019908_695_1183 159
692 3300053078 Ga0495612_0077954 Ga0495612_0077954_418_900 159
693 3300053080 Ga0500635_0001194 Ga0500635_0001194_1251_1733 159
694 3300053080 Ga0500635_0114002 Ga0500635_0114002_276_758 159
695 3300053084 Ga0495595_0229364 Ga0495595_0229364_138_626 159
696 3300053087 Ga0500643_000007 Ga0500643_000007_8624_9106 159
697 3300053091 Ga0500647_0274777 Ga0500647_0274777_36_518 159
698 3300053094 Ga0500566_0034843 Ga0500566_0034843_1466_1948 159
699 3300053094 Ga0500566_0043006 Ga0500566_0043006_853_1335 159
700 3300053097 Ga0500648_204553 Ga0500648_204553_256_738 159
701 3300053102 Ga0500554_004996 Ga0500554_004996_2227_2709 159
702 3300053103 Ga0500555_001725 Ga0500555_001725_4747_5229 159
703 3300053104 Ga0500556_0066417 Ga0500556_0066417_655_1137 159
704 3300053105 Ga0500557_000052 Ga0500557_000052_25196_25678 159
705 3300053119 Ga0500595_022872 Ga0500595_022872_765_1247 159
706 3300053121 Ga0500607_012093 Ga0500607_012093_1372_1854 159
707 3300053122 Ga0500608_236962 Ga0500608_236962_184_666 159
708 3300053130 Ga0500642_0000306 Ga0500642_0000306_4495_4977 159
709 3300053130 Ga0500642_0022000 Ga0500642_0022000_1031_1513 159
710 3300053139 Ga0500568_0036717 Ga0500568_0036717_572_1054 159
711 3300053140 Ga0500573_0008281 Ga0500573_0008281_1098_1580 159
712 3300053142 Ga0500577_0237576 Ga0500577_0237576_87_569 159
713 3300053148 Ga0500590_100392 Ga0500590_100392_174_656 159
714 3300053150 Ga0500603_002547 Ga0500603_002547_172_654 159
715 3300053153 Ga0500616_0080109 Ga0500616_0080109_1121_1603 159
716 3300053155 Ga0500620_097226 Ga0500620_097226_535_1017 159
717 3300053156 Ga0500622_0237636 Ga0500622_0237636_156_638 159
718 3300053162 Ga0500638_166551 Ga0500638_166551_157_639 159
719 3300053163 Ga0500639_045546 Ga0500639_045546_285_767 159
720 3300053177 Ga0500636_0059198 Ga0500636_0059198_942_1424 159
721 3300053178 Ga0500637_0041913 Ga0500637_0041913_894_1376 159
722 3300053178 Ga0500637_0119103 Ga0500637_0119103_721_1203 159
723 3300053729 Ga0500625_000139 Ga0500625_000139_11727_12209 159
724 3300053733 Ga0500552_007174 Ga0500552_007174_650_1132 159
725 3300053735 Ga0500596_001166 Ga0500596_001166_2341_2823 159
726 3300055283 Ga0500661_033874 Ga0500661_033874_66_548 159
727 iso_pu_bacteria 2643221603 2644029507 159
728 3300005339 Ga0070660_100156222 Ga0070660_1001562223 160
729 3300005455 Ga0070663_100090802 Ga0070663_1000908022 160
730 3300005530 Ga0070679_101092814 Ga0070679_1010928141 160
731 3300005536 Ga0070697_100273394 Ga0070697_1002733942 160
732 3300007788 Ga0099795_10322051 Ga0099795_103220511 160
733 3300025253 Ga0209677_102108 Ga0209677_1021086 160
734 3300025261 Ga0209233_1003604 Ga0209233_10036042 160
735 3300025272 Ga0209455_1007029 Ga0209455_10070293 160
736 3300026067 Ga0207678_10130984 Ga0207678_101309842 160
737 3300038443 Ga0395901_0006629 Ga0395901_0006629_6624_7109 160
738 3300039437 Ga0436365_0475914 Ga0436365_0475914_534_1019 160
739 3300046471 Ga0495650_0025895 Ga0495650_0025895_2152_2652 160
740 3300048924 Ga0496121_0474364 Ga0496121_0474364_239_724 160
741 3300048928 Ga0496125_0097725 Ga0496125_0097725_903_1388 160
742 3300061719 Ga0466962_0136991 Ga0466962_0136991_25_510 160
743 3300005327 Ga0070658_10654571 Ga0070658_106545712 161
744 3300005339 Ga0070660_100090985 Ga0070660_1000909852 161
745 3300005366 Ga0070659_100217668 Ga0070659_1002176682 161
746 3300005458 Ga0070681_10171454 Ga0070681_101714542 161
747 3300005563 Ga0068855_100150597 Ga0068855_1001505972 161
748 3300009551 Ga0105238_10340831 Ga0105238_103408312 161
749 3300012510 Ga0157316_1019734 Ga0157316_10197342 161
750 3300013100 Ga0157373_10110078 Ga0157373_101100782 161
751 3300013105 Ga0157369_10481821 Ga0157369_104818212 161
752 3300013307 Ga0157372_10490646 Ga0157372_104906461 161
753 3300025917 Ga0207660_10559623 Ga0207660_105596232 161
754 3300025919 Ga0207657_10004866 Ga0207657_100048667 161
755 3300025932 Ga0207690_10147613 Ga0207690_101476132 161
756 3300026078 Ga0207702_11135512 Ga0207702_111355121 161
757 3300028379 Ga0268266_10246751 Ga0268266_102467511 161
758 3300049572 Ga0501036_0616520 Ga0501036_0616520_194_691 161
759 3300049573 Ga0501037_0143926 Ga0501037_0143926_665_1162 161
760 3300049579 Ga0501043_0093533 Ga0501043_0093533_66_563 161
761 3300049580 Ga0501046_0094978 Ga0501046_0094978_25_522 161
762 3300049583 Ga0501067_0337538 Ga0501067_0337538_100_597 161
763 3300049584 Ga0501068_0468687 Ga0501068_0468687_65_562 161
764 3300049742 Ga0501080_0074660 Ga0501080_0074660_2164_2661 161
765 3300049822 Ga0501035_0071669 Ga0501035_0071669_182_679 161
766 3300049823 Ga0501044_0145576 Ga0501044_0145576_197_694 161
767 3300053109 Ga0500569_094412 Ga0500569_094412_195_740 161
768 3300005347 Ga0070668_100021312 Ga0070668_1000213122 162
769 3300005438 Ga0070701_10005863 Ga0070701_100058634 162
770 3300005444 Ga0070694_100034752 Ga0070694_1000347522 162
771 3300005455 Ga0070663_100332415 Ga0070663_1003324152 162
772 3300005564 Ga0070664_100334299 Ga0070664_1003342992 162
773 3300005577 Ga0068857_100019190 Ga0068857_1000191905 162
774 3300005840 Ga0068870_10009642 Ga0068870_100096422 162
775 3300005843 Ga0068860_100235462 Ga0068860_1002354623 162
776 3300005844 Ga0068862_100010749 Ga0068862_1000107492 162
777 3300009094 Ga0111539_10131263 Ga0111539_101312632 162
778 3300009553 Ga0105249_10001807 Ga0105249_100018078 162
779 3300013306 Ga0163162_11710688 Ga0163162_117106881 162
780 3300013308 Ga0157375_10032410 Ga0157375_100324107 162
781 3300014326 Ga0157380_10004824 Ga0157380_100048249 162
782 3300025901 Ga0207688_10710688 Ga0207688_107106882 162
783 3300025908 Ga0207643_10010821 Ga0207643_100108218 162
784 3300025923 Ga0207681_10004668 Ga0207681_100046687 162
785 3300025961 Ga0207712_10013250 Ga0207712_100132508 162
786 3300026075 Ga0207708_10137849 Ga0207708_101378492 162
787 3300026089 Ga0207648_10012512 Ga0207648_100125122 162
788 3300026095 Ga0207676_10079917 Ga0207676_100799174 162
789 3300026116 Ga0207674_10006034 Ga0207674_100060342 162
790 3300026118 Ga0207675_100071151 Ga0207675_1000711513 162
791 3300027907 Ga0207428_10727441 Ga0207428_107274411 162
792 3300028380 Ga0268265_10002435 Ga0268265_1000243510 162
793 3300028381 Ga0268264_10222339 Ga0268264_102223392 162
794 3300031852 Ga0307410_10634933 Ga0307410_106349332 162
795 3300032002 Ga0307416_100025085 Ga0307416_1000250852 162
796 3300032005 Ga0307411_10114610 Ga0307411_101146102 162
797 3300039438 Ga0436360_1119210 Ga0436360_1119210_480_992 162
798 3300046794 Ga0495589_0017858 Ga0495589_0017858_2069_2575 162
799 3300049521 Ga0501298_113475 Ga0501298_113475_51_539 162
800 3300049654 Ga0501207_060029 Ga0501207_060029_34_522 162
801 3300050510 nmdc:mga06r32_1283615_c1 nmdc:mga06r32_1283615_c1_158_646 162
802 3300050511 nmdc:mga08y16_530729_c1 nmdc:mga08y16_530729_c1_81_569 162
803 3300046462 Ga0495651_0312885 Ga0495651_0312885_63_590 164
804 3300002070 JGI24750J21931_1047247 JGI24750J21931_10472471 166
805 3300005295 Ga0065707_10567551 Ga0065707_105675511 166
806 3300005328 Ga0070676_10002228 Ga0070676_100022287 166
807 3300005329 Ga0070683_100020341 Ga0070683_1000203413 166
808 3300005331 Ga0070670_100083010 Ga0070670_1000830102 166
809 3300005334 Ga0068869_100063887 Ga0068869_1000638871 166
810 3300005338 Ga0068868_100049271 Ga0068868_1000492712 166
811 3300005339 Ga0070660_100053333 Ga0070660_1000533332 166
812 3300005340 Ga0070689_100816931 Ga0070689_1008169311 166
813 3300005343 Ga0070687_100393483 Ga0070687_1003934831 166
814 3300005344 Ga0070661_100026905 Ga0070661_1000269052 166
815 3300005345 Ga0070692_10093497 Ga0070692_100934972 166
816 3300005347 Ga0070668_100013869 Ga0070668_1000138692 166
817 3300005353 Ga0070669_100014943 Ga0070669_1000149432 166
818 3300005354 Ga0070675_100021193 Ga0070675_1000211932 166
819 3300005356 Ga0070674_100547834 Ga0070674_1005478342 166
820 3300005364 Ga0070673_100324007 Ga0070673_1003240072 166
821 3300005365 Ga0070688_100127895 Ga0070688_1001278952 166
822 3300005366 Ga0070659_100022073 Ga0070659_1000220733 166
823 3300005367 Ga0070667_100642436 Ga0070667_1006424362 166
824 3300005438 Ga0070701_10014733 Ga0070701_100147332 166
825 3300005439 Ga0070711_100479552 Ga0070711_1004795521 166
826 3300005441 Ga0070700_100024131 Ga0070700_1000241313 166
827 3300005444 Ga0070694_100074662 Ga0070694_1000746621 166
828 3300005455 Ga0070663_100060738 Ga0070663_1000607381 166
829 3300005457 Ga0070662_100027569 Ga0070662_1000275692 166
830 3300005535 Ga0070684_100005863 Ga0070684_1000058632 166
831 3300005539 Ga0068853_101606809 Ga0068853_1016068091 166
832 3300005543 Ga0070672_100043937 Ga0070672_1000439372 166
833 3300005544 Ga0070686_101019078 Ga0070686_1010190781 166
834 3300005563 Ga0068855_100129894 Ga0068855_1001298942 166
835 3300005564 Ga0070664_100024422 Ga0070664_1000244223 166
836 3300005577 Ga0068857_100273225 Ga0068857_1002732251 166
837 3300005578 Ga0068854_100195086 Ga0068854_1001950861 166
838 3300005616 Ga0068852_100021960 Ga0068852_1000219602 166
839 3300005617 Ga0068859_100148657 Ga0068859_1001486572 166
840 3300005719 Ga0068861_100011932 Ga0068861_1000119322 166
841 3300005834 Ga0068851_10022349 Ga0068851_100223492 166
842 3300005842 Ga0068858_100039931 Ga0068858_1000399312 166
843 3300005843 Ga0068860_100059712 Ga0068860_1000597122 166
844 3300005844 Ga0068862_100106989 Ga0068862_1001069892 166
845 3300006871 Ga0075434_100066726 Ga0075434_1000667262 166
846 3300006881 Ga0068865_100010434 Ga0068865_1000104343 166
847 3300006931 Ga0097620_100148653 Ga0097620_1001486532 166
848 3300009093 Ga0105240_10508133 Ga0105240_105081331 166
849 3300009098 Ga0105245_10600271 Ga0105245_106002712 166
850 3300009177 Ga0105248_10189369 Ga0105248_101893692 166
851 3300009553 Ga0105249_10007552 Ga0105249_100075522 166
852 3300010375 Ga0105239_10043084 Ga0105239_100430842 166
853 3300013296 Ga0157374_11756236 Ga0157374_117562361 166
854 3300013306 Ga0163162_10096710 Ga0163162_100967102 166
855 3300013307 Ga0157372_10244395 Ga0157372_102443952 166
856 3300013308 Ga0157375_10044327 Ga0157375_100443275 166
857 3300014326 Ga0157380_10286219 Ga0157380_102862192 166
858 3300014745 Ga0157377_10019271 Ga0157377_100192713 166
859 3300014968 Ga0157379_10009268 Ga0157379_100092683 166
860 3300017792 Ga0163161_10036989 Ga0163161_100369893 166
861 3300025315 Ga0207697_10027785 Ga0207697_100277852 166
862 3300025321 Ga0207656_10024927 Ga0207656_100249272 166
863 3300025901 Ga0207688_10023474 Ga0207688_100234742 166
864 3300025904 Ga0207647_10479813 Ga0207647_104798132 166
865 3300025907 Ga0207645_10000746 Ga0207645_1000074612 166
866 3300025918 Ga0207662_10016645 Ga0207662_100166451 166
867 3300025919 Ga0207657_10026433 Ga0207657_100264332 166
868 3300025920 Ga0207649_10025156 Ga0207649_100251562 166
869 3300025923 Ga0207681_10023787 Ga0207681_100237873 166
870 3300025925 Ga0207650_10023587 Ga0207650_100235872 166
871 3300025926 Ga0207659_10069822 Ga0207659_100698222 166
872 3300025932 Ga0207690_10190044 Ga0207690_101900442 166
873 3300025933 Ga0207706_10000761 Ga0207706_1000076114 166
874 3300025936 Ga0207670_10050670 Ga0207670_100506702 166
875 3300025938 Ga0207704_10146614 Ga0207704_101466142 166
876 3300025940 Ga0207691_10017636 Ga0207691_100176363 166
877 3300025941 Ga0207711_10102153 Ga0207711_101021533 166
878 3300025942 Ga0207689_10005497 Ga0207689_100054973 166
879 3300025944 Ga0207661_10023101 Ga0207661_100231012 166
880 3300025945 Ga0207679_10031886 Ga0207679_100318862 166
881 3300025949 Ga0207667_10044596 Ga0207667_100445962 166
882 3300025960 Ga0207651_10992050 Ga0207651_109920501 166
883 3300025961 Ga0207712_10051370 Ga0207712_100513701 166
884 3300025972 Ga0207668_10009741 Ga0207668_100097415 166
885 3300025981 Ga0207640_10389694 Ga0207640_103896942 166
886 3300025986 Ga0207658_10115507 Ga0207658_101155072 166
887 3300026035 Ga0207703_10075337 Ga0207703_100753374 166
888 3300026035 Ga0207703_10208683 Ga0207703_102086832 166
889 3300026067 Ga0207678_10018357 Ga0207678_100183572 166
890 3300026075 Ga0207708_10059942 Ga0207708_100599422 166
891 3300026089 Ga0207648_11334790 Ga0207648_113347901 166
892 3300026116 Ga0207674_10002712 Ga0207674_100027129 166
893 3300026118 Ga0207675_100020256 Ga0207675_1000202563 166
894 3300026142 Ga0207698_10144600 Ga0207698_101446001 166
895 3300028380 Ga0268265_10128893 Ga0268265_101288931 166
896 3300028381 Ga0268264_10109587 Ga0268264_101095872 166
897 3300042012 Ga0439455_0073321 Ga0439455_0073321_372_872 166
898 3300048911 Ga0496108_0817456 Ga0496108_0817456_51_551 166

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

106

179

0.95

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

38

97

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1dgj-assembly1.cif.gz_A crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774 0.9617 7 155
1rm6-assembly1.cif.gz_C structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica 0.9584 5 156
8gy3-assembly1.cif.gz_B cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans 0.9578 6 155
4c7y-assembly1.cif.gz_A aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with sodium dithionite and sodium sulfide 0.9567 6 155
1ffv-assembly1.cif.gz_A carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.9525 6 156
ID Description Score Start End Superfamily
1alo002 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9663 78 155 1.10.150.120
4zohC02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9464 83 156 1.10.150.120
3hrdH02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9453 83 155 1.10.150.120
5y6qA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.94 5 80 3.10.20.30
1sb3F01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9374 5 80 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A2V8I7C9-F1-model_v4 (2Fe-2S)-binding protein 0.9945 6 154 GO:0016491
GO:0046872
GO:0051537
AF-A0A2G0VS79-F1-model_v4 (2Fe-2S)-binding protein 0.9937 5 156 GO:0016491
GO:0046872
GO:0051537
AF-A0A2V8NWD2-F1-model_v4 (2Fe-2S)-binding protein 0.9937 6 154 GO:0016491
GO:0046872
GO:0051537
AF-A0A1W6Z9M6-F1-model_v4 (2Fe-2S)-binding protein 0.9931 6 155 GO:0016491
GO:0046872
GO:0051537
AF-A0A370NBK9-F1-model_v4 (2Fe-2S)-binding protein 0.9924 4 155 GO:0016491
GO:0046872
GO:0051537

Feature Viewer

pLDDT pTM Quality
91.41 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map