F485056

General Info

Members Datasets Scaffolds Average Seq Length
897 427 1794 122

Family's Representative Sequence

Representative Sequence 3300049581|Ga0501047_0623571|Ga0501047_0623571_108_554
Length 148
Sequence MARLGSVLIKGFRLQANSDSFTQFWEGEMARFDLSDAEWALIKPLLPDKPRGVARVNDRRVLNGIFYVLRTGSPWRDLPERFGPYTTVYNRFNRWAKAGVWVQIFETLAAKSPHSMAFIDSSIIRAHQHAAGGKKGARITPSAVLVED

Samples

Sample ID Description Type Environment
1 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
7 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
8 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
9 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
10 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
11 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
12 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
15 3300003502 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM Metagenome Rhizosphere
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
34 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
45 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
46 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
47 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
48 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
49 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
50 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
57 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
58 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
65 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
78 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
79 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
80 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
81 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
86 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
87 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
88 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
89 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
90 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
91 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
92 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
93 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
94 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
95 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
96 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
97 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
98 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
99 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
101 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
102 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
103 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
104 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
105 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
106 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
107 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
108 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
110 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
111 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
112 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
113 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
114 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
115 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
116 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
117 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
118 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
119 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
120 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
121 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
122 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
123 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
124 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
125 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
126 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
127 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
128 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
129 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
130 3300013874 Rhizosphere microbial communities from switchgrass harvested rhizosphere in Austin, TX, USA - RS_213 Metagenome Rhizosphere
131 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
132 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
133 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
134 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
135 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
136 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
137 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
138 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
139 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
140 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
141 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
143 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
144 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
146 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
148 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
217 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
219 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
223 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
224 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
225 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
226 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
227 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
228 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
229 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
230 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
231 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
232 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
233 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
234 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
235 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
238 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
239 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
240 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
241 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
242 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
243 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
244 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
245 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
246 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
247 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
248 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
249 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
250 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
251 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
252 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
253 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
254 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
255 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
256 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
257 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
258 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
259 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
260 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
261 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
262 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
263 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
264 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
265 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
266 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
267 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
268 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
269 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
270 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
271 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
272 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
273 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
274 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
275 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
276 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
277 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
278 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
279 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
280 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
281 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
282 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
283 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
284 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
285 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
286 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
287 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
288 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
289 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
290 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
291 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
292 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
293 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
294 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
295 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
296 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
297 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
298 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
299 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
300 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
301 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
302 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
303 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
304 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
305 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
306 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
307 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
308 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
309 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
310 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
311 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
312 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
313 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
314 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
315 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
316 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
317 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
318 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
319 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
320 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
321 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
322 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
323 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
324 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
325 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
326 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
327 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
328 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
329 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
330 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
331 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
332 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
333 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
334 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
335 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
336 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
337 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
338 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
339 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
340 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
341 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
342 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
343 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
344 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
345 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
346 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
347 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
348 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
349 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
350 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
351 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
352 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
353 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
354 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
355 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
356 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
357 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
358 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
359 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
360 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
361 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
362 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
363 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
364 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
365 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
366 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
367 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
370 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
372 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
373 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
374 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
375 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
376 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
377 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
378 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
379 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
380 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
381 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
382 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
383 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
384 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
385 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
386 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
387 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
388 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
389 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
390 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
391 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
392 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
393 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
394 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
395 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
396 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
397 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
398 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
399 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
400 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
401 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
402 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
403 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
404 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
405 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
406 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
407 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
408 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
409 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
410 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
411 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
412 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
413 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
414 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
415 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
416 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
417 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
418 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
419 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
420 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
421 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
422 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
423 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
424 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
425 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
426 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
427 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.92
Nodule 0
Rhizoplane 3.23
Rhizosphere 86.73
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501047_0623571 3300049581 Bacteria 899
2 CNXas_1005060 3300000545 Bacteria 934
3 JGI24752J21851_1059595 3300001976 Bacteria 525
4 JGI24746J21847_1051016 3300001977 Bacteria 582
5 JGI24743J22301_10046276 3300001991 Bacteria 880
6 JGI24750J21931_1023029 3300002070 Bacteria 882
7 JGI24745J21846_1024783 3300002073 Bacteria 712
8 JGI24748J21848_1017376 3300002074 Bacteria 861
9 JGI24749J21850_1023847 3300002076 Bacteria 870
10 JGI24033J26618_1017357 3300002155 Bacteria 900
11 JGI24033J26618_1059427 3300002155 Bacteria 560
12 JGI24034J26672_10028374 3300002239 Bacteria 903
13 JGI24742J22300_10038747 3300002244 Bacteria 845
14 JGI25153J46596_10045490 3300003215 Bacteria 1309
15 JGI25153J46596_10065455 3300003215 Bacteria 966
16 JGI25160J50197_1000699 3300003354 Bacteria 18486
17 JGI26143J51219_1001643 3300003502 Bacteria 930
18 Ga0055526_1026391 3300003771 Bacteria 1833
19 Ga0055526_1040729 3300003771 Bacteria 1167
20 Ga0055540_1047742 3300003792 Bacteria 895
21 Ga0055531_10002518 3300003794 Bacteria 12206
22 Ga0065165_1004302 3300005262 Bacteria 8962
23 Ga0065165_1005501 3300005262 Bacteria 7083
24 Ga0065712_10244630 3300005290 Bacteria 878
25 Ga0070658_10432172 3300005327 Bacteria 1133
26 Ga0070658_10534816 3300005327 Bacteria 1014
27 Ga0070676_10307453 3300005328 Bacteria 1077
28 Ga0070676_10411748 3300005328 Bacteria 943
29 Ga0070683_100827448 3300005329 Bacteria 888
30 Ga0070690_101648284 3300005330 Bacteria 521
31 Ga0070670_100476607 3300005331 Bacteria 1108
32 Ga0070670_100493853 3300005331 Bacteria 1088
33 Ga0068869_100252547 3300005334 Bacteria 1409
34 Ga0068869_100351382 3300005334 Bacteria 1202
35 Ga0068869_101077658 3300005334 Bacteria 702
36 Ga0070666_10270158 3300005335 Bacteria 1207
37 Ga0070666_10462690 3300005335 Bacteria 917
38 Ga0070680_100497796 3300005336 Bacteria 1043
39 Ga0070682_100525163 3300005337 Bacteria 922
40 Ga0070682_101290518 3300005337 Bacteria 620
41 Ga0068868_100274983 3300005338 Bacteria 1424
42 Ga0068868_100344091 3300005338 Bacteria 1276
43 Ga0068868_100482002 3300005338 Bacteria 1084
44 Ga0068868_100650573 3300005338 Bacteria 938
45 Ga0068868_101143515 3300005338 Bacteria 718
46 Ga0070660_100509243 3300005339 Bacteria 1002
47 Ga0070660_101415597 3300005339 Bacteria 591
48 Ga0070689_100668862 3300005340 Bacteria 905
49 Ga0070691_10252694 3300005341 Bacteria 946
50 Ga0070687_100010730 3300005343 Bacteria 3978
51 Ga0070687_100067604 3300005343 Bacteria 1908
52 Ga0070661_100085832 3300005344 Bacteria 2326
53 Ga0070661_100417865 3300005344 Bacteria 1063
54 Ga0070661_101489906 3300005344 Bacteria 570
55 Ga0070668_100256035 3300005347 Bacteria 1454
56 Ga0070668_101868691 3300005347 Bacteria 553
57 Ga0070669_100488441 3300005353 Bacteria 1020
58 Ga0070669_101553736 3300005353 Bacteria 576
59 Ga0070675_100316731 3300005354 Bacteria 1377
60 Ga0070675_100429750 3300005354 Bacteria 1182
61 Ga0070671_100501803 3300005355 Bacteria 1044
62 Ga0070671_100585378 3300005355 Bacteria 964
63 Ga0070671_101067456 3300005355 Bacteria 709
64 Ga0070674_100452024 3300005356 Bacteria 1060
65 Ga0070674_100512451 3300005356 Bacteria 1001
66 Ga0070674_101968677 3300005356 Bacteria 532
67 Ga0070688_100392236 3300005365 Bacteria 1026
68 Ga0070688_100435785 3300005365 Bacteria 977
69 Ga0070659_100288928 3300005366 Bacteria 1365
70 Ga0070667_100482921 3300005367 Bacteria 1134
71 Ga0070667_100602120 3300005367 Bacteria 1013
72 Ga0070667_100922863 3300005367 Bacteria 813
73 Ga0070714_100229494 3300005435 Bacteria 1709
74 Ga0070714_100797310 3300005435 Bacteria 914
75 Ga0070713_101720379 3300005436 Bacteria 609
76 Ga0070713_102034967 3300005436 Bacteria 557
77 Ga0070713_102165676 3300005436 Bacteria 539
78 Ga0070701_10022111 3300005438 Bacteria 3045
79 Ga0070701_10482958 3300005438 Bacteria 801
80 Ga0070711_100359789 3300005439 Bacteria 1172
81 Ga0070711_100947059 3300005439 Bacteria 737
82 Ga0070705_100751382 3300005440 Bacteria 771
83 Ga0070700_100056481 3300005441 Bacteria 2461
84 Ga0070694_100678726 3300005444 Bacteria 836
85 Ga0070663_100073411 3300005455 Bacteria 2496
86 Ga0070663_100083699 3300005455 Bacteria 2350
87 Ga0070663_100421634 3300005455 Bacteria 1095
88 Ga0070678_100289670 3300005456 Bacteria 1387
89 Ga0070678_100555684 3300005456 Bacteria 1019
90 Ga0070678_100891787 3300005456 Bacteria 812
91 Ga0070678_100997640 3300005456 Bacteria 769
92 Ga0070662_100270575 3300005457 Bacteria 1372
93 Ga0070662_100288196 3300005457 Bacteria 1330
94 Ga0070681_10143547 3300005458 Bacteria 2317
95 Ga0070681_10346019 3300005458 Bacteria 1397
96 Ga0070681_11573628 3300005458 Bacteria 582
97 Ga0068867_100199881 3300005459 Bacteria 1600
98 Ga0068867_100376408 3300005459 Bacteria 1191
99 Ga0070685_10331526 3300005466 Bacteria 1035
100 Ga0070685_11074578 3300005466 Bacteria 607
101 Ga0070685_11151469 3300005466 Bacteria 588
102 Ga0070685_11629093 3300005466 Bacteria 500
103 Ga0070706_101870915 3300005467 Bacteria 545
104 Ga0070698_101238521 3300005471 Bacteria 696
105 Ga0070679_100596364 3300005530 Bacteria 1048
106 Ga0070679_100722881 3300005530 Bacteria 939
107 Ga0070679_100872001 3300005530 Bacteria 843
108 Ga0070684_100086448 3300005535 Bacteria 2783
109 Ga0070684_100883074 3300005535 Bacteria 837
110 Ga0070684_101480132 3300005535 Bacteria 640
111 Ga0068853_100120836 3300005539 Bacteria 2336
112 Ga0068853_100279212 3300005539 Bacteria 1540
113 Ga0068853_100793236 3300005539 Bacteria 907
114 Ga0068853_100794236 3300005539 Bacteria 906
115 Ga0068853_102001732 3300005539 Bacteria 562
116 Ga0070672_100289074 3300005543 Bacteria 1387
117 Ga0070686_100322112 3300005544 Bacteria 1153
118 Ga0070686_100398684 3300005544 Bacteria 1046
119 Ga0070696_100546984 3300005546 Bacteria 927
120 Ga0070693_100642050 3300005547 Bacteria 771
121 Ga0070665_100069007 3300005548 Bacteria 3543
122 Ga0070665_100199327 3300005548 Bacteria 2002
123 Ga0070665_100569207 3300005548 Bacteria 1146
124 Ga0070665_101197213 3300005548 Bacteria 770
125 Ga0070665_101767965 3300005548 Bacteria 625
126 Ga0070665_101970454 3300005548 Bacteria 589
127 Ga0070704_100755069 3300005549 Bacteria 866
128 Ga0068855_100135468 3300005563 Bacteria 2810
129 Ga0068855_100210201 3300005563 Bacteria 2187
130 Ga0068855_100353028 3300005563 Bacteria 1619
131 Ga0068855_100484219 3300005563 Bacteria 1346
132 Ga0068855_100663006 3300005563 Bacteria 1119
133 Ga0068855_100739458 3300005563 Bacteria 1050
134 Ga0068855_101080044 3300005563 Bacteria 840
135 Ga0070664_100214203 3300005564 Bacteria 1722
136 Ga0070664_100577107 3300005564 Bacteria 1042
137 Ga0068857_100660870 3300005577 Bacteria 991
138 Ga0068857_101438979 3300005577 Bacteria 671
139 Ga0068854_100175847 3300005578 Bacteria 1669
140 Ga0068854_100233983 3300005578 Bacteria 1460
141 Ga0068854_100555018 3300005578 Bacteria 975
142 Ga0068854_101025747 3300005578 Bacteria 732
143 Ga0068854_101081466 3300005578 Bacteria 714
144 Ga0068854_101152596 3300005578 Bacteria 693
145 Ga0068856_100000883 3300005614 Bacteria 32112
146 Ga0068856_100591343 3300005614 Bacteria 1131
147 Ga0068856_101007490 3300005614 Bacteria 851
148 Ga0068856_101142912 3300005614 Bacteria 796
149 Ga0070702_100532548 3300005615 Bacteria 869
150 Ga0068852_100386648 3300005616 Bacteria 1373
151 Ga0068852_100464229 3300005616 Bacteria 1255
152 Ga0068852_100482103 3300005616 Bacteria 1232
153 Ga0068852_100600255 3300005616 Bacteria 1105
154 Ga0068852_101028718 3300005616 Bacteria 843
155 Ga0068859_100406469 3300005617 Bacteria 1457
156 Ga0068859_101966145 3300005617 Bacteria 646
157 Ga0068864_100384048 3300005618 Bacteria 1331
158 Ga0068866_10156543 3300005718 Bacteria 1325
159 Ga0068866_10629158 3300005718 Bacteria 728
160 Ga0068861_100280890 3300005719 Bacteria 1434
161 Ga0068861_100730743 3300005719 Bacteria 923
162 Ga0068851_10186216 3300005834 Bacteria 1152
163 Ga0068870_10159400 3300005840 Bacteria 1337
164 Ga0068870_10184245 3300005840 Bacteria 1255
165 Ga0068863_101288245 3300005841 Bacteria 737
166 Ga0068858_100361704 3300005842 Bacteria 1391
167 Ga0068858_100633463 3300005842 Bacteria 1038
168 Ga0068860_100238206 3300005843 Bacteria 1770
169 Ga0068860_100439152 3300005843 Bacteria 1296
170 Ga0068860_100486031 3300005843 Bacteria 1231
171 Ga0068860_102323376 3300005843 Bacteria 557
172 Ga0068862_100704357 3300005844 Bacteria 979
173 Ga0081455_10099141 3300005937 Bacteria 2344
174 Ga0081540_1194970 3300005983 Bacteria 743
175 Ga0081540_1294799 3300005983 Bacteria 558
176 Ga0070717_10897891 3300006028 Bacteria 807
177 Ga0075365_10414400 3300006038 Bacteria 951
178 Ga0075365_10520451 3300006038 Bacteria 841
179 Ga0075365_10794774 3300006038 Bacteria 668
180 Ga0075368_10094474 3300006042 Bacteria 1224
181 Ga0075363_100305607 3300006048 Bacteria 924
182 Ga0075363_100418564 3300006048 Bacteria 789
183 Ga0075364_10696642 3300006051 Bacteria 693
184 Ga0075364_11073411 3300006051 Bacteria 547
185 Ga0075432_10535480 3300006058 Bacteria 527
186 Ga0070716_101179063 3300006173 Bacteria 614
187 Ga0070712_100301785 3300006175 Bacteria 1296
188 Ga0075362_10089575 3300006177 Bacteria 1427
189 Ga0075362_10192580 3300006177 Bacteria 991
190 Ga0075367_10318077 3300006178 Bacteria 981
191 Ga0075367_10545878 3300006178 Bacteria 736
192 Ga0075369_10110420 3300006186 Bacteria 1239
193 Ga0075369_10303418 3300006186 Bacteria 746
194 Ga0075366_10284514 3300006195 Bacteria 1011
195 Ga0075366_10347126 3300006195 Bacteria 911
196 Ga0075366_10362873 3300006195 Bacteria 890
197 Ga0075366_10924521 3300006195 Bacteria 544
198 Ga0097621_100214177 3300006237 Bacteria 1676
199 Ga0097621_100260183 3300006237 Bacteria 1522
200 Ga0075370_10505406 3300006353 Bacteria 730
201 Ga0068871_100193120 3300006358 Bacteria 1755
202 Ga0068871_100629521 3300006358 Bacteria 978
203 Ga0068871_101454728 3300006358 Bacteria 647
204 Ga0068871_101558322 3300006358 Bacteria 625
205 Ga0075430_100184487 3300006846 Bacteria 1735
206 Ga0075431_100603016 3300006847 Bacteria 1082
207 Ga0075431_100835533 3300006847 Bacteria 893
208 Ga0068865_100570590 3300006881 Bacteria 953
209 Ga0068865_102166632 3300006881 Bacteria 506
210 Ga0097620_100406494 3300006931 Bacteria 1457
211 Ga0097620_101271562 3300006931 Bacteria 811
212 Ga0097620_101966163 3300006931 Bacteria 646
213 Ga0105250_10286747 3300009092 Bacteria 709
214 Ga0105240_10481979 3300009093 Bacteria 1382
215 Ga0105240_10555535 3300009093 Bacteria 1270
216 Ga0105240_11335799 3300009093 Bacteria 755
217 Ga0111539_11053940 3300009094 Bacteria 945
218 Ga0105245_10488672 3300009098 Bacteria 1245
219 Ga0105245_10494405 3300009098 Bacteria 1238
220 Ga0105245_11469308 3300009098 Bacteria 732
221 Ga0105245_12090607 3300009098 Bacteria 620
222 Ga0105247_10231293 3300009101 Bacteria 1255
223 Ga0105247_10421471 3300009101 Bacteria 956
224 Ga0105243_10177275 3300009148 Bacteria 1851
225 Ga0105243_10647470 3300009148 Bacteria 1024
226 Ga0105241_10323652 3300009174 Bacteria 1330
227 Ga0105241_10341217 3300009174 Bacteria 1298
228 Ga0105241_10727974 3300009174 Bacteria 908
229 Ga0105242_10997988 3300009176 Bacteria 845
230 Ga0105248_10285455 3300009177 Bacteria 1858
231 Ga0105248_10542572 3300009177 Bacteria 1312
232 Ga0105248_10782734 3300009177 Bacteria 1077
233 Ga0105248_12705536 3300009177 Bacteria 566
234 Ga0105237_10390729 3300009545 Bacteria 1396
235 Ga0105237_10450655 3300009545 Bacteria 1293
236 Ga0105237_10638894 3300009545 Bacteria 1071
237 Ga0105238_10399833 3300009551 Bacteria 1367
238 Ga0105238_10544931 3300009551 Bacteria 1164
239 Ga0105238_10644147 3300009551 Bacteria 1069
240 Ga0105238_10732446 3300009551 Bacteria 1002
241 Ga0105238_10761353 3300009551 Bacteria 983
242 Ga0105238_11641054 3300009551 Bacteria 673
243 Ga0105238_12223935 3300009551 Bacteria 583
244 Ga0105148_105206 3300009978 Bacteria 936
245 Ga0105032_106458 3300009979 Bacteria 980
246 Ga0105030_119167 3300009987 Bacteria 617
247 Ga0105239_10554390 3300010375 Bacteria 1309
248 Ga0105239_10580810 3300010375 Bacteria 1277
249 Ga0105239_10624171 3300010375 Bacteria 1230
250 Ga0105239_11885432 3300010375 Bacteria 693
251 Ga0105246_10079678 3300011119 Bacteria 2329
252 Ga0105246_10349654 3300011119 Bacteria 1211
253 Ga0157373_10323875 3300013100 Bacteria 1097
254 Ga0157373_10333035 3300013100 Bacteria 1081
255 Ga0157373_10454326 3300013100 Bacteria 922
256 Ga0157370_10507119 3300013104 Bacteria 1108
257 Ga0157370_10572432 3300013104 Bacteria 1035
258 Ga0157370_11878592 3300013104 Bacteria 537
259 Ga0157369_10327048 3300013105 Bacteria 1593
260 Ga0157369_10545603 3300013105 Bacteria 1198
261 Ga0157369_10654289 3300013105 Bacteria 1083
262 Ga0157369_11320969 3300013105 Bacteria 735
263 Ga0157374_10643192 3300013296 Bacteria 1072
264 Ga0157374_10804421 3300013296 Bacteria 956
265 Ga0157374_11563807 3300013296 Bacteria 683
266 Ga0157378_10560851 3300013297 Bacteria 1149
267 Ga0157378_10614675 3300013297 Bacteria 1099
268 Ga0163162_10203458 3300013306 Bacteria 2109
269 Ga0163162_11409929 3300013306 Bacteria 793
270 Ga0163162_11754245 3300013306 Bacteria 709
271 Ga0157372_10531099 3300013307 Bacteria 1371
272 Ga0157372_10772222 3300013307 Bacteria 1117
273 Ga0157372_10852244 3300013307 Bacteria 1058
274 Ga0157372_10895346 3300013307 Bacteria 1030
275 Ga0157375_10611661 3300013308 Bacteria 1248
276 Ga0157375_10854618 3300013308 Bacteria 1056
277 Ga0157514_115907 3300013874 Bacteria 617
278 Ga0163163_10142840 3300014325 Bacteria 2436
279 Ga0163163_10422425 3300014325 Bacteria 1392
280 Ga0163163_10451732 3300014325 Bacteria 1345
281 Ga0163163_10522735 3300014325 Bacteria 1249
282 Ga0157380_10284865 3300014326 Bacteria 1514
283 Ga0157380_10574604 3300014326 Bacteria 1110
284 Ga0157377_10087688 3300014745 Bacteria 1831
285 Ga0157377_10303118 3300014745 Bacteria 1055
286 Ga0157379_10424305 3300014968 Bacteria 1225
287 Ga0157376_11539114 3300014969 Bacteria 698
288 Ga0182006_1175086 3300015261 Bacteria 717
289 Ga0182005_1065990 3300015265 Bacteria 991
290 Ga0163161_10291706 3300017792 Bacteria 1282
291 Ga0213872_10252535 3300021361 Bacteria 742
292 Ga0213871_10166607 3300021441 Bacteria 676
293 Ga0209563_115646 3300025230 Bacteria 948
294 Ga0207425_1021466 3300025245 Bacteria 1369
295 Ga0209026_1000929 3300025250 Bacteria 14890
296 Ga0209564_1033767 3300025295 Bacteria 1514
297 Ga0209758_1012894 3300025297 Bacteria 4622
298 Ga0209758_1097941 3300025297 Bacteria 841
299 Ga0209758_1172750 3300025297 Bacteria 527
300 Ga0209050_1038655 3300025298 Bacteria 1356
301 Ga0207426_1003111 3300025302 Bacteria 9467
302 Ga0209051_1088573 3300025303 Bacteria 868
303 Ga0209257_1000426 3300025304 Bacteria 81095
304 Ga0209257_1116310 3300025304 Bacteria 631
305 Ga0207697_10111574 3300025315 Bacteria 1171
306 Ga0207656_10188499 3300025321 Bacteria 992
307 Ga0207682_10395830 3300025893 Bacteria 653
308 Ga0207642_10349128 3300025899 Bacteria 872
309 Ga0207710_10225420 3300025900 Bacteria 932
310 Ga0207710_10270946 3300025900 Bacteria 853
311 Ga0207688_10063324 3300025901 Bacteria 2086
312 Ga0207688_10083083 3300025901 Bacteria 1831
313 Ga0207688_10111644 3300025901 Bacteria 1587
314 Ga0207680_10231079 3300025903 Bacteria 1271
315 Ga0207680_10507366 3300025903 Bacteria 859
316 Ga0207647_10057503 3300025904 Bacteria 2384
317 Ga0207699_10578992 3300025906 Bacteria 816
318 Ga0207645_10225773 3300025907 Bacteria 1235
319 Ga0207645_10354471 3300025907 Bacteria 982
320 Ga0207643_10017049 3300025908 Bacteria 3966
321 Ga0207643_10154522 3300025908 Bacteria 1377
322 Ga0207705_10421913 3300025909 Bacteria 1033
323 Ga0207705_11550767 3300025909 Bacteria 501
324 Ga0207654_10392866 3300025911 Bacteria 963
325 Ga0207654_10518498 3300025911 Bacteria 844
326 Ga0207707_10048166 3300025912 Bacteria 3712
327 Ga0207707_10267458 3300025912 Bacteria 1482
328 Ga0207707_10575246 3300025912 Bacteria 955
329 Ga0207707_11103875 3300025912 Bacteria 646
330 Ga0207695_10056250 3300025913 Bacteria 4095
331 Ga0207695_10617938 3300025913 Bacteria 965
332 Ga0207695_10724852 3300025913 Bacteria 875
333 Ga0207695_10731627 3300025913 Bacteria 870
334 Ga0207695_11031959 3300025913 Bacteria 702
335 Ga0207671_10565429 3300025914 Bacteria 907
336 Ga0207671_10602275 3300025914 Bacteria 876
337 Ga0207693_10329478 3300025915 Bacteria 1195
338 Ga0207663_10984192 3300025916 Bacteria 676
339 Ga0207660_10044091 3300025917 Bacteria 3137
340 Ga0207660_10172295 3300025917 Bacteria 1676
341 Ga0207660_10653422 3300025917 Bacteria 857
342 Ga0207662_10137687 3300025918 Bacteria 1544
343 Ga0207662_10168421 3300025918 Bacteria 1404
344 Ga0207657_10142602 3300025919 Bacteria 1957
345 Ga0207657_10661320 3300025919 Bacteria 813
346 Ga0207649_10423437 3300025920 Bacteria 1000
347 Ga0207649_10443679 3300025920 Bacteria 978
348 Ga0207649_10561668 3300025920 Bacteria 874
349 Ga0207652_10607725 3300025921 Bacteria 980
350 Ga0207652_10644510 3300025921 Bacteria 948
351 Ga0207652_10749367 3300025921 Bacteria 869
352 Ga0207681_10071503 3300025923 Bacteria 2420
353 Ga0207694_10030758 3300025924 Bacteria 4099
354 Ga0207694_10533387 3300025924 Bacteria 984
355 Ga0207694_10635046 3300025924 Bacteria 899
356 Ga0207694_10644353 3300025924 Bacteria 892
357 Ga0207694_11254366 3300025924 Bacteria 627
358 Ga0207694_11522182 3300025924 Bacteria 564
359 Ga0207650_10414003 3300025925 Bacteria 1117
360 Ga0207650_10534172 3300025925 Bacteria 982
361 Ga0207659_10556138 3300025926 Bacteria 976
362 Ga0207659_10695867 3300025926 Bacteria 870
363 Ga0207687_10379569 3300025927 Bacteria 1158
364 Ga0207687_10667150 3300025927 Bacteria 881
365 Ga0207700_10531982 3300025928 Bacteria 1042
366 Ga0207700_10846062 3300025928 Bacteria 819
367 Ga0207700_11917758 3300025928 Bacteria 519
368 Ga0207664_10254025 3300025929 Bacteria 1535
369 Ga0207664_10836821 3300025929 Bacteria 827
370 Ga0207644_10446959 3300025931 Bacteria 1061
371 Ga0207644_10674079 3300025931 Bacteria 861
372 Ga0207690_11322137 3300025932 Bacteria 602
373 Ga0207706_10081080 3300025933 Bacteria 2852
374 Ga0207706_10277931 3300025933 Bacteria 1461
375 Ga0207706_11637119 3300025933 Bacteria 520
376 Ga0207709_10423891 3300025935 Bacteria 1023
377 Ga0207709_10581472 3300025935 Bacteria 885
378 Ga0207709_10631515 3300025935 Bacteria 851
379 Ga0207669_10633528 3300025937 Bacteria 872
380 Ga0207669_11043363 3300025937 Bacteria 688
381 Ga0207704_10194873 3300025938 Bacteria 1477
382 Ga0207665_11062236 3300025939 Bacteria 645
383 Ga0207691_10157102 3300025940 Bacteria 1997
384 Ga0207711_10553289 3300025941 Bacteria 1073
385 Ga0207711_10928635 3300025941 Bacteria 809
386 Ga0207689_10172105 3300025942 Bacteria 1785
387 Ga0207689_10324761 3300025942 Bacteria 1277
388 Ga0207661_10829064 3300025944 Bacteria 851
389 Ga0207679_10542231 3300025945 Bacteria 1043
390 Ga0207679_10754387 3300025945 Bacteria 885
391 Ga0207667_10059464 3300025949 Bacteria 4002
392 Ga0207667_10299345 3300025949 Bacteria 1643
393 Ga0207667_10669482 3300025949 Bacteria 1042
394 Ga0207667_10763144 3300025949 Bacteria 966
395 Ga0207667_11027423 3300025949 Bacteria 810
396 Ga0207667_11146405 3300025949 Bacteria 759
397 Ga0207667_11962920 3300025949 Bacteria 546
398 Ga0207651_10321453 3300025960 Bacteria 1294
399 Ga0207651_10452754 3300025960 Bacteria 1101
400 Ga0207712_10673129 3300025961 Bacteria 901
401 Ga0207668_10587815 3300025972 Bacteria 969
402 Ga0207668_10696636 3300025972 Bacteria 892
403 Ga0207668_11032666 3300025972 Bacteria 735
404 Ga0207640_10546717 3300025981 Bacteria 972
405 Ga0207640_10686623 3300025981 Bacteria 876
406 Ga0207640_10713278 3300025981 Bacteria 861
407 Ga0207640_11193026 3300025981 Bacteria 676
408 Ga0207640_11315471 3300025981 Bacteria 645
409 Ga0207658_10787794 3300025986 Bacteria 862
410 Ga0207658_10866961 3300025986 Bacteria 821
411 Ga0207677_10366325 3300026023 Bacteria 1212
412 Ga0207677_10491535 3300026023 Bacteria 1059
413 Ga0207677_10535444 3300026023 Bacteria 1018
414 Ga0207677_10751577 3300026023 Bacteria 869
415 Ga0207703_10700409 3300026035 Bacteria 963
416 Ga0207639_10119140 3300026041 Bacteria 2166
417 Ga0207639_10329625 3300026041 Bacteria 1358
418 Ga0207639_10338680 3300026041 Bacteria 1340
419 Ga0207639_10591104 3300026041 Bacteria 1023
420 Ga0207639_12212685 3300026041 Bacteria 511
421 Ga0207678_10064404 3300026067 Bacteria 3149
422 Ga0207678_10477852 3300026067 Bacteria 1085
423 Ga0207678_10673701 3300026067 Bacteria 909
424 Ga0207708_10073316 3300026075 Bacteria 2623
425 Ga0207708_10359781 3300026075 Bacteria 1196
426 Ga0207702_10415360 3300026078 Bacteria 1300
427 Ga0207702_10517373 3300026078 Bacteria 1165
428 Ga0207702_11188733 3300026078 Bacteria 757
429 Ga0207641_10736975 3300026088 Bacteria 972
430 Ga0207641_10759465 3300026088 Bacteria 957
431 Ga0207648_10459914 3300026089 Bacteria 1160
432 Ga0207648_11551922 3300026089 Bacteria 622
433 Ga0207676_10101818 3300026095 Bacteria 2382
434 Ga0207676_10577196 3300026095 Bacteria 1077
435 Ga0207674_10415503 3300026116 Bacteria 1300
436 Ga0207674_10564473 3300026116 Bacteria 1099
437 Ga0207674_10874965 3300026116 Bacteria 866
438 Ga0207675_100139017 3300026118 Bacteria 2306
439 Ga0207683_10056877 3300026121 Bacteria 3432
440 Ga0207683_10524748 3300026121 Bacteria 1094
441 Ga0207683_10570334 3300026121 Bacteria 1047
442 Ga0207698_10081543 3300026142 Bacteria 2612
443 Ga0207698_10324123 3300026142 Bacteria 1444
444 Ga0207698_10738615 3300026142 Bacteria 982
445 Ga0207698_11484494 3300026142 Bacteria 693
446 Ga0209973_1012485 3300027252 Bacteria 1034
447 Ga0209981_1063851 3300027378 Bacteria 565
448 Ga0209999_1019065 3300027543 Bacteria 1257
449 Ga0209970_1014039 3300027614 Bacteria 1329
450 Ga0209983_1012207 3300027665 Bacteria 1763
451 Ga0209813_10091867 3300027866 Bacteria 1020
452 Ga0209974_10065853 3300027876 Bacteria 1231
453 Ga0207428_10689671 3300027907 Bacteria 731
454 Ga0268266_10074100 3300028379 Bacteria 2955
455 Ga0268266_10496752 3300028379 Bacteria 1164
456 Ga0268266_10805195 3300028379 Bacteria 907
457 Ga0268266_11001765 3300028379 Bacteria 808
458 Ga0268265_10746332 3300028380 Bacteria 949
459 Ga0268264_10910242 3300028381 Bacteria 883
460 Ga0268264_11142682 3300028381 Bacteria 788
461 Ga0268264_11324578 3300028381 Bacteria 730
462 Ga0265337_1022259 3300028556 Bacteria 1965
463 Ga0265337_1088736 3300028556 Bacteria 843
464 Ga0265326_10003186 3300028558 Bacteria 5422
465 Ga0265326_10043668 3300028558 Bacteria 1271
466 Ga0265319_1073152 3300028563 Bacteria 1096
467 Ga0265319_1114829 3300028563 Bacteria 840
468 Ga0265334_10002307 3300028573 Bacteria 8973
469 Ga0265334_10053923 3300028573 Bacteria 1534
470 Ga0265334_10258923 3300028573 Bacteria 598
471 Ga0265318_10010565 3300028577 Bacteria 4013
472 Ga0265318_10069146 3300028577 Bacteria 1309
473 Ga0265323_10002415 3300028653 Bacteria 8588
474 Ga0265323_10123166 3300028653 Bacteria 843
475 Ga0265322_10023709 3300028654 Bacteria 1754
476 Ga0265322_10054932 3300028654 Bacteria 1129
477 Ga0265336_10000852 3300028666 Bacteria 15879
478 Ga0265336_10215479 3300028666 Bacteria 570
479 Ga0307517_10042835 3300028786 Bacteria 4841
480 Ga0307517_10318791 3300028786 Bacteria 861
481 Ga0307515_10389334 3300028794 Bacteria 1023
482 Ga0265338_10152427 3300028800 Bacteria 1794
483 Ga0265338_10515392 3300028800 Bacteria 840
484 Ga0265338_10613910 3300028800 Bacteria 756
485 Ga0265324_10133588 3300029957 Bacteria 842
486 Ga0307512_10209011 3300030522 Bacteria 1041
487 Ga0265770_1017892 3300030878 Bacteria 1099
488 Ga0265760_10052774 3300031090 Bacteria 1226
489 Ga0265330_10036938 3300031235 Bacteria 2175
490 Ga0265330_10224578 3300031235 Bacteria 792
491 Ga0265330_10335104 3300031235 Bacteria 638
492 Ga0265332_10132354 3300031238 Bacteria 1046
493 Ga0265332_10186100 3300031238 Bacteria 864
494 Ga0265332_10193250 3300031238 Bacteria 847
495 Ga0265328_10082481 3300031239 Bacteria 1185
496 Ga0265328_10205697 3300031239 Bacteria 748
497 Ga0265320_10159304 3300031240 Bacteria 1017
498 Ga0265325_10003723 3300031241 Bacteria 9855
499 Ga0265325_10041687 3300031241 Bacteria 2404
500 Ga0265325_10108678 3300031241 Bacteria 1350
501 Ga0265325_10165052 3300031241 Bacteria 1039
502 Ga0265325_10217243 3300031241 Bacteria 876
503 Ga0265325_10304464 3300031241 Bacteria 711
504 Ga0265329_10022989 3300031242 Bacteria 2080
505 Ga0265340_10086003 3300031247 Bacteria 1475
506 Ga0265340_10208239 3300031247 Bacteria 878
507 Ga0265340_10235159 3300031247 Bacteria 818
508 Ga0265339_10249890 3300031249 Bacteria 858
509 Ga0265339_10261367 3300031249 Bacteria 835
510 Ga0265331_10146059 3300031250 Bacteria 1074
511 Ga0265331_10188999 3300031250 Bacteria 929
512 Ga0265316_10047567 3300031344 Bacteria 3392
513 Ga0265316_10446708 3300031344 Bacteria 927
514 Ga0265316_10886448 3300031344 Bacteria 623
515 Ga0265316_10947646 3300031344 Bacteria 600
516 Ga0307513_10669467 3300031456 Bacteria 744
517 Ga0307408_100291388 3300031548 Bacteria 1363
518 Ga0307408_100611846 3300031548 Bacteria 969
519 Ga0265313_10037961 3300031595 Bacteria 2403
520 Ga0265313_10138479 3300031595 Bacteria 1048
521 Ga0265313_10340569 3300031595 Bacteria 596
522 Ga0265313_10357155 3300031595 Bacteria 578
523 Ga0307508_10329176 3300031616 Bacteria 1119
524 Ga0307508_10509513 3300031616 Bacteria 799
525 Ga0316575_10098612 3300031665 Bacteria 1186
526 Ga0316575_10398984 3300031665 Bacteria 590
527 Ga0316575_10545551 3300031665 Bacteria 505
528 Ga0265314_10015943 3300031711 Bacteria 5950
529 Ga0265314_10131100 3300031711 Bacteria 1564
530 Ga0265314_10159717 3300031711 Bacteria 1373
531 Ga0265314_10288027 3300031711 Bacteria 926
532 Ga0265342_10242015 3300031712 Bacteria 965
533 Ga0265342_10255412 3300031712 Bacteria 934
534 Ga0265342_10307782 3300031712 Bacteria 833
535 Ga0265342_10353889 3300031712 Bacteria 764
536 Ga0307516_10595146 3300031730 Bacteria 760
537 Ga0307405_10266152 3300031731 Bacteria 1283
538 Ga0307413_10705541 3300031824 Bacteria 838
539 Ga0307410_11020902 3300031852 Bacteria 714
540 Ga0307407_10867353 3300031903 Bacteria 691
541 Ga0307412_11634943 3300031911 Bacteria 589
542 Ga0307414_10012988 3300032004 Bacteria 4945
543 Ga0307414_10292994 3300032004 Bacteria 1373
544 Ga0307414_10371467 3300032004 Bacteria 1233
545 Ga0307411_10141647 3300032005 Bacteria 1774
546 Ga0307411_10596703 3300032005 Bacteria 949
547 Ga0316583_10357437 3300032133 Bacteria 505
548 Ga0307507_10236074 3300033179 Bacteria 1204
549 Ga0307510_10345865 3300033180 Bacteria 938
550 Ga0373959_0009135 3300034820 Bacteria 1703
551 Ga0373926_0230741 3300035083 Bacteria 715
552 Ga0373928_0039737 3300035084 Bacteria 1076
553 Ga0373934_0017660 3300035086 Bacteria 2726
554 Ga0373934_0188459 3300035086 Bacteria 848
555 Ga0373940_0374681 3300035088 Bacteria 504
556 Ga0373949_0138218 3300035090 Bacteria 696
557 Ga0373951_0075362 3300035091 Bacteria 865
558 Ga0373951_0293390 3300035091 Bacteria 500
559 Ga0373923_0400059 3300035111 Bacteria 661
560 Ga0373936_0078655 3300035113 Bacteria 1370
561 Ga0373936_0230379 3300035113 Bacteria 824
562 Ga0373936_0314190 3300035113 Bacteria 709
563 Ga0373939_0069245 3300035114 Bacteria 1144
564 Ga0373939_0132719 3300035114 Bacteria 890
565 Ga0373939_0506826 3300035114 Bacteria 516
566 Ga0373941_0144526 3300035115 Bacteria 867
567 Ga0373954_0412309 3300035118 Bacteria 668
568 Ga0373960_0105853 3300035121 Bacteria 917
569 Ga0373955_0355727 3300035172 Bacteria 887
570 Ga0373961_0076877 3300035241 Bacteria 1043
571 Ga0373931_0842681 3300035691 Bacteria 613
572 Ga0373927_0136652 3300035695 Bacteria 1602
573 Ga0373933_0051436 3300035724 Bacteria 2462
574 Ga0373947_0855054 3300035725 Bacteria 621
575 Ga0373937_0130917 3300036401 Bacteria 2343
576 Ga0373937_0381181 3300036401 Bacteria 1337
577 Ga0373937_0493097 3300036401 Bacteria 1164
578 Ga0373937_1009634 3300036401 Bacteria 781
579 Ga0373937_1401659 3300036401 Bacteria 647
580 Ga0316582_0328083 3300036647 Bacteria 1052
581 Ga0373925_0999497 3300037068 Bacteria 689
582 Ga0395899_0322855 3300037312 Bacteria 1039
583 Ga0395900_0245967 3300037418 Bacteria 1792
584 Ga0395900_0620675 3300037418 Bacteria 1020
585 Ga0395900_0656791 3300037418 Bacteria 985
586 Ga0395900_0657147 3300037418 Bacteria 984
587 Ga0395898_0248258 3300037466 Bacteria 1697
588 Ga0395898_0348744 3300037466 Bacteria 1412
589 Ga0395898_1863366 3300037466 Bacteria 522
590 Ga0395905_0133032 3300037471 Bacteria 2339
591 Ga0395905_0524875 3300037471 Bacteria 1084
592 Ga0395905_0640783 3300037471 Bacteria 964
593 Ga0395905_0689878 3300037471 Bacteria 923
594 Ga0395901_0541277 3300038443 Bacteria 1181
595 Ga0395901_0600767 3300038443 Bacteria 1109
596 Ga0395901_0636819 3300038443 Bacteria 1071
597 Ga0395901_1611061 3300038443 Bacteria 602
598 Ga0395901_1952262 3300038443 Bacteria 534
599 Ga0436365_0402399 3300039437 Bacteria 1062
600 Ga0436360_0681037 3300039438 Bacteria 3803
601 Ga0436360_1184291 3300039438 Bacteria 1136
602 Ga0436360_1240939 3300039438 Bacteria 1328
603 Ga0436360_1255461 3300039438 Bacteria 1142
604 Ga0436361_0335125 3300039447 Bacteria 1285
605 Ga0436361_0692057 3300039447 Bacteria 1203
606 Ga0436361_0953792 3300039447 Bacteria 935
607 Ga0436363_0346786 3300039450 Bacteria 516
608 Ga0451800_0380214 3300041459 Bacteria 614
609 Ga0451802_0559195 3300041460 Bacteria 598
610 Ga0451807_1505350 3300041486 Bacteria 1228
611 Ga0450914_007222 3300042118 Bacteria 997
612 Ga0450890_011347 3300042127 Bacteria 1150
613 Ga0450900_023954 3300042136 Bacteria 864
614 Ga0439444_0099621 3300042437 Bacteria 657
615 Ga0439464_0163161 3300042439 Bacteria 700
616 Ga0439440_0287415 3300042993 Bacteria 509
617 Ga0453684_0007285 3300044712 Bacteria 20473
618 Ga0466971_0206352 3300044719 Bacteria 929
619 Ga0466968_0164626 3300044735 Bacteria 1025
620 Ga0466968_0686523 3300044735 Bacteria 522
621 Ga0466967_0921622 3300045976 Bacteria 869
622 Ga0495592_0533213 3300046454 Bacteria 724
623 Ga0495592_0665596 3300046454 Bacteria 629
624 Ga0495603_0114179 3300046455 Bacteria 1575
625 Ga0495629_0291690 3300046459 Bacteria 1118
626 Ga0495651_0387271 3300046462 Bacteria 915
627 Ga0495580_0482533 3300046472 Bacteria 829
628 Ga0495605_0196983 3300046474 Bacteria 879
629 Ga0495639_0183171 3300046475 Bacteria 1020
630 Ga0495664_0134897 3300046477 Bacteria 1495
631 Ga0495594_0330332 3300046499 Bacteria 868
632 Ga0495596_0064569 3300046500 Bacteria 1424
633 Ga0495583_0194876 3300046506 Bacteria 825
634 Ga0495608_0385790 3300046511 Bacteria 858
635 Ga0495630_0481672 3300046517 Bacteria 951
636 Ga0495648_0267503 3300046524 Bacteria 817
637 Ga0495652_0097414 3300046529 Bacteria 2393
638 Ga0495640_0209787 3300046533 Bacteria 1232
639 Ga0495587_0443234 3300046536 Bacteria 720
640 Ga0495645_0654067 3300046543 Bacteria 642
641 Ga0495622_0001917 3300046557 Bacteria 10219
642 Ga0495667_0162559 3300046559 Bacteria 1436
643 Ga0495668_0304053 3300046616 Bacteria 874
644 Ga0495634_0231300 3300046642 Bacteria 1137
645 Ga0495625_0243983 3300046660 Bacteria 1168
646 Ga0495625_0277451 3300046660 Bacteria 1079
647 Ga0495635_0309546 3300046663 Bacteria 1058
648 Ga0495599_0286277 3300046678 Bacteria 997
649 Ga0495599_0554699 3300046678 Bacteria 672
650 Ga0495646_0228424 3300046680 Bacteria 1004
651 Ga0495646_0357086 3300046680 Bacteria 765
652 Ga0495658_0091312 3300046683 Bacteria 1803
653 Ga0495624_0052836 3300046690 Bacteria 2566
654 Ga0495671_0157723 3300046692 Bacteria 1104
655 Ga0495600_0105468 3300046809 Bacteria 1836
656 Ga0495581_0248054 3300047315 Bacteria 1041
657 Ga0495581_0570128 3300047315 Bacteria 656
658 Ga0495604_0288263 3300047317 Bacteria 1106
659 Ga0495604_0702069 3300047317 Bacteria 642
660 Ga0495674_0226433 3300047319 Bacteria 1544
661 Ga0495674_1199652 3300047319 Bacteria 574
662 Ga0495672_0039474 3300047320 Bacteria 2870
663 Ga0495672_0090158 3300047320 Bacteria 1686
664 Ga0495672_0209562 3300047320 Bacteria 969
665 Ga0495672_0477487 3300047320 Bacteria 558
666 Ga0495676_0081803 3300047321 Bacteria 2446
667 Ga0495675_0296363 3300047444 Bacteria 961
668 Ga0495593_0208950 3300047673 Bacteria 980
669 Ga0495602_0284591 3300048088 Bacteria 1216
670 Ga0495602_0385505 3300048088 Bacteria 1003
671 Ga0496100_0572191 3300048903 Bacteria 875
672 Ga0496100_1461854 3300048903 Bacteria 540
673 Ga0496101_0550944 3300048904 Bacteria 912
674 Ga0496101_1063323 3300048904 Bacteria 636
675 Ga0496102_0430116 3300048905 Bacteria 1239
676 Ga0496102_1106165 3300048905 Bacteria 712
677 Ga0496102_1447434 3300048905 Bacteria 606
678 Ga0496103_0244273 3300048906 Bacteria 1155
679 Ga0496104_0160988 3300048907 Bacteria 2153
680 Ga0496105_0114387 3300048908 Bacteria 2226
681 Ga0496106_0252486 3300048909 Bacteria 1410
682 Ga0496107_0523406 3300048910 Bacteria 879
683 Ga0496108_0244926 3300048911 Bacteria 1559
684 Ga0496109_0532467 3300048912 Bacteria 1108
685 Ga0496109_0873127 3300048912 Bacteria 837
686 Ga0496110_0544880 3300048913 Bacteria 1054
687 Ga0496111_0291803 3300048914 Bacteria 1209
688 Ga0496111_0346414 3300048914 Bacteria 1100
689 Ga0496112_0089025 3300048915 Bacteria 3054
690 Ga0496112_0402004 3300048915 Bacteria 1309
691 Ga0496112_1040414 3300048915 Bacteria 738
692 Ga0496113_0349885 3300048916 Bacteria 1185
693 Ga0496114_0376190 3300048917 Bacteria 1257
694 Ga0496115_0328849 3300048918 Bacteria 1249
695 Ga0496115_0550440 3300048918 Bacteria 922
696 Ga0496115_0569501 3300048918 Bacteria 903
697 Ga0496124_0397276 3300048927 Bacteria 958
698 Ga0496125_0001114 3300048928 Bacteria 41120
699 Ga0496125_0281439 3300048928 Bacteria 1030
700 Ga0496126_0086758 3300048929 Bacteria 2758
701 Ga0496126_0148345 3300048929 Bacteria 2012
702 Ga0496126_0785618 3300048929 Bacteria 732
703 Ga0501291_110941 3300049514 Bacteria 584
704 Ga0501031_0334553 3300049568 Bacteria 980
705 Ga0501031_0478782 3300049568 Bacteria 803
706 Ga0501031_0613838 3300049568 Bacteria 699
707 Ga0501031_1005033 3300049568 Bacteria 533
708 Ga0501032_0026483 3300049569 Bacteria 3988
709 Ga0501032_0066015 3300049569 Bacteria 2419
710 Ga0501032_0137193 3300049569 Bacteria 1612
711 Ga0501032_0219859 3300049569 Bacteria 1236
712 Ga0501032_0376005 3300049569 Bacteria 914
713 Ga0501032_0480681 3300049569 Bacteria 794
714 Ga0501033_0010404 3300049570 Bacteria 7134
715 Ga0501033_0032643 3300049570 Bacteria 3910
716 Ga0501033_0078698 3300049570 Bacteria 2419
717 Ga0501033_0145261 3300049570 Bacteria 1713
718 Ga0501033_0469549 3300049570 Bacteria 872
719 Ga0501033_0844373 3300049570 Bacteria 617
720 Ga0501034_0096853 3300049571 Bacteria 2946
721 Ga0501034_0177026 3300049571 Bacteria 2099
722 Ga0501034_0326959 3300049571 Bacteria 1465
723 Ga0501034_0375408 3300049571 Bacteria 1347
724 Ga0501034_0442542 3300049571 Bacteria 1218
725 Ga0501034_0529542 3300049571 Bacteria 1089
726 Ga0501034_0614576 3300049571 Bacteria 991
727 Ga0501034_0667008 3300049571 Bacteria 940
728 Ga0501034_0735907 3300049571 Bacteria 882
729 Ga0501034_1211443 3300049571 Bacteria 633
730 Ga0501036_0158568 3300049572 Bacteria 1908
731 Ga0501036_0161610 3300049572 Bacteria 1888
732 Ga0501036_0206253 3300049572 Bacteria 1652
733 Ga0501036_0372769 3300049572 Bacteria 1191
734 Ga0501036_0483611 3300049572 Bacteria 1030
735 Ga0501036_0507554 3300049572 Bacteria 1003
736 Ga0501036_0617636 3300049572 Bacteria 898
737 Ga0501037_0094318 3300049573 Bacteria 2164
738 Ga0501037_0353408 3300049573 Bacteria 1013
739 Ga0501037_0497225 3300049573 Bacteria 827
740 Ga0501037_0985524 3300049573 Bacteria 549
741 Ga0501037_1063785 3300049573 Bacteria 525
742 Ga0501038_0072965 3300049574 Bacteria 2907
743 Ga0501038_0151598 3300049574 Bacteria 1889
744 Ga0501038_0204164 3300049574 Bacteria 1584
745 Ga0501038_0444588 3300049574 Bacteria 997
746 Ga0501038_0528366 3300049574 Bacteria 899
747 Ga0501038_0570921 3300049574 Bacteria 858
748 Ga0501038_0574213 3300049574 Bacteria 856
749 Ga0501038_0591327 3300049574 Bacteria 840
750 Ga0501038_0721026 3300049574 Bacteria 746
751 Ga0501038_1243125 3300049574 Bacteria 539
752 Ga0501039_0240168 3300049575 Bacteria 1424
753 Ga0501039_0325340 3300049575 Bacteria 1208
754 Ga0501039_0405578 3300049575 Bacteria 1070
755 Ga0501039_0406993 3300049575 Bacteria 1068
756 Ga0501039_0955263 3300049575 Bacteria 666
757 Ga0501040_0356070 3300049576 Bacteria 1049
758 Ga0501040_0693810 3300049576 Bacteria 736
759 Ga0501040_1012424 3300049576 Bacteria 602
760 Ga0501042_0506637 3300049578 Bacteria 876
761 Ga0501043_0093552 3300049579 Bacteria 2363
762 Ga0501043_0102181 3300049579 Bacteria 2253
763 Ga0501043_0298956 3300049579 Bacteria 1230
764 Ga0501043_0332129 3300049579 Bacteria 1157
765 Ga0501043_0374101 3300049579 Bacteria 1079
766 Ga0501043_0403731 3300049579 Bacteria 1032
767 Ga0501043_0472843 3300049579 Bacteria 939
768 Ga0501043_0757312 3300049579 Bacteria 705
769 Ga0501043_0842242 3300049579 Bacteria 661
770 Ga0501046_0064803 3300049580 Bacteria 2851
771 Ga0501046_0087760 3300049580 Bacteria 2396
772 Ga0501046_0240756 3300049580 Bacteria 1334
773 Ga0501046_0376958 3300049580 Bacteria 1027
774 Ga0501046_0478578 3300049580 Bacteria 893
775 Ga0501047_0085978 3300049581 Bacteria 3021
776 Ga0501047_0238406 3300049581 Bacteria 1670
777 Ga0501047_0272525 3300049581 Bacteria 1538
778 Ga0501047_0406771 3300049581 Bacteria 1193
779 Ga0501047_0496354 3300049581 Bacteria 1047
780 Ga0501047_0689243 3300049581 Bacteria 839
781 Ga0501047_0776266 3300049581 Bacteria 773
782 Ga0501048_0100230 3300049582 Bacteria 2043
783 Ga0501048_0266135 3300049582 Bacteria 1218
784 Ga0501048_0282909 3300049582 Bacteria 1179
785 Ga0501048_0405054 3300049582 Bacteria 975
786 Ga0501048_0676757 3300049582 Bacteria 741
787 Ga0501067_0024840 3300049583 Bacteria 3323
788 Ga0501067_0276962 3300049583 Bacteria 934
789 Ga0501067_0411316 3300049583 Bacteria 755
790 Ga0501067_0824915 3300049583 Bacteria 522
791 Ga0501068_0134513 3300049584 Bacteria 1547
792 Ga0501068_0190253 3300049584 Bacteria 1299
793 Ga0501068_0632941 3300049584 Bacteria 698
794 Ga0501069_0107977 3300049585 Bacteria 1583
795 Ga0501069_0243362 3300049585 Bacteria 1048
796 Ga0501069_0289995 3300049585 Bacteria 958
797 Ga0501069_0295968 3300049585 Bacteria 948
798 Ga0501070_0376971 3300049586 Bacteria 1149
799 Ga0501070_0423196 3300049586 Bacteria 1075
800 Ga0501070_0587742 3300049586 Bacteria 888
801 Ga0501070_0927024 3300049586 Bacteria 678
802 Ga0501070_1496209 3300049586 Bacteria 511
803 Ga0501073_0306083 3300049589 Bacteria 1096
804 Ga0501073_0419056 3300049589 Bacteria 925
805 Ga0501074_0193347 3300049590 Bacteria 1450
806 Ga0501074_0214616 3300049590 Bacteria 1370
807 Ga0501074_0512735 3300049590 Bacteria 849
808 Ga0501074_1011015 3300049590 Bacteria 584
809 Ga0501076_0341442 3300049592 Bacteria 1229
810 Ga0501076_0701576 3300049592 Bacteria 835
811 Ga0501076_1700686 3300049592 Bacteria 517
812 Ga0501198_052190 3300049649 Bacteria 731
813 Ga0501079_0342064 3300049741 Bacteria 1172
814 Ga0501079_0487848 3300049741 Bacteria 968
815 Ga0501079_0949825 3300049741 Bacteria 677
816 Ga0501079_0970171 3300049741 Bacteria 669
817 Ga0501080_0184552 3300049742 Bacteria 1918
818 Ga0501080_0686343 3300049742 Bacteria 904
819 Ga0501080_0688513 3300049742 Bacteria 902
820 Ga0501080_0850737 3300049742 Bacteria 797
821 Ga0501080_0922044 3300049742 Bacteria 760
822 Ga0501081_1229977 3300049743 Bacteria 568
823 Ga0501083_0137250 3300049744 Bacteria 1602
824 Ga0501083_0283954 3300049744 Bacteria 1076
825 Ga0501083_0391071 3300049744 Bacteria 904
826 Ga0501083_0408415 3300049744 Bacteria 883
827 Ga0501035_0162356 3300049822 Bacteria 1933
828 Ga0501035_0248992 3300049822 Bacteria 1509
829 Ga0501035_0353837 3300049822 Bacteria 1228
830 Ga0501035_0387693 3300049822 Bacteria 1164
831 Ga0501035_0441574 3300049822 Bacteria 1077
832 Ga0501035_1145999 3300049822 Bacteria 605
833 Ga0501035_1368388 3300049822 Bacteria 543
834 Ga0501044_0019252 3300049823 Bacteria 7307
835 Ga0501044_0038066 3300049823 Bacteria 5023
836 Ga0501044_0164626 3300049823 Bacteria 2192
837 Ga0501044_0220811 3300049823 Bacteria 1846
838 Ga0501044_0232905 3300049823 Bacteria 1788
839 Ga0501044_0296202 3300049823 Bacteria 1548
840 Ga0501044_0332558 3300049823 Bacteria 1441
841 Ga0501044_0379553 3300049823 Bacteria 1328
842 Ga0501044_0475297 3300049823 Bacteria 1153
843 Ga0501044_0649229 3300049823 Bacteria 944
844 Ga0501044_1031517 3300049823 Bacteria 693
845 Ga0501044_1276912 3300049823 Bacteria 601
846 Ga0501045_0467428 3300049824 Bacteria 937
847 Ga0501045_0561737 3300049824 Bacteria 846
848 nmdc:mga03683_340426_c1 3300050489 Bacteria 709
849 nmdc:mga03683_43238_c1 3300050489 Bacteria 1291
850 nmdc:mga03n38_602691_c1 3300050490 Bacteria 626
851 nmdc:mga00v17_879759_c1 3300050491 Bacteria 568
852 nmdc:mga0yw44_195074_c1 3300050492 Bacteria 1336
853 nmdc:mga0k408_322752_c1 3300050493 Bacteria 921
854 nmdc:mga0k408_571908_c1 3300050493 Bacteria 667
855 nmdc:mga06z11_281853_c1 3300050494 Bacteria 985
856 nmdc:mga06z11_963435_c1 3300050494 Bacteria 520
857 nmdc:mga04h51_44561_c1 3300050495 Bacteria 1463
858 nmdc:mga07m45_778978_c1 3300050496 Bacteria 549
859 nmdc:mga09592_318080_c1 3300050508 Bacteria 1348
860 nmdc:mga0qj67_613336_c1 3300050509 Bacteria 870
861 nmdc:mga0n895_2005690_c1 3300050512 Bacteria 536
862 nmdc:mga0sz30_251399_c1 3300050516 Bacteria 787
863 Ga0495612_0089544 3300053078 Bacteria 1301
864 Ga0495612_0216955 3300053078 Bacteria 846
865 Ga0495612_0295916 3300053078 Bacteria 725
866 Ga0495595_0171996 3300053084 Bacteria 1072
867 Ga0495619_0301939 3300053085 Bacteria 1109
868 Ga0495619_0525870 3300053085 Bacteria 812
869 Ga0500643_068814 3300053087 Bacteria 984
870 Ga0500651_0235579 3300053093 Bacteria 1069
871 Ga0500651_0340045 3300053093 Bacteria 853
872 Ga0500566_0120972 3300053094 Bacteria 1411
873 Ga0500641_0043397 3300053096 Bacteria 1825
874 Ga0500554_049703 3300053102 Bacteria 1316
875 Ga0500594_0127742 3300053118 Bacteria 803
876 Ga0500595_004337 3300053119 Bacteria 6385
877 Ga0500595_132400 3300053119 Bacteria 701
878 Ga0500597_111832 3300053120 Bacteria 1186
879 Ga0500607_071295 3300053121 Bacteria 1794
880 Ga0500614_011709 3300053123 Bacteria 1904
881 Ga0500614_133126 3300053123 Bacteria 739
882 Ga0500655_031644 3300053133 Bacteria 1020
883 Ga0500636_0204115 3300053177 Bacteria 1043
884 Ga0500637_0282893 3300053178 Bacteria 912
885 Ga0500576_085277 3300053725 Bacteria 1324
886 Ga0500552_029050 3300053733 Bacteria 840
887 Ga0500587_009449 3300053739 Bacteria 1244
888 Ga0501084_0200001 3300054114 Bacteria 1686
889 Ga0501084_0551897 3300054114 Bacteria 973
890 Ga0501084_0843727 3300054114 Bacteria 771
891 Ga0501084_0865901 3300054114 Bacteria 760
892 Ga0501084_1000046 3300054114 Bacteria 703
893 Ga0501082_0310821 3300060353 Bacteria 1372
894 Ga0501082_0356393 3300060353 Bacteria 1276
895 Ga0501082_0443925 3300060353 Bacteria 1133
896 Ga0501082_0475965 3300060353 Bacteria 1091
897 Ga0501082_1073220 3300060353 Bacteria 704
898 Ga0501047_0623571
899 CNXas_1005060
900 JGI24752J21851_1059595
901 JGI24746J21847_1051016
902 JGI24743J22301_10046276
903 JGI24750J21931_1023029
904 JGI24745J21846_1024783
905 JGI24748J21848_1017376
906 JGI24749J21850_1023847
907 JGI24033J26618_1017357
908 JGI24033J26618_1059427
909 JGI24034J26672_10028374
910 JGI24742J22300_10038747
911 JGI25153J46596_10045490
912 JGI25153J46596_10065455
913 JGI25160J50197_1000699
914 JGI26143J51219_1001643
915 Ga0055526_1026391
916 Ga0055526_1040729
917 Ga0055540_1047742
918 Ga0055531_10002518
919 Ga0065165_1004302
920 Ga0065165_1005501
921 Ga0065712_10244630
922 Ga0070658_10432172
923 Ga0070658_10534816
924 Ga0070676_10307453
925 Ga0070676_10411748
926 Ga0070683_100827448
927 Ga0070690_101648284
928 Ga0070670_100476607
929 Ga0070670_100493853
930 Ga0068869_100252547
931 Ga0068869_100351382
932 Ga0068869_101077658
933 Ga0070666_10270158
934 Ga0070666_10462690
935 Ga0070680_100497796
936 Ga0070682_100525163
937 Ga0070682_101290518
938 Ga0068868_100274983
939 Ga0068868_100344091
940 Ga0068868_100482002
941 Ga0068868_100650573
942 Ga0068868_101143515
943 Ga0070660_100509243
944 Ga0070660_101415597
945 Ga0070689_100668862
946 Ga0070691_10252694
947 Ga0070687_100010730
948 Ga0070687_100067604
949 Ga0070661_100085832
950 Ga0070661_100417865
951 Ga0070661_101489906
952 Ga0070668_100256035
953 Ga0070668_101868691
954 Ga0070669_100488441
955 Ga0070669_101553736
956 Ga0070675_100316731
957 Ga0070675_100429750
958 Ga0070671_100501803
959 Ga0070671_100585378
960 Ga0070671_101067456
961 Ga0070674_100452024
962 Ga0070674_100512451
963 Ga0070674_101968677
964 Ga0070688_100392236
965 Ga0070688_100435785
966 Ga0070659_100288928
967 Ga0070667_100482921
968 Ga0070667_100602120
969 Ga0070667_100922863
970 Ga0070714_100229494
971 Ga0070714_100797310
972 Ga0070713_101720379
973 Ga0070713_102034967
974 Ga0070713_102165676
975 Ga0070701_10022111
976 Ga0070701_10482958
977 Ga0070711_100359789
978 Ga0070711_100947059
979 Ga0070705_100751382
980 Ga0070700_100056481
981 Ga0070694_100678726
982 Ga0070663_100073411
983 Ga0070663_100083699
984 Ga0070663_100421634
985 Ga0070678_100289670
986 Ga0070678_100555684
987 Ga0070678_100891787
988 Ga0070678_100997640
989 Ga0070662_100270575
990 Ga0070662_100288196
991 Ga0070681_10143547
992 Ga0070681_10346019
993 Ga0070681_11573628
994 Ga0068867_100199881
995 Ga0068867_100376408
996 Ga0070685_10331526
997 Ga0070685_11074578
998 Ga0070685_11151469
999 Ga0070685_11629093
1000 Ga0070706_101870915
1001 Ga0070698_101238521
1002 Ga0070679_100596364
1003 Ga0070679_100722881
1004 Ga0070679_100872001
1005 Ga0070684_100086448
1006 Ga0070684_100883074
1007 Ga0070684_101480132
1008 Ga0068853_100120836
1009 Ga0068853_100279212
1010 Ga0068853_100793236
1011 Ga0068853_100794236
1012 Ga0068853_102001732
1013 Ga0070672_100289074
1014 Ga0070686_100322112
1015 Ga0070686_100398684
1016 Ga0070696_100546984
1017 Ga0070693_100642050
1018 Ga0070665_100069007
1019 Ga0070665_100199327
1020 Ga0070665_100569207
1021 Ga0070665_101197213
1022 Ga0070665_101767965
1023 Ga0070665_101970454
1024 Ga0070704_100755069
1025 Ga0068855_100135468
1026 Ga0068855_100210201
1027 Ga0068855_100353028
1028 Ga0068855_100484219
1029 Ga0068855_100663006
1030 Ga0068855_100739458
1031 Ga0068855_101080044
1032 Ga0070664_100214203
1033 Ga0070664_100577107
1034 Ga0068857_100660870
1035 Ga0068857_101438979
1036 Ga0068854_100175847
1037 Ga0068854_100233983
1038 Ga0068854_100555018
1039 Ga0068854_101025747
1040 Ga0068854_101081466
1041 Ga0068854_101152596
1042 Ga0068856_100000883
1043 Ga0068856_100591343
1044 Ga0068856_101007490
1045 Ga0068856_101142912
1046 Ga0070702_100532548
1047 Ga0068852_100386648
1048 Ga0068852_100464229
1049 Ga0068852_100482103
1050 Ga0068852_100600255
1051 Ga0068852_101028718
1052 Ga0068859_100406469
1053 Ga0068859_101966145
1054 Ga0068864_100384048
1055 Ga0068866_10156543
1056 Ga0068866_10629158
1057 Ga0068861_100280890
1058 Ga0068861_100730743
1059 Ga0068851_10186216
1060 Ga0068870_10159400
1061 Ga0068870_10184245
1062 Ga0068863_101288245
1063 Ga0068858_100361704
1064 Ga0068858_100633463
1065 Ga0068860_100238206
1066 Ga0068860_100439152
1067 Ga0068860_100486031
1068 Ga0068860_102323376
1069 Ga0068862_100704357
1070 Ga0081455_10099141
1071 Ga0081540_1194970
1072 Ga0081540_1294799
1073 Ga0070717_10897891
1074 Ga0075365_10414400
1075 Ga0075365_10520451
1076 Ga0075365_10794774
1077 Ga0075368_10094474
1078 Ga0075363_100305607
1079 Ga0075363_100418564
1080 Ga0075364_10696642
1081 Ga0075364_11073411
1082 Ga0075432_10535480
1083 Ga0070716_101179063
1084 Ga0070712_100301785
1085 Ga0075362_10089575
1086 Ga0075362_10192580
1087 Ga0075367_10318077
1088 Ga0075367_10545878
1089 Ga0075369_10110420
1090 Ga0075369_10303418
1091 Ga0075366_10284514
1092 Ga0075366_10347126
1093 Ga0075366_10362873
1094 Ga0075366_10924521
1095 Ga0097621_100214177
1096 Ga0097621_100260183
1097 Ga0075370_10505406
1098 Ga0068871_100193120
1099 Ga0068871_100629521
1100 Ga0068871_101454728
1101 Ga0068871_101558322
1102 Ga0075430_100184487
1103 Ga0075431_100603016
1104 Ga0075431_100835533
1105 Ga0068865_100570590
1106 Ga0068865_102166632
1107 Ga0097620_100406494
1108 Ga0097620_101271562
1109 Ga0097620_101966163
1110 Ga0105250_10286747
1111 Ga0105240_10481979
1112 Ga0105240_10555535
1113 Ga0105240_11335799
1114 Ga0111539_11053940
1115 Ga0105245_10488672
1116 Ga0105245_10494405
1117 Ga0105245_11469308
1118 Ga0105245_12090607
1119 Ga0105247_10231293
1120 Ga0105247_10421471
1121 Ga0105243_10177275
1122 Ga0105243_10647470
1123 Ga0105241_10323652
1124 Ga0105241_10341217
1125 Ga0105241_10727974
1126 Ga0105242_10997988
1127 Ga0105248_10285455
1128 Ga0105248_10542572
1129 Ga0105248_10782734
1130 Ga0105248_12705536
1131 Ga0105237_10390729
1132 Ga0105237_10450655
1133 Ga0105237_10638894
1134 Ga0105238_10399833
1135 Ga0105238_10544931
1136 Ga0105238_10644147
1137 Ga0105238_10732446
1138 Ga0105238_10761353
1139 Ga0105238_11641054
1140 Ga0105238_12223935
1141 Ga0105148_105206
1142 Ga0105032_106458
1143 Ga0105030_119167
1144 Ga0105239_10554390
1145 Ga0105239_10580810
1146 Ga0105239_10624171
1147 Ga0105239_11885432
1148 Ga0105246_10079678
1149 Ga0105246_10349654
1150 Ga0157373_10323875
1151 Ga0157373_10333035
1152 Ga0157373_10454326
1153 Ga0157370_10507119
1154 Ga0157370_10572432
1155 Ga0157370_11878592
1156 Ga0157369_10327048
1157 Ga0157369_10545603
1158 Ga0157369_10654289
1159 Ga0157369_11320969
1160 Ga0157374_10643192
1161 Ga0157374_10804421
1162 Ga0157374_11563807
1163 Ga0157378_10560851
1164 Ga0157378_10614675
1165 Ga0163162_10203458
1166 Ga0163162_11409929
1167 Ga0163162_11754245
1168 Ga0157372_10531099
1169 Ga0157372_10772222
1170 Ga0157372_10852244
1171 Ga0157372_10895346
1172 Ga0157375_10611661
1173 Ga0157375_10854618
1174 Ga0157514_115907
1175 Ga0163163_10142840
1176 Ga0163163_10422425
1177 Ga0163163_10451732
1178 Ga0163163_10522735
1179 Ga0157380_10284865
1180 Ga0157380_10574604
1181 Ga0157377_10087688
1182 Ga0157377_10303118
1183 Ga0157379_10424305
1184 Ga0157376_11539114
1185 Ga0182006_1175086
1186 Ga0182005_1065990
1187 Ga0163161_10291706
1188 Ga0213872_10252535
1189 Ga0213871_10166607
1190 Ga0209563_115646
1191 Ga0207425_1021466
1192 Ga0209026_1000929
1193 Ga0209564_1033767
1194 Ga0209758_1012894
1195 Ga0209758_1097941
1196 Ga0209758_1172750
1197 Ga0209050_1038655
1198 Ga0207426_1003111
1199 Ga0209051_1088573
1200 Ga0209257_1000426
1201 Ga0209257_1116310
1202 Ga0207697_10111574
1203 Ga0207656_10188499
1204 Ga0207682_10395830
1205 Ga0207642_10349128
1206 Ga0207710_10225420
1207 Ga0207710_10270946
1208 Ga0207688_10063324
1209 Ga0207688_10083083
1210 Ga0207688_10111644
1211 Ga0207680_10231079
1212 Ga0207680_10507366
1213 Ga0207647_10057503
1214 Ga0207699_10578992
1215 Ga0207645_10225773
1216 Ga0207645_10354471
1217 Ga0207643_10017049
1218 Ga0207643_10154522
1219 Ga0207705_10421913
1220 Ga0207705_11550767
1221 Ga0207654_10392866
1222 Ga0207654_10518498
1223 Ga0207707_10048166
1224 Ga0207707_10267458
1225 Ga0207707_10575246
1226 Ga0207707_11103875
1227 Ga0207695_10056250
1228 Ga0207695_10617938
1229 Ga0207695_10724852
1230 Ga0207695_10731627
1231 Ga0207695_11031959
1232 Ga0207671_10565429
1233 Ga0207671_10602275
1234 Ga0207693_10329478
1235 Ga0207663_10984192
1236 Ga0207660_10044091
1237 Ga0207660_10172295
1238 Ga0207660_10653422
1239 Ga0207662_10137687
1240 Ga0207662_10168421
1241 Ga0207657_10142602
1242 Ga0207657_10661320
1243 Ga0207649_10423437
1244 Ga0207649_10443679
1245 Ga0207649_10561668
1246 Ga0207652_10607725
1247 Ga0207652_10644510
1248 Ga0207652_10749367
1249 Ga0207681_10071503
1250 Ga0207694_10030758
1251 Ga0207694_10533387
1252 Ga0207694_10635046
1253 Ga0207694_10644353
1254 Ga0207694_11254366
1255 Ga0207694_11522182
1256 Ga0207650_10414003
1257 Ga0207650_10534172
1258 Ga0207659_10556138
1259 Ga0207659_10695867
1260 Ga0207687_10379569
1261 Ga0207687_10667150
1262 Ga0207700_10531982
1263 Ga0207700_10846062
1264 Ga0207700_11917758
1265 Ga0207664_10254025
1266 Ga0207664_10836821
1267 Ga0207644_10446959
1268 Ga0207644_10674079
1269 Ga0207690_11322137
1270 Ga0207706_10081080
1271 Ga0207706_10277931
1272 Ga0207706_11637119
1273 Ga0207709_10423891
1274 Ga0207709_10581472
1275 Ga0207709_10631515
1276 Ga0207669_10633528
1277 Ga0207669_11043363
1278 Ga0207704_10194873
1279 Ga0207665_11062236
1280 Ga0207691_10157102
1281 Ga0207711_10553289
1282 Ga0207711_10928635
1283 Ga0207689_10172105
1284 Ga0207689_10324761
1285 Ga0207661_10829064
1286 Ga0207679_10542231
1287 Ga0207679_10754387
1288 Ga0207667_10059464
1289 Ga0207667_10299345
1290 Ga0207667_10669482
1291 Ga0207667_10763144
1292 Ga0207667_11027423
1293 Ga0207667_11146405
1294 Ga0207667_11962920
1295 Ga0207651_10321453
1296 Ga0207651_10452754
1297 Ga0207712_10673129
1298 Ga0207668_10587815
1299 Ga0207668_10696636
1300 Ga0207668_11032666
1301 Ga0207640_10546717
1302 Ga0207640_10686623
1303 Ga0207640_10713278
1304 Ga0207640_11193026
1305 Ga0207640_11315471
1306 Ga0207658_10787794
1307 Ga0207658_10866961
1308 Ga0207677_10366325
1309 Ga0207677_10491535
1310 Ga0207677_10535444
1311 Ga0207677_10751577
1312 Ga0207703_10700409
1313 Ga0207639_10119140
1314 Ga0207639_10329625
1315 Ga0207639_10338680
1316 Ga0207639_10591104
1317 Ga0207639_12212685
1318 Ga0207678_10064404
1319 Ga0207678_10477852
1320 Ga0207678_10673701
1321 Ga0207708_10073316
1322 Ga0207708_10359781
1323 Ga0207702_10415360
1324 Ga0207702_10517373
1325 Ga0207702_11188733
1326 Ga0207641_10736975
1327 Ga0207641_10759465
1328 Ga0207648_10459914
1329 Ga0207648_11551922
1330 Ga0207676_10101818
1331 Ga0207676_10577196
1332 Ga0207674_10415503
1333 Ga0207674_10564473
1334 Ga0207674_10874965
1335 Ga0207675_100139017
1336 Ga0207683_10056877
1337 Ga0207683_10524748
1338 Ga0207683_10570334
1339 Ga0207698_10081543
1340 Ga0207698_10324123
1341 Ga0207698_10738615
1342 Ga0207698_11484494
1343 Ga0209973_1012485
1344 Ga0209981_1063851
1345 Ga0209999_1019065
1346 Ga0209970_1014039
1347 Ga0209983_1012207
1348 Ga0209813_10091867
1349 Ga0209974_10065853
1350 Ga0207428_10689671
1351 Ga0268266_10074100
1352 Ga0268266_10496752
1353 Ga0268266_10805195
1354 Ga0268266_11001765
1355 Ga0268265_10746332
1356 Ga0268264_10910242
1357 Ga0268264_11142682
1358 Ga0268264_11324578
1359 Ga0265337_1022259
1360 Ga0265337_1088736
1361 Ga0265326_10003186
1362 Ga0265326_10043668
1363 Ga0265319_1073152
1364 Ga0265319_1114829
1365 Ga0265334_10002307
1366 Ga0265334_10053923
1367 Ga0265334_10258923
1368 Ga0265318_10010565
1369 Ga0265318_10069146
1370 Ga0265323_10002415
1371 Ga0265323_10123166
1372 Ga0265322_10023709
1373 Ga0265322_10054932
1374 Ga0265336_10000852
1375 Ga0265336_10215479
1376 Ga0307517_10042835
1377 Ga0307517_10318791
1378 Ga0307515_10389334
1379 Ga0265338_10152427
1380 Ga0265338_10515392
1381 Ga0265338_10613910
1382 Ga0265324_10133588
1383 Ga0307512_10209011
1384 Ga0265770_1017892
1385 Ga0265760_10052774
1386 Ga0265330_10036938
1387 Ga0265330_10224578
1388 Ga0265330_10335104
1389 Ga0265332_10132354
1390 Ga0265332_10186100
1391 Ga0265332_10193250
1392 Ga0265328_10082481
1393 Ga0265328_10205697
1394 Ga0265320_10159304
1395 Ga0265325_10003723
1396 Ga0265325_10041687
1397 Ga0265325_10108678
1398 Ga0265325_10165052
1399 Ga0265325_10217243
1400 Ga0265325_10304464
1401 Ga0265329_10022989
1402 Ga0265340_10086003
1403 Ga0265340_10208239
1404 Ga0265340_10235159
1405 Ga0265339_10249890
1406 Ga0265339_10261367
1407 Ga0265331_10146059
1408 Ga0265331_10188999
1409 Ga0265316_10047567
1410 Ga0265316_10446708
1411 Ga0265316_10886448
1412 Ga0265316_10947646
1413 Ga0307513_10669467
1414 Ga0307408_100291388
1415 Ga0307408_100611846
1416 Ga0265313_10037961
1417 Ga0265313_10138479
1418 Ga0265313_10340569
1419 Ga0265313_10357155
1420 Ga0307508_10329176
1421 Ga0307508_10509513
1422 Ga0316575_10098612
1423 Ga0316575_10398984
1424 Ga0316575_10545551
1425 Ga0265314_10015943
1426 Ga0265314_10131100
1427 Ga0265314_10159717
1428 Ga0265314_10288027
1429 Ga0265342_10242015
1430 Ga0265342_10255412
1431 Ga0265342_10307782
1432 Ga0265342_10353889
1433 Ga0307516_10595146
1434 Ga0307405_10266152
1435 Ga0307413_10705541
1436 Ga0307410_11020902
1437 Ga0307407_10867353
1438 Ga0307412_11634943
1439 Ga0307414_10012988
1440 Ga0307414_10292994
1441 Ga0307414_10371467
1442 Ga0307411_10141647
1443 Ga0307411_10596703
1444 Ga0316583_10357437
1445 Ga0307507_10236074
1446 Ga0307510_10345865
1447 Ga0373959_0009135
1448 Ga0373926_0230741
1449 Ga0373928_0039737
1450 Ga0373934_0017660
1451 Ga0373934_0188459
1452 Ga0373940_0374681
1453 Ga0373949_0138218
1454 Ga0373951_0075362
1455 Ga0373951_0293390
1456 Ga0373923_0400059
1457 Ga0373936_0078655
1458 Ga0373936_0230379
1459 Ga0373936_0314190
1460 Ga0373939_0069245
1461 Ga0373939_0132719
1462 Ga0373939_0506826
1463 Ga0373941_0144526
1464 Ga0373954_0412309
1465 Ga0373960_0105853
1466 Ga0373955_0355727
1467 Ga0373961_0076877
1468 Ga0373931_0842681
1469 Ga0373927_0136652
1470 Ga0373933_0051436
1471 Ga0373947_0855054
1472 Ga0373937_0130917
1473 Ga0373937_0381181
1474 Ga0373937_0493097
1475 Ga0373937_1009634
1476 Ga0373937_1401659
1477 Ga0316582_0328083
1478 Ga0373925_0999497
1479 Ga0395899_0322855
1480 Ga0395900_0245967
1481 Ga0395900_0620675
1482 Ga0395900_0656791
1483 Ga0395900_0657147
1484 Ga0395898_0248258
1485 Ga0395898_0348744
1486 Ga0395898_1863366
1487 Ga0395905_0133032
1488 Ga0395905_0524875
1489 Ga0395905_0640783
1490 Ga0395905_0689878
1491 Ga0395901_0541277
1492 Ga0395901_0600767
1493 Ga0395901_0636819
1494 Ga0395901_1611061
1495 Ga0395901_1952262
1496 Ga0436365_0402399
1497 Ga0436360_0681037
1498 Ga0436360_1184291
1499 Ga0436360_1240939
1500 Ga0436360_1255461
1501 Ga0436361_0335125
1502 Ga0436361_0692057
1503 Ga0436361_0953792
1504 Ga0436363_0346786
1505 Ga0451800_0380214
1506 Ga0451802_0559195
1507 Ga0451807_1505350
1508 Ga0450914_007222
1509 Ga0450890_011347
1510 Ga0450900_023954
1511 Ga0439444_0099621
1512 Ga0439464_0163161
1513 Ga0439440_0287415
1514 Ga0453684_0007285
1515 Ga0466971_0206352
1516 Ga0466968_0164626
1517 Ga0466968_0686523
1518 Ga0466967_0921622
1519 Ga0495592_0533213
1520 Ga0495592_0665596
1521 Ga0495603_0114179
1522 Ga0495629_0291690
1523 Ga0495651_0387271
1524 Ga0495580_0482533
1525 Ga0495605_0196983
1526 Ga0495639_0183171
1527 Ga0495664_0134897
1528 Ga0495594_0330332
1529 Ga0495596_0064569
1530 Ga0495583_0194876
1531 Ga0495608_0385790
1532 Ga0495630_0481672
1533 Ga0495648_0267503
1534 Ga0495652_0097414
1535 Ga0495640_0209787
1536 Ga0495587_0443234
1537 Ga0495645_0654067
1538 Ga0495622_0001917
1539 Ga0495667_0162559
1540 Ga0495668_0304053
1541 Ga0495634_0231300
1542 Ga0495625_0243983
1543 Ga0495625_0277451
1544 Ga0495635_0309546
1545 Ga0495599_0286277
1546 Ga0495599_0554699
1547 Ga0495646_0228424
1548 Ga0495646_0357086
1549 Ga0495658_0091312
1550 Ga0495624_0052836
1551 Ga0495671_0157723
1552 Ga0495600_0105468
1553 Ga0495581_0248054
1554 Ga0495581_0570128
1555 Ga0495604_0288263
1556 Ga0495604_0702069
1557 Ga0495674_0226433
1558 Ga0495674_1199652
1559 Ga0495672_0039474
1560 Ga0495672_0090158
1561 Ga0495672_0209562
1562 Ga0495672_0477487
1563 Ga0495676_0081803
1564 Ga0495675_0296363
1565 Ga0495593_0208950
1566 Ga0495602_0284591
1567 Ga0495602_0385505
1568 Ga0496100_0572191
1569 Ga0496100_1461854
1570 Ga0496101_0550944
1571 Ga0496101_1063323
1572 Ga0496102_0430116
1573 Ga0496102_1106165
1574 Ga0496102_1447434
1575 Ga0496103_0244273
1576 Ga0496104_0160988
1577 Ga0496105_0114387
1578 Ga0496106_0252486
1579 Ga0496107_0523406
1580 Ga0496108_0244926
1581 Ga0496109_0532467
1582 Ga0496109_0873127
1583 Ga0496110_0544880
1584 Ga0496111_0291803
1585 Ga0496111_0346414
1586 Ga0496112_0089025
1587 Ga0496112_0402004
1588 Ga0496112_1040414
1589 Ga0496113_0349885
1590 Ga0496114_0376190
1591 Ga0496115_0328849
1592 Ga0496115_0550440
1593 Ga0496115_0569501
1594 Ga0496124_0397276
1595 Ga0496125_0001114
1596 Ga0496125_0281439
1597 Ga0496126_0086758
1598 Ga0496126_0148345
1599 Ga0496126_0785618
1600 Ga0501291_110941
1601 Ga0501031_0334553
1602 Ga0501031_0478782
1603 Ga0501031_0613838
1604 Ga0501031_1005033
1605 Ga0501032_0026483
1606 Ga0501032_0066015
1607 Ga0501032_0137193
1608 Ga0501032_0219859
1609 Ga0501032_0376005
1610 Ga0501032_0480681
1611 Ga0501033_0010404
1612 Ga0501033_0032643
1613 Ga0501033_0078698
1614 Ga0501033_0145261
1615 Ga0501033_0469549
1616 Ga0501033_0844373
1617 Ga0501034_0096853
1618 Ga0501034_0177026
1619 Ga0501034_0326959
1620 Ga0501034_0375408
1621 Ga0501034_0442542
1622 Ga0501034_0529542
1623 Ga0501034_0614576
1624 Ga0501034_0667008
1625 Ga0501034_0735907
1626 Ga0501034_1211443
1627 Ga0501036_0158568
1628 Ga0501036_0161610
1629 Ga0501036_0206253
1630 Ga0501036_0372769
1631 Ga0501036_0483611
1632 Ga0501036_0507554
1633 Ga0501036_0617636
1634 Ga0501037_0094318
1635 Ga0501037_0353408
1636 Ga0501037_0497225
1637 Ga0501037_0985524
1638 Ga0501037_1063785
1639 Ga0501038_0072965
1640 Ga0501038_0151598
1641 Ga0501038_0204164
1642 Ga0501038_0444588
1643 Ga0501038_0528366
1644 Ga0501038_0570921
1645 Ga0501038_0574213
1646 Ga0501038_0591327
1647 Ga0501038_0721026
1648 Ga0501038_1243125
1649 Ga0501039_0240168
1650 Ga0501039_0325340
1651 Ga0501039_0405578
1652 Ga0501039_0406993
1653 Ga0501039_0955263
1654 Ga0501040_0356070
1655 Ga0501040_0693810
1656 Ga0501040_1012424
1657 Ga0501042_0506637
1658 Ga0501043_0093552
1659 Ga0501043_0102181
1660 Ga0501043_0298956
1661 Ga0501043_0332129
1662 Ga0501043_0374101
1663 Ga0501043_0403731
1664 Ga0501043_0472843
1665 Ga0501043_0757312
1666 Ga0501043_0842242
1667 Ga0501046_0064803
1668 Ga0501046_0087760
1669 Ga0501046_0240756
1670 Ga0501046_0376958
1671 Ga0501046_0478578
1672 Ga0501047_0085978
1673 Ga0501047_0238406
1674 Ga0501047_0272525
1675 Ga0501047_0406771
1676 Ga0501047_0496354
1677 Ga0501047_0689243
1678 Ga0501047_0776266
1679 Ga0501048_0100230
1680 Ga0501048_0266135
1681 Ga0501048_0282909
1682 Ga0501048_0405054
1683 Ga0501048_0676757
1684 Ga0501067_0024840
1685 Ga0501067_0276962
1686 Ga0501067_0411316
1687 Ga0501067_0824915
1688 Ga0501068_0134513
1689 Ga0501068_0190253
1690 Ga0501068_0632941
1691 Ga0501069_0107977
1692 Ga0501069_0243362
1693 Ga0501069_0289995
1694 Ga0501069_0295968
1695 Ga0501070_0376971
1696 Ga0501070_0423196
1697 Ga0501070_0587742
1698 Ga0501070_0927024
1699 Ga0501070_1496209
1700 Ga0501073_0306083
1701 Ga0501073_0419056
1702 Ga0501074_0193347
1703 Ga0501074_0214616
1704 Ga0501074_0512735
1705 Ga0501074_1011015
1706 Ga0501076_0341442
1707 Ga0501076_0701576
1708 Ga0501076_1700686
1709 Ga0501198_052190
1710 Ga0501079_0342064
1711 Ga0501079_0487848
1712 Ga0501079_0949825
1713 Ga0501079_0970171
1714 Ga0501080_0184552
1715 Ga0501080_0686343
1716 Ga0501080_0688513
1717 Ga0501080_0850737
1718 Ga0501080_0922044
1719 Ga0501081_1229977
1720 Ga0501083_0137250
1721 Ga0501083_0283954
1722 Ga0501083_0391071
1723 Ga0501083_0408415
1724 Ga0501035_0162356
1725 Ga0501035_0248992
1726 Ga0501035_0353837
1727 Ga0501035_0387693
1728 Ga0501035_0441574
1729 Ga0501035_1145999
1730 Ga0501035_1368388
1731 Ga0501044_0019252
1732 Ga0501044_0038066
1733 Ga0501044_0164626
1734 Ga0501044_0220811
1735 Ga0501044_0232905
1736 Ga0501044_0296202
1737 Ga0501044_0332558
1738 Ga0501044_0379553
1739 Ga0501044_0475297
1740 Ga0501044_0649229
1741 Ga0501044_1031517
1742 Ga0501044_1276912
1743 Ga0501045_0467428
1744 Ga0501045_0561737
1745 nmdc:mga03683_340426_c1
1746 nmdc:mga03683_43238_c1
1747 nmdc:mga03n38_602691_c1
1748 nmdc:mga00v17_879759_c1
1749 nmdc:mga0yw44_195074_c1
1750 nmdc:mga0k408_322752_c1
1751 nmdc:mga0k408_571908_c1
1752 nmdc:mga06z11_281853_c1
1753 nmdc:mga06z11_963435_c1
1754 nmdc:mga04h51_44561_c1
1755 nmdc:mga07m45_778978_c1
1756 nmdc:mga09592_318080_c1
1757 nmdc:mga0qj67_613336_c1
1758 nmdc:mga0n895_2005690_c1
1759 nmdc:mga0sz30_251399_c1
1760 Ga0495612_0089544
1761 Ga0495612_0216955
1762 Ga0495612_0295916
1763 Ga0495595_0171996
1764 Ga0495619_0301939
1765 Ga0495619_0525870
1766 Ga0500643_068814
1767 Ga0500651_0235579
1768 Ga0500651_0340045
1769 Ga0500566_0120972
1770 Ga0500641_0043397
1771 Ga0500554_049703
1772 Ga0500594_0127742
1773 Ga0500595_004337
1774 Ga0500595_132400
1775 Ga0500597_111832
1776 Ga0500607_071295
1777 Ga0500614_011709
1778 Ga0500614_133126
1779 Ga0500655_031644
1780 Ga0500636_0204115
1781 Ga0500637_0282893
1782 Ga0500576_085277
1783 Ga0500552_029050
1784 Ga0500587_009449
1785 Ga0501084_0200001
1786 Ga0501084_0551897
1787 Ga0501084_0843727
1788 Ga0501084_0865901
1789 Ga0501084_1000046
1790 Ga0501082_0310821
1791 Ga0501082_0356393
1792 Ga0501082_0443925
1793 Ga0501082_0475965
1794 Ga0501082_1073220

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13340

DUF4096

Putative transposase of IS4/5 family (DUF4096)

34

105

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nzn-assembly1.cif.gz_A cytosolic domain of the human mitchondrial fission protein fis1 adopts a tpr fold 0.3599 30 109
3zg1-assembly2.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.3361 2 107
4wwf-assembly2.cif.gz_B-2 high-resolution structure of two ni-bound forms of the m123c mutant of c. metallidurans cnrxs 0.3348 3 103
3zg1-assembly2.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.3153 2 107
3zg1-assembly1.cif.gz_D error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.3133 2 107
ID Description Score Start End Superfamily
af_P10815_336_443_1.10.472.10 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.424 8 93 1.10.472.10
af_B7ZWR6_89_231_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.392 32 106 1.25.40.10
4dxwA02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.3806 35 106 1.10.287.70
af_P10815_336_443_1.10.472.10 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.3632 8 93 1.10.472.10
af_C6KT28_128_709_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.3561 32 114 1.25.10.10
ID Description Score Start End GO Terms
AF-A0A1G9SM53-F1-model_v4 Transposase 0.9002 1 97
AF-A0A1C3VMS2-F1-model_v4 Putative transposase of IS4/5 family 0.9001 1 85
AF-A0A2S3VX66-F1-model_v4 Uncharacterized protein 0.8984 1 85 GO:0003677
GO:0004803
GO:0006313
AF-A0A101LRV1-F1-model_v4 Insertion element IS402-like domain-containing protein 0.8923 1 89
AF-A0A1G5ZHB2-F1-model_v4 deleted 0.8911 1 85

Map