F485005
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 896 | 363 | 1792 | 130 |
Family's Representative Sequence
| Representative Sequence | 3300005530|Ga0070679_100289959|Ga0070679_1002899592 |
| Length | 151 |
| Sequence | VEPSARVSEGTAAAAHDASVLEMTTSPQSTLETFSNPGSGADYTIRIQIPEFTCLCPKTGQPDFATLELEYVPDRTCVELKALKLYIWSFRDRGAFHEAVTNEIADTIASATEPRFLRLTARFNVRGGIYTSVVVERRKAGWQPASPVTLP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 59 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 60 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 61 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 69 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 71 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 72 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 83 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 102 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 103 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 104 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 105 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 106 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 161 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 162 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 166 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 167 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 168 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 169 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 170 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 171 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 172 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 173 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 174 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 175 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 176 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 177 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 178 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 179 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 180 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 181 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 182 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 183 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 184 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 185 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 186 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 187 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 188 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 189 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 190 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 191 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 192 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 193 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 194 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 195 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 196 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 197 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 198 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 199 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 200 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 201 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 202 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 203 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 204 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 205 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 206 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 207 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 208 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 209 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 210 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 211 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 212 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 213 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 214 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 215 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 216 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 217 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 218 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 219 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 220 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 221 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 222 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 223 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 224 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 225 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 226 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 227 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 228 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 229 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 230 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 231 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 232 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 233 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 234 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 235 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 236 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 237 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 238 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 239 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 240 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 241 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 242 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 243 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 244 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 245 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 246 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 247 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 248 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 249 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 250 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 251 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 252 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 253 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 254 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 255 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 280 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 281 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 282 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 283 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 284 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 285 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 286 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 288 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 289 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 290 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 291 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 292 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 293 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 294 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 295 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 296 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 297 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 298 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 299 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 300 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 301 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 302 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 335 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 338 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 339 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 340 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 341 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 342 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 343 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 344 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 345 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 346 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 347 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 348 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 349 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 350 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 351 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 352 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 353 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 354 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 355 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 356 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 357 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 358 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 361 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 362 | 2894510363 | Methylomonas sp. Kb3 | Isolate | Unclassified |
| 363 | 2989392574 | Methylomonas rhizoryzae GJ1 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.88 |
| Metatranscriptomes | 0.89 |
| Isolates | 0.22 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.46 |
| Nodule | 0 |
| Rhizoplane | 4.24 |
| Rhizosphere | 86.38 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.34 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070679_100289959 | 3300005530 | Bacteria | 1588 |
| 2 | JGI25406J46586_10009833 | 3300003203 | Bacteria | 4271 |
| 3 | rootH2_10190203 | 3300003320 | Bacteria | 1240 |
| 4 | rootL2_10119616 | 3300003322 | Bacteria | 3010 |
| 5 | JGI25405J52794_10055149 | 3300003911 | Bacteria | 855 |
| 6 | Ga0065707_10084632 | 3300005295 | Bacteria | 6954 |
| 7 | Ga0070676_10500829 | 3300005328 | Bacteria | 862 |
| 8 | Ga0070683_100540449 | 3300005329 | Bacteria | 1114 |
| 9 | Ga0070690_100027703 | 3300005330 | Bacteria | 3504 |
| 10 | Ga0070690_100258318 | 3300005330 | Bacteria | 1235 |
| 11 | Ga0070670_100601384 | 3300005331 | Bacteria | 984 |
| 12 | Ga0070670_101311740 | 3300005331 | Bacteria | 663 |
| 13 | Ga0070670_101510988 | 3300005331 | Unclassified | 617 |
| 14 | Ga0068869_100155428 | 3300005334 | Bacteria | 1777 |
| 15 | Ga0070666_10004167 | 3300005335 | Bacteria | 8774 |
| 16 | Ga0070666_10008920 | 3300005335 | Bacteria | 6239 |
| 17 | Ga0070666_10086527 | 3300005335 | Bacteria | 2147 |
| 18 | Ga0070666_10093722 | 3300005335 | Bacteria | 2065 |
| 19 | Ga0070666_10194470 | 3300005335 | Bacteria | 1426 |
| 20 | Ga0070666_10367807 | 3300005335 | Bacteria | 1031 |
| 21 | Ga0070680_100021018 | 3300005336 | Bacteria | 5182 |
| 22 | Ga0070680_100177938 | 3300005336 | Bacteria | 1791 |
| 23 | Ga0070680_100922828 | 3300005336 | Bacteria | 753 |
| 24 | Ga0070682_100051237 | 3300005337 | Bacteria | 2579 |
| 25 | Ga0070682_100120967 | 3300005337 | Bacteria | 1757 |
| 26 | Ga0070682_100192453 | 3300005337 | Bacteria | 1433 |
| 27 | Ga0068868_100009710 | 3300005338 | Bacteria | 6942 |
| 28 | Ga0068868_100061045 | 3300005338 | Bacteria | 2986 |
| 29 | Ga0068868_100150388 | 3300005338 | Bacteria | 1917 |
| 30 | Ga0070660_100588190 | 3300005339 | Bacteria | 930 |
| 31 | Ga0070689_100027251 | 3300005340 | Bacteria | 4307 |
| 32 | Ga0070689_101854373 | 3300005340 | Bacteria | 550 |
| 33 | Ga0070668_101622535 | 3300005347 | Bacteria | 593 |
| 34 | Ga0070671_100007243 | 3300005355 | Bacteria | 8865 |
| 35 | Ga0070671_102077297 | 3300005355 | Bacteria | 506 |
| 36 | Ga0070673_100408062 | 3300005364 | Bacteria | 1216 |
| 37 | Ga0070673_100532911 | 3300005364 | Bacteria | 1065 |
| 38 | Ga0070667_100000148 | 3300005367 | Bacteria | 87700 |
| 39 | Ga0070667_100006050 | 3300005367 | Bacteria | 10052 |
| 40 | Ga0070667_100006867 | 3300005367 | Bacteria | 9458 |
| 41 | Ga0070667_100020790 | 3300005367 | Bacteria | 5452 |
| 42 | Ga0070667_100041352 | 3300005367 | Bacteria | 3867 |
| 43 | Ga0070667_100308865 | 3300005367 | Bacteria | 1425 |
| 44 | Ga0070667_100631757 | 3300005367 | Bacteria | 988 |
| 45 | Ga0070709_10000762 | 3300005434 | Bacteria | 18089 |
| 46 | Ga0070709_10037055 | 3300005434 | Bacteria | 2975 |
| 47 | Ga0070709_11114276 | 3300005434 | Bacteria | 632 |
| 48 | Ga0070714_100010023 | 3300005435 | Bacteria | 7475 |
| 49 | Ga0070714_100157343 | 3300005435 | Bacteria | 2052 |
| 50 | Ga0070714_100218777 | 3300005435 | Bacteria | 1749 |
| 51 | Ga0070714_100651495 | 3300005435 | Bacteria | 1014 |
| 52 | Ga0070714_100963138 | 3300005435 | Bacteria | 830 |
| 53 | Ga0070714_101088033 | 3300005435 | Bacteria | 779 |
| 54 | Ga0070713_100009052 | 3300005436 | Bacteria | 7101 |
| 55 | Ga0070713_100028708 | 3300005436 | Bacteria | 4395 |
| 56 | Ga0070713_100057286 | 3300005436 | Bacteria | 3244 |
| 57 | Ga0070713_100065170 | 3300005436 | Bacteria | 3059 |
| 58 | Ga0070713_100183446 | 3300005436 | Bacteria | 1882 |
| 59 | Ga0070713_100523337 | 3300005436 | Bacteria | 1121 |
| 60 | Ga0070710_10000916 | 3300005437 | Bacteria | 14069 |
| 61 | Ga0070710_10289385 | 3300005437 | Bacteria | 1066 |
| 62 | Ga0070710_10617633 | 3300005437 | Bacteria | 756 |
| 63 | Ga0070701_10082380 | 3300005438 | Bacteria | 1744 |
| 64 | Ga0070701_10683622 | 3300005438 | Bacteria | 688 |
| 65 | Ga0070711_100006494 | 3300005439 | Bacteria | 7051 |
| 66 | Ga0070711_100018376 | 3300005439 | Bacteria | 4463 |
| 67 | Ga0070711_100091228 | 3300005439 | Bacteria | 2196 |
| 68 | Ga0070711_100411670 | 3300005439 | Bacteria | 1100 |
| 69 | Ga0070711_100497483 | 3300005439 | Bacteria | 1005 |
| 70 | Ga0070711_100585015 | 3300005439 | Bacteria | 930 |
| 71 | Ga0070705_100003534 | 3300005440 | Bacteria | 7653 |
| 72 | Ga0070694_100032398 | 3300005444 | Bacteria | 3432 |
| 73 | Ga0070694_100387225 | 3300005444 | Bacteria | 1092 |
| 74 | Ga0070663_100405328 | 3300005455 | Bacteria | 1115 |
| 75 | Ga0070662_100762848 | 3300005457 | Bacteria | 821 |
| 76 | Ga0070681_10003431 | 3300005458 | Bacteria | 14846 |
| 77 | Ga0070681_10007497 | 3300005458 | Bacteria | 10664 |
| 78 | Ga0070681_10094069 | 3300005458 | Bacteria | 2946 |
| 79 | Ga0070681_10094996 | 3300005458 | Bacteria | 2930 |
| 80 | Ga0070681_10107336 | 3300005458 | Bacteria | 2733 |
| 81 | Ga0070681_10160829 | 3300005458 | Bacteria | 2170 |
| 82 | Ga0070681_10786427 | 3300005458 | Bacteria | 868 |
| 83 | Ga0070681_11015322 | 3300005458 | Bacteria | 749 |
| 84 | Ga0068867_100022503 | 3300005459 | Bacteria | 4507 |
| 85 | Ga0068867_100045403 | 3300005459 | Bacteria | 3222 |
| 86 | Ga0070685_10316049 | 3300005466 | Bacteria | 1057 |
| 87 | Ga0070699_100402808 | 3300005518 | Bacteria | 1237 |
| 88 | Ga0070679_100068631 | 3300005530 | Bacteria | 3536 |
| 89 | Ga0070679_100150172 | 3300005530 | Bacteria | 2307 |
| 90 | Ga0070679_100153592 | 3300005530 | Bacteria | 2278 |
| 91 | Ga0070679_100308405 | 3300005530 | Bacteria | 1533 |
| 92 | Ga0070679_100534218 | 3300005530 | Bacteria | 1116 |
| 93 | Ga0070679_100823396 | 3300005530 | Bacteria | 871 |
| 94 | Ga0070679_100828442 | 3300005530 | Bacteria | 868 |
| 95 | Ga0070679_101274707 | 3300005530 | Bacteria | 680 |
| 96 | Ga0070679_101414748 | 3300005530 | Bacteria | 642 |
| 97 | Ga0070684_100065027 | 3300005535 | Bacteria | 3201 |
| 98 | Ga0070684_100198313 | 3300005535 | Bacteria | 1828 |
| 99 | Ga0068853_100531578 | 3300005539 | Bacteria | 1112 |
| 100 | Ga0068853_101399417 | 3300005539 | Bacteria | 676 |
| 101 | Ga0070672_100226653 | 3300005543 | Bacteria | 1569 |
| 102 | Ga0070686_100342277 | 3300005544 | Bacteria | 1121 |
| 103 | Ga0070695_100109427 | 3300005545 | Bacteria | 1873 |
| 104 | Ga0070695_100153885 | 3300005545 | Bacteria | 1607 |
| 105 | Ga0070695_101884707 | 3300005545 | Bacteria | 502 |
| 106 | Ga0070696_100012034 | 3300005546 | Bacteria | 5797 |
| 107 | Ga0070696_100294335 | 3300005546 | Bacteria | 1241 |
| 108 | Ga0070696_100596975 | 3300005546 | Bacteria | 890 |
| 109 | Ga0070696_101053161 | 3300005546 | Bacteria | 682 |
| 110 | Ga0070696_101397470 | 3300005546 | Bacteria | 597 |
| 111 | Ga0070693_100439243 | 3300005547 | Bacteria | 913 |
| 112 | Ga0070665_100001135 | 3300005548 | Bacteria | 32737 |
| 113 | Ga0070665_100010722 | 3300005548 | Bacteria | 9277 |
| 114 | Ga0070665_100015402 | 3300005548 | Bacteria | 7678 |
| 115 | Ga0070665_100023939 | 3300005548 | Bacteria | 6149 |
| 116 | Ga0070665_100031741 | 3300005548 | Bacteria | 5316 |
| 117 | Ga0070665_100052534 | 3300005548 | Bacteria | 4086 |
| 118 | Ga0070665_100126834 | 3300005548 | Bacteria | 2554 |
| 119 | Ga0070665_102019940 | 3300005548 | Unclassified | 582 |
| 120 | Ga0070704_101267727 | 3300005549 | Bacteria | 674 |
| 121 | Ga0070704_101833414 | 3300005549 | Bacteria | 562 |
| 122 | Ga0068855_100006417 | 3300005563 | Bacteria | 14318 |
| 123 | Ga0068855_100067475 | 3300005563 | Bacteria | 4166 |
| 124 | Ga0068855_100347577 | 3300005563 | Bacteria | 1634 |
| 125 | Ga0068855_100446981 | 3300005563 | Bacteria | 1411 |
| 126 | Ga0068855_100526548 | 3300005563 | Bacteria | 1282 |
| 127 | Ga0068855_100865346 | 3300005563 | Bacteria | 957 |
| 128 | Ga0068855_101014068 | 3300005563 | Bacteria | 871 |
| 129 | Ga0070664_100739239 | 3300005564 | Bacteria | 918 |
| 130 | Ga0068857_100327336 | 3300005577 | Bacteria | 1416 |
| 131 | Ga0068857_100558636 | 3300005577 | Bacteria | 1079 |
| 132 | Ga0068856_100011179 | 3300005614 | Bacteria | 8714 |
| 133 | Ga0068856_100020953 | 3300005614 | Bacteria | 6353 |
| 134 | Ga0068856_101245459 | 3300005614 | Bacteria | 760 |
| 135 | Ga0068852_100127445 | 3300005616 | Bacteria | 2339 |
| 136 | Ga0068852_100463149 | 3300005616 | Bacteria | 1257 |
| 137 | Ga0068859_100005986 | 3300005617 | Bacteria | 12354 |
| 138 | Ga0068859_100015270 | 3300005617 | Bacteria | 7713 |
| 139 | Ga0068859_100075517 | 3300005617 | Bacteria | 3411 |
| 140 | Ga0068859_100283043 | 3300005617 | Bacteria | 1751 |
| 141 | Ga0068859_100289279 | 3300005617 | Bacteria | 1731 |
| 142 | Ga0068859_100486159 | 3300005617 | Bacteria | 1330 |
| 143 | Ga0068864_100025887 | 3300005618 | Bacteria | 4943 |
| 144 | Ga0068864_100112088 | 3300005618 | Bacteria | 2431 |
| 145 | Ga0068864_100197280 | 3300005618 | Bacteria | 1848 |
| 146 | Ga0068866_10132297 | 3300005718 | Bacteria | 1420 |
| 147 | Ga0068866_10971321 | 3300005718 | Bacteria | 602 |
| 148 | Ga0068861_100008424 | 3300005719 | Bacteria | 7102 |
| 149 | Ga0068861_100175878 | 3300005719 | Bacteria | 1778 |
| 150 | Ga0068861_100505917 | 3300005719 | Bacteria | 1093 |
| 151 | Ga0068851_10154257 | 3300005834 | Bacteria | 1257 |
| 152 | Ga0068863_100002292 | 3300005841 | Bacteria | 19021 |
| 153 | Ga0068863_100021649 | 3300005841 | Bacteria | 6132 |
| 154 | Ga0068863_100084364 | 3300005841 | Bacteria | 3010 |
| 155 | Ga0068863_100709852 | 3300005841 | Bacteria | 1000 |
| 156 | Ga0068863_100824345 | 3300005841 | Bacteria | 926 |
| 157 | Ga0068858_100002654 | 3300005842 | Bacteria | 18016 |
| 158 | Ga0068858_100006327 | 3300005842 | Bacteria | 11529 |
| 159 | Ga0068858_100019192 | 3300005842 | Bacteria | 6395 |
| 160 | Ga0068858_100027404 | 3300005842 | Bacteria | 5293 |
| 161 | Ga0068858_100244266 | 3300005842 | Bacteria | 1704 |
| 162 | Ga0068860_100006415 | 3300005843 | Bacteria | 11809 |
| 163 | Ga0068860_100012778 | 3300005843 | Bacteria | 8255 |
| 164 | Ga0068860_100100587 | 3300005843 | Bacteria | 2758 |
| 165 | Ga0068860_100116111 | 3300005843 | Bacteria | 2560 |
| 166 | Ga0068860_100432101 | 3300005843 | Bacteria | 1307 |
| 167 | Ga0068860_102578793 | 3300005843 | Bacteria | 527 |
| 168 | Ga0068862_100024681 | 3300005844 | Bacteria | 5045 |
| 169 | Ga0068862_100428540 | 3300005844 | Bacteria | 1243 |
| 170 | Ga0068862_100525341 | 3300005844 | Bacteria | 1127 |
| 171 | Ga0068862_101075146 | 3300005844 | Bacteria | 799 |
| 172 | Ga0081455_10000985 | 3300005937 | Bacteria | 36252 |
| 173 | Ga0081455_10020882 | 3300005937 | Bacteria | 6155 |
| 174 | Ga0081539_10000066 | 3300005985 | Bacteria | 246391 |
| 175 | Ga0070717_10163912 | 3300006028 | Bacteria | 1930 |
| 176 | Ga0070717_10491248 | 3300006028 | Bacteria | 1109 |
| 177 | Ga0070717_10520378 | 3300006028 | Bacteria | 1076 |
| 178 | Ga0070715_10000791 | 3300006163 | Bacteria | 8598 |
| 179 | Ga0070715_10068806 | 3300006163 | Bacteria | 1575 |
| 180 | Ga0070716_100007700 | 3300006173 | Bacteria | 5316 |
| 181 | Ga0070716_100024175 | 3300006173 | Bacteria | 3231 |
| 182 | Ga0070716_100160243 | 3300006173 | Bacteria | 1457 |
| 183 | Ga0070712_100003340 | 3300006175 | Bacteria | 9858 |
| 184 | Ga0070712_100095331 | 3300006175 | Bacteria | 2189 |
| 185 | Ga0070712_100234853 | 3300006175 | Bacteria | 1458 |
| 186 | Ga0070712_100439959 | 3300006175 | Bacteria | 1084 |
| 187 | Ga0070712_100782675 | 3300006175 | Bacteria | 818 |
| 188 | Ga0075367_10298523 | 3300006178 | Bacteria | 1014 |
| 189 | Ga0097621_100007995 | 3300006237 | Bacteria | 7590 |
| 190 | Ga0097621_100462386 | 3300006237 | Bacteria | 1145 |
| 191 | Ga0097621_100505819 | 3300006237 | Bacteria | 1095 |
| 192 | Ga0097621_101857200 | 3300006237 | Bacteria | 575 |
| 193 | Ga0068871_100016901 | 3300006358 | Bacteria | 5508 |
| 194 | Ga0068871_100082840 | 3300006358 | Bacteria | 2660 |
| 195 | Ga0068871_100167838 | 3300006358 | Bacteria | 1880 |
| 196 | Ga0068871_100215257 | 3300006358 | Bacteria | 1663 |
| 197 | Ga0068871_101771653 | 3300006358 | Bacteria | 586 |
| 198 | Ga0068865_100157602 | 3300006881 | Bacteria | 1728 |
| 199 | Ga0097620_100005986 | 3300006931 | Bacteria | 12354 |
| 200 | Ga0097620_100015269 | 3300006931 | Bacteria | 7713 |
| 201 | Ga0097620_100075516 | 3300006931 | Bacteria | 3411 |
| 202 | Ga0097620_100283074 | 3300006931 | Bacteria | 1751 |
| 203 | Ga0097620_100289284 | 3300006931 | Bacteria | 1731 |
| 204 | Ga0097620_100486155 | 3300006931 | Bacteria | 1330 |
| 205 | Ga0097620_100637752 | 3300006931 | Bacteria | 1158 |
| 206 | Ga0097620_102473999 | 3300006931 | Unclassified | 572 |
| 207 | Ga0099794_10085789 | 3300007265 | Bacteria | 1558 |
| 208 | Ga0099794_10242255 | 3300007265 | Bacteria | 929 |
| 209 | Ga0099795_10000009 | 3300007788 | Bacteria | 84256 |
| 210 | Ga0099795_10000519 | 3300007788 | Bacteria | 7227 |
| 211 | Ga0105250_10010779 | 3300009092 | Bacteria | 3804 |
| 212 | Ga0105240_10015206 | 3300009093 | Bacteria | 10471 |
| 213 | Ga0105240_10019976 | 3300009093 | Bacteria | 8944 |
| 214 | Ga0105240_10052604 | 3300009093 | Bacteria | 5118 |
| 215 | Ga0105240_10097414 | 3300009093 | Bacteria | 3584 |
| 216 | Ga0105240_10099490 | 3300009093 | Bacteria | 3539 |
| 217 | Ga0105240_10104845 | 3300009093 | Bacteria | 3433 |
| 218 | Ga0105240_10182185 | 3300009093 | Bacteria | 2478 |
| 219 | Ga0105240_10215377 | 3300009093 | Bacteria | 2241 |
| 220 | Ga0105240_10445036 | 3300009093 | Bacteria | 1451 |
| 221 | Ga0105240_10575625 | 3300009093 | Bacteria | 1243 |
| 222 | Ga0105240_11005603 | 3300009093 | Bacteria | 891 |
| 223 | Ga0105240_11065259 | 3300009093 | Bacteria | 862 |
| 224 | Ga0105240_11109833 | 3300009093 | Bacteria | 841 |
| 225 | Ga0105240_11230539 | 3300009093 | Bacteria | 792 |
| 226 | Ga0105245_10004800 | 3300009098 | Bacteria | 11929 |
| 227 | Ga0105245_10038969 | 3300009098 | Bacteria | 4229 |
| 228 | Ga0105245_11760873 | 3300009098 | Unclassified | 672 |
| 229 | Ga0105247_10000162 | 3300009101 | Bacteria | 65804 |
| 230 | Ga0105247_10024572 | 3300009101 | Bacteria | 3632 |
| 231 | Ga0105247_10158224 | 3300009101 | Bacteria | 1498 |
| 232 | Ga0105247_10472454 | 3300009101 | Bacteria | 908 |
| 233 | Ga0105247_10658522 | 3300009101 | Bacteria | 783 |
| 234 | Ga0105247_11156770 | 3300009101 | Unclassified | 614 |
| 235 | Ga0105241_10012665 | 3300009174 | Bacteria | 6189 |
| 236 | Ga0105241_10090277 | 3300009174 | Bacteria | 2416 |
| 237 | Ga0105241_10210604 | 3300009174 | Bacteria | 1628 |
| 238 | Ga0105242_10007917 | 3300009176 | Bacteria | 8180 |
| 239 | Ga0105242_10096488 | 3300009176 | Bacteria | 2498 |
| 240 | Ga0105242_11793190 | 3300009176 | Bacteria | 652 |
| 241 | Ga0105248_10014006 | 3300009177 | Bacteria | 8823 |
| 242 | Ga0105248_10028521 | 3300009177 | Bacteria | 6219 |
| 243 | Ga0105248_10063316 | 3300009177 | Bacteria | 4152 |
| 244 | Ga0105248_11228341 | 3300009177 | Bacteria | 847 |
| 245 | Ga0105237_10108339 | 3300009545 | Bacteria | 2770 |
| 246 | Ga0105237_10429665 | 3300009545 | Bacteria | 1326 |
| 247 | Ga0105237_11767296 | 3300009545 | Bacteria | 626 |
| 248 | Ga0105237_11824609 | 3300009545 | Bacteria | 616 |
| 249 | Ga0105237_11837940 | 3300009545 | Unclassified | 613 |
| 250 | Ga0105237_12148691 | 3300009545 | Bacteria | 567 |
| 251 | Ga0105238_10011003 | 3300009551 | Bacteria | 9099 |
| 252 | Ga0105238_10043729 | 3300009551 | Bacteria | 4531 |
| 253 | Ga0105238_10363064 | 3300009551 | Bacteria | 1438 |
| 254 | Ga0105238_10469692 | 3300009551 | Bacteria | 1256 |
| 255 | Ga0105238_10538089 | 3300009551 | Bacteria | 1172 |
| 256 | Ga0105238_11066008 | 3300009551 | Unclassified | 830 |
| 257 | Ga0105249_10283253 | 3300009553 | Bacteria | 1656 |
| 258 | Ga0105249_10328190 | 3300009553 | Bacteria | 1543 |
| 259 | Ga0105249_10555153 | 3300009553 | Bacteria | 1199 |
| 260 | Ga0099796_10000005 | 3300010159 | Bacteria | 74057 |
| 261 | Ga0099796_10001369 | 3300010159 | Bacteria | 4863 |
| 262 | Ga0099796_10020489 | 3300010159 | Bacteria | 2021 |
| 263 | Ga0105239_10165299 | 3300010375 | Bacteria | 2474 |
| 264 | Ga0105239_10420076 | 3300010375 | Bacteria | 1515 |
| 265 | Ga0105239_10848184 | 3300010375 | Bacteria | 1048 |
| 266 | Ga0105239_10892168 | 3300010375 | Bacteria | 1020 |
| 267 | Ga0105239_11498596 | 3300010375 | Bacteria | 779 |
| 268 | Ga0105239_12018287 | 3300010375 | Bacteria | 670 |
| 269 | Ga0105239_12279782 | 3300010375 | Bacteria | 630 |
| 270 | Ga0105239_13260161 | 3300010375 | Bacteria | 528 |
| 271 | Ga0105239_13353694 | 3300010375 | Bacteria | 521 |
| 272 | Ga0105246_10178051 | 3300011119 | Bacteria | 1635 |
| 273 | Ga0105246_12059132 | 3300011119 | Bacteria | 552 |
| 274 | Ga0157373_10810716 | 3300013100 | Bacteria | 691 |
| 275 | Ga0157370_10251453 | 3300013104 | Bacteria | 1635 |
| 276 | Ga0157370_10782422 | 3300013104 | Bacteria | 869 |
| 277 | Ga0157370_10834048 | 3300013104 | Bacteria | 838 |
| 278 | Ga0157370_11293437 | 3300013104 | Bacteria | 657 |
| 279 | Ga0157369_10006063 | 3300013105 | Bacteria | 14023 |
| 280 | Ga0157369_10371802 | 3300013105 | Bacteria | 1484 |
| 281 | Ga0157369_10924663 | 3300013105 | Bacteria | 894 |
| 282 | Ga0157369_10927861 | 3300013105 | Bacteria | 892 |
| 283 | Ga0157369_11003738 | 3300013105 | Bacteria | 854 |
| 284 | Ga0157369_11993967 | 3300013105 | Bacteria | 589 |
| 285 | Ga0157374_10004337 | 3300013296 | Bacteria | 11937 |
| 286 | Ga0157374_10009231 | 3300013296 | Bacteria | 8456 |
| 287 | Ga0157374_10095763 | 3300013296 | Bacteria | 2839 |
| 288 | Ga0157378_10036536 | 3300013297 | Bacteria | 4347 |
| 289 | Ga0157378_10117341 | 3300013297 | Bacteria | 2448 |
| 290 | Ga0163162_10026787 | 3300013306 | Bacteria | 5700 |
| 291 | Ga0163162_10028215 | 3300013306 | Bacteria | 5552 |
| 292 | Ga0163162_10328675 | 3300013306 | Bacteria | 1661 |
| 293 | Ga0163162_10996076 | 3300013306 | Bacteria | 947 |
| 294 | Ga0157372_10263750 | 3300013307 | Bacteria | 2001 |
| 295 | Ga0157372_11572979 | 3300013307 | Bacteria | 757 |
| 296 | Ga0157372_12087796 | 3300013307 | Bacteria | 651 |
| 297 | Ga0157375_10029004 | 3300013308 | Bacteria | 5197 |
| 298 | Ga0157375_10640202 | 3300013308 | Bacteria | 1220 |
| 299 | Ga0157375_11269991 | 3300013308 | Bacteria | 865 |
| 300 | Ga0163163_10002748 | 3300014325 | Bacteria | 14853 |
| 301 | Ga0163163_10075161 | 3300014325 | Bacteria | 3372 |
| 302 | Ga0163163_10117505 | 3300014325 | Bacteria | 2691 |
| 303 | Ga0163163_10193502 | 3300014325 | Bacteria | 2082 |
| 304 | Ga0163163_10266099 | 3300014325 | Bacteria | 1765 |
| 305 | Ga0163163_10455153 | 3300014325 | Bacteria | 1340 |
| 306 | Ga0163163_11149980 | 3300014325 | Bacteria | 839 |
| 307 | Ga0163163_12046427 | 3300014325 | Bacteria | 632 |
| 308 | Ga0157380_10024905 | 3300014326 | Bacteria | 4534 |
| 309 | Ga0157380_10567984 | 3300014326 | Unclassified | 1116 |
| 310 | Ga0157380_11764145 | 3300014326 | Bacteria | 677 |
| 311 | Ga0157377_10527943 | 3300014745 | Bacteria | 830 |
| 312 | Ga0157379_10000582 | 3300014968 | Bacteria | 29612 |
| 313 | Ga0157379_10010612 | 3300014968 | Bacteria | 8028 |
| 314 | Ga0157379_10049267 | 3300014968 | Bacteria | 3760 |
| 315 | Ga0157379_10121930 | 3300014968 | Bacteria | 2346 |
| 316 | Ga0157379_10200286 | 3300014968 | Bacteria | 1806 |
| 317 | Ga0157379_10261561 | 3300014968 | Bacteria | 1572 |
| 318 | Ga0157379_10787852 | 3300014968 | Bacteria | 897 |
| 319 | Ga0157379_11171543 | 3300014968 | Bacteria | 738 |
| 320 | Ga0157376_10051973 | 3300014969 | Bacteria | 3406 |
| 321 | Ga0157376_10064620 | 3300014969 | Bacteria | 3087 |
| 322 | Ga0157376_10439307 | 3300014969 | Bacteria | 1270 |
| 323 | Ga0163161_10307646 | 3300017792 | Unclassified | 1250 |
| 324 | Ga0206356_11287745 | 3300020070 | Bacteria | 863 |
| 325 | Ga0206354_10937309 | 3300020081 | Bacteria | 508 |
| 326 | Ga0213874_10040069 | 3300021377 | Bacteria | 1397 |
| 327 | Ga0213874_10043704 | 3300021377 | Bacteria | 1350 |
| 328 | Ga0213874_10048667 | 3300021377 | Bacteria | 1294 |
| 329 | Ga0213874_10229184 | 3300021377 | Bacteria | 678 |
| 330 | Ga0213876_10288331 | 3300021384 | Bacteria | 872 |
| 331 | Ga0213875_10408700 | 3300021388 | Bacteria | 648 |
| 332 | Ga0213871_10042366 | 3300021441 | Bacteria | 1226 |
| 333 | Ga0228598_1062446 | 3300024227 | Bacteria | 742 |
| 334 | Ga0207696_1036486 | 3300025711 | Bacteria | 1459 |
| 335 | Ga0207692_10087071 | 3300025898 | Bacteria | 1685 |
| 336 | Ga0207692_10156727 | 3300025898 | Bacteria | 1309 |
| 337 | Ga0207692_10705697 | 3300025898 | Bacteria | 655 |
| 338 | Ga0207710_10000320 | 3300025900 | Bacteria | 36737 |
| 339 | Ga0207710_10065156 | 3300025900 | Bacteria | 1660 |
| 340 | Ga0207710_10160165 | 3300025900 | Bacteria | 1096 |
| 341 | Ga0207680_10052405 | 3300025903 | Bacteria | 2445 |
| 342 | Ga0207680_10076197 | 3300025903 | Bacteria | 2094 |
| 343 | Ga0207680_10174449 | 3300025903 | Bacteria | 1450 |
| 344 | Ga0207680_10200947 | 3300025903 | Bacteria | 1358 |
| 345 | Ga0207680_10232373 | 3300025903 | Bacteria | 1268 |
| 346 | Ga0207647_10239782 | 3300025904 | Bacteria | 1041 |
| 347 | Ga0207685_10063333 | 3300025905 | Bacteria | 1473 |
| 348 | Ga0207699_10003645 | 3300025906 | Bacteria | 7357 |
| 349 | Ga0207699_10016940 | 3300025906 | Bacteria | 3823 |
| 350 | Ga0207654_10027563 | 3300025911 | Bacteria | 3089 |
| 351 | Ga0207654_10722380 | 3300025911 | Bacteria | 716 |
| 352 | Ga0207707_10000035 | 3300025912 | Bacteria | 147299 |
| 353 | Ga0207707_10004421 | 3300025912 | Bacteria | 12393 |
| 354 | Ga0207707_10025671 | 3300025912 | Bacteria | 5153 |
| 355 | Ga0207707_10077128 | 3300025912 | Bacteria | 2908 |
| 356 | Ga0207707_10260957 | 3300025912 | Bacteria | 1503 |
| 357 | Ga0207707_10334384 | 3300025912 | Bacteria | 1306 |
| 358 | Ga0207707_11069853 | 3300025912 | Bacteria | 659 |
| 359 | Ga0207695_10031719 | 3300025913 | Bacteria | 5790 |
| 360 | Ga0207695_10040261 | 3300025913 | Bacteria | 5014 |
| 361 | Ga0207695_10043756 | 3300025913 | Bacteria | 4769 |
| 362 | Ga0207695_10059073 | 3300025913 | Bacteria | 3979 |
| 363 | Ga0207695_10062771 | 3300025913 | Bacteria | 3833 |
| 364 | Ga0207695_10066204 | 3300025913 | Bacteria | 3712 |
| 365 | Ga0207695_10067634 | 3300025913 | Bacteria | 3664 |
| 366 | Ga0207695_10099097 | 3300025913 | Bacteria | 2912 |
| 367 | Ga0207695_10199956 | 3300025913 | Bacteria | 1913 |
| 368 | Ga0207695_10421531 | 3300025913 | Bacteria | 1219 |
| 369 | Ga0207695_10432122 | 3300025913 | Bacteria | 1200 |
| 370 | Ga0207695_10802045 | 3300025913 | Bacteria | 822 |
| 371 | Ga0207695_10815337 | 3300025913 | Bacteria | 813 |
| 372 | Ga0207671_10022415 | 3300025914 | Bacteria | 4776 |
| 373 | Ga0207671_10160086 | 3300025914 | Bacteria | 1743 |
| 374 | Ga0207671_10189287 | 3300025914 | Bacteria | 1604 |
| 375 | Ga0207671_10233575 | 3300025914 | Bacteria | 1443 |
| 376 | Ga0207671_11046947 | 3300025914 | Bacteria | 642 |
| 377 | Ga0207693_10001259 | 3300025915 | Bacteria | 22563 |
| 378 | Ga0207693_10075566 | 3300025915 | Bacteria | 2638 |
| 379 | Ga0207693_10246116 | 3300025915 | Bacteria | 1403 |
| 380 | Ga0207693_10355455 | 3300025915 | Bacteria | 1146 |
| 381 | Ga0207693_10568336 | 3300025915 | Bacteria | 884 |
| 382 | Ga0207663_10022310 | 3300025916 | Bacteria | 3617 |
| 383 | Ga0207663_10221701 | 3300025916 | Bacteria | 1376 |
| 384 | Ga0207663_10488107 | 3300025916 | Bacteria | 955 |
| 385 | Ga0207663_10490319 | 3300025916 | Bacteria | 953 |
| 386 | Ga0207663_10609339 | 3300025916 | Bacteria | 859 |
| 387 | Ga0207663_10620350 | 3300025916 | Bacteria | 851 |
| 388 | Ga0207660_10006384 | 3300025917 | Bacteria | 7641 |
| 389 | Ga0207660_10082787 | 3300025917 | Bacteria | 2361 |
| 390 | Ga0207660_10272297 | 3300025917 | Bacteria | 1342 |
| 391 | Ga0207660_11026652 | 3300025917 | Bacteria | 672 |
| 392 | Ga0207657_10284194 | 3300025919 | Bacteria | 1313 |
| 393 | Ga0207652_10001083 | 3300025921 | Bacteria | 24670 |
| 394 | Ga0207652_10017401 | 3300025921 | Bacteria | 5883 |
| 395 | Ga0207652_10330057 | 3300025921 | Bacteria | 1377 |
| 396 | Ga0207652_10957708 | 3300025921 | Bacteria | 754 |
| 397 | Ga0207652_11142665 | 3300025921 | Bacteria | 680 |
| 398 | Ga0207681_10515536 | 3300025923 | Bacteria | 981 |
| 399 | Ga0207694_10028754 | 3300025924 | Bacteria | 4239 |
| 400 | Ga0207694_10190183 | 3300025924 | Bacteria | 1667 |
| 401 | Ga0207694_10581861 | 3300025924 | Bacteria | 941 |
| 402 | Ga0207694_10961267 | 3300025924 | Bacteria | 723 |
| 403 | Ga0207650_10969194 | 3300025925 | Bacteria | 723 |
| 404 | Ga0207659_10798925 | 3300025926 | Bacteria | 810 |
| 405 | Ga0207687_10014344 | 3300025927 | Bacteria | 5184 |
| 406 | Ga0207687_10175116 | 3300025927 | Bacteria | 1658 |
| 407 | Ga0207700_10039865 | 3300025928 | Bacteria | 3423 |
| 408 | Ga0207700_10173111 | 3300025928 | Bacteria | 1802 |
| 409 | Ga0207700_10199543 | 3300025928 | Bacteria | 1685 |
| 410 | Ga0207700_10205613 | 3300025928 | Bacteria | 1661 |
| 411 | Ga0207700_11182294 | 3300025928 | Bacteria | 683 |
| 412 | Ga0207700_11296024 | 3300025928 | Bacteria | 649 |
| 413 | Ga0207664_10036157 | 3300025929 | Bacteria | 3816 |
| 414 | Ga0207664_10252419 | 3300025929 | Bacteria | 1540 |
| 415 | Ga0207664_10900555 | 3300025929 | Bacteria | 794 |
| 416 | Ga0207644_10009259 | 3300025931 | Bacteria | 6461 |
| 417 | Ga0207644_10068469 | 3300025931 | Bacteria | 2589 |
| 418 | Ga0207644_11303807 | 3300025931 | Unclassified | 610 |
| 419 | Ga0207686_10609454 | 3300025934 | Unclassified | 860 |
| 420 | Ga0207670_10005228 | 3300025936 | Bacteria | 7104 |
| 421 | Ga0207704_10103157 | 3300025938 | Bacteria | 1907 |
| 422 | Ga0207704_10389441 | 3300025938 | Bacteria | 1096 |
| 423 | Ga0207665_10001212 | 3300025939 | Bacteria | 17417 |
| 424 | Ga0207665_10013006 | 3300025939 | Bacteria | 5468 |
| 425 | Ga0207665_10358106 | 3300025939 | Bacteria | 1103 |
| 426 | Ga0207665_11617624 | 3300025939 | Bacteria | 513 |
| 427 | Ga0207691_10149514 | 3300025940 | Bacteria | 2054 |
| 428 | Ga0207711_10003478 | 3300025941 | Bacteria | 13625 |
| 429 | Ga0207711_10029910 | 3300025941 | Bacteria | 4594 |
| 430 | Ga0207711_10251479 | 3300025941 | Bacteria | 1623 |
| 431 | Ga0207711_10713035 | 3300025941 | Bacteria | 935 |
| 432 | Ga0207711_11536130 | 3300025941 | Bacteria | 609 |
| 433 | Ga0207689_10172418 | 3300025942 | Bacteria | 1784 |
| 434 | Ga0207689_10214579 | 3300025942 | Bacteria | 1590 |
| 435 | Ga0207689_10469704 | 3300025942 | Bacteria | 1052 |
| 436 | Ga0207689_10510256 | 3300025942 | Bacteria | 1008 |
| 437 | Ga0207689_10647041 | 3300025942 | Unclassified | 890 |
| 438 | Ga0207661_10182731 | 3300025944 | Bacteria | 1833 |
| 439 | Ga0207661_10817931 | 3300025944 | Bacteria | 858 |
| 440 | Ga0207661_10875377 | 3300025944 | Bacteria | 827 |
| 441 | Ga0207679_10378967 | 3300025945 | Bacteria | 1240 |
| 442 | Ga0207667_10005372 | 3300025949 | Bacteria | 15620 |
| 443 | Ga0207667_10036086 | 3300025949 | Bacteria | 5301 |
| 444 | Ga0207667_10370422 | 3300025949 | Bacteria | 1460 |
| 445 | Ga0207667_10502117 | 3300025949 | Bacteria | 1230 |
| 446 | Ga0207667_10994899 | 3300025949 | Bacteria | 826 |
| 447 | Ga0207667_11040895 | 3300025949 | Bacteria | 804 |
| 448 | Ga0207651_11841510 | 3300025960 | Bacteria | 544 |
| 449 | Ga0207712_10053501 | 3300025961 | Bacteria | 2832 |
| 450 | Ga0207712_10112562 | 3300025961 | Bacteria | 2044 |
| 451 | Ga0207668_11357845 | 3300025972 | Bacteria | 640 |
| 452 | Ga0207668_11450915 | 3300025972 | Bacteria | 619 |
| 453 | Ga0207640_10166815 | 3300025981 | Bacteria | 1636 |
| 454 | Ga0207640_10183589 | 3300025981 | Bacteria | 1570 |
| 455 | Ga0207640_10882483 | 3300025981 | Bacteria | 780 |
| 456 | Ga0207658_10000139 | 3300025986 | Bacteria | 76554 |
| 457 | Ga0207658_10018255 | 3300025986 | Bacteria | 4840 |
| 458 | Ga0207658_10144009 | 3300025986 | Bacteria | 1932 |
| 459 | Ga0207658_10176543 | 3300025986 | Bacteria | 1764 |
| 460 | Ga0207658_10220902 | 3300025986 | Bacteria | 1594 |
| 461 | Ga0207658_11512625 | 3300025986 | Bacteria | 614 |
| 462 | Ga0207677_10074919 | 3300026023 | Bacteria | 2403 |
| 463 | Ga0207677_10219003 | 3300026023 | Bacteria | 1525 |
| 464 | Ga0207677_10728625 | 3300026023 | Unclassified | 882 |
| 465 | Ga0207703_10001986 | 3300026035 | Bacteria | 18033 |
| 466 | Ga0207703_10003361 | 3300026035 | Bacteria | 13440 |
| 467 | Ga0207703_10007484 | 3300026035 | Bacteria | 8673 |
| 468 | Ga0207703_10271969 | 3300026035 | Bacteria | 1535 |
| 469 | Ga0207703_10394831 | 3300026035 | Bacteria | 1282 |
| 470 | Ga0207703_11057990 | 3300026035 | Bacteria | 779 |
| 471 | Ga0207639_10432162 | 3300026041 | Bacteria | 1192 |
| 472 | Ga0207678_10118093 | 3300026067 | Bacteria | 2263 |
| 473 | Ga0207708_10073669 | 3300026075 | Bacteria | 2617 |
| 474 | Ga0207702_10035788 | 3300026078 | Bacteria | 4151 |
| 475 | Ga0207702_10067929 | 3300026078 | Bacteria | 3061 |
| 476 | Ga0207702_10307906 | 3300026078 | Bacteria | 1505 |
| 477 | Ga0207702_11126189 | 3300026078 | Bacteria | 779 |
| 478 | Ga0207641_10005250 | 3300026088 | Bacteria | 11073 |
| 479 | Ga0207641_10108148 | 3300026088 | Bacteria | 2461 |
| 480 | Ga0207641_11188249 | 3300026088 | Bacteria | 762 |
| 481 | Ga0207648_10078310 | 3300026089 | Bacteria | 2883 |
| 482 | Ga0207648_10277990 | 3300026089 | Bacteria | 1497 |
| 483 | Ga0207676_10022747 | 3300026095 | Bacteria | 4614 |
| 484 | Ga0207676_10185792 | 3300026095 | Bacteria | 1824 |
| 485 | Ga0207674_10119171 | 3300026116 | Bacteria | 2608 |
| 486 | Ga0207674_10785713 | 3300026116 | Bacteria | 919 |
| 487 | Ga0207675_100003083 | 3300026118 | Bacteria | 16329 |
| 488 | Ga0207675_100062001 | 3300026118 | Bacteria | 3491 |
| 489 | Ga0207675_100530375 | 3300026118 | Bacteria | 1175 |
| 490 | Ga0207675_100606292 | 3300026118 | Bacteria | 1098 |
| 491 | Ga0207698_10365862 | 3300026142 | Bacteria | 1367 |
| 492 | Ga0207698_10975621 | 3300026142 | Bacteria | 857 |
| 493 | Ga0209967_1020570 | 3300027364 | Bacteria | 961 |
| 494 | Ga0209179_1000088 | 3300027512 | Bacteria | 13573 |
| 495 | Ga0209974_10169935 | 3300027876 | Bacteria | 794 |
| 496 | Ga0265354_1002482 | 3300028016 | Bacteria | 2271 |
| 497 | Ga0265356_1001181 | 3300028017 | Bacteria | 3997 |
| 498 | Ga0268266_10002207 | 3300028379 | Bacteria | 21293 |
| 499 | Ga0268266_10004715 | 3300028379 | Bacteria | 12970 |
| 500 | Ga0268266_10005644 | 3300028379 | Bacteria | 11607 |
| 501 | Ga0268266_10030435 | 3300028379 | Bacteria | 4586 |
| 502 | Ga0268266_10056362 | 3300028379 | Bacteria | 3381 |
| 503 | Ga0268266_10099979 | 3300028379 | Bacteria | 2554 |
| 504 | Ga0268266_10104733 | 3300028379 | Bacteria | 2498 |
| 505 | Ga0268265_10010696 | 3300028380 | Bacteria | 6194 |
| 506 | Ga0268265_10350151 | 3300028380 | Bacteria | 1348 |
| 507 | Ga0268265_10622040 | 3300028380 | Bacteria | 1035 |
| 508 | Ga0268265_10674563 | 3300028380 | Bacteria | 996 |
| 509 | Ga0268264_10001054 | 3300028381 | Bacteria | 27425 |
| 510 | Ga0268264_10012665 | 3300028381 | Bacteria | 6943 |
| 511 | Ga0268264_10014823 | 3300028381 | Bacteria | 6402 |
| 512 | Ga0268264_10039821 | 3300028381 | Bacteria | 3882 |
| 513 | Ga0268264_10258379 | 3300028381 | Bacteria | 1621 |
| 514 | Ga0265326_10040931 | 3300028558 | Bacteria | 1316 |
| 515 | Ga0265319_1022664 | 3300028563 | Bacteria | 2284 |
| 516 | Ga0265334_10001296 | 3300028573 | Bacteria | 12069 |
| 517 | Ga0265334_10010492 | 3300028573 | Bacteria | 3911 |
| 518 | Ga0265318_10000970 | 3300028577 | Bacteria | 18415 |
| 519 | Ga0265318_10109412 | 3300028577 | Bacteria | 1016 |
| 520 | Ga0265336_10225419 | 3300028666 | Bacteria | 557 |
| 521 | Ga0307515_10002500 | 3300028794 | Bacteria | 39832 |
| 522 | Ga0307515_10131709 | 3300028794 | Bacteria | 2748 |
| 523 | Ga0265338_10024866 | 3300028800 | Bacteria | 6102 |
| 524 | Ga0265338_10312085 | 3300028800 | Bacteria | 1140 |
| 525 | Ga0265338_10885675 | 3300028800 | Bacteria | 608 |
| 526 | Ga0307511_10000066 | 3300030521 | Bacteria | 87505 |
| 527 | Ga0307511_10012157 | 3300030521 | Bacteria | 8456 |
| 528 | Ga0265763_1017956 | 3300030763 | Bacteria | 722 |
| 529 | Ga0265770_1001320 | 3300030878 | Bacteria | 3428 |
| 530 | Ga0265765_1012300 | 3300030879 | Bacteria | 969 |
| 531 | Ga0265760_10000720 | 3300031090 | Bacteria | 9414 |
| 532 | Ga0265760_10026183 | 3300031090 | Bacteria | 1705 |
| 533 | Ga0265760_10075870 | 3300031090 | Bacteria | 1036 |
| 534 | Ga0265330_10004467 | 3300031235 | Bacteria | 7094 |
| 535 | Ga0265332_10009507 | 3300031238 | Bacteria | 4338 |
| 536 | Ga0265332_10198964 | 3300031238 | Bacteria | 833 |
| 537 | Ga0265328_10013642 | 3300031239 | Bacteria | 3212 |
| 538 | Ga0265320_10018704 | 3300031240 | Bacteria | 3806 |
| 539 | Ga0265325_10008410 | 3300031241 | Bacteria | 6093 |
| 540 | Ga0265329_10005810 | 3300031242 | Bacteria | 4953 |
| 541 | Ga0265340_10031639 | 3300031247 | Bacteria | 2645 |
| 542 | Ga0265340_10038550 | 3300031247 | Bacteria | 2363 |
| 543 | Ga0265340_10441535 | 3300031247 | Bacteria | 573 |
| 544 | Ga0265339_10065346 | 3300031249 | Bacteria | 1950 |
| 545 | Ga0265331_10002949 | 3300031250 | Bacteria | 11215 |
| 546 | Ga0265331_10095627 | 3300031250 | Bacteria | 1370 |
| 547 | Ga0265331_10302520 | 3300031250 | Bacteria | 716 |
| 548 | Ga0265327_10057572 | 3300031251 | Bacteria | 1999 |
| 549 | Ga0265316_10010397 | 3300031344 | Bacteria | 8485 |
| 550 | Ga0265316_10204738 | 3300031344 | Bacteria | 1462 |
| 551 | Ga0307509_10000496 | 3300031507 | Bacteria | 66653 |
| 552 | Ga0307509_10109775 | 3300031507 | Bacteria | 2767 |
| 553 | Ga0307408_100038042 | 3300031548 | Bacteria | 3393 |
| 554 | Ga0265313_10016110 | 3300031595 | Bacteria | 4315 |
| 555 | Ga0265313_10134762 | 3300031595 | Bacteria | 1067 |
| 556 | Ga0307508_10337435 | 3300031616 | Bacteria | 1099 |
| 557 | Ga0316575_10078350 | 3300031665 | Bacteria | 1331 |
| 558 | Ga0265314_10003891 | 3300031711 | Bacteria | 14193 |
| 559 | Ga0265342_10038857 | 3300031712 | Bacteria | 2895 |
| 560 | Ga0265342_10475720 | 3300031712 | Bacteria | 639 |
| 561 | Ga0316576_10138818 | 3300031727 | Bacteria | 1829 |
| 562 | Ga0316578_10397641 | 3300031728 | Bacteria | 817 |
| 563 | Ga0307516_10001009 | 3300031730 | Bacteria | 39000 |
| 564 | Ga0307406_10146156 | 3300031901 | Bacteria | 1680 |
| 565 | Ga0307407_10158143 | 3300031903 | Bacteria | 1480 |
| 566 | Ga0307412_10689602 | 3300031911 | Bacteria | 875 |
| 567 | Ga0307416_100662573 | 3300032002 | Bacteria | 1129 |
| 568 | Ga0307416_100740068 | 3300032002 | Bacteria | 1075 |
| 569 | Ga0307411_10280703 | 3300032005 | Bacteria | 1325 |
| 570 | Ga0307415_100018502 | 3300032126 | Bacteria | 4209 |
| 571 | Ga0307415_100377258 | 3300032126 | Bacteria | 1203 |
| 572 | Ga0307507_10229823 | 3300033179 | Bacteria | 1232 |
| 573 | Ga0307510_10000001 | 3300033180 | Bacteria | 1172244 |
| 574 | Ga0316212_1066833 | 3300033547 | Bacteria | 521 |
| 575 | Ga0373923_0097517 | 3300035111 | Bacteria | 1293 |
| 576 | Ga0373936_0016039 | 3300035113 | Bacteria | 2877 |
| 577 | Ga0373954_0077143 | 3300035118 | Bacteria | 1589 |
| 578 | Ga0373943_0772331 | 3300035170 | Bacteria | 571 |
| 579 | Ga0373955_0423686 | 3300035172 | Bacteria | 810 |
| 580 | Ga0316574_0066701 | 3300035398 | Bacteria | 2268 |
| 581 | Ga0316574_0139046 | 3300035398 | Bacteria | 1564 |
| 582 | Ga0373924_0215296 | 3300035410 | Bacteria | 848 |
| 583 | Ga0373927_0127414 | 3300035695 | Bacteria | 1662 |
| 584 | Ga0373933_0741189 | 3300035724 | Bacteria | 646 |
| 585 | Ga0373947_0794918 | 3300035725 | Bacteria | 646 |
| 586 | Ga0373937_0462339 | 3300036401 | Bacteria | 1205 |
| 587 | Ga0373937_1815489 | 3300036401 | Bacteria | 556 |
| 588 | Ga0316582_0425747 | 3300036647 | Bacteria | 915 |
| 589 | Ga0316584_0116776 | 3300036712 | Bacteria | 1995 |
| 590 | Ga0373925_0969840 | 3300037068 | Bacteria | 700 |
| 591 | Ga0373925_1078075 | 3300037068 | Bacteria | 661 |
| 592 | Ga0395900_0066787 | 3300037418 | Bacteria | 3696 |
| 593 | Ga0395898_0069935 | 3300037466 | Bacteria | 3395 |
| 594 | Ga0395898_0091471 | 3300037466 | Bacteria | 2927 |
| 595 | Ga0395898_0405885 | 3300037466 | Bacteria | 1299 |
| 596 | Ga0395898_1392611 | 3300037466 | Bacteria | 629 |
| 597 | Ga0436364_0323462 | 3300037853 | Bacteria | 904 |
| 598 | Ga0436365_0811138 | 3300039437 | Bacteria | 1420 |
| 599 | Ga0436365_1364122 | 3300039437 | Bacteria | 537 |
| 600 | Ga0436365_1698314 | 3300039437 | Bacteria | 6820 |
| 601 | Ga0436365_1764508 | 3300039437 | Bacteria | 1670 |
| 602 | Ga0436360_1074362 | 3300039438 | Bacteria | 914 |
| 603 | Ga0436360_1219824 | 3300039438 | Unclassified | 955 |
| 604 | Ga0436361_0420316 | 3300039447 | Bacteria | 1990 |
| 605 | Ga0436361_0425201 | 3300039447 | Bacteria | 1358 |
| 606 | Ga0436363_0025065 | 3300039450 | Bacteria | 2048 |
| 607 | Ga0436363_0243183 | 3300039450 | Bacteria | 2355 |
| 608 | Ga0436363_0733063 | 3300039450 | Bacteria | 4654 |
| 609 | Ga0436363_0733334 | 3300039450 | Bacteria | 1258 |
| 610 | Ga0436363_0742457 | 3300039450 | Bacteria | 3619 |
| 611 | Ga0436363_1611612 | 3300039450 | Bacteria | 597 |
| 612 | Ga0436362_0030616 | 3300039453 | Bacteria | 1771 |
| 613 | Ga0436362_0800989 | 3300039453 | Bacteria | 1434 |
| 614 | Ga0436362_1290881 | 3300039453 | Bacteria | 1159 |
| 615 | Ga0439431_0047146 | 3300041997 | Bacteria | 1110 |
| 616 | Ga0439433_0079053 | 3300041999 | Bacteria | 798 |
| 617 | Ga0439456_019865 | 3300042013 | Bacteria | 1414 |
| 618 | Ga0450920_005165 | 3300042122 | Bacteria | 2314 |
| 619 | Ga0450920_026771 | 3300042122 | Bacteria | 1126 |
| 620 | Ga0450922_015132 | 3300042124 | Bacteria | 765 |
| 621 | Ga0450923_019512 | 3300042125 | Bacteria | 1307 |
| 622 | Ga0450895_000039 | 3300042132 | Bacteria | 4651 |
| 623 | Ga0450906_030803 | 3300042145 | Bacteria | 948 |
| 624 | Ga0450907_010162 | 3300042146 | Bacteria | 1562 |
| 625 | Ga0439446_0027722 | 3300042156 | Bacteria | 1627 |
| 626 | Ga0450908_005018 | 3300042184 | Bacteria | 2541 |
| 627 | Ga0439434_0057049 | 3300042435 | Bacteria | 1217 |
| 628 | Ga0439435_0000842 | 3300042436 | Bacteria | 5252 |
| 629 | Ga0439444_0030052 | 3300042437 | Bacteria | 1015 |
| 630 | Ga0439460_0006230 | 3300042461 | Bacteria | 2953 |
| 631 | Ga0451577_0000101 | 3300042876 | Bacteria | 190854 |
| 632 | Ga0451577_0055780 | 3300042876 | Bacteria | 3524 |
| 633 | Ga0451577_1230462 | 3300042876 | Bacteria | 667 |
| 634 | Ga0466969_0001578 | 3300044656 | Bacteria | 12182 |
| 635 | Ga0466969_0087034 | 3300044656 | Bacteria | 1484 |
| 636 | Ga0466969_0417996 | 3300044656 | Bacteria | 609 |
| 637 | Ga0466966_0025133 | 3300044684 | Bacteria | 3892 |
| 638 | Ga0466961_0798365 | 3300044693 | Bacteria | 563 |
| 639 | Ga0466964_0206264 | 3300044706 | Bacteria | 947 |
| 640 | Ga0466964_0522597 | 3300044706 | Bacteria | 640 |
| 641 | Ga0453684_0002015 | 3300044712 | Bacteria | 51956 |
| 642 | Ga0453684_0244515 | 3300044712 | Bacteria | 2064 |
| 643 | Ga0453684_0547270 | 3300044712 | Bacteria | 1275 |
| 644 | Ga0466970_0394280 | 3300044765 | Unclassified | 789 |
| 645 | Ga0466960_0321552 | 3300044901 | Unclassified | 876 |
| 646 | Ga0466959_0011430 | 3300045049 | Bacteria | 6380 |
| 647 | Ga0466959_0015538 | 3300045049 | Bacteria | 5548 |
| 648 | Ga0466959_0016482 | 3300045049 | Bacteria | 5400 |
| 649 | Ga0466959_0264212 | 3300045049 | Bacteria | 1184 |
| 650 | Ga0466958_0065843 | 3300045836 | Bacteria | 2211 |
| 651 | Ga0466958_0870591 | 3300045836 | Bacteria | 588 |
| 652 | Ga0466967_0627637 | 3300045976 | Bacteria | 1062 |
| 653 | Ga0466967_0738357 | 3300045976 | Bacteria | 976 |
| 654 | Ga0495629_0374538 | 3300046459 | Bacteria | 969 |
| 655 | Ga0495638_0208291 | 3300046460 | Bacteria | 1100 |
| 656 | Ga0495651_0364949 | 3300046462 | Bacteria | 951 |
| 657 | Ga0495580_0020927 | 3300046472 | Bacteria | 4831 |
| 658 | Ga0495580_0101265 | 3300046472 | Bacteria | 2003 |
| 659 | Ga0495580_0203298 | 3300046472 | Bacteria | 1364 |
| 660 | Ga0495582_0668512 | 3300046473 | Bacteria | 601 |
| 661 | Ga0495583_0187288 | 3300046506 | Bacteria | 845 |
| 662 | Ga0495583_0288741 | 3300046506 | Bacteria | 653 |
| 663 | Ga0495606_0160974 | 3300046507 | Bacteria | 1309 |
| 664 | Ga0495606_0259241 | 3300046507 | Bacteria | 960 |
| 665 | Ga0495630_0118803 | 3300046517 | Bacteria | 2005 |
| 666 | Ga0495632_0019330 | 3300046519 | Bacteria | 3715 |
| 667 | Ga0495632_0132119 | 3300046519 | Bacteria | 1161 |
| 668 | Ga0495648_0300152 | 3300046524 | Bacteria | 753 |
| 669 | Ga0495645_0305028 | 3300046543 | Bacteria | 1039 |
| 670 | Ga0495622_0094034 | 3300046557 | Bacteria | 1376 |
| 671 | Ga0495656_0398380 | 3300046615 | Bacteria | 720 |
| 672 | Ga0495668_0627367 | 3300046616 | Bacteria | 594 |
| 673 | Ga0495611_0317345 | 3300046648 | Bacteria | 717 |
| 674 | Ga0495659_0070518 | 3300046664 | Bacteria | 1308 |
| 675 | Ga0495623_0194501 | 3300046679 | Bacteria | 1170 |
| 676 | Ga0495658_0476885 | 3300046683 | Bacteria | 798 |
| 677 | Ga0495671_0029334 | 3300046692 | Bacteria | 2826 |
| 678 | Ga0495581_0276017 | 3300047315 | Bacteria | 983 |
| 679 | Ga0495674_0174955 | 3300047319 | Bacteria | 1789 |
| 680 | Ga0495687_062257 | 3300047443 | Bacteria | 1532 |
| 681 | Ga0495602_1104086 | 3300048088 | Bacteria | 520 |
| 682 | Ga0496100_0003421 | 3300048903 | Bacteria | 8270 |
| 683 | Ga0496100_0564579 | 3300048903 | Bacteria | 881 |
| 684 | Ga0496101_0148273 | 3300048904 | Bacteria | 1793 |
| 685 | Ga0496101_0462655 | 3300048904 | Bacteria | 1001 |
| 686 | Ga0496102_0014589 | 3300048905 | Bacteria | 6829 |
| 687 | Ga0496102_0035957 | 3300048905 | Bacteria | 4460 |
| 688 | Ga0496102_0097264 | 3300048905 | Bacteria | 2730 |
| 689 | Ga0496103_0081805 | 3300048906 | Bacteria | 2032 |
| 690 | Ga0496103_0112470 | 3300048906 | Bacteria | 1730 |
| 691 | Ga0496103_0117244 | 3300048906 | Bacteria | 1694 |
| 692 | Ga0496104_0003285 | 3300048907 | Bacteria | 13956 |
| 693 | Ga0496104_0024629 | 3300048907 | Bacteria | 5537 |
| 694 | Ga0496104_0135313 | 3300048907 | Bacteria | 2367 |
| 695 | Ga0496104_0441716 | 3300048907 | Bacteria | 1213 |
| 696 | Ga0496105_0157676 | 3300048908 | Bacteria | 1864 |
| 697 | Ga0496105_0176744 | 3300048908 | Bacteria | 1748 |
| 698 | Ga0496106_0010002 | 3300048909 | Bacteria | 7006 |
| 699 | Ga0496107_0015484 | 3300048910 | Bacteria | 5347 |
| 700 | Ga0496107_0414265 | 3300048910 | Bacteria | 1002 |
| 701 | Ga0496108_0002984 | 3300048911 | Bacteria | 13596 |
| 702 | Ga0496108_0068793 | 3300048911 | Bacteria | 2987 |
| 703 | Ga0496108_0871867 | 3300048911 | Bacteria | 774 |
| 704 | Ga0496109_0038058 | 3300048912 | Bacteria | 4348 |
| 705 | Ga0496109_0038409 | 3300048912 | Bacteria | 4328 |
| 706 | Ga0496110_0022533 | 3300048913 | Bacteria | 5349 |
| 707 | Ga0496110_0057284 | 3300048913 | Bacteria | 3430 |
| 708 | Ga0496110_1612770 | 3300048913 | Bacteria | 559 |
| 709 | Ga0496111_0003939 | 3300048914 | Bacteria | 9313 |
| 710 | Ga0496112_0163336 | 3300048915 | Bacteria | 2193 |
| 711 | Ga0496112_0175484 | 3300048915 | Bacteria | 2108 |
| 712 | Ga0496112_0500225 | 3300048915 | Bacteria | 1151 |
| 713 | Ga0496113_1547296 | 3300048916 | Bacteria | 511 |
| 714 | Ga0496113_1549371 | 3300048916 | Bacteria | 511 |
| 715 | Ga0496114_0087990 | 3300048917 | Bacteria | 2634 |
| 716 | Ga0496114_0564083 | 3300048917 | Bacteria | 1005 |
| 717 | Ga0496115_0040294 | 3300048918 | Bacteria | 3712 |
| 718 | Ga0496115_0217085 | 3300048918 | Bacteria | 1579 |
| 719 | Ga0496115_0364467 | 3300048918 | Bacteria | 1177 |
| 720 | Ga0496117_0000155 | 3300048920 | Bacteria | 146091 |
| 721 | Ga0496118_0000066 | 3300048921 | Bacteria | 207678 |
| 722 | Ga0496118_0114050 | 3300048921 | Bacteria | 1783 |
| 723 | Ga0496118_0330067 | 3300048921 | Bacteria | 823 |
| 724 | Ga0496119_0026335 | 3300048922 | Bacteria | 4034 |
| 725 | Ga0496119_0028215 | 3300048922 | Bacteria | 3836 |
| 726 | Ga0496120_0001239 | 3300048923 | Bacteria | 32260 |
| 727 | Ga0496120_0111963 | 3300048923 | Bacteria | 1424 |
| 728 | Ga0496121_0001415 | 3300048924 | Bacteria | 40652 |
| 729 | Ga0496121_0031058 | 3300048924 | Bacteria | 4892 |
| 730 | Ga0496121_0052573 | 3300048924 | Bacteria | 3419 |
| 731 | Ga0496124_0079173 | 3300048927 | Bacteria | 2706 |
| 732 | Ga0496124_0856585 | 3300048927 | Bacteria | 556 |
| 733 | Ga0496125_0000415 | 3300048928 | Bacteria | 79627 |
| 734 | Ga0496125_0043237 | 3300048928 | Bacteria | 3827 |
| 735 | Ga0496125_0047679 | 3300048928 | Bacteria | 3580 |
| 736 | Ga0496126_0007065 | 3300048929 | Bacteria | 12369 |
| 737 | Ga0496126_0016741 | 3300048929 | Bacteria | 7321 |
| 738 | Ga0496126_0048773 | 3300048929 | Bacteria | 3868 |
| 739 | Ga0496126_0355238 | 3300048929 | Bacteria | 1198 |
| 740 | Ga0496126_0762565 | 3300048929 | Bacteria | 746 |
| 741 | Ga0495682_0074098 | 3300049460 | Bacteria | 1225 |
| 742 | Ga0495682_0186358 | 3300049460 | Bacteria | 737 |
| 743 | Ga0501031_0057829 | 3300049568 | Bacteria | 2527 |
| 744 | Ga0501032_0132710 | 3300049569 | Bacteria | 1642 |
| 745 | Ga0501032_0139263 | 3300049569 | Bacteria | 1598 |
| 746 | Ga0501032_0209005 | 3300049569 | Bacteria | 1273 |
| 747 | Ga0501033_0059304 | 3300049570 | Bacteria | 2826 |
| 748 | Ga0501033_0344630 | 3300049570 | Bacteria | 1044 |
| 749 | Ga0501036_0018575 | 3300049572 | Bacteria | 5828 |
| 750 | Ga0501036_0037096 | 3300049572 | Bacteria | 4123 |
| 751 | Ga0501036_1311525 | 3300049572 | Unclassified | 588 |
| 752 | Ga0501038_0012616 | 3300049574 | Bacteria | 7723 |
| 753 | Ga0501038_0648616 | 3300049574 | Bacteria | 795 |
| 754 | Ga0501038_0943045 | 3300049574 | Bacteria | 636 |
| 755 | Ga0501039_0001832 | 3300049575 | Bacteria | 15714 |
| 756 | Ga0501039_0005303 | 3300049575 | Bacteria | 9749 |
| 757 | Ga0501039_0048456 | 3300049575 | Bacteria | 3284 |
| 758 | Ga0501039_0256663 | 3300049575 | Bacteria | 1374 |
| 759 | Ga0501040_0014175 | 3300049576 | Bacteria | 5247 |
| 760 | Ga0501040_0030747 | 3300049576 | Bacteria | 3628 |
| 761 | Ga0501040_0031219 | 3300049576 | Bacteria | 3598 |
| 762 | Ga0501040_0185959 | 3300049576 | Bacteria | 1473 |
| 763 | Ga0501040_0255098 | 3300049576 | Bacteria | 1251 |
| 764 | Ga0501041_0001509 | 3300049577 | Bacteria | 12911 |
| 765 | Ga0501041_0005823 | 3300049577 | Bacteria | 7208 |
| 766 | Ga0501041_0151525 | 3300049577 | Bacteria | 1448 |
| 767 | Ga0501042_0001503 | 3300049578 | Bacteria | 13773 |
| 768 | Ga0501042_0004957 | 3300049578 | Bacteria | 8522 |
| 769 | Ga0501042_0078194 | 3300049578 | Bacteria | 2369 |
| 770 | Ga0501042_0354410 | 3300049578 | Bacteria | 1061 |
| 771 | Ga0501043_0288394 | 3300049579 | Bacteria | 1257 |
| 772 | Ga0501046_0058287 | 3300049580 | Bacteria | 3028 |
| 773 | Ga0501046_0100418 | 3300049580 | Bacteria | 2220 |
| 774 | Ga0501046_0195637 | 3300049580 | Bacteria | 1506 |
| 775 | Ga0501047_0362216 | 3300049581 | Bacteria | 1286 |
| 776 | Ga0501047_0847517 | 3300049581 | Bacteria | 728 |
| 777 | Ga0501048_0001334 | 3300049582 | Bacteria | 18712 |
| 778 | Ga0501048_0008534 | 3300049582 | Bacteria | 7746 |
| 779 | Ga0501048_0990326 | 3300049582 | Bacteria | 605 |
| 780 | Ga0501067_0009294 | 3300049583 | Bacteria | 5446 |
| 781 | Ga0501068_0006468 | 3300049584 | Bacteria | 6462 |
| 782 | Ga0501068_0049799 | 3300049584 | Bacteria | 2531 |
| 783 | Ga0501068_0241310 | 3300049584 | Bacteria | 1150 |
| 784 | Ga0501068_0269980 | 3300049584 | Bacteria | 1086 |
| 785 | Ga0501069_0975679 | 3300049585 | Bacteria | 517 |
| 786 | Ga0501070_0798782 | 3300049586 | Bacteria | 741 |
| 787 | Ga0501071_0009214 | 3300049587 | Bacteria | 6562 |
| 788 | Ga0501071_0009637 | 3300049587 | Bacteria | 6446 |
| 789 | Ga0501071_0026939 | 3300049587 | Bacteria | 4040 |
| 790 | Ga0501071_1521820 | 3300049587 | Unclassified | 516 |
| 791 | Ga0501072_0000744 | 3300049588 | Bacteria | 23769 |
| 792 | Ga0501072_0006549 | 3300049588 | Bacteria | 8871 |
| 793 | Ga0501072_0016843 | 3300049588 | Bacteria | 5615 |
| 794 | Ga0501072_0061615 | 3300049588 | Bacteria | 2959 |
| 795 | Ga0501072_1320773 | 3300049588 | Unclassified | 559 |
| 796 | Ga0501073_0008298 | 3300049589 | Bacteria | 7704 |
| 797 | Ga0501073_0110406 | 3300049589 | Bacteria | 1908 |
| 798 | Ga0501073_0286885 | 3300049589 | Bacteria | 1136 |
| 799 | Ga0501073_0544198 | 3300049589 | Bacteria | 802 |
| 800 | Ga0501074_0028072 | 3300049590 | Bacteria | 4079 |
| 801 | Ga0501074_0030789 | 3300049590 | Bacteria | 3888 |
| 802 | Ga0501074_0045148 | 3300049590 | Bacteria | 3188 |
| 803 | Ga0501074_0311060 | 3300049590 | Bacteria | 1119 |
| 804 | Ga0501075_0002627 | 3300049591 | Bacteria | 12000 |
| 805 | Ga0501075_0027821 | 3300049591 | Bacteria | 4168 |
| 806 | Ga0501075_0159190 | 3300049591 | Bacteria | 1722 |
| 807 | Ga0501075_0201508 | 3300049591 | Bacteria | 1518 |
| 808 | Ga0501075_0305014 | 3300049591 | Bacteria | 1213 |
| 809 | Ga0501076_0030995 | 3300049592 | Bacteria | 4167 |
| 810 | Ga0501076_0036163 | 3300049592 | Bacteria | 3868 |
| 811 | Ga0501076_0053393 | 3300049592 | Bacteria | 3202 |
| 812 | Ga0501076_0112209 | 3300049592 | Bacteria | 2205 |
| 813 | Ga0501076_0256253 | 3300049592 | Bacteria | 1432 |
| 814 | Ga0501076_1520651 | 3300049592 | Bacteria | 549 |
| 815 | Ga0501077_0261235 | 3300049593 | Bacteria | 1101 |
| 816 | Ga0501077_0580505 | 3300049593 | Bacteria | 720 |
| 817 | Ga0501079_0015313 | 3300049741 | Bacteria | 5849 |
| 818 | Ga0501079_0054259 | 3300049741 | Bacteria | 3091 |
| 819 | Ga0501079_0106390 | 3300049741 | Bacteria | 2177 |
| 820 | Ga0501079_0216027 | 3300049741 | Bacteria | 1498 |
| 821 | Ga0501079_0219707 | 3300049741 | Bacteria | 1484 |
| 822 | Ga0501079_0301630 | 3300049741 | Bacteria | 1253 |
| 823 | Ga0501080_0005054 | 3300049742 | Bacteria | 11750 |
| 824 | Ga0501080_0014418 | 3300049742 | Bacteria | 7279 |
| 825 | Ga0501080_0014682 | 3300049742 | Bacteria | 7211 |
| 826 | Ga0501080_0335348 | 3300049742 | Bacteria | 1367 |
| 827 | Ga0501081_0002058 | 3300049743 | Bacteria | 12549 |
| 828 | Ga0501081_0014404 | 3300049743 | Bacteria | 5216 |
| 829 | Ga0501081_0071309 | 3300049743 | Bacteria | 2421 |
| 830 | Ga0501081_0845933 | 3300049743 | Bacteria | 689 |
| 831 | Ga0501081_1218591 | 3300049743 | Unclassified | 570 |
| 832 | Ga0501083_0022909 | 3300049744 | Bacteria | 4334 |
| 833 | Ga0501083_0313642 | 3300049744 | Bacteria | 1020 |
| 834 | Ga0501083_0452801 | 3300049744 | Bacteria | 835 |
| 835 | Ga0501035_0018681 | 3300049822 | Bacteria | 6386 |
| 836 | Ga0501035_0058382 | 3300049822 | Bacteria | 3438 |
| 837 | Ga0501035_0101465 | 3300049822 | Bacteria | 2525 |
| 838 | Ga0501044_0935455 | 3300049823 | Bacteria | 740 |
| 839 | Ga0501045_0003976 | 3300049824 | Bacteria | 10174 |
| 840 | Ga0501045_0011919 | 3300049824 | Bacteria | 6111 |
| 841 | Ga0501045_0057594 | 3300049824 | Bacteria | 2844 |
| 842 | Ga0501045_0249318 | 3300049824 | Bacteria | 1322 |
| 843 | Ga0501045_0463841 | 3300049824 | Bacteria | 941 |
| 844 | nmdc:mga06z11_356690_c1 | 3300050494 | Bacteria | 876 |
| 845 | nmdc:mga08x19_427709_c1 | 3300050514 | Bacteria | 930 |
| 846 | Ga0495612_0070395 | 3300053078 | Bacteria | 1458 |
| 847 | Ga0500583_0001918 | 3300053092 | Bacteria | 6092 |
| 848 | Ga0500583_0019060 | 3300053092 | Bacteria | 2805 |
| 849 | Ga0500583_0082895 | 3300053092 | Bacteria | 1551 |
| 850 | Ga0500583_0355942 | 3300053092 | Unclassified | 708 |
| 851 | Ga0500566_0134515 | 3300053094 | Bacteria | 1319 |
| 852 | Ga0500641_0075193 | 3300053096 | Bacteria | 1427 |
| 853 | Ga0500650_0230436 | 3300053098 | Bacteria | 836 |
| 854 | Ga0500556_0000208 | 3300053104 | Bacteria | 48224 |
| 855 | Ga0500556_0098243 | 3300053104 | Bacteria | 1125 |
| 856 | Ga0500562_006188 | 3300053108 | Bacteria | 3020 |
| 857 | Ga0500591_020160 | 3300053115 | Bacteria | 3232 |
| 858 | Ga0500595_007671 | 3300053119 | Bacteria | 4464 |
| 859 | Ga0500642_0221290 | 3300053130 | Bacteria | 877 |
| 860 | Ga0500642_0323793 | 3300053130 | Bacteria | 690 |
| 861 | Ga0500658_0088442 | 3300053134 | Bacteria | 1336 |
| 862 | Ga0500559_0040319 | 3300053136 | Bacteria | 2033 |
| 863 | Ga0500559_0106423 | 3300053136 | Bacteria | 1297 |
| 864 | Ga0500559_0394859 | 3300053136 | Bacteria | 644 |
| 865 | Ga0500577_0343635 | 3300053142 | Bacteria | 652 |
| 866 | Ga0500588_0022432 | 3300053146 | Bacteria | 1719 |
| 867 | Ga0500590_309960 | 3300053148 | Bacteria | 588 |
| 868 | Ga0500604_0038871 | 3300053151 | Bacteria | 1429 |
| 869 | Ga0500616_0000063 | 3300053153 | Bacteria | 243457 |
| 870 | Ga0500616_0007863 | 3300053153 | Bacteria | 6711 |
| 871 | Ga0500633_0215488 | 3300053160 | Bacteria | 717 |
| 872 | Ga0500639_022047 | 3300053163 | Bacteria | 3366 |
| 873 | Ga0500637_0060264 | 3300053178 | Bacteria | 2173 |
| 874 | Ga0500611_004509 | 3300053727 | Bacteria | 1884 |
| 875 | Ga0500656_006595 | 3300053732 | Bacteria | 1183 |
| 876 | Ga0501084_0006522 | 3300054114 | Bacteria | 9588 |
| 877 | Ga0501084_0012082 | 3300054114 | Bacteria | 7150 |
| 878 | Ga0501084_0028626 | 3300054114 | Bacteria | 4658 |
| 879 | Ga0501084_0185431 | 3300054114 | Bacteria | 1756 |
| 880 | Ga0501084_0976914 | 3300054114 | Bacteria | 712 |
| 881 | Ga0501082_0002104 | 3300060353 | Bacteria | 17534 |
| 882 | Ga0501082_0013115 | 3300060353 | Bacteria | 7126 |
| 883 | Ga0501082_0050398 | 3300060353 | Bacteria | 3590 |
| 884 | Ga0501082_0128971 | 3300060353 | Bacteria | 2194 |
| 885 | Ga0501082_0174807 | 3300060353 | Bacteria | 1867 |
| 886 | Ga0501082_0630271 | 3300060353 | Bacteria | 938 |
| 887 | Ga0501082_0676019 | 3300060353 | Bacteria | 904 |
| 888 | Ga0466962_0310274 | 3300061719 | Bacteria | 781 |
| 889 | Ga0530510_0011034 | 3300061734 | Bacteria | 6338 |
| 890 | Ga0530510_0033413 | 3300061734 | Bacteria | 3703 |
| 891 | Ga0530510_0054005 | 3300061734 | Bacteria | 2903 |
| 892 | Ga0530510_0061127 | 3300061734 | Bacteria | 2727 |
| 893 | Ga0530510_0451652 | 3300061734 | Bacteria | 972 |
| 894 | Ga0530510_1023598 | 3300061734 | Bacteria | 632 |
| 895 | 2894512902 | 2894510363 | Bacteria | 5121143 |
| 896 | 2989395914 | 2989392574 | Bacteria | 4554005 |
| 897 | Ga0070679_100289959 | |||
| 898 | JGI25406J46586_10009833 | |||
| 899 | rootH2_10190203 | |||
| 900 | rootL2_10119616 | |||
| 901 | JGI25405J52794_10055149 | |||
| 902 | Ga0065707_10084632 | |||
| 903 | Ga0070676_10500829 | |||
| 904 | Ga0070683_100540449 | |||
| 905 | Ga0070690_100027703 | |||
| 906 | Ga0070690_100258318 | |||
| 907 | Ga0070670_100601384 | |||
| 908 | Ga0070670_101311740 | |||
| 909 | Ga0070670_101510988 | |||
| 910 | Ga0068869_100155428 | |||
| 911 | Ga0070666_10004167 | |||
| 912 | Ga0070666_10008920 | |||
| 913 | Ga0070666_10086527 | |||
| 914 | Ga0070666_10093722 | |||
| 915 | Ga0070666_10194470 | |||
| 916 | Ga0070666_10367807 | |||
| 917 | Ga0070680_100021018 | |||
| 918 | Ga0070680_100177938 | |||
| 919 | Ga0070680_100922828 | |||
| 920 | Ga0070682_100051237 | |||
| 921 | Ga0070682_100120967 | |||
| 922 | Ga0070682_100192453 | |||
| 923 | Ga0068868_100009710 | |||
| 924 | Ga0068868_100061045 | |||
| 925 | Ga0068868_100150388 | |||
| 926 | Ga0070660_100588190 | |||
| 927 | Ga0070689_100027251 | |||
| 928 | Ga0070689_101854373 | |||
| 929 | Ga0070668_101622535 | |||
| 930 | Ga0070671_100007243 | |||
| 931 | Ga0070671_102077297 | |||
| 932 | Ga0070673_100408062 | |||
| 933 | Ga0070673_100532911 | |||
| 934 | Ga0070667_100000148 | |||
| 935 | Ga0070667_100006050 | |||
| 936 | Ga0070667_100006867 | |||
| 937 | Ga0070667_100020790 | |||
| 938 | Ga0070667_100041352 | |||
| 939 | Ga0070667_100308865 | |||
| 940 | Ga0070667_100631757 | |||
| 941 | Ga0070709_10000762 | |||
| 942 | Ga0070709_10037055 | |||
| 943 | Ga0070709_11114276 | |||
| 944 | Ga0070714_100010023 | |||
| 945 | Ga0070714_100157343 | |||
| 946 | Ga0070714_100218777 | |||
| 947 | Ga0070714_100651495 | |||
| 948 | Ga0070714_100963138 | |||
| 949 | Ga0070714_101088033 | |||
| 950 | Ga0070713_100009052 | |||
| 951 | Ga0070713_100028708 | |||
| 952 | Ga0070713_100057286 | |||
| 953 | Ga0070713_100065170 | |||
| 954 | Ga0070713_100183446 | |||
| 955 | Ga0070713_100523337 | |||
| 956 | Ga0070710_10000916 | |||
| 957 | Ga0070710_10289385 | |||
| 958 | Ga0070710_10617633 | |||
| 959 | Ga0070701_10082380 | |||
| 960 | Ga0070701_10683622 | |||
| 961 | Ga0070711_100006494 | |||
| 962 | Ga0070711_100018376 | |||
| 963 | Ga0070711_100091228 | |||
| 964 | Ga0070711_100411670 | |||
| 965 | Ga0070711_100497483 | |||
| 966 | Ga0070711_100585015 | |||
| 967 | Ga0070705_100003534 | |||
| 968 | Ga0070694_100032398 | |||
| 969 | Ga0070694_100387225 | |||
| 970 | Ga0070663_100405328 | |||
| 971 | Ga0070662_100762848 | |||
| 972 | Ga0070681_10003431 | |||
| 973 | Ga0070681_10007497 | |||
| 974 | Ga0070681_10094069 | |||
| 975 | Ga0070681_10094996 | |||
| 976 | Ga0070681_10107336 | |||
| 977 | Ga0070681_10160829 | |||
| 978 | Ga0070681_10786427 | |||
| 979 | Ga0070681_11015322 | |||
| 980 | Ga0068867_100022503 | |||
| 981 | Ga0068867_100045403 | |||
| 982 | Ga0070685_10316049 | |||
| 983 | Ga0070699_100402808 | |||
| 984 | Ga0070679_100068631 | |||
| 985 | Ga0070679_100150172 | |||
| 986 | Ga0070679_100153592 | |||
| 987 | Ga0070679_100308405 | |||
| 988 | Ga0070679_100534218 | |||
| 989 | Ga0070679_100823396 | |||
| 990 | Ga0070679_100828442 | |||
| 991 | Ga0070679_101274707 | |||
| 992 | Ga0070679_101414748 | |||
| 993 | Ga0070684_100065027 | |||
| 994 | Ga0070684_100198313 | |||
| 995 | Ga0068853_100531578 | |||
| 996 | Ga0068853_101399417 | |||
| 997 | Ga0070672_100226653 | |||
| 998 | Ga0070686_100342277 | |||
| 999 | Ga0070695_100109427 | |||
| 1000 | Ga0070695_100153885 | |||
| 1001 | Ga0070695_101884707 | |||
| 1002 | Ga0070696_100012034 | |||
| 1003 | Ga0070696_100294335 | |||
| 1004 | Ga0070696_100596975 | |||
| 1005 | Ga0070696_101053161 | |||
| 1006 | Ga0070696_101397470 | |||
| 1007 | Ga0070693_100439243 | |||
| 1008 | Ga0070665_100001135 | |||
| 1009 | Ga0070665_100010722 | |||
| 1010 | Ga0070665_100015402 | |||
| 1011 | Ga0070665_100023939 | |||
| 1012 | Ga0070665_100031741 | |||
| 1013 | Ga0070665_100052534 | |||
| 1014 | Ga0070665_100126834 | |||
| 1015 | Ga0070665_102019940 | |||
| 1016 | Ga0070704_101267727 | |||
| 1017 | Ga0070704_101833414 | |||
| 1018 | Ga0068855_100006417 | |||
| 1019 | Ga0068855_100067475 | |||
| 1020 | Ga0068855_100347577 | |||
| 1021 | Ga0068855_100446981 | |||
| 1022 | Ga0068855_100526548 | |||
| 1023 | Ga0068855_100865346 | |||
| 1024 | Ga0068855_101014068 | |||
| 1025 | Ga0070664_100739239 | |||
| 1026 | Ga0068857_100327336 | |||
| 1027 | Ga0068857_100558636 | |||
| 1028 | Ga0068856_100011179 | |||
| 1029 | Ga0068856_100020953 | |||
| 1030 | Ga0068856_101245459 | |||
| 1031 | Ga0068852_100127445 | |||
| 1032 | Ga0068852_100463149 | |||
| 1033 | Ga0068859_100005986 | |||
| 1034 | Ga0068859_100015270 | |||
| 1035 | Ga0068859_100075517 | |||
| 1036 | Ga0068859_100283043 | |||
| 1037 | Ga0068859_100289279 | |||
| 1038 | Ga0068859_100486159 | |||
| 1039 | Ga0068864_100025887 | |||
| 1040 | Ga0068864_100112088 | |||
| 1041 | Ga0068864_100197280 | |||
| 1042 | Ga0068866_10132297 | |||
| 1043 | Ga0068866_10971321 | |||
| 1044 | Ga0068861_100008424 | |||
| 1045 | Ga0068861_100175878 | |||
| 1046 | Ga0068861_100505917 | |||
| 1047 | Ga0068851_10154257 | |||
| 1048 | Ga0068863_100002292 | |||
| 1049 | Ga0068863_100021649 | |||
| 1050 | Ga0068863_100084364 | |||
| 1051 | Ga0068863_100709852 | |||
| 1052 | Ga0068863_100824345 | |||
| 1053 | Ga0068858_100002654 | |||
| 1054 | Ga0068858_100006327 | |||
| 1055 | Ga0068858_100019192 | |||
| 1056 | Ga0068858_100027404 | |||
| 1057 | Ga0068858_100244266 | |||
| 1058 | Ga0068860_100006415 | |||
| 1059 | Ga0068860_100012778 | |||
| 1060 | Ga0068860_100100587 | |||
| 1061 | Ga0068860_100116111 | |||
| 1062 | Ga0068860_100432101 | |||
| 1063 | Ga0068860_102578793 | |||
| 1064 | Ga0068862_100024681 | |||
| 1065 | Ga0068862_100428540 | |||
| 1066 | Ga0068862_100525341 | |||
| 1067 | Ga0068862_101075146 | |||
| 1068 | Ga0081455_10000985 | |||
| 1069 | Ga0081455_10020882 | |||
| 1070 | Ga0081539_10000066 | |||
| 1071 | Ga0070717_10163912 | |||
| 1072 | Ga0070717_10491248 | |||
| 1073 | Ga0070717_10520378 | |||
| 1074 | Ga0070715_10000791 | |||
| 1075 | Ga0070715_10068806 | |||
| 1076 | Ga0070716_100007700 | |||
| 1077 | Ga0070716_100024175 | |||
| 1078 | Ga0070716_100160243 | |||
| 1079 | Ga0070712_100003340 | |||
| 1080 | Ga0070712_100095331 | |||
| 1081 | Ga0070712_100234853 | |||
| 1082 | Ga0070712_100439959 | |||
| 1083 | Ga0070712_100782675 | |||
| 1084 | Ga0075367_10298523 | |||
| 1085 | Ga0097621_100007995 | |||
| 1086 | Ga0097621_100462386 | |||
| 1087 | Ga0097621_100505819 | |||
| 1088 | Ga0097621_101857200 | |||
| 1089 | Ga0068871_100016901 | |||
| 1090 | Ga0068871_100082840 | |||
| 1091 | Ga0068871_100167838 | |||
| 1092 | Ga0068871_100215257 | |||
| 1093 | Ga0068871_101771653 | |||
| 1094 | Ga0068865_100157602 | |||
| 1095 | Ga0097620_100005986 | |||
| 1096 | Ga0097620_100015269 | |||
| 1097 | Ga0097620_100075516 | |||
| 1098 | Ga0097620_100283074 | |||
| 1099 | Ga0097620_100289284 | |||
| 1100 | Ga0097620_100486155 | |||
| 1101 | Ga0097620_100637752 | |||
| 1102 | Ga0097620_102473999 | |||
| 1103 | Ga0099794_10085789 | |||
| 1104 | Ga0099794_10242255 | |||
| 1105 | Ga0099795_10000009 | |||
| 1106 | Ga0099795_10000519 | |||
| 1107 | Ga0105250_10010779 | |||
| 1108 | Ga0105240_10015206 | |||
| 1109 | Ga0105240_10019976 | |||
| 1110 | Ga0105240_10052604 | |||
| 1111 | Ga0105240_10097414 | |||
| 1112 | Ga0105240_10099490 | |||
| 1113 | Ga0105240_10104845 | |||
| 1114 | Ga0105240_10182185 | |||
| 1115 | Ga0105240_10215377 | |||
| 1116 | Ga0105240_10445036 | |||
| 1117 | Ga0105240_10575625 | |||
| 1118 | Ga0105240_11005603 | |||
| 1119 | Ga0105240_11065259 | |||
| 1120 | Ga0105240_11109833 | |||
| 1121 | Ga0105240_11230539 | |||
| 1122 | Ga0105245_10004800 | |||
| 1123 | Ga0105245_10038969 | |||
| 1124 | Ga0105245_11760873 | |||
| 1125 | Ga0105247_10000162 | |||
| 1126 | Ga0105247_10024572 | |||
| 1127 | Ga0105247_10158224 | |||
| 1128 | Ga0105247_10472454 | |||
| 1129 | Ga0105247_10658522 | |||
| 1130 | Ga0105247_11156770 | |||
| 1131 | Ga0105241_10012665 | |||
| 1132 | Ga0105241_10090277 | |||
| 1133 | Ga0105241_10210604 | |||
| 1134 | Ga0105242_10007917 | |||
| 1135 | Ga0105242_10096488 | |||
| 1136 | Ga0105242_11793190 | |||
| 1137 | Ga0105248_10014006 | |||
| 1138 | Ga0105248_10028521 | |||
| 1139 | Ga0105248_10063316 | |||
| 1140 | Ga0105248_11228341 | |||
| 1141 | Ga0105237_10108339 | |||
| 1142 | Ga0105237_10429665 | |||
| 1143 | Ga0105237_11767296 | |||
| 1144 | Ga0105237_11824609 | |||
| 1145 | Ga0105237_11837940 | |||
| 1146 | Ga0105237_12148691 | |||
| 1147 | Ga0105238_10011003 | |||
| 1148 | Ga0105238_10043729 | |||
| 1149 | Ga0105238_10363064 | |||
| 1150 | Ga0105238_10469692 | |||
| 1151 | Ga0105238_10538089 | |||
| 1152 | Ga0105238_11066008 | |||
| 1153 | Ga0105249_10283253 | |||
| 1154 | Ga0105249_10328190 | |||
| 1155 | Ga0105249_10555153 | |||
| 1156 | Ga0099796_10000005 | |||
| 1157 | Ga0099796_10001369 | |||
| 1158 | Ga0099796_10020489 | |||
| 1159 | Ga0105239_10165299 | |||
| 1160 | Ga0105239_10420076 | |||
| 1161 | Ga0105239_10848184 | |||
| 1162 | Ga0105239_10892168 | |||
| 1163 | Ga0105239_11498596 | |||
| 1164 | Ga0105239_12018287 | |||
| 1165 | Ga0105239_12279782 | |||
| 1166 | Ga0105239_13260161 | |||
| 1167 | Ga0105239_13353694 | |||
| 1168 | Ga0105246_10178051 | |||
| 1169 | Ga0105246_12059132 | |||
| 1170 | Ga0157373_10810716 | |||
| 1171 | Ga0157370_10251453 | |||
| 1172 | Ga0157370_10782422 | |||
| 1173 | Ga0157370_10834048 | |||
| 1174 | Ga0157370_11293437 | |||
| 1175 | Ga0157369_10006063 | |||
| 1176 | Ga0157369_10371802 | |||
| 1177 | Ga0157369_10924663 | |||
| 1178 | Ga0157369_10927861 | |||
| 1179 | Ga0157369_11003738 | |||
| 1180 | Ga0157369_11993967 | |||
| 1181 | Ga0157374_10004337 | |||
| 1182 | Ga0157374_10009231 | |||
| 1183 | Ga0157374_10095763 | |||
| 1184 | Ga0157378_10036536 | |||
| 1185 | Ga0157378_10117341 | |||
| 1186 | Ga0163162_10026787 | |||
| 1187 | Ga0163162_10028215 | |||
| 1188 | Ga0163162_10328675 | |||
| 1189 | Ga0163162_10996076 | |||
| 1190 | Ga0157372_10263750 | |||
| 1191 | Ga0157372_11572979 | |||
| 1192 | Ga0157372_12087796 | |||
| 1193 | Ga0157375_10029004 | |||
| 1194 | Ga0157375_10640202 | |||
| 1195 | Ga0157375_11269991 | |||
| 1196 | Ga0163163_10002748 | |||
| 1197 | Ga0163163_10075161 | |||
| 1198 | Ga0163163_10117505 | |||
| 1199 | Ga0163163_10193502 | |||
| 1200 | Ga0163163_10266099 | |||
| 1201 | Ga0163163_10455153 | |||
| 1202 | Ga0163163_11149980 | |||
| 1203 | Ga0163163_12046427 | |||
| 1204 | Ga0157380_10024905 | |||
| 1205 | Ga0157380_10567984 | |||
| 1206 | Ga0157380_11764145 | |||
| 1207 | Ga0157377_10527943 | |||
| 1208 | Ga0157379_10000582 | |||
| 1209 | Ga0157379_10010612 | |||
| 1210 | Ga0157379_10049267 | |||
| 1211 | Ga0157379_10121930 | |||
| 1212 | Ga0157379_10200286 | |||
| 1213 | Ga0157379_10261561 | |||
| 1214 | Ga0157379_10787852 | |||
| 1215 | Ga0157379_11171543 | |||
| 1216 | Ga0157376_10051973 | |||
| 1217 | Ga0157376_10064620 | |||
| 1218 | Ga0157376_10439307 | |||
| 1219 | Ga0163161_10307646 | |||
| 1220 | Ga0206356_11287745 | |||
| 1221 | Ga0206354_10937309 | |||
| 1222 | Ga0213874_10040069 | |||
| 1223 | Ga0213874_10043704 | |||
| 1224 | Ga0213874_10048667 | |||
| 1225 | Ga0213874_10229184 | |||
| 1226 | Ga0213876_10288331 | |||
| 1227 | Ga0213875_10408700 | |||
| 1228 | Ga0213871_10042366 | |||
| 1229 | Ga0228598_1062446 | |||
| 1230 | Ga0207696_1036486 | |||
| 1231 | Ga0207692_10087071 | |||
| 1232 | Ga0207692_10156727 | |||
| 1233 | Ga0207692_10705697 | |||
| 1234 | Ga0207710_10000320 | |||
| 1235 | Ga0207710_10065156 | |||
| 1236 | Ga0207710_10160165 | |||
| 1237 | Ga0207680_10052405 | |||
| 1238 | Ga0207680_10076197 | |||
| 1239 | Ga0207680_10174449 | |||
| 1240 | Ga0207680_10200947 | |||
| 1241 | Ga0207680_10232373 | |||
| 1242 | Ga0207647_10239782 | |||
| 1243 | Ga0207685_10063333 | |||
| 1244 | Ga0207699_10003645 | |||
| 1245 | Ga0207699_10016940 | |||
| 1246 | Ga0207654_10027563 | |||
| 1247 | Ga0207654_10722380 | |||
| 1248 | Ga0207707_10000035 | |||
| 1249 | Ga0207707_10004421 | |||
| 1250 | Ga0207707_10025671 | |||
| 1251 | Ga0207707_10077128 | |||
| 1252 | Ga0207707_10260957 | |||
| 1253 | Ga0207707_10334384 | |||
| 1254 | Ga0207707_11069853 | |||
| 1255 | Ga0207695_10031719 | |||
| 1256 | Ga0207695_10040261 | |||
| 1257 | Ga0207695_10043756 | |||
| 1258 | Ga0207695_10059073 | |||
| 1259 | Ga0207695_10062771 | |||
| 1260 | Ga0207695_10066204 | |||
| 1261 | Ga0207695_10067634 | |||
| 1262 | Ga0207695_10099097 | |||
| 1263 | Ga0207695_10199956 | |||
| 1264 | Ga0207695_10421531 | |||
| 1265 | Ga0207695_10432122 | |||
| 1266 | Ga0207695_10802045 | |||
| 1267 | Ga0207695_10815337 | |||
| 1268 | Ga0207671_10022415 | |||
| 1269 | Ga0207671_10160086 | |||
| 1270 | Ga0207671_10189287 | |||
| 1271 | Ga0207671_10233575 | |||
| 1272 | Ga0207671_11046947 | |||
| 1273 | Ga0207693_10001259 | |||
| 1274 | Ga0207693_10075566 | |||
| 1275 | Ga0207693_10246116 | |||
| 1276 | Ga0207693_10355455 | |||
| 1277 | Ga0207693_10568336 | |||
| 1278 | Ga0207663_10022310 | |||
| 1279 | Ga0207663_10221701 | |||
| 1280 | Ga0207663_10488107 | |||
| 1281 | Ga0207663_10490319 | |||
| 1282 | Ga0207663_10609339 | |||
| 1283 | Ga0207663_10620350 | |||
| 1284 | Ga0207660_10006384 | |||
| 1285 | Ga0207660_10082787 | |||
| 1286 | Ga0207660_10272297 | |||
| 1287 | Ga0207660_11026652 | |||
| 1288 | Ga0207657_10284194 | |||
| 1289 | Ga0207652_10001083 | |||
| 1290 | Ga0207652_10017401 | |||
| 1291 | Ga0207652_10330057 | |||
| 1292 | Ga0207652_10957708 | |||
| 1293 | Ga0207652_11142665 | |||
| 1294 | Ga0207681_10515536 | |||
| 1295 | Ga0207694_10028754 | |||
| 1296 | Ga0207694_10190183 | |||
| 1297 | Ga0207694_10581861 | |||
| 1298 | Ga0207694_10961267 | |||
| 1299 | Ga0207650_10969194 | |||
| 1300 | Ga0207659_10798925 | |||
| 1301 | Ga0207687_10014344 | |||
| 1302 | Ga0207687_10175116 | |||
| 1303 | Ga0207700_10039865 | |||
| 1304 | Ga0207700_10173111 | |||
| 1305 | Ga0207700_10199543 | |||
| 1306 | Ga0207700_10205613 | |||
| 1307 | Ga0207700_11182294 | |||
| 1308 | Ga0207700_11296024 | |||
| 1309 | Ga0207664_10036157 | |||
| 1310 | Ga0207664_10252419 | |||
| 1311 | Ga0207664_10900555 | |||
| 1312 | Ga0207644_10009259 | |||
| 1313 | Ga0207644_10068469 | |||
| 1314 | Ga0207644_11303807 | |||
| 1315 | Ga0207686_10609454 | |||
| 1316 | Ga0207670_10005228 | |||
| 1317 | Ga0207704_10103157 | |||
| 1318 | Ga0207704_10389441 | |||
| 1319 | Ga0207665_10001212 | |||
| 1320 | Ga0207665_10013006 | |||
| 1321 | Ga0207665_10358106 | |||
| 1322 | Ga0207665_11617624 | |||
| 1323 | Ga0207691_10149514 | |||
| 1324 | Ga0207711_10003478 | |||
| 1325 | Ga0207711_10029910 | |||
| 1326 | Ga0207711_10251479 | |||
| 1327 | Ga0207711_10713035 | |||
| 1328 | Ga0207711_11536130 | |||
| 1329 | Ga0207689_10172418 | |||
| 1330 | Ga0207689_10214579 | |||
| 1331 | Ga0207689_10469704 | |||
| 1332 | Ga0207689_10510256 | |||
| 1333 | Ga0207689_10647041 | |||
| 1334 | Ga0207661_10182731 | |||
| 1335 | Ga0207661_10817931 | |||
| 1336 | Ga0207661_10875377 | |||
| 1337 | Ga0207679_10378967 | |||
| 1338 | Ga0207667_10005372 | |||
| 1339 | Ga0207667_10036086 | |||
| 1340 | Ga0207667_10370422 | |||
| 1341 | Ga0207667_10502117 | |||
| 1342 | Ga0207667_10994899 | |||
| 1343 | Ga0207667_11040895 | |||
| 1344 | Ga0207651_11841510 | |||
| 1345 | Ga0207712_10053501 | |||
| 1346 | Ga0207712_10112562 | |||
| 1347 | Ga0207668_11357845 | |||
| 1348 | Ga0207668_11450915 | |||
| 1349 | Ga0207640_10166815 | |||
| 1350 | Ga0207640_10183589 | |||
| 1351 | Ga0207640_10882483 | |||
| 1352 | Ga0207658_10000139 | |||
| 1353 | Ga0207658_10018255 | |||
| 1354 | Ga0207658_10144009 | |||
| 1355 | Ga0207658_10176543 | |||
| 1356 | Ga0207658_10220902 | |||
| 1357 | Ga0207658_11512625 | |||
| 1358 | Ga0207677_10074919 | |||
| 1359 | Ga0207677_10219003 | |||
| 1360 | Ga0207677_10728625 | |||
| 1361 | Ga0207703_10001986 | |||
| 1362 | Ga0207703_10003361 | |||
| 1363 | Ga0207703_10007484 | |||
| 1364 | Ga0207703_10271969 | |||
| 1365 | Ga0207703_10394831 | |||
| 1366 | Ga0207703_11057990 | |||
| 1367 | Ga0207639_10432162 | |||
| 1368 | Ga0207678_10118093 | |||
| 1369 | Ga0207708_10073669 | |||
| 1370 | Ga0207702_10035788 | |||
| 1371 | Ga0207702_10067929 | |||
| 1372 | Ga0207702_10307906 | |||
| 1373 | Ga0207702_11126189 | |||
| 1374 | Ga0207641_10005250 | |||
| 1375 | Ga0207641_10108148 | |||
| 1376 | Ga0207641_11188249 | |||
| 1377 | Ga0207648_10078310 | |||
| 1378 | Ga0207648_10277990 | |||
| 1379 | Ga0207676_10022747 | |||
| 1380 | Ga0207676_10185792 | |||
| 1381 | Ga0207674_10119171 | |||
| 1382 | Ga0207674_10785713 | |||
| 1383 | Ga0207675_100003083 | |||
| 1384 | Ga0207675_100062001 | |||
| 1385 | Ga0207675_100530375 | |||
| 1386 | Ga0207675_100606292 | |||
| 1387 | Ga0207698_10365862 | |||
| 1388 | Ga0207698_10975621 | |||
| 1389 | Ga0209967_1020570 | |||
| 1390 | Ga0209179_1000088 | |||
| 1391 | Ga0209974_10169935 | |||
| 1392 | Ga0265354_1002482 | |||
| 1393 | Ga0265356_1001181 | |||
| 1394 | Ga0268266_10002207 | |||
| 1395 | Ga0268266_10004715 | |||
| 1396 | Ga0268266_10005644 | |||
| 1397 | Ga0268266_10030435 | |||
| 1398 | Ga0268266_10056362 | |||
| 1399 | Ga0268266_10099979 | |||
| 1400 | Ga0268266_10104733 | |||
| 1401 | Ga0268265_10010696 | |||
| 1402 | Ga0268265_10350151 | |||
| 1403 | Ga0268265_10622040 | |||
| 1404 | Ga0268265_10674563 | |||
| 1405 | Ga0268264_10001054 | |||
| 1406 | Ga0268264_10012665 | |||
| 1407 | Ga0268264_10014823 | |||
| 1408 | Ga0268264_10039821 | |||
| 1409 | Ga0268264_10258379 | |||
| 1410 | Ga0265326_10040931 | |||
| 1411 | Ga0265319_1022664 | |||
| 1412 | Ga0265334_10001296 | |||
| 1413 | Ga0265334_10010492 | |||
| 1414 | Ga0265318_10000970 | |||
| 1415 | Ga0265318_10109412 | |||
| 1416 | Ga0265336_10225419 | |||
| 1417 | Ga0307515_10002500 | |||
| 1418 | Ga0307515_10131709 | |||
| 1419 | Ga0265338_10024866 | |||
| 1420 | Ga0265338_10312085 | |||
| 1421 | Ga0265338_10885675 | |||
| 1422 | Ga0307511_10000066 | |||
| 1423 | Ga0307511_10012157 | |||
| 1424 | Ga0265763_1017956 | |||
| 1425 | Ga0265770_1001320 | |||
| 1426 | Ga0265765_1012300 | |||
| 1427 | Ga0265760_10000720 | |||
| 1428 | Ga0265760_10026183 | |||
| 1429 | Ga0265760_10075870 | |||
| 1430 | Ga0265330_10004467 | |||
| 1431 | Ga0265332_10009507 | |||
| 1432 | Ga0265332_10198964 | |||
| 1433 | Ga0265328_10013642 | |||
| 1434 | Ga0265320_10018704 | |||
| 1435 | Ga0265325_10008410 | |||
| 1436 | Ga0265329_10005810 | |||
| 1437 | Ga0265340_10031639 | |||
| 1438 | Ga0265340_10038550 | |||
| 1439 | Ga0265340_10441535 | |||
| 1440 | Ga0265339_10065346 | |||
| 1441 | Ga0265331_10002949 | |||
| 1442 | Ga0265331_10095627 | |||
| 1443 | Ga0265331_10302520 | |||
| 1444 | Ga0265327_10057572 | |||
| 1445 | Ga0265316_10010397 | |||
| 1446 | Ga0265316_10204738 | |||
| 1447 | Ga0307509_10000496 | |||
| 1448 | Ga0307509_10109775 | |||
| 1449 | Ga0307408_100038042 | |||
| 1450 | Ga0265313_10016110 | |||
| 1451 | Ga0265313_10134762 | |||
| 1452 | Ga0307508_10337435 | |||
| 1453 | Ga0316575_10078350 | |||
| 1454 | Ga0265314_10003891 | |||
| 1455 | Ga0265342_10038857 | |||
| 1456 | Ga0265342_10475720 | |||
| 1457 | Ga0316576_10138818 | |||
| 1458 | Ga0316578_10397641 | |||
| 1459 | Ga0307516_10001009 | |||
| 1460 | Ga0307406_10146156 | |||
| 1461 | Ga0307407_10158143 | |||
| 1462 | Ga0307412_10689602 | |||
| 1463 | Ga0307416_100662573 | |||
| 1464 | Ga0307416_100740068 | |||
| 1465 | Ga0307411_10280703 | |||
| 1466 | Ga0307415_100018502 | |||
| 1467 | Ga0307415_100377258 | |||
| 1468 | Ga0307507_10229823 | |||
| 1469 | Ga0307510_10000001 | |||
| 1470 | Ga0316212_1066833 | |||
| 1471 | Ga0373923_0097517 | |||
| 1472 | Ga0373936_0016039 | |||
| 1473 | Ga0373954_0077143 | |||
| 1474 | Ga0373943_0772331 | |||
| 1475 | Ga0373955_0423686 | |||
| 1476 | Ga0316574_0066701 | |||
| 1477 | Ga0316574_0139046 | |||
| 1478 | Ga0373924_0215296 | |||
| 1479 | Ga0373927_0127414 | |||
| 1480 | Ga0373933_0741189 | |||
| 1481 | Ga0373947_0794918 | |||
| 1482 | Ga0373937_0462339 | |||
| 1483 | Ga0373937_1815489 | |||
| 1484 | Ga0316582_0425747 | |||
| 1485 | Ga0316584_0116776 | |||
| 1486 | Ga0373925_0969840 | |||
| 1487 | Ga0373925_1078075 | |||
| 1488 | Ga0395900_0066787 | |||
| 1489 | Ga0395898_0069935 | |||
| 1490 | Ga0395898_0091471 | |||
| 1491 | Ga0395898_0405885 | |||
| 1492 | Ga0395898_1392611 | |||
| 1493 | Ga0436364_0323462 | |||
| 1494 | Ga0436365_0811138 | |||
| 1495 | Ga0436365_1364122 | |||
| 1496 | Ga0436365_1698314 | |||
| 1497 | Ga0436365_1764508 | |||
| 1498 | Ga0436360_1074362 | |||
| 1499 | Ga0436360_1219824 | |||
| 1500 | Ga0436361_0420316 | |||
| 1501 | Ga0436361_0425201 | |||
| 1502 | Ga0436363_0025065 | |||
| 1503 | Ga0436363_0243183 | |||
| 1504 | Ga0436363_0733063 | |||
| 1505 | Ga0436363_0733334 | |||
| 1506 | Ga0436363_0742457 | |||
| 1507 | Ga0436363_1611612 | |||
| 1508 | Ga0436362_0030616 | |||
| 1509 | Ga0436362_0800989 | |||
| 1510 | Ga0436362_1290881 | |||
| 1511 | Ga0439431_0047146 | |||
| 1512 | Ga0439433_0079053 | |||
| 1513 | Ga0439456_019865 | |||
| 1514 | Ga0450920_005165 | |||
| 1515 | Ga0450920_026771 | |||
| 1516 | Ga0450922_015132 | |||
| 1517 | Ga0450923_019512 | |||
| 1518 | Ga0450895_000039 | |||
| 1519 | Ga0450906_030803 | |||
| 1520 | Ga0450907_010162 | |||
| 1521 | Ga0439446_0027722 | |||
| 1522 | Ga0450908_005018 | |||
| 1523 | Ga0439434_0057049 | |||
| 1524 | Ga0439435_0000842 | |||
| 1525 | Ga0439444_0030052 | |||
| 1526 | Ga0439460_0006230 | |||
| 1527 | Ga0451577_0000101 | |||
| 1528 | Ga0451577_0055780 | |||
| 1529 | Ga0451577_1230462 | |||
| 1530 | Ga0466969_0001578 | |||
| 1531 | Ga0466969_0087034 | |||
| 1532 | Ga0466969_0417996 | |||
| 1533 | Ga0466966_0025133 | |||
| 1534 | Ga0466961_0798365 | |||
| 1535 | Ga0466964_0206264 | |||
| 1536 | Ga0466964_0522597 | |||
| 1537 | Ga0453684_0002015 | |||
| 1538 | Ga0453684_0244515 | |||
| 1539 | Ga0453684_0547270 | |||
| 1540 | Ga0466970_0394280 | |||
| 1541 | Ga0466960_0321552 | |||
| 1542 | Ga0466959_0011430 | |||
| 1543 | Ga0466959_0015538 | |||
| 1544 | Ga0466959_0016482 | |||
| 1545 | Ga0466959_0264212 | |||
| 1546 | Ga0466958_0065843 | |||
| 1547 | Ga0466958_0870591 | |||
| 1548 | Ga0466967_0627637 | |||
| 1549 | Ga0466967_0738357 | |||
| 1550 | Ga0495629_0374538 | |||
| 1551 | Ga0495638_0208291 | |||
| 1552 | Ga0495651_0364949 | |||
| 1553 | Ga0495580_0020927 | |||
| 1554 | Ga0495580_0101265 | |||
| 1555 | Ga0495580_0203298 | |||
| 1556 | Ga0495582_0668512 | |||
| 1557 | Ga0495583_0187288 | |||
| 1558 | Ga0495583_0288741 | |||
| 1559 | Ga0495606_0160974 | |||
| 1560 | Ga0495606_0259241 | |||
| 1561 | Ga0495630_0118803 | |||
| 1562 | Ga0495632_0019330 | |||
| 1563 | Ga0495632_0132119 | |||
| 1564 | Ga0495648_0300152 | |||
| 1565 | Ga0495645_0305028 | |||
| 1566 | Ga0495622_0094034 | |||
| 1567 | Ga0495656_0398380 | |||
| 1568 | Ga0495668_0627367 | |||
| 1569 | Ga0495611_0317345 | |||
| 1570 | Ga0495659_0070518 | |||
| 1571 | Ga0495623_0194501 | |||
| 1572 | Ga0495658_0476885 | |||
| 1573 | Ga0495671_0029334 | |||
| 1574 | Ga0495581_0276017 | |||
| 1575 | Ga0495674_0174955 | |||
| 1576 | Ga0495687_062257 | |||
| 1577 | Ga0495602_1104086 | |||
| 1578 | Ga0496100_0003421 | |||
| 1579 | Ga0496100_0564579 | |||
| 1580 | Ga0496101_0148273 | |||
| 1581 | Ga0496101_0462655 | |||
| 1582 | Ga0496102_0014589 | |||
| 1583 | Ga0496102_0035957 | |||
| 1584 | Ga0496102_0097264 | |||
| 1585 | Ga0496103_0081805 | |||
| 1586 | Ga0496103_0112470 | |||
| 1587 | Ga0496103_0117244 | |||
| 1588 | Ga0496104_0003285 | |||
| 1589 | Ga0496104_0024629 | |||
| 1590 | Ga0496104_0135313 | |||
| 1591 | Ga0496104_0441716 | |||
| 1592 | Ga0496105_0157676 | |||
| 1593 | Ga0496105_0176744 | |||
| 1594 | Ga0496106_0010002 | |||
| 1595 | Ga0496107_0015484 | |||
| 1596 | Ga0496107_0414265 | |||
| 1597 | Ga0496108_0002984 | |||
| 1598 | Ga0496108_0068793 | |||
| 1599 | Ga0496108_0871867 | |||
| 1600 | Ga0496109_0038058 | |||
| 1601 | Ga0496109_0038409 | |||
| 1602 | Ga0496110_0022533 | |||
| 1603 | Ga0496110_0057284 | |||
| 1604 | Ga0496110_1612770 | |||
| 1605 | Ga0496111_0003939 | |||
| 1606 | Ga0496112_0163336 | |||
| 1607 | Ga0496112_0175484 | |||
| 1608 | Ga0496112_0500225 | |||
| 1609 | Ga0496113_1547296 | |||
| 1610 | Ga0496113_1549371 | |||
| 1611 | Ga0496114_0087990 | |||
| 1612 | Ga0496114_0564083 | |||
| 1613 | Ga0496115_0040294 | |||
| 1614 | Ga0496115_0217085 | |||
| 1615 | Ga0496115_0364467 | |||
| 1616 | Ga0496117_0000155 | |||
| 1617 | Ga0496118_0000066 | |||
| 1618 | Ga0496118_0114050 | |||
| 1619 | Ga0496118_0330067 | |||
| 1620 | Ga0496119_0026335 | |||
| 1621 | Ga0496119_0028215 | |||
| 1622 | Ga0496120_0001239 | |||
| 1623 | Ga0496120_0111963 | |||
| 1624 | Ga0496121_0001415 | |||
| 1625 | Ga0496121_0031058 | |||
| 1626 | Ga0496121_0052573 | |||
| 1627 | Ga0496124_0079173 | |||
| 1628 | Ga0496124_0856585 | |||
| 1629 | Ga0496125_0000415 | |||
| 1630 | Ga0496125_0043237 | |||
| 1631 | Ga0496125_0047679 | |||
| 1632 | Ga0496126_0007065 | |||
| 1633 | Ga0496126_0016741 | |||
| 1634 | Ga0496126_0048773 | |||
| 1635 | Ga0496126_0355238 | |||
| 1636 | Ga0496126_0762565 | |||
| 1637 | Ga0495682_0074098 | |||
| 1638 | Ga0495682_0186358 | |||
| 1639 | Ga0501031_0057829 | |||
| 1640 | Ga0501032_0132710 | |||
| 1641 | Ga0501032_0139263 | |||
| 1642 | Ga0501032_0209005 | |||
| 1643 | Ga0501033_0059304 | |||
| 1644 | Ga0501033_0344630 | |||
| 1645 | Ga0501036_0018575 | |||
| 1646 | Ga0501036_0037096 | |||
| 1647 | Ga0501036_1311525 | |||
| 1648 | Ga0501038_0012616 | |||
| 1649 | Ga0501038_0648616 | |||
| 1650 | Ga0501038_0943045 | |||
| 1651 | Ga0501039_0001832 | |||
| 1652 | Ga0501039_0005303 | |||
| 1653 | Ga0501039_0048456 | |||
| 1654 | Ga0501039_0256663 | |||
| 1655 | Ga0501040_0014175 | |||
| 1656 | Ga0501040_0030747 | |||
| 1657 | Ga0501040_0031219 | |||
| 1658 | Ga0501040_0185959 | |||
| 1659 | Ga0501040_0255098 | |||
| 1660 | Ga0501041_0001509 | |||
| 1661 | Ga0501041_0005823 | |||
| 1662 | Ga0501041_0151525 | |||
| 1663 | Ga0501042_0001503 | |||
| 1664 | Ga0501042_0004957 | |||
| 1665 | Ga0501042_0078194 | |||
| 1666 | Ga0501042_0354410 | |||
| 1667 | Ga0501043_0288394 | |||
| 1668 | Ga0501046_0058287 | |||
| 1669 | Ga0501046_0100418 | |||
| 1670 | Ga0501046_0195637 | |||
| 1671 | Ga0501047_0362216 | |||
| 1672 | Ga0501047_0847517 | |||
| 1673 | Ga0501048_0001334 | |||
| 1674 | Ga0501048_0008534 | |||
| 1675 | Ga0501048_0990326 | |||
| 1676 | Ga0501067_0009294 | |||
| 1677 | Ga0501068_0006468 | |||
| 1678 | Ga0501068_0049799 | |||
| 1679 | Ga0501068_0241310 | |||
| 1680 | Ga0501068_0269980 | |||
| 1681 | Ga0501069_0975679 | |||
| 1682 | Ga0501070_0798782 | |||
| 1683 | Ga0501071_0009214 | |||
| 1684 | Ga0501071_0009637 | |||
| 1685 | Ga0501071_0026939 | |||
| 1686 | Ga0501071_1521820 | |||
| 1687 | Ga0501072_0000744 | |||
| 1688 | Ga0501072_0006549 | |||
| 1689 | Ga0501072_0016843 | |||
| 1690 | Ga0501072_0061615 | |||
| 1691 | Ga0501072_1320773 | |||
| 1692 | Ga0501073_0008298 | |||
| 1693 | Ga0501073_0110406 | |||
| 1694 | Ga0501073_0286885 | |||
| 1695 | Ga0501073_0544198 | |||
| 1696 | Ga0501074_0028072 | |||
| 1697 | Ga0501074_0030789 | |||
| 1698 | Ga0501074_0045148 | |||
| 1699 | Ga0501074_0311060 | |||
| 1700 | Ga0501075_0002627 | |||
| 1701 | Ga0501075_0027821 | |||
| 1702 | Ga0501075_0159190 | |||
| 1703 | Ga0501075_0201508 | |||
| 1704 | Ga0501075_0305014 | |||
| 1705 | Ga0501076_0030995 | |||
| 1706 | Ga0501076_0036163 | |||
| 1707 | Ga0501076_0053393 | |||
| 1708 | Ga0501076_0112209 | |||
| 1709 | Ga0501076_0256253 | |||
| 1710 | Ga0501076_1520651 | |||
| 1711 | Ga0501077_0261235 | |||
| 1712 | Ga0501077_0580505 | |||
| 1713 | Ga0501079_0015313 | |||
| 1714 | Ga0501079_0054259 | |||
| 1715 | Ga0501079_0106390 | |||
| 1716 | Ga0501079_0216027 | |||
| 1717 | Ga0501079_0219707 | |||
| 1718 | Ga0501079_0301630 | |||
| 1719 | Ga0501080_0005054 | |||
| 1720 | Ga0501080_0014418 | |||
| 1721 | Ga0501080_0014682 | |||
| 1722 | Ga0501080_0335348 | |||
| 1723 | Ga0501081_0002058 | |||
| 1724 | Ga0501081_0014404 | |||
| 1725 | Ga0501081_0071309 | |||
| 1726 | Ga0501081_0845933 | |||
| 1727 | Ga0501081_1218591 | |||
| 1728 | Ga0501083_0022909 | |||
| 1729 | Ga0501083_0313642 | |||
| 1730 | Ga0501083_0452801 | |||
| 1731 | Ga0501035_0018681 | |||
| 1732 | Ga0501035_0058382 | |||
| 1733 | Ga0501035_0101465 | |||
| 1734 | Ga0501044_0935455 | |||
| 1735 | Ga0501045_0003976 | |||
| 1736 | Ga0501045_0011919 | |||
| 1737 | Ga0501045_0057594 | |||
| 1738 | Ga0501045_0249318 | |||
| 1739 | Ga0501045_0463841 | |||
| 1740 | nmdc:mga06z11_356690_c1 | |||
| 1741 | nmdc:mga08x19_427709_c1 | |||
| 1742 | Ga0495612_0070395 | |||
| 1743 | Ga0500583_0001918 | |||
| 1744 | Ga0500583_0019060 | |||
| 1745 | Ga0500583_0082895 | |||
| 1746 | Ga0500583_0355942 | |||
| 1747 | Ga0500566_0134515 | |||
| 1748 | Ga0500641_0075193 | |||
| 1749 | Ga0500650_0230436 | |||
| 1750 | Ga0500556_0000208 | |||
| 1751 | Ga0500556_0098243 | |||
| 1752 | Ga0500562_006188 | |||
| 1753 | Ga0500591_020160 | |||
| 1754 | Ga0500595_007671 | |||
| 1755 | Ga0500642_0221290 | |||
| 1756 | Ga0500642_0323793 | |||
| 1757 | Ga0500658_0088442 | |||
| 1758 | Ga0500559_0040319 | |||
| 1759 | Ga0500559_0106423 | |||
| 1760 | Ga0500559_0394859 | |||
| 1761 | Ga0500577_0343635 | |||
| 1762 | Ga0500588_0022432 | |||
| 1763 | Ga0500590_309960 | |||
| 1764 | Ga0500604_0038871 | |||
| 1765 | Ga0500616_0000063 | |||
| 1766 | Ga0500616_0007863 | |||
| 1767 | Ga0500633_0215488 | |||
| 1768 | Ga0500639_022047 | |||
| 1769 | Ga0500637_0060264 | |||
| 1770 | Ga0500611_004509 | |||
| 1771 | Ga0500656_006595 | |||
| 1772 | Ga0501084_0006522 | |||
| 1773 | Ga0501084_0012082 | |||
| 1774 | Ga0501084_0028626 | |||
| 1775 | Ga0501084_0185431 | |||
| 1776 | Ga0501084_0976914 | |||
| 1777 | Ga0501082_0002104 | |||
| 1778 | Ga0501082_0013115 | |||
| 1779 | Ga0501082_0050398 | |||
| 1780 | Ga0501082_0128971 | |||
| 1781 | Ga0501082_0174807 | |||
| 1782 | Ga0501082_0630271 | |||
| 1783 | Ga0501082_0676019 | |||
| 1784 | Ga0466962_0310274 | |||
| 1785 | Ga0530510_0011034 | |||
| 1786 | Ga0530510_0033413 | |||
| 1787 | Ga0530510_0054005 | |||
| 1788 | Ga0530510_0061127 | |||
| 1789 | Ga0530510_0451652 | |||
| 1790 | Ga0530510_1023598 | |||
| 1791 | 2894512902 | |||
| 1792 | 2989395914 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4f8b-assembly1.cif.gz_B-2 | crystal structure of the covalent thioimide intermediate of unimodular nitrile reductase quef | 0.977 | 14 | 126 |
| 4fgc-assembly1.cif.gz_A-2 | crystal structure of active site mutant c55a of nitrile reductase quef, bound to substrate preq0 | 0.9416 | 8 | 125 |
| 3uxj-assembly2.cif.gz_C | crystal structure of 7-cyano-7-deazaguanine reductase, quef from vibrio cholerae complexed with nadp and preq0 | 0.9361 | 24 | 119 |
| 4ghm-assembly1.cif.gz_B | crystal structure of the h233a mutant of 7-cyano-7-deazaguanine reductase, quef from vibrio cholerae complexed with preq0 | 0.936 | 24 | 119 |
| 3bp1-assembly1.cif.gz_D | crystal structure of putative 7-cyano-7-deazaguanine reductase quef from vibrio cholerae o1 biovar eltor | 0.9351 | 24 | 119 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G081_22_166_3.30.1130.10 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.9574 | 9 | 125 | 3.30.1130.10 |
| 4uqfA02 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.901 | 24 | 121 | 3.30.1130.10 |
| 1a8rA02 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.8694 | 15 | 118 | 3.30.1130.10 |
| af_Q8I5H7_254_381_3.30.1130.10 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.8488 | 15 | 133 | 3.30.1130.10 |
| 1jkfB03 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.8451 | 99 | 123 | 3.30.360.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A432TJK3-F1-model_v4 | NADPH-dependent 7-cyano-7-deazaguanine reductase QueF | 0.9981 | 8 | 100 |
GO:0005737
GO:0008616 GO:0033739 |
| AF-A0A4Q5ZII6-F1-model_v4 | deleted | 0.9938 | 8 | 102 |
|
| AF-A0A351XPB0-F1-model_v4 | deleted | 0.9923 | 7 | 122 |
|
| AF-D5SQT4-F1-model_v4 | NADPH-dependent 7-cyano-7-deazaguanine reductase (EC 1.7.1.13) (7-cyano-7-carbaguanine reductase) (NADPH-dependent nitrile oxidoreductase) (PreQ(0) reductase) | 0.9923 | 14 | 123 |
GO:0005737
GO:0006400 GO:0008616 GO:0033739 |
| AF-A0A2E0GPN9-F1-model_v4 | NADPH-dependent 7-cyano-7-deazaguanine reductase (EC 1.7.1.13) (7-cyano-7-carbaguanine reductase) (NADPH-dependent nitrile oxidoreductase) (PreQ(0) reductase) | 0.9919 | 14 | 122 |
GO:0005737
GO:0006400 GO:0008616 GO:0033739 |