F484856

General Info

Members Datasets Scaffolds Average Seq Length
891 402 1782 217

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10328234|Ga0111539_103282343
Length 232
Sequence MIVQGLHHSDESVMLDLRLYALVDPERANGRALDDLAQRVVAGGATLVQLRDKHGATRRLVEEARAVKQALSASGVPLLVNDRVDVALAADADGVHVGQDDMAVSDARRLLGKRAIIGLSVKTPAQARAAPLDLLDYVAIGGVFATTSKDNPDPPVGADGLHAMADIVRSRDAGMPICAIAGIDEHNAGDVIAAGADGVAVISALSMTPDPSAAARALRAVVDRALKLRAGA

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
3 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
4 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
5 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
8 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
11 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
12 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
13 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
45 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
46 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
47 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
48 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
49 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
50 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
51 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
52 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
53 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
54 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
59 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
60 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
61 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
62 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
63 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
64 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
65 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
66 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
67 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
68 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
69 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
70 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
71 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
72 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
73 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
74 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
75 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
76 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
77 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
78 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
79 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
80 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
81 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
82 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
83 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
84 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
85 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
86 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
87 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
88 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
89 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
90 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
91 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
92 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
93 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
94 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
95 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
96 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
97 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
98 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
99 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
100 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
102 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
103 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
104 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
105 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
106 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
107 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
108 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
109 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
110 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
112 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
113 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
114 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
115 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
116 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
118 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
119 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
120 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
121 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
122 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
123 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
124 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
125 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
126 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
127 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
128 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
129 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
130 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
131 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
132 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
133 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
134 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
135 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
136 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
137 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
138 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
139 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
140 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
141 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
142 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
143 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
144 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
146 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
147 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
149 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
223 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
227 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
228 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
229 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
230 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
231 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
232 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
233 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
234 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
235 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
236 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
237 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
238 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
239 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
240 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
241 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
242 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
243 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
244 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
245 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
246 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
247 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
248 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
249 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
250 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
251 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
252 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
253 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
254 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
255 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
256 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
257 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
258 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
259 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
260 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
261 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
262 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
263 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
264 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
265 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
266 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
267 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
268 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
269 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
270 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
271 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
272 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
273 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
274 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
275 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
276 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
277 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
278 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
279 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
280 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
281 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
282 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
283 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
284 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
285 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
286 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
287 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
288 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
289 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
290 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
291 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
292 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
293 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
294 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
295 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
296 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
297 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
298 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
299 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
300 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
301 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
302 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
303 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
304 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
305 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
306 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
307 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
308 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
309 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
310 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
311 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
312 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
313 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
314 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
315 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
316 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
317 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
318 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
319 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
320 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
321 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
322 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
323 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
324 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
325 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
326 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
327 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
328 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
329 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
330 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
331 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
332 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
333 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
334 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
335 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
336 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
337 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
338 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
339 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
340 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
341 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
342 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
343 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
344 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
345 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
346 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
347 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
348 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
349 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
352 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
353 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
354 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
359 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
364 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
365 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
366 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
367 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
368 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
369 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
370 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
371 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
372 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
373 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
374 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
375 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
376 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
377 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
378 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
379 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
380 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
381 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
382 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
383 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
384 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
385 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
386 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
387 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
388 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
389 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
390 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
391 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
392 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
393 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
394 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
395 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
396 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
397 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
398 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
399 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
400 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
401 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
402 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.44
Metatranscriptomes 0.34
Isolates 0.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.01
Nodule 0
Rhizoplane 6.96
Rhizosphere 91.47
Stem 0
Stem Tuber 0
Unclassified 0.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10328234 3300009094 Bacteria 1781
2 ARcpr5yngRDRAFT_c000365 3300000043 Bacteria 5996
3 ARSoilOldRDRAFT_c000254 3300000044 Bacteria 7768
4 ARCol0yngRDRAFT_1000499 3300000652 Bacteria 4595
5 JGI24747J21853_1003952 3300001978 Bacteria 1305
6 JGI24743J22301_10000605 3300001991 Bacteria 4360
7 JGI24745J21846_1000703 3300002073 Bacteria 3023
8 JGI24748J21848_1002038 3300002074 Bacteria 2259
9 JGI24748J21848_1005842 3300002074 Bacteria 1431
10 JGI24738J21930_10005115 3300002075 Bacteria 3171
11 JGI24749J21850_1002989 3300002076 Bacteria 2362
12 JGI24033J26618_1007155 3300002155 Bacteria 1263
13 JGI24034J26672_10009009 3300002239 Bacteria 1467
14 JGI24742J22300_10005065 3300002244 Bacteria 2167
15 JGI24742J22300_10006181 3300002244 Bacteria 1975
16 Ga0065704_10122202 3300005289 Bacteria 1753
17 Ga0065712_10002723 3300005290 Bacteria 5061
18 Ga0065715_10091280 3300005293 Bacteria 5926
19 Ga0065715_10226018 3300005293 Bacteria 1242
20 Ga0065707_10121136 3300005295 Bacteria 2112
21 Ga0070658_10030612 3300005327 Bacteria 4323
22 Ga0070658_10125452 3300005327 Bacteria 2136
23 Ga0070676_10004937 3300005328 Bacteria 7063
24 Ga0070676_10042488 3300005328 Bacteria 2640
25 Ga0070676_10079599 3300005328 Bacteria 1985
26 Ga0070676_10409562 3300005328 Bacteria 945
27 Ga0070683_100024177 3300005329 Bacteria 5438
28 Ga0070683_100653089 3300005329 Bacteria 1007
29 Ga0070690_100007512 3300005330 Bacteria 6241
30 Ga0070690_100013607 3300005330 Bacteria 4813
31 Ga0070690_100029653 3300005330 Bacteria 3395
32 Ga0070690_100277166 3300005330 Bacteria 1195
33 Ga0070670_100043716 3300005331 Bacteria 3851
34 Ga0070670_100098990 3300005331 Bacteria 2509
35 Ga0070670_100154280 3300005331 Bacteria 1988
36 Ga0070670_100281975 3300005331 Bacteria 1451
37 Ga0070677_10004385 3300005333 Bacteria 4604
38 Ga0068869_100026927 3300005334 Bacteria 4004
39 Ga0070666_10018139 3300005335 Bacteria 4521
40 Ga0070680_100018426 3300005336 Bacteria 5515
41 Ga0070680_100025758 3300005336 Bacteria 4702
42 Ga0070682_100016560 3300005337 Bacteria 4288
43 Ga0070682_100057208 3300005337 Bacteria 2456
44 Ga0070682_100181233 3300005337 Bacteria 1472
45 Ga0068868_100015719 3300005338 Bacteria 5606
46 Ga0070660_100011094 3300005339 Bacteria 6390
47 Ga0070660_100026606 3300005339 Bacteria 4309
48 Ga0070660_100089254 3300005339 Bacteria 2429
49 Ga0070660_100118606 3300005339 Bacteria 2110
50 Ga0070660_100254515 3300005339 Bacteria 1433
51 Ga0070689_100001782 3300005340 Bacteria 13823
52 Ga0070689_100012413 3300005340 Bacteria 6136
53 Ga0070689_100488365 3300005340 Bacteria 1053
54 Ga0070691_10011715 3300005341 Bacteria 4011
55 Ga0070691_10032533 3300005341 Bacteria 2451
56 Ga0070687_100010799 3300005343 Bacteria 3970
57 Ga0070687_100064297 3300005343 Bacteria 1949
58 Ga0070661_100004855 3300005344 Bacteria 9259
59 Ga0070661_100077106 3300005344 Bacteria 2456
60 Ga0070661_100267542 3300005344 Bacteria 1323
61 Ga0070661_100664177 3300005344 Bacteria 847
62 Ga0070692_10014877 3300005345 Bacteria 3666
63 Ga0070692_10016319 3300005345 Bacteria 3531
64 Ga0070668_100034060 3300005347 Bacteria 3881
65 Ga0070668_100328250 3300005347 Bacteria 1290
66 Ga0070669_100019915 3300005353 Bacteria 4792
67 Ga0070669_100062967 3300005353 Bacteria 2729
68 Ga0070669_100189300 3300005353 Bacteria 1614
69 Ga0070675_100044432 3300005354 Bacteria 3633
70 Ga0070675_100046633 3300005354 Bacteria 3549
71 Ga0070675_100081517 3300005354 Bacteria 2698
72 Ga0070671_100011618 3300005355 Bacteria 7081
73 Ga0070671_100013456 3300005355 Bacteria 6596
74 Ga0070671_100521115 3300005355 Bacteria 1023
75 Ga0070674_100005992 3300005356 Bacteria 7067
76 Ga0070674_100061116 3300005356 Bacteria 2628
77 Ga0070674_100143149 3300005356 Bacteria 1797
78 Ga0070673_100032568 3300005364 Bacteria 3927
79 Ga0070673_100149683 3300005364 Bacteria 1976
80 Ga0070673_100240938 3300005364 Bacteria 1572
81 Ga0070673_100271572 3300005364 Bacteria 1484
82 Ga0070688_100000518 3300005365 Bacteria 19476
83 Ga0070688_100004868 3300005365 Bacteria 7025
84 Ga0070688_100038214 3300005365 Bacteria 2930
85 Ga0070688_100167543 3300005365 Bacteria 1513
86 Ga0070688_100307899 3300005365 Bacteria 1147
87 Ga0070659_100001996 3300005366 Bacteria 14594
88 Ga0070659_100159990 3300005366 Bacteria 1841
89 Ga0070659_100533826 3300005366 Bacteria 1003
90 Ga0070667_100034646 3300005367 Bacteria 4225
91 Ga0070667_100077992 3300005367 Bacteria 2829
92 Ga0070667_100119611 3300005367 Bacteria 2291
93 Ga0070667_100127394 3300005367 Bacteria 2219
94 Ga0070703_10004338 3300005406 Bacteria 3996
95 Ga0070703_10017557 3300005406 Bacteria 2061
96 Ga0070709_10014166 3300005434 Bacteria 4504
97 Ga0070709_10317144 3300005434 Bacteria 1143
98 Ga0070714_100001923 3300005435 Bacteria 15163
99 Ga0070714_100127958 3300005435 Bacteria 2267
100 Ga0070714_100649937 3300005435 Bacteria 1015
101 Ga0070713_100003280 3300005436 Bacteria 10662
102 Ga0070710_10004440 3300005437 Bacteria 6636
103 Ga0070710_10075750 3300005437 Bacteria 1951
104 Ga0070710_10179665 3300005437 Bacteria 1324
105 Ga0070710_10274110 3300005437 Bacteria 1092
106 Ga0070710_10313400 3300005437 Bacteria 1028
107 Ga0070701_10000142 3300005438 Bacteria 21810
108 Ga0070701_10010502 3300005438 Bacteria 4096
109 Ga0070711_100002714 3300005439 Bacteria 10157
110 Ga0070711_100020648 3300005439 Bacteria 4249
111 Ga0070711_100068060 3300005439 Bacteria 2501
112 Ga0070705_100033691 3300005440 Bacteria 2857
113 Ga0070705_100078845 3300005440 Bacteria 2016
114 Ga0070700_100001943 3300005441 Bacteria 10475
115 Ga0070700_100003023 3300005441 Bacteria 8623
116 Ga0070700_100011069 3300005441 Bacteria 4989
117 Ga0070694_100007446 3300005444 Bacteria 6675
118 Ga0070708_100024592 3300005445 Bacteria 5141
119 Ga0070663_100003188 3300005455 Bacteria 9416
120 Ga0070663_100034489 3300005455 Bacteria 3505
121 Ga0070663_100154844 3300005455 Bacteria 1760
122 Ga0070678_100020126 3300005456 Bacteria 4372
123 Ga0070678_100099858 3300005456 Bacteria 2247
124 Ga0070678_100104740 3300005456 Bacteria 2200
125 Ga0070678_100304441 3300005456 Bacteria 1355
126 Ga0070662_100017985 3300005457 Bacteria 4774
127 Ga0070662_100034776 3300005457 Bacteria 3555
128 Ga0070681_10003015 3300005458 Bacteria 15622
129 Ga0070681_10023523 3300005458 Bacteria 6197
130 Ga0070681_10044128 3300005458 Bacteria 4462
131 Ga0068867_100031357 3300005459 Bacteria 3837
132 Ga0068867_100102117 3300005459 Bacteria 2192
133 Ga0070685_10001300 3300005466 Bacteria 13163
134 Ga0070685_10022069 3300005466 Bacteria 3466
135 Ga0070685_10092377 3300005466 Bacteria 1834
136 Ga0070699_100000908 3300005518 Bacteria 27634
137 Ga0070699_100231780 3300005518 Bacteria 1647
138 Ga0070679_100053642 3300005530 Bacteria 4013
139 Ga0070679_100116923 3300005530 Bacteria 2651
140 Ga0070679_100675360 3300005530 Bacteria 975
141 Ga0070684_100029749 3300005535 Bacteria 4632
142 Ga0070684_100644675 3300005535 Bacteria 986
143 Ga0070697_100482145 3300005536 Bacteria 1083
144 Ga0068853_100052726 3300005539 Bacteria 3503
145 Ga0068853_100128704 3300005539 Bacteria 2264
146 Ga0068853_100187882 3300005539 Bacteria 1876
147 Ga0070672_100022262 3300005543 Bacteria 4651
148 Ga0070672_100040163 3300005543 Bacteria 3588
149 Ga0070672_100091448 3300005543 Bacteria 2455
150 Ga0070672_100404598 3300005543 Bacteria 1170
151 Ga0070686_100003357 3300005544 Bacteria 8770
152 Ga0070686_100013828 3300005544 Bacteria 4632
153 Ga0070686_100035834 3300005544 Bacteria 3067
154 Ga0070686_100400046 3300005544 Bacteria 1044
155 Ga0070686_100665076 3300005544 Bacteria 827
156 Ga0070695_100012524 3300005545 Bacteria 5090
157 Ga0070695_100210721 3300005545 Bacteria 1395
158 Ga0070696_100018615 3300005546 Bacteria 4697
159 Ga0070696_100341860 3300005546 Bacteria 1157
160 Ga0070696_100343237 3300005546 Bacteria 1154
161 Ga0070696_100356113 3300005546 Bacteria 1135
162 Ga0070693_100003906 3300005547 Bacteria 6989
163 Ga0070693_100149981 3300005547 Bacteria 1476
164 Ga0070665_100071975 3300005548 Bacteria 3465
165 Ga0070665_100100234 3300005548 Bacteria 2900
166 Ga0070665_100697133 3300005548 Bacteria 1028
167 Ga0070704_100012922 3300005549 Bacteria 5166
168 Ga0070704_100245267 3300005549 Bacteria 1468
169 Ga0070704_100269711 3300005549 Bacteria 1406
170 Ga0068855_100052008 3300005563 Bacteria 4824
171 Ga0068855_100056970 3300005563 Bacteria 4582
172 Ga0068855_100124804 3300005563 Bacteria 2944
173 Ga0070664_100013046 3300005564 Bacteria 6761
174 Ga0070664_100036958 3300005564 Bacteria 4104
175 Ga0070664_100271676 3300005564 Bacteria 1527
176 Ga0068857_100000715 3300005577 Bacteria 24767
177 Ga0068854_100017444 3300005578 Bacteria 4803
178 Ga0068854_100200403 3300005578 Bacteria 1569
179 Ga0068854_100697366 3300005578 Bacteria 876
180 Ga0068856_100034734 3300005614 Bacteria 4939
181 Ga0068856_100084104 3300005614 Bacteria 3161
182 Ga0068856_100111146 3300005614 Bacteria 2738
183 Ga0068856_100445209 3300005614 Bacteria 1316
184 Ga0068856_100521238 3300005614 Bacteria 1210
185 Ga0068856_100580916 3300005614 Bacteria 1142
186 Ga0070702_100019614 3300005615 Bacteria 3531
187 Ga0070702_100046726 3300005615 Bacteria 2455
188 Ga0070702_100131420 3300005615 Bacteria 1582
189 Ga0068852_100047595 3300005616 Bacteria 3659
190 Ga0068852_100048222 3300005616 Bacteria 3638
191 Ga0068852_100215039 3300005616 Bacteria 1826
192 Ga0068852_100290617 3300005616 Bacteria 1579
193 Ga0068859_100038251 3300005617 Bacteria 4814
194 Ga0068859_100067588 3300005617 Bacteria 3608
195 Ga0068864_100009132 3300005618 Bacteria 8172
196 Ga0068864_100037870 3300005618 Bacteria 4117
197 Ga0068864_100047077 3300005618 Bacteria 3702
198 Ga0068866_10001095 3300005718 Bacteria 11931
199 Ga0068866_10035187 3300005718 Bacteria 2444
200 Ga0068866_10188112 3300005718 Bacteria 1225
201 Ga0068861_100006353 3300005719 Bacteria 8047
202 Ga0068861_100041923 3300005719 Bacteria 3431
203 Ga0068861_100350015 3300005719 Bacteria 1296
204 Ga0068851_10014025 3300005834 Bacteria 3799
205 Ga0068870_10022160 3300005840 Bacteria 3118
206 Ga0068870_10026604 3300005840 Bacteria 2885
207 Ga0068863_100005317 3300005841 Bacteria 12710
208 Ga0068863_100068592 3300005841 Bacteria 3354
209 Ga0068858_100017768 3300005842 Bacteria 6661
210 Ga0068858_100051422 3300005842 Bacteria 3812
211 Ga0068858_100542048 3300005842 Bacteria 1126
212 Ga0068858_100578112 3300005842 Bacteria 1089
213 Ga0068858_100613461 3300005842 Bacteria 1056
214 Ga0068860_100032941 3300005843 Bacteria 4976
215 Ga0068860_100041452 3300005843 Bacteria 4397
216 Ga0068860_100110689 3300005843 Bacteria 2625
217 Ga0068860_101335054 3300005843 Bacteria 738
218 Ga0068862_100008712 3300005844 Bacteria 8396
219 Ga0068862_100465920 3300005844 Bacteria 1193
220 Ga0081455_10000508 3300005937 Bacteria 50455
221 Ga0081538_10023513 3300005981 Bacteria 4427
222 Ga0081540_1001712 3300005983 Bacteria 18561
223 Ga0081540_1027806 3300005983 Bacteria 3194
224 Ga0081539_10001727 3300005985 Bacteria 34927
225 Ga0070717_10000186 3300006028 Bacteria 45360
226 Ga0070717_10141200 3300006028 Bacteria 2078
227 Ga0070717_10249985 3300006028 Bacteria 1566
228 Ga0070717_10581905 3300006028 Bacteria 1015
229 Ga0075368_10100035 3300006042 Bacteria 1190
230 Ga0075432_10106536 3300006058 Bacteria 1041
231 Ga0070715_10003296 3300006163 Bacteria 5105
232 Ga0070716_100009167 3300006173 Bacteria 4926
233 Ga0070712_100005488 3300006175 Bacteria 7851
234 Ga0070712_100100645 3300006175 Bacteria 2136
235 Ga0070712_100109314 3300006175 Bacteria 2060
236 Ga0070712_100134114 3300006175 Bacteria 1880
237 Ga0097621_100010840 3300006237 Bacteria 6687
238 Ga0097621_100024728 3300006237 Bacteria 4694
239 Ga0097621_100208935 3300006237 Bacteria 1697
240 Ga0068871_100011946 3300006358 Bacteria 6392
241 Ga0068871_100022854 3300006358 Bacteria 4827
242 Ga0075428_100156284 3300006844 Bacteria 2477
243 Ga0075428_100167451 3300006844 Bacteria 2384
244 Ga0075430_100007717 3300006846 Bacteria 9090
245 Ga0075430_100018982 3300006846 Bacteria 5850
246 Ga0075431_100096315 3300006847 Bacteria 3055
247 Ga0075433_10021951 3300006852 Bacteria 5356
248 Ga0075433_10165615 3300006852 Bacteria 1967
249 Ga0075434_100009283 3300006871 Bacteria 9165
250 Ga0075434_100103320 3300006871 Bacteria 2858
251 Ga0075434_100236747 3300006871 Bacteria 1846
252 Ga0075429_100952336 3300006880 Bacteria 751
253 Ga0068865_100014485 3300006881 Bacteria 5011
254 Ga0068865_100167660 3300006881 Bacteria 1680
255 Ga0075436_100370862 3300006914 Bacteria 1034
256 Ga0075436_100432109 3300006914 Bacteria 957
257 Ga0097620_100038250 3300006931 Bacteria 4814
258 Ga0097620_100067595 3300006931 Bacteria 3608
259 Ga0075435_100230856 3300007076 Bacteria 1572
260 Ga0075435_100550114 3300007076 Bacteria 999
261 Ga0099795_10035341 3300007788 Bacteria 1747
262 Ga0105250_10045209 3300009092 Bacteria 1765
263 Ga0111539_10037182 3300009094 Bacteria 5881
264 Ga0111539_10061036 3300009094 Bacteria 4467
265 Ga0111539_10070428 3300009094 Bacteria 4129
266 Ga0111539_10120604 3300009094 Bacteria 3072
267 Ga0111539_10325028 3300009094 Bacteria 1790
268 Ga0105245_10030092 3300009098 Bacteria 4800
269 Ga0105245_10032673 3300009098 Bacteria 4607
270 Ga0105245_10179396 3300009098 Bacteria 2022
271 Ga0105247_10005590 3300009101 Bacteria 7893
272 Ga0105247_10019206 3300009101 Bacteria 4102
273 Ga0105247_10060851 3300009101 Bacteria 2341
274 Ga0114129_10132865 3300009147 Bacteria 3417
275 Ga0105243_10007170 3300009148 Bacteria 8573
276 Ga0105243_10011661 3300009148 Bacteria 6648
277 Ga0105243_10028675 3300009148 Bacteria 4275
278 Ga0105241_10942308 3300009174 Bacteria 804
279 Ga0105242_10001935 3300009176 Bacteria 16290
280 Ga0105242_10076243 3300009176 Bacteria 2795
281 Ga0105242_10190600 3300009176 Bacteria 1815
282 Ga0105248_10006012 3300009177 Bacteria 13318
283 Ga0105248_10008947 3300009177 Bacteria 11013
284 Ga0105248_10370410 3300009177 Bacteria 1612
285 Ga0105248_10477501 3300009177 Bacteria 1405
286 Ga0105237_10033687 3300009545 Bacteria 5189
287 Ga0105237_10041778 3300009545 Bacteria 4624
288 Ga0105238_10010345 3300009551 Bacteria 9360
289 Ga0105249_10020195 3300009553 Bacteria 5953
290 Ga0105249_10065368 3300009553 Bacteria 3346
291 Ga0105249_10438014 3300009553 Bacteria 1344
292 Ga0099796_10108362 3300010159 Bacteria 1054
293 Ga0105239_10030558 3300010375 Bacteria 5923
294 Ga0105239_10063403 3300010375 Bacteria 4057
295 Ga0105239_10102206 3300010375 Bacteria 3172
296 Ga0105239_10524742 3300010375 Bacteria 1347
297 Ga0105246_10015600 3300011119 Bacteria 4800
298 Ga0105246_10236845 3300011119 Bacteria 1441
299 Ga0105246_10626622 3300011119 Bacteria 933
300 Ga0157344_1006718 3300012476 Bacteria 750
301 Ga0157318_1002428 3300012482 Bacteria 1013
302 Ga0157321_1001368 3300012487 Bacteria 1227
303 Ga0157322_1002750 3300012490 Bacteria 1020
304 Ga0157335_1001301 3300012492 Bacteria 1344
305 Ga0157370_10029408 3300013104 Bacteria 5391
306 Ga0157374_10011924 3300013296 Bacteria 7544
307 Ga0157374_10039016 3300013296 Bacteria 4369
308 Ga0157378_10017617 3300013297 Bacteria 6271
309 Ga0157378_10425637 3300013297 Bacteria 1313
310 Ga0163162_10126160 3300013306 Bacteria 2665
311 Ga0163162_10303778 3300013306 Bacteria 1728
312 Ga0163162_10584899 3300013306 Bacteria 1243
313 Ga0163162_10842481 3300013306 Bacteria 1032
314 Ga0157372_10747205 3300013307 Bacteria 1137
315 Ga0157375_10013661 3300013308 Bacteria 7238
316 Ga0157375_10127122 3300013308 Bacteria 2665
317 Ga0157375_10127223 3300013308 Bacteria 2664
318 Ga0163163_10003978 3300014325 Bacteria 12611
319 Ga0163163_10015764 3300014325 Bacteria 6999
320 Ga0163163_10023328 3300014325 Bacteria 5870
321 Ga0163163_10601886 3300014325 Bacteria 1162
322 Ga0157380_10004813 3300014326 Bacteria 9407
323 Ga0157380_10100396 3300014326 Bacteria 2409
324 Ga0157380_10157928 3300014326 Bacteria 1967
325 Ga0157377_10004770 3300014745 Bacteria 6283
326 Ga0157377_10180499 3300014745 Bacteria 1327
327 Ga0157379_10010240 3300014968 Bacteria 8165
328 Ga0157379_10094745 3300014968 Bacteria 2679
329 Ga0157379_10211753 3300014968 Bacteria 1755
330 Ga0157376_10014086 3300014969 Bacteria 5989
331 Ga0157376_10338797 3300014969 Bacteria 1436
332 Ga0163161_10007898 3300017792 Bacteria 7361
333 Ga0163161_10041289 3300017792 Bacteria 3315
334 Ga0163161_10456733 3300017792 Bacteria 1033
335 Ga0163161_10777903 3300017792 Bacteria 803
336 Ga0206356_10486688 3300020070 Bacteria 1689
337 Ga0206354_11375852 3300020081 Bacteria 2252
338 Ga0206353_11199619 3300020082 Bacteria 1712
339 Ga0207666_1000154 3300025271 Bacteria 10649
340 Ga0207666_1003243 3300025271 Bacteria 1991
341 Ga0207673_1000426 3300025290 Bacteria 4346
342 Ga0209676_1031966 3300025292 Bacteria 1589
343 Ga0207697_10010494 3300025315 Bacteria 3957
344 Ga0207697_10028382 3300025315 Bacteria 2289
345 Ga0207656_10074793 3300025321 Bacteria 1512
346 Ga0207653_10005246 3300025885 Bacteria 4049
347 Ga0207682_10000334 3300025893 Bacteria 21500
348 Ga0207682_10000708 3300025893 Bacteria 15474
349 Ga0207692_10014755 3300025898 Bacteria 3420
350 Ga0207692_10038583 3300025898 Bacteria 2344
351 Ga0207692_10120059 3300025898 Bacteria 1471
352 Ga0207692_10315067 3300025898 Bacteria 956
353 Ga0207642_10006348 3300025899 Bacteria 3925
354 Ga0207642_10008392 3300025899 Bacteria 3540
355 Ga0207710_10006771 3300025900 Bacteria 4882
356 Ga0207710_10007564 3300025900 Bacteria 4595
357 Ga0207688_10000275 3300025901 Bacteria 23509
358 Ga0207688_10001351 3300025901 Bacteria 12746
359 Ga0207688_10092807 3300025901 Bacteria 1735
360 Ga0207680_10068441 3300025903 Bacteria 2190
361 Ga0207680_10137075 3300025903 Bacteria 1619
362 Ga0207680_10169036 3300025903 Bacteria 1471
363 Ga0207680_10331376 3300025903 Bacteria 1066
364 Ga0207647_10000612 3300025904 Bacteria 27777
365 Ga0207647_10023601 3300025904 Bacteria 4067
366 Ga0207647_10084842 3300025904 Bacteria 1895
367 Ga0207647_10194721 3300025904 Bacteria 1174
368 Ga0207685_10000320 3300025905 Bacteria 7735
369 Ga0207685_10043520 3300025905 Bacteria 1692
370 Ga0207699_10282515 3300025906 Bacteria 1154
371 Ga0207645_10000507 3300025907 Bacteria 32224
372 Ga0207645_10082273 3300025907 Bacteria 2064
373 Ga0207645_10096268 3300025907 Bacteria 1907
374 Ga0207645_10119712 3300025907 Bacteria 1709
375 Ga0207643_10000568 3300025908 Bacteria 23402
376 Ga0207643_10012113 3300025908 Bacteria 4659
377 Ga0207643_10056119 3300025908 Bacteria 2240
378 Ga0207705_10031407 3300025909 Bacteria 3791
379 Ga0207654_10016338 3300025911 Bacteria 3864
380 Ga0207707_10027362 3300025912 Bacteria 4988
381 Ga0207707_10033854 3300025912 Bacteria 4471
382 Ga0207707_10200597 3300025912 Bacteria 1739
383 Ga0207695_10571172 3300025913 Bacteria 1012
384 Ga0207671_10162914 3300025914 Bacteria 1728
385 Ga0207693_10009655 3300025915 Bacteria 7857
386 Ga0207693_10182232 3300025915 Bacteria 1653
387 Ga0207663_10004000 3300025916 Bacteria 7299
388 Ga0207663_10022980 3300025916 Bacteria 3572
389 Ga0207663_10028057 3300025916 Bacteria 3290
390 Ga0207663_10176638 3300025916 Bacteria 1521
391 Ga0207663_10327568 3300025916 Bacteria 1153
392 Ga0207663_10416479 3300025916 Bacteria 1030
393 Ga0207660_10209640 3300025917 Bacteria 1525
394 Ga0207660_10299596 3300025917 Bacteria 1280
395 Ga0207660_10482542 3300025917 Bacteria 1005
396 Ga0207662_10000180 3300025918 Bacteria 30030
397 Ga0207662_10001226 3300025918 Bacteria 12284
398 Ga0207662_10126602 3300025918 Bacteria 1607
399 Ga0207662_10303721 3300025918 Bacteria 1062
400 Ga0207657_10007922 3300025919 Bacteria 10835
401 Ga0207657_10033193 3300025919 Bacteria 4655
402 Ga0207657_10112127 3300025919 Bacteria 2251
403 Ga0207657_10114769 3300025919 Bacteria 2221
404 Ga0207657_10165307 3300025919 Bacteria 1795
405 Ga0207649_10060687 3300025920 Bacteria 2377
406 Ga0207649_10062856 3300025920 Bacteria 2342
407 Ga0207652_10006172 3300025921 Bacteria 9687
408 Ga0207652_10065666 3300025921 Bacteria 3143
409 Ga0207652_10147776 3300025921 Bacteria 2104
410 Ga0207681_10002030 3300025923 Bacteria 13006
411 Ga0207681_10415523 3300025923 Bacteria 1089
412 Ga0207681_10422636 3300025923 Bacteria 1080
413 Ga0207694_10015181 3300025924 Bacteria 5809
414 Ga0207694_10038471 3300025924 Bacteria 3678
415 Ga0207650_10039975 3300025925 Bacteria 3430
416 Ga0207650_10427782 3300025925 Bacteria 1099
417 Ga0207659_10050219 3300025926 Bacteria 2962
418 Ga0207659_10132723 3300025926 Bacteria 1924
419 Ga0207659_10152956 3300025926 Bacteria 1803
420 Ga0207659_10199323 3300025926 Bacteria 1598
421 Ga0207687_10002607 3300025927 Bacteria 12234
422 Ga0207687_10003614 3300025927 Bacteria 10416
423 Ga0207700_10001220 3300025928 Bacteria 14725
424 Ga0207700_10019945 3300025928 Bacteria 4540
425 Ga0207700_10085182 3300025928 Bacteria 2480
426 Ga0207700_10404713 3300025928 Bacteria 1196
427 Ga0207664_10040635 3300025929 Bacteria 3619
428 Ga0207664_10727263 3300025929 Bacteria 893
429 Ga0207664_10972646 3300025929 Bacteria 761
430 Ga0207644_10051426 3300025931 Bacteria 2957
431 Ga0207644_10126305 3300025931 Bacteria 1953
432 Ga0207690_10022040 3300025932 Bacteria 3957
433 Ga0207690_10128802 3300025932 Bacteria 1849
434 Ga0207690_10132430 3300025932 Bacteria 1826
435 Ga0207690_10165427 3300025932 Bacteria 1653
436 Ga0207690_10507899 3300025932 Bacteria 976
437 Ga0207706_10017852 3300025933 Bacteria 6390
438 Ga0207706_10052339 3300025933 Bacteria 3604
439 Ga0207706_10129897 3300025933 Bacteria 2216
440 Ga0207706_10201281 3300025933 Bacteria 1747
441 Ga0207686_10003280 3300025934 Bacteria 8699
442 Ga0207709_10007840 3300025935 Bacteria 5920
443 Ga0207709_10008453 3300025935 Bacteria 5694
444 Ga0207670_10001377 3300025936 Bacteria 12776
445 Ga0207670_10003114 3300025936 Bacteria 8775
446 Ga0207670_10415255 3300025936 Bacteria 1079
447 Ga0207669_10000408 3300025937 Bacteria 18868
448 Ga0207669_10001914 3300025937 Bacteria 8827
449 Ga0207669_10152532 3300025937 Bacteria 1620
450 Ga0207704_10004703 3300025938 Bacteria 6263
451 Ga0207665_10012736 3300025939 Bacteria 5530
452 Ga0207691_10001024 3300025940 Bacteria 27662
453 Ga0207691_10004697 3300025940 Bacteria 13224
454 Ga0207691_10006125 3300025940 Bacteria 11628
455 Ga0207691_10091605 3300025940 Bacteria 2724
456 Ga0207691_10209859 3300025940 Bacteria 1692
457 Ga0207711_10011912 3300025941 Bacteria 7227
458 Ga0207711_10028076 3300025941 Bacteria 4732
459 Ga0207689_10000332 3300025942 Bacteria 43928
460 Ga0207689_10005191 3300025942 Bacteria 11691
461 Ga0207661_10003166 3300025944 Bacteria 11415
462 Ga0207679_10001592 3300025945 Bacteria 14183
463 Ga0207679_10198059 3300025945 Bacteria 1676
464 Ga0207667_10124810 3300025949 Bacteria 2651
465 Ga0207667_10964065 3300025949 Bacteria 842
466 Ga0207651_10021088 3300025960 Bacteria 3950
467 Ga0207651_10155032 3300025960 Bacteria 1788
468 Ga0207712_10001343 3300025961 Bacteria 16854
469 Ga0207712_10138257 3300025961 Bacteria 1866
470 Ga0207712_10141856 3300025961 Bacteria 1845
471 Ga0207712_10467189 3300025961 Bacteria 1073
472 Ga0207668_10004567 3300025972 Bacteria 8145
473 Ga0207668_10501658 3300025972 Bacteria 1044
474 Ga0207640_10002417 3300025981 Bacteria 9990
475 Ga0207640_10389669 3300025981 Bacteria 1131
476 Ga0207640_11008644 3300025981 Bacteria 733
477 Ga0207658_10004726 3300025986 Bacteria 9428
478 Ga0207658_10027786 3300025986 Bacteria 3979
479 Ga0207677_10002427 3300026023 Bacteria 9782
480 Ga0207677_10278296 3300026023 Bacteria 1372
481 Ga0207703_10002645 3300026035 Bacteria 15434
482 Ga0207703_10005585 3300026035 Bacteria 10097
483 Ga0207703_10150403 3300026035 Bacteria 2029
484 Ga0207639_10055289 3300026041 Bacteria 3037
485 Ga0207639_10159382 3300026041 Bacteria 1900
486 Ga0207639_10193855 3300026041 Bacteria 1737
487 Ga0207678_10025860 3300026067 Bacteria 5122
488 Ga0207678_10112958 3300026067 Bacteria 2317
489 Ga0207678_10159510 3300026067 Bacteria 1926
490 Ga0207708_10002748 3300026075 Bacteria 12925
491 Ga0207708_10018053 3300026075 Bacteria 5308
492 Ga0207708_10048486 3300026075 Bacteria 3233
493 Ga0207702_10026502 3300026078 Bacteria 4812
494 Ga0207702_10176552 3300026078 Bacteria 1963
495 Ga0207702_10237089 3300026078 Bacteria 1707
496 Ga0207702_10286038 3300026078 Bacteria 1560
497 Ga0207641_10006287 3300026088 Bacteria 10041
498 Ga0207641_10053257 3300026088 Bacteria 3429
499 Ga0207641_10274649 3300026088 Bacteria 1583
500 Ga0207648_10003365 3300026089 Bacteria 16795
501 Ga0207648_10006303 3300026089 Bacteria 11799
502 Ga0207648_10042779 3300026089 Bacteria 3977
503 Ga0207676_10013324 3300026095 Bacteria 5906
504 Ga0207676_10183895 3300026095 Bacteria 1832
505 Ga0207674_10023885 3300026116 Bacteria 6539
506 Ga0207674_10047854 3300026116 Bacteria 4381
507 Ga0207674_10331663 3300026116 Bacteria 1471
508 Ga0207675_100004008 3300026118 Bacteria 14284
509 Ga0207675_100045522 3300026118 Bacteria 4099
510 Ga0207683_10000274 3300026121 Bacteria 46060
511 Ga0207683_10005903 3300026121 Bacteria 10500
512 Ga0207683_10025275 3300026121 Bacteria 5122
513 Ga0207683_10154753 3300026121 Bacteria 2070
514 Ga0207698_10067335 3300026142 Bacteria 2823
515 Ga0207698_10416439 3300026142 Bacteria 1288
516 Ga0207698_10507500 3300026142 Bacteria 1175
517 Ga0209996_1011097 3300027395 Bacteria 1200
518 Ga0210002_1019822 3300027617 Bacteria 1081
519 Ga0209971_1009446 3300027682 Bacteria 2310
520 Ga0209966_1003812 3300027695 Bacteria 2543
521 Ga0209998_10000845 3300027717 Bacteria 7895
522 Ga0209974_10005778 3300027876 Bacteria 4338
523 Ga0207428_10001592 3300027907 Bacteria 23650
524 Ga0268266_10025407 3300028379 Bacteria 5039
525 Ga0268266_10045475 3300028379 Bacteria 3756
526 Ga0268265_10078047 3300028380 Bacteria 2603
527 Ga0268265_10225098 3300028380 Bacteria 1644
528 Ga0268264_10010815 3300028381 Bacteria 7539
529 Ga0268264_10018602 3300028381 Bacteria 5680
530 Ga0268264_10340709 3300028381 Bacteria 1424
531 Ga0268264_10834109 3300028381 Bacteria 923
532 Ga0265318_10010865 3300028577 Bacteria 3949
533 Ga0265328_10024780 3300031239 Bacteria 2264
534 Ga0265320_10039805 3300031240 Bacteria 2347
535 Ga0265325_10000053 3300031241 Bacteria 77918
536 Ga0265329_10011841 3300031242 Bacteria 3159
537 Ga0265340_10026434 3300031247 Bacteria 2934
538 Ga0265340_10150493 3300031247 Bacteria 1061
539 Ga0265339_10112314 3300031249 Bacteria 1408
540 Ga0265316_10040955 3300031344 Bacteria 3711
541 Ga0265316_10156098 3300031344 Bacteria 1708
542 Ga0265316_10185435 3300031344 Bacteria 1548
543 Ga0307513_10146529 3300031456 Bacteria 2278
544 Ga0265313_10021409 3300031595 Bacteria 3536
545 Ga0265313_10028044 3300031595 Bacteria 2934
546 Ga0265313_10039983 3300031595 Bacteria 2322
547 Ga0265313_10042605 3300031595 Bacteria 2228
548 Ga0265313_10049442 3300031595 Bacteria 2023
549 Ga0316579_10016702 3300031691 Bacteria 3211
550 Ga0265314_10064843 3300031711 Bacteria 2470
551 Ga0265342_10000518 3300031712 Bacteria 41040
552 Ga0373948_0020831 3300034817 Bacteria 1252
553 Ga0373950_0002923 3300034818 Bacteria 2403
554 Ga0373958_0000164 3300034819 Bacteria 7587
555 Ga0373958_0002465 3300034819 Bacteria 2597
556 Ga0373959_0001690 3300034820 Bacteria 3514
557 Ga0373926_0056031 3300035083 Bacteria 1429
558 Ga0373928_0001377 3300035084 Bacteria 4753
559 Ga0373929_0001028 3300035085 Bacteria 5403
560 Ga0373940_0008662 3300035088 Bacteria 2343
561 Ga0373940_0023024 3300035088 Bacteria 1605
562 Ga0373944_0044641 3300035089 Bacteria 1381
563 Ga0373949_0009783 3300035090 Bacteria 2099
564 Ga0373949_0011027 3300035090 Bacteria 1987
565 Ga0373951_0001467 3300035091 Bacteria 6173
566 Ga0373951_0009850 3300035091 Bacteria 2148
567 Ga0373952_0000292 3300035092 Bacteria 8280
568 Ga0373952_0005480 3300035092 Bacteria 2320
569 Ga0373923_0035655 3300035111 Bacteria 2026
570 Ga0373932_0002291 3300035112 Bacteria 4879
571 Ga0373932_0003964 3300035112 Bacteria 3526
572 Ga0373932_0017384 3300035112 Bacteria 1845
573 Ga0373939_0001821 3300035114 Bacteria 5132
574 Ga0373939_0012022 3300035114 Bacteria 2199
575 Ga0373939_0012263 3300035114 Bacteria 2182
576 Ga0373941_0000983 3300035115 Bacteria 5911
577 Ga0373941_0025573 3300035115 Bacteria 1706
578 Ga0373945_0044159 3300035116 Bacteria 1619
579 Ga0373953_0107126 3300035117 Bacteria 1180
580 Ga0373954_0036706 3300035118 Bacteria 2276
581 Ga0373957_0140312 3300035120 Bacteria 988
582 Ga0373960_0004413 3300035121 Bacteria 3221
583 Ga0373943_0156582 3300035170 Bacteria 1237
584 Ga0373946_0117900 3300035171 Bacteria 1209
585 Ga0373942_0006267 3300035207 Bacteria 2744
586 Ga0373961_0004306 3300035241 Bacteria 3445
587 Ga0373962_0002831 3300035242 Bacteria 4145
588 Ga0373962_0004616 3300035242 Bacteria 3328
589 Ga0373924_0025743 3300035410 Bacteria 2327
590 Ga0373924_0136218 3300035410 Bacteria 1070
591 Ga0373931_0003138 3300035691 Bacteria 7381
592 Ga0373931_0054400 3300035691 Bacteria 2139
593 Ga0373935_0188118 3300035692 Bacteria 1421
594 Ga0373935_0431947 3300035692 Bacteria 949
595 Ga0373927_0049835 3300035695 Bacteria 2707
596 Ga0373927_0094513 3300035695 Bacteria 1942
597 Ga0373933_0012915 3300035724 Bacteria 4620
598 Ga0373933_0453406 3300035724 Bacteria 839
599 Ga0373947_0096813 3300035725 Bacteria 1849
600 Ga0373947_0159607 3300035725 Bacteria 1457
601 Ga0373937_0002979 3300036401 Bacteria 14182
602 Ga0373937_0031439 3300036401 Bacteria 4811
603 Ga0373937_0034566 3300036401 Bacteria 4597
604 Ga0373937_0050723 3300036401 Bacteria 3802
605 Ga0373937_0129816 3300036401 Bacteria 2353
606 Ga0373937_0533252 3300036401 Unclassified 1115
607 Ga0373925_0210053 3300037068 Bacteria 1550
608 Ga0395900_0971672 3300037418 Bacteria 770
609 Ga0395898_0439103 3300037466 Bacteria 1243
610 Ga0395905_0301087 3300037471 Bacteria 1491
611 Ga0436364_0336407 3300037853 Bacteria 5591
612 Ga0395901_0183204 3300038443 Bacteria 2197
613 Ga0395901_1228684 3300038443 Bacteria 714
614 Ga0436365_1171847 3300039437 Bacteria 6320
615 Ga0439453_0000038 3300041408 Bacteria 8861
616 Ga0439441_022252 3300042001 Bacteria 1177
617 Ga0439455_0033007 3300042012 Bacteria 1296
618 Ga0439459_0074535 3300042438 Bacteria 791
619 Ga0439464_0008371 3300042439 Bacteria 2711
620 Ga0439460_0010277 3300042461 Bacteria 2392
621 Ga0451577_0427936 3300042876 Bacteria 1202
622 Ga0439440_0008135 3300042993 Bacteria 2148
623 Ga0466968_0120417 3300044735 Bacteria 1187
624 Ga0466960_0104840 3300044901 Bacteria 1461
625 Ga0451576_0055704 3300045051 Bacteria 4135
626 Ga0495592_0050832 3300046454 Bacteria 3079
627 Ga0495603_0028052 3300046455 Bacteria 3395
628 Ga0495638_0104840 3300046460 Bacteria 1686
629 Ga0495641_0119944 3300046461 Bacteria 1173
630 Ga0495651_0020033 3300046462 Bacteria 5190
631 Ga0495653_0174274 3300046463 Bacteria 1482
632 Ga0495580_0010013 3300046472 Bacteria 7413
633 Ga0495582_0018246 3300046473 Bacteria 3839
634 Ga0495639_0130392 3300046475 Bacteria 1203
635 Ga0495662_0027889 3300046476 Bacteria 2727
636 Ga0495664_0030331 3300046477 Bacteria 3167
637 Ga0495584_0074023 3300046491 Bacteria 1712
638 Ga0495608_0019894 3300046511 Bacteria 4616
639 Ga0495618_0107975 3300046514 Bacteria 1782
640 Ga0495628_0195141 3300046516 Bacteria 1528
641 Ga0495628_0472243 3300046516 Bacteria 908
642 Ga0495630_0056924 3300046517 Bacteria 2929
643 Ga0495632_0082612 3300046519 Bacteria 1531
644 Ga0495666_0031958 3300046526 Bacteria 2578
645 Ga0495652_0059083 3300046529 Bacteria 3245
646 Ga0495652_0084712 3300046529 Bacteria 2606
647 Ga0495640_0054577 3300046533 Bacteria 2736
648 Ga0495640_0220229 3300046533 Bacteria 1197
649 Ga0495587_0190662 3300046536 Bacteria 1161
650 Ga0495598_0001611 3300046537 Bacteria 4521
651 Ga0495598_0101142 3300046537 Bacteria 954
652 Ga0495645_0251121 3300046543 Bacteria 1175
653 Ga0495667_0121301 3300046559 Bacteria 1688
654 Ga0495667_0214121 3300046559 Bacteria 1231
655 Ga0495668_0411227 3300046616 Bacteria 744
656 Ga0495634_0151140 3300046642 Bacteria 1468
657 Ga0495635_0014508 3300046663 Bacteria 5514
658 Ga0495635_0083023 3300046663 Bacteria 2193
659 Ga0495659_0074367 3300046664 Bacteria 1278
660 Ga0495661_0346132 3300046665 Bacteria 733
661 Ga0495657_0039179 3300046675 Bacteria 3258
662 Ga0495599_0138251 3300046678 Bacteria 1511
663 Ga0495646_0014727 3300046680 Bacteria 4970
664 Ga0495647_0025963 3300046681 Bacteria 2143
665 Ga0495647_0151596 3300046681 Bacteria 994
666 Ga0495658_0028224 3300046683 Bacteria 3027
667 Ga0495613_0561261 3300046689 Bacteria 763
668 Ga0495589_0206502 3300046794 Bacteria 926
669 Ga0495600_0018126 3300046809 Bacteria 4483
670 Ga0495581_0055023 3300047315 Bacteria 2297
671 Ga0495604_0218833 3300047317 Bacteria 1312
672 Ga0495604_0237887 3300047317 Bacteria 1246
673 Ga0495604_0297581 3300047317 Bacteria 1085
674 Ga0495674_0155404 3300047319 Bacteria 1916
675 Ga0495674_0204619 3300047319 Bacteria 1637
676 Ga0495674_0288918 3300047319 Bacteria 1341
677 Ga0495680_0021675 3300047322 Bacteria 5374
678 Ga0495680_0352938 3300047322 Bacteria 1023
679 Ga0495675_0114418 3300047444 Bacteria 1682
680 Ga0495675_0162056 3300047444 Bacteria 1377
681 Ga0495602_0036446 3300048088 Bacteria 4578
682 Ga0496100_0003675 3300048903 Bacteria 8028
683 Ga0496101_0001773 3300048904 Bacteria 12961
684 Ga0496101_0011849 3300048904 Bacteria 5803
685 Ga0496101_0014644 3300048904 Bacteria 5274
686 Ga0496102_0001904 3300048905 Bacteria 18000
687 Ga0496102_0100023 3300048905 Bacteria 2692
688 Ga0496102_0212394 3300048905 Bacteria 1824
689 Ga0496102_0587698 3300048905 Bacteria 1036
690 Ga0496102_0680950 3300048905 Bacteria 951
691 Ga0496103_0001021 3300048906 Bacteria 19584
692 Ga0496103_0005324 3300048906 Bacteria 7712
693 Ga0496103_0127166 3300048906 Bacteria 1625
694 Ga0496104_0001263 3300048907 Bacteria 21783
695 Ga0496104_0050329 3300048907 Bacteria 3931
696 Ga0496104_0075765 3300048907 Bacteria 3203
697 Ga0496104_0132864 3300048907 Bacteria 2391
698 Ga0496104_0886231 3300048907 Bacteria 797
699 Ga0496105_0004984 3300048908 Bacteria 10045
700 Ga0496105_0053068 3300048908 Bacteria 3348
701 Ga0496105_0094935 3300048908 Bacteria 2463
702 Ga0496105_0323920 3300048908 Bacteria 1235
703 Ga0496105_0617798 3300048908 Bacteria 840
704 Ga0496106_0002628 3300048909 Bacteria 13353
705 Ga0496106_0045337 3300048909 Bacteria 3302
706 Ga0496106_0061632 3300048909 Bacteria 2846
707 Ga0496106_0238318 3300048909 Bacteria 1453
708 Ga0496106_0285592 3300048909 Bacteria 1322
709 Ga0496107_0000236 3300048910 Bacteria 29092
710 Ga0496107_0049407 3300048910 Bacteria 3031
711 Ga0496107_0053424 3300048910 Bacteria 2914
712 Ga0496107_0099804 3300048910 Bacteria 2128
713 Ga0496107_0120324 3300048910 Bacteria 1934
714 Ga0496107_0198406 3300048910 Bacteria 1491
715 Ga0496108_0003388 3300048911 Bacteria 12796
716 Ga0496108_0022997 3300048911 Bacteria 5128
717 Ga0496108_0035092 3300048911 Bacteria 4168
718 Ga0496108_0462155 3300048911 Bacteria 1109
719 Ga0496109_0037467 3300048912 Bacteria 4380
720 Ga0496109_0080887 3300048912 Bacteria 2994
721 Ga0496109_0083716 3300048912 Bacteria 2941
722 Ga0496109_0085820 3300048912 Bacteria 2906
723 Ga0496109_0393277 3300048912 Bacteria 1310
724 Ga0496110_0004352 3300048913 Bacteria 10961
725 Ga0496110_0078643 3300048913 Bacteria 2936
726 Ga0496110_0395400 3300048913 Bacteria 1260
727 Ga0496110_0667981 3300048913 Bacteria 939
728 Ga0496111_0001756 3300048914 Bacteria 12695
729 Ga0496111_0126324 3300048914 Bacteria 1891
730 Ga0496111_0148239 3300048914 Bacteria 1740
731 Ga0496112_0005669 3300048915 Bacteria 10847
732 Ga0496112_0077435 3300048915 Bacteria 3288
733 Ga0496113_0021874 3300048916 Bacteria 4515
734 Ga0496113_0127702 3300048916 Bacteria 1992
735 Ga0496113_0198643 3300048916 Bacteria 1594
736 Ga0496114_0002646 3300048917 Bacteria 13670
737 Ga0496114_0147587 3300048917 Bacteria 2039
738 Ga0496114_0155495 3300048917 Bacteria 1985
739 Ga0496115_0005597 3300048918 Bacteria 9143
740 Ga0496115_0040996 3300048918 Bacteria 3682
741 Ga0496115_0109599 3300048918 Bacteria 2267
742 Ga0496115_0136882 3300048918 Bacteria 2019
743 Ga0496115_0259437 3300048918 Bacteria 1429
744 Ga0501031_0198670 3300049568 Bacteria 1309
745 Ga0501031_0232862 3300049568 Bacteria 1198
746 Ga0501032_0016084 3300049569 Bacteria 5265
747 Ga0501032_0043822 3300049569 Bacteria 3029
748 Ga0501032_0071433 3300049569 Bacteria 2313
749 Ga0501032_0180878 3300049569 Bacteria 1380
750 Ga0501033_0214878 3300049570 Bacteria 1370
751 Ga0501034_0000499 3300049571 Bacteria 63629
752 Ga0501034_0009608 3300049571 Bacteria 10119
753 Ga0501034_0134450 3300049571 Bacteria 2454
754 Ga0501034_0215630 3300049571 Bacteria 1873
755 Ga0501036_0007398 3300049572 Bacteria 8947
756 Ga0501036_0009764 3300049572 Bacteria 7902
757 Ga0501036_0012348 3300049572 Bacteria 7073
758 Ga0501036_0131644 3300049572 Bacteria 2111
759 Ga0501036_0432528 3300049572 Bacteria 1097
760 Ga0501036_0635171 3300049572 Bacteria 884
761 Ga0501037_0024974 3300049573 Bacteria 4416
762 Ga0501037_0051020 3300049573 Bacteria 3026
763 Ga0501037_0056031 3300049573 Bacteria 2880
764 Ga0501037_0560181 3300049573 Unclassified 771
765 Ga0501038_0035923 3300049574 Bacteria 4349
766 Ga0501038_0152298 3300049574 Bacteria 1885
767 Ga0501038_0273766 3300049574 Bacteria 1330
768 Ga0501039_0104501 3300049575 Bacteria 2211
769 Ga0501039_0233072 3300049575 Bacteria 1447
770 Ga0501039_0262812 3300049575 Bacteria 1356
771 Ga0501040_0125243 3300049576 Bacteria 1805
772 Ga0501042_0223183 3300049578 Bacteria 1359
773 Ga0501043_0005754 3300049579 Bacteria 9987
774 Ga0501043_0008504 3300049579 Bacteria 8080
775 Ga0501043_0011982 3300049579 Bacteria 6784
776 Ga0501043_0042246 3300049579 Bacteria 3582
777 Ga0501043_0113119 3300049579 Bacteria 2131
778 Ga0501043_0179409 3300049579 Bacteria 1650
779 Ga0501046_0062627 3300049580 Bacteria 2906
780 Ga0501046_0072062 3300049580 Bacteria 2683
781 Ga0501046_0083772 3300049580 Bacteria 2460
782 Ga0501046_0170329 3300049580 Bacteria 1635
783 Ga0501046_0327756 3300049580 Bacteria 1115
784 Ga0501047_0002024 3300049581 Bacteria 19400
785 Ga0501047_0041290 3300049581 Bacteria 4458
786 Ga0501047_0062852 3300049581 Bacteria 3581
787 Ga0501047_0077885 3300049581 Bacteria 3188
788 Ga0501047_0114702 3300049581 Bacteria 2576
789 Ga0501047_0153238 3300049581 Bacteria 2179
790 Ga0501048_0004059 3300049582 Bacteria 11147
791 Ga0501067_0082459 3300049583 Bacteria 1783
792 Ga0501067_0270368 3300049583 Bacteria 946
793 Ga0501068_0020626 3300049584 Bacteria 3841
794 Ga0501068_0090238 3300049584 Bacteria 1890
795 Ga0501068_0213840 3300049584 Bacteria 1225
796 Ga0501069_0016777 3300049585 Bacteria 3935
797 Ga0501070_0004251 3300049586 Bacteria 12311
798 Ga0501070_0006750 3300049586 Bacteria 9773
799 Ga0501070_0045798 3300049586 Bacteria 3637
800 Ga0501070_0070352 3300049586 Bacteria 2897
801 Ga0501070_0456724 3300049586 Bacteria 1029
802 Ga0501070_0505704 3300049586 Bacteria 970
803 Ga0501071_0502129 3300049587 Bacteria 930
804 Ga0501072_0179975 3300049588 Bacteria 1686
805 Ga0501073_0086972 3300049589 Bacteria 2174
806 Ga0501073_0103694 3300049589 Bacteria 1974
807 Ga0501073_0191402 3300049589 Bacteria 1415
808 Ga0501073_0261827 3300049589 Bacteria 1193
809 Ga0501074_0057844 3300049590 Bacteria 2793
810 Ga0501074_0064261 3300049590 Bacteria 2642
811 Ga0501074_0085347 3300049590 Bacteria 2262
812 Ga0501074_0414306 3300049590 Bacteria 955
813 Ga0501075_0285254 3300049591 Bacteria 1258
814 Ga0501076_0031419 3300049592 Bacteria 4141
815 Ga0501076_0206375 3300049592 Bacteria 1605
816 Ga0501079_0060978 3300049741 Bacteria 2910
817 Ga0501079_0136693 3300049741 Bacteria 1908
818 Ga0501079_0457862 3300049741 Bacteria 1002
819 Ga0501079_0781986 3300049741 Bacteria 751
820 Ga0501080_0002821 3300049742 Bacteria 15273
821 Ga0501080_0119895 3300049742 Bacteria 2438
822 Ga0501080_0319221 3300049742 Bacteria 1406
823 Ga0501083_0020404 3300049744 Bacteria 4610
824 Ga0501083_0038865 3300049744 Bacteria 3233
825 Ga0501083_0065021 3300049744 Bacteria 2430
826 Ga0501083_0554275 3300049744 Bacteria 748
827 Ga0501035_0000267 3300049822 Bacteria 61712
828 Ga0501035_0056076 3300049822 Bacteria 3517
829 Ga0501035_0106239 3300049822 Bacteria 2461
830 Ga0501035_0146968 3300049822 Bacteria 2047
831 Ga0501044_0018785 3300049823 Bacteria 7405
832 Ga0501044_0108203 3300049823 Bacteria 2790
833 Ga0501044_0180339 3300049823 Bacteria 2079
834 Ga0501044_0182169 3300049823 Bacteria 2067
835 Ga0501044_0219016 3300049823 Bacteria 1854
836 Ga0501044_0225061 3300049823 Bacteria 1825
837 Ga0501044_0417186 3300049823 Bacteria 1253
838 Ga0501044_0529607 3300049823 Bacteria 1077
839 Ga0501045_0098632 3300049824 Bacteria 2162
840 Ga0501045_0523311 3300049824 Bacteria 880
841 nmdc:mga05p37_141876_c1 3300050507 Bacteria 2943
842 nmdc:mga05p37_9183_c1 3300050507 Bacteria 11689
843 nmdc:mga0qj67_10820_c1 3300050509 Bacteria 6824
844 nmdc:mga0qj67_243628_c1 3300050509 Bacteria 1458
845 nmdc:mga0qj67_540679_c1 3300050509 Bacteria 935
846 nmdc:mga06r32_173500_c1 3300050510 Bacteria 2140
847 nmdc:mga06r32_664848_c1 3300050510 Bacteria 1009
848 nmdc:mga08y16_29557_c1 3300050511 Bacteria 5773
849 nmdc:mga08y16_413561_c1 3300050511 Bacteria 1379
850 nmdc:mga0n895_196205_c1 3300050512 Bacteria 2050
851 nmdc:mga0n895_258203_c1 3300050512 Bacteria 1768
852 nmdc:mga0n895_289077_c1 3300050512 Bacteria 1662
853 nmdc:mga0n895_336714_c1 3300050512 Bacteria 1529
854 nmdc:mga0n895_38629_c1 3300050512 Bacteria 4626
855 nmdc:mga0n895_677052_c1 3300050512 Bacteria 1029
856 nmdc:mga0rr50_223321_c1 3300050513 Bacteria 1556
857 nmdc:mga08x19_247378_c1 3300050514 Bacteria 1230
858 nmdc:mga08x19_252421_c1 3300050514 Bacteria 1218
859 nmdc:mga08x19_317731_c1 3300050514 Bacteria 1083
860 nmdc:mga0a205_30249_c1 3300050515 Bacteria 5184
861 nmdc:mga0a205_8069_c1 3300050515 Bacteria 9573
862 Ga0495601_0000239 3300053077 Bacteria 29362
863 Ga0495601_0016186 3300053077 Bacteria 4516
864 Ga0495601_0041202 3300053077 Bacteria 2894
865 Ga0495601_0081394 3300053077 Bacteria 2078
866 Ga0495601_0213035 3300053077 Bacteria 1262
867 Ga0495612_0013490 3300053078 Bacteria 3291
868 Ga0495595_0126243 3300053084 Bacteria 1248
869 Ga0495619_0015834 3300053085 Bacteria 4774
870 Ga0495619_0020761 3300053085 Bacteria 4188
871 Ga0495619_0089778 3300053085 Bacteria 2079
872 Ga0495619_0135735 3300053085 Bacteria 1692
873 Ga0495619_0237444 3300053085 Bacteria 1263
874 Ga0495619_0271059 3300053085 Bacteria 1176
875 Ga0500643_002282 3300053087 Bacteria 10057
876 Ga0500644_0000531 3300053088 Bacteria 15833
877 Ga0500651_0064307 3300053093 Bacteria 2288
878 Ga0500566_0020733 3300053094 Bacteria 3866
879 Ga0500595_000029 3300053119 Bacteria 122318
880 Ga0500616_0000006 3300053153 Bacteria 944738
881 Ga0500645_000143 3300053730 Bacteria 56081
882 Ga0501084_0133044 3300054114 Bacteria 2094
883 Ga0501084_0159614 3300054114 Bacteria 1902
884 Ga0501082_0056787 3300060353 Bacteria 3373
885 Ga0501082_0142893 3300060353 Bacteria 2077
886 Ga0501082_0171208 3300060353 Bacteria 1888
887 Ga0501082_0256389 3300060353 Bacteria 1522
888 Ga0530510_0139099 3300061734 Bacteria 1788
889 Ga0530510_0395263 3300061734 Unclassified 1041
890 2643755356 2643221547 Bacteria 4740017
891 8054565198 8054563764 Bacteria 5592885
892 Ga0111539_10328234
893 ARcpr5yngRDRAFT_c000365
894 ARSoilOldRDRAFT_c000254
895 ARCol0yngRDRAFT_1000499
896 JGI24747J21853_1003952
897 JGI24743J22301_10000605
898 JGI24745J21846_1000703
899 JGI24748J21848_1002038
900 JGI24748J21848_1005842
901 JGI24738J21930_10005115
902 JGI24749J21850_1002989
903 JGI24033J26618_1007155
904 JGI24034J26672_10009009
905 JGI24742J22300_10005065
906 JGI24742J22300_10006181
907 Ga0065704_10122202
908 Ga0065712_10002723
909 Ga0065715_10091280
910 Ga0065715_10226018
911 Ga0065707_10121136
912 Ga0070658_10030612
913 Ga0070658_10125452
914 Ga0070676_10004937
915 Ga0070676_10042488
916 Ga0070676_10079599
917 Ga0070676_10409562
918 Ga0070683_100024177
919 Ga0070683_100653089
920 Ga0070690_100007512
921 Ga0070690_100013607
922 Ga0070690_100029653
923 Ga0070690_100277166
924 Ga0070670_100043716
925 Ga0070670_100098990
926 Ga0070670_100154280
927 Ga0070670_100281975
928 Ga0070677_10004385
929 Ga0068869_100026927
930 Ga0070666_10018139
931 Ga0070680_100018426
932 Ga0070680_100025758
933 Ga0070682_100016560
934 Ga0070682_100057208
935 Ga0070682_100181233
936 Ga0068868_100015719
937 Ga0070660_100011094
938 Ga0070660_100026606
939 Ga0070660_100089254
940 Ga0070660_100118606
941 Ga0070660_100254515
942 Ga0070689_100001782
943 Ga0070689_100012413
944 Ga0070689_100488365
945 Ga0070691_10011715
946 Ga0070691_10032533
947 Ga0070687_100010799
948 Ga0070687_100064297
949 Ga0070661_100004855
950 Ga0070661_100077106
951 Ga0070661_100267542
952 Ga0070661_100664177
953 Ga0070692_10014877
954 Ga0070692_10016319
955 Ga0070668_100034060
956 Ga0070668_100328250
957 Ga0070669_100019915
958 Ga0070669_100062967
959 Ga0070669_100189300
960 Ga0070675_100044432
961 Ga0070675_100046633
962 Ga0070675_100081517
963 Ga0070671_100011618
964 Ga0070671_100013456
965 Ga0070671_100521115
966 Ga0070674_100005992
967 Ga0070674_100061116
968 Ga0070674_100143149
969 Ga0070673_100032568
970 Ga0070673_100149683
971 Ga0070673_100240938
972 Ga0070673_100271572
973 Ga0070688_100000518
974 Ga0070688_100004868
975 Ga0070688_100038214
976 Ga0070688_100167543
977 Ga0070688_100307899
978 Ga0070659_100001996
979 Ga0070659_100159990
980 Ga0070659_100533826
981 Ga0070667_100034646
982 Ga0070667_100077992
983 Ga0070667_100119611
984 Ga0070667_100127394
985 Ga0070703_10004338
986 Ga0070703_10017557
987 Ga0070709_10014166
988 Ga0070709_10317144
989 Ga0070714_100001923
990 Ga0070714_100127958
991 Ga0070714_100649937
992 Ga0070713_100003280
993 Ga0070710_10004440
994 Ga0070710_10075750
995 Ga0070710_10179665
996 Ga0070710_10274110
997 Ga0070710_10313400
998 Ga0070701_10000142
999 Ga0070701_10010502
1000 Ga0070711_100002714
1001 Ga0070711_100020648
1002 Ga0070711_100068060
1003 Ga0070705_100033691
1004 Ga0070705_100078845
1005 Ga0070700_100001943
1006 Ga0070700_100003023
1007 Ga0070700_100011069
1008 Ga0070694_100007446
1009 Ga0070708_100024592
1010 Ga0070663_100003188
1011 Ga0070663_100034489
1012 Ga0070663_100154844
1013 Ga0070678_100020126
1014 Ga0070678_100099858
1015 Ga0070678_100104740
1016 Ga0070678_100304441
1017 Ga0070662_100017985
1018 Ga0070662_100034776
1019 Ga0070681_10003015
1020 Ga0070681_10023523
1021 Ga0070681_10044128
1022 Ga0068867_100031357
1023 Ga0068867_100102117
1024 Ga0070685_10001300
1025 Ga0070685_10022069
1026 Ga0070685_10092377
1027 Ga0070699_100000908
1028 Ga0070699_100231780
1029 Ga0070679_100053642
1030 Ga0070679_100116923
1031 Ga0070679_100675360
1032 Ga0070684_100029749
1033 Ga0070684_100644675
1034 Ga0070697_100482145
1035 Ga0068853_100052726
1036 Ga0068853_100128704
1037 Ga0068853_100187882
1038 Ga0070672_100022262
1039 Ga0070672_100040163
1040 Ga0070672_100091448
1041 Ga0070672_100404598
1042 Ga0070686_100003357
1043 Ga0070686_100013828
1044 Ga0070686_100035834
1045 Ga0070686_100400046
1046 Ga0070686_100665076
1047 Ga0070695_100012524
1048 Ga0070695_100210721
1049 Ga0070696_100018615
1050 Ga0070696_100341860
1051 Ga0070696_100343237
1052 Ga0070696_100356113
1053 Ga0070693_100003906
1054 Ga0070693_100149981
1055 Ga0070665_100071975
1056 Ga0070665_100100234
1057 Ga0070665_100697133
1058 Ga0070704_100012922
1059 Ga0070704_100245267
1060 Ga0070704_100269711
1061 Ga0068855_100052008
1062 Ga0068855_100056970
1063 Ga0068855_100124804
1064 Ga0070664_100013046
1065 Ga0070664_100036958
1066 Ga0070664_100271676
1067 Ga0068857_100000715
1068 Ga0068854_100017444
1069 Ga0068854_100200403
1070 Ga0068854_100697366
1071 Ga0068856_100034734
1072 Ga0068856_100084104
1073 Ga0068856_100111146
1074 Ga0068856_100445209
1075 Ga0068856_100521238
1076 Ga0068856_100580916
1077 Ga0070702_100019614
1078 Ga0070702_100046726
1079 Ga0070702_100131420
1080 Ga0068852_100047595
1081 Ga0068852_100048222
1082 Ga0068852_100215039
1083 Ga0068852_100290617
1084 Ga0068859_100038251
1085 Ga0068859_100067588
1086 Ga0068864_100009132
1087 Ga0068864_100037870
1088 Ga0068864_100047077
1089 Ga0068866_10001095
1090 Ga0068866_10035187
1091 Ga0068866_10188112
1092 Ga0068861_100006353
1093 Ga0068861_100041923
1094 Ga0068861_100350015
1095 Ga0068851_10014025
1096 Ga0068870_10022160
1097 Ga0068870_10026604
1098 Ga0068863_100005317
1099 Ga0068863_100068592
1100 Ga0068858_100017768
1101 Ga0068858_100051422
1102 Ga0068858_100542048
1103 Ga0068858_100578112
1104 Ga0068858_100613461
1105 Ga0068860_100032941
1106 Ga0068860_100041452
1107 Ga0068860_100110689
1108 Ga0068860_101335054
1109 Ga0068862_100008712
1110 Ga0068862_100465920
1111 Ga0081455_10000508
1112 Ga0081538_10023513
1113 Ga0081540_1001712
1114 Ga0081540_1027806
1115 Ga0081539_10001727
1116 Ga0070717_10000186
1117 Ga0070717_10141200
1118 Ga0070717_10249985
1119 Ga0070717_10581905
1120 Ga0075368_10100035
1121 Ga0075432_10106536
1122 Ga0070715_10003296
1123 Ga0070716_100009167
1124 Ga0070712_100005488
1125 Ga0070712_100100645
1126 Ga0070712_100109314
1127 Ga0070712_100134114
1128 Ga0097621_100010840
1129 Ga0097621_100024728
1130 Ga0097621_100208935
1131 Ga0068871_100011946
1132 Ga0068871_100022854
1133 Ga0075428_100156284
1134 Ga0075428_100167451
1135 Ga0075430_100007717
1136 Ga0075430_100018982
1137 Ga0075431_100096315
1138 Ga0075433_10021951
1139 Ga0075433_10165615
1140 Ga0075434_100009283
1141 Ga0075434_100103320
1142 Ga0075434_100236747
1143 Ga0075429_100952336
1144 Ga0068865_100014485
1145 Ga0068865_100167660
1146 Ga0075436_100370862
1147 Ga0075436_100432109
1148 Ga0097620_100038250
1149 Ga0097620_100067595
1150 Ga0075435_100230856
1151 Ga0075435_100550114
1152 Ga0099795_10035341
1153 Ga0105250_10045209
1154 Ga0111539_10037182
1155 Ga0111539_10061036
1156 Ga0111539_10070428
1157 Ga0111539_10120604
1158 Ga0111539_10325028
1159 Ga0105245_10030092
1160 Ga0105245_10032673
1161 Ga0105245_10179396
1162 Ga0105247_10005590
1163 Ga0105247_10019206
1164 Ga0105247_10060851
1165 Ga0114129_10132865
1166 Ga0105243_10007170
1167 Ga0105243_10011661
1168 Ga0105243_10028675
1169 Ga0105241_10942308
1170 Ga0105242_10001935
1171 Ga0105242_10076243
1172 Ga0105242_10190600
1173 Ga0105248_10006012
1174 Ga0105248_10008947
1175 Ga0105248_10370410
1176 Ga0105248_10477501
1177 Ga0105237_10033687
1178 Ga0105237_10041778
1179 Ga0105238_10010345
1180 Ga0105249_10020195
1181 Ga0105249_10065368
1182 Ga0105249_10438014
1183 Ga0099796_10108362
1184 Ga0105239_10030558
1185 Ga0105239_10063403
1186 Ga0105239_10102206
1187 Ga0105239_10524742
1188 Ga0105246_10015600
1189 Ga0105246_10236845
1190 Ga0105246_10626622
1191 Ga0157344_1006718
1192 Ga0157318_1002428
1193 Ga0157321_1001368
1194 Ga0157322_1002750
1195 Ga0157335_1001301
1196 Ga0157370_10029408
1197 Ga0157374_10011924
1198 Ga0157374_10039016
1199 Ga0157378_10017617
1200 Ga0157378_10425637
1201 Ga0163162_10126160
1202 Ga0163162_10303778
1203 Ga0163162_10584899
1204 Ga0163162_10842481
1205 Ga0157372_10747205
1206 Ga0157375_10013661
1207 Ga0157375_10127122
1208 Ga0157375_10127223
1209 Ga0163163_10003978
1210 Ga0163163_10015764
1211 Ga0163163_10023328
1212 Ga0163163_10601886
1213 Ga0157380_10004813
1214 Ga0157380_10100396
1215 Ga0157380_10157928
1216 Ga0157377_10004770
1217 Ga0157377_10180499
1218 Ga0157379_10010240
1219 Ga0157379_10094745
1220 Ga0157379_10211753
1221 Ga0157376_10014086
1222 Ga0157376_10338797
1223 Ga0163161_10007898
1224 Ga0163161_10041289
1225 Ga0163161_10456733
1226 Ga0163161_10777903
1227 Ga0206356_10486688
1228 Ga0206354_11375852
1229 Ga0206353_11199619
1230 Ga0207666_1000154
1231 Ga0207666_1003243
1232 Ga0207673_1000426
1233 Ga0209676_1031966
1234 Ga0207697_10010494
1235 Ga0207697_10028382
1236 Ga0207656_10074793
1237 Ga0207653_10005246
1238 Ga0207682_10000334
1239 Ga0207682_10000708
1240 Ga0207692_10014755
1241 Ga0207692_10038583
1242 Ga0207692_10120059
1243 Ga0207692_10315067
1244 Ga0207642_10006348
1245 Ga0207642_10008392
1246 Ga0207710_10006771
1247 Ga0207710_10007564
1248 Ga0207688_10000275
1249 Ga0207688_10001351
1250 Ga0207688_10092807
1251 Ga0207680_10068441
1252 Ga0207680_10137075
1253 Ga0207680_10169036
1254 Ga0207680_10331376
1255 Ga0207647_10000612
1256 Ga0207647_10023601
1257 Ga0207647_10084842
1258 Ga0207647_10194721
1259 Ga0207685_10000320
1260 Ga0207685_10043520
1261 Ga0207699_10282515
1262 Ga0207645_10000507
1263 Ga0207645_10082273
1264 Ga0207645_10096268
1265 Ga0207645_10119712
1266 Ga0207643_10000568
1267 Ga0207643_10012113
1268 Ga0207643_10056119
1269 Ga0207705_10031407
1270 Ga0207654_10016338
1271 Ga0207707_10027362
1272 Ga0207707_10033854
1273 Ga0207707_10200597
1274 Ga0207695_10571172
1275 Ga0207671_10162914
1276 Ga0207693_10009655
1277 Ga0207693_10182232
1278 Ga0207663_10004000
1279 Ga0207663_10022980
1280 Ga0207663_10028057
1281 Ga0207663_10176638
1282 Ga0207663_10327568
1283 Ga0207663_10416479
1284 Ga0207660_10209640
1285 Ga0207660_10299596
1286 Ga0207660_10482542
1287 Ga0207662_10000180
1288 Ga0207662_10001226
1289 Ga0207662_10126602
1290 Ga0207662_10303721
1291 Ga0207657_10007922
1292 Ga0207657_10033193
1293 Ga0207657_10112127
1294 Ga0207657_10114769
1295 Ga0207657_10165307
1296 Ga0207649_10060687
1297 Ga0207649_10062856
1298 Ga0207652_10006172
1299 Ga0207652_10065666
1300 Ga0207652_10147776
1301 Ga0207681_10002030
1302 Ga0207681_10415523
1303 Ga0207681_10422636
1304 Ga0207694_10015181
1305 Ga0207694_10038471
1306 Ga0207650_10039975
1307 Ga0207650_10427782
1308 Ga0207659_10050219
1309 Ga0207659_10132723
1310 Ga0207659_10152956
1311 Ga0207659_10199323
1312 Ga0207687_10002607
1313 Ga0207687_10003614
1314 Ga0207700_10001220
1315 Ga0207700_10019945
1316 Ga0207700_10085182
1317 Ga0207700_10404713
1318 Ga0207664_10040635
1319 Ga0207664_10727263
1320 Ga0207664_10972646
1321 Ga0207644_10051426
1322 Ga0207644_10126305
1323 Ga0207690_10022040
1324 Ga0207690_10128802
1325 Ga0207690_10132430
1326 Ga0207690_10165427
1327 Ga0207690_10507899
1328 Ga0207706_10017852
1329 Ga0207706_10052339
1330 Ga0207706_10129897
1331 Ga0207706_10201281
1332 Ga0207686_10003280
1333 Ga0207709_10007840
1334 Ga0207709_10008453
1335 Ga0207670_10001377
1336 Ga0207670_10003114
1337 Ga0207670_10415255
1338 Ga0207669_10000408
1339 Ga0207669_10001914
1340 Ga0207669_10152532
1341 Ga0207704_10004703
1342 Ga0207665_10012736
1343 Ga0207691_10001024
1344 Ga0207691_10004697
1345 Ga0207691_10006125
1346 Ga0207691_10091605
1347 Ga0207691_10209859
1348 Ga0207711_10011912
1349 Ga0207711_10028076
1350 Ga0207689_10000332
1351 Ga0207689_10005191
1352 Ga0207661_10003166
1353 Ga0207679_10001592
1354 Ga0207679_10198059
1355 Ga0207667_10124810
1356 Ga0207667_10964065
1357 Ga0207651_10021088
1358 Ga0207651_10155032
1359 Ga0207712_10001343
1360 Ga0207712_10138257
1361 Ga0207712_10141856
1362 Ga0207712_10467189
1363 Ga0207668_10004567
1364 Ga0207668_10501658
1365 Ga0207640_10002417
1366 Ga0207640_10389669
1367 Ga0207640_11008644
1368 Ga0207658_10004726
1369 Ga0207658_10027786
1370 Ga0207677_10002427
1371 Ga0207677_10278296
1372 Ga0207703_10002645
1373 Ga0207703_10005585
1374 Ga0207703_10150403
1375 Ga0207639_10055289
1376 Ga0207639_10159382
1377 Ga0207639_10193855
1378 Ga0207678_10025860
1379 Ga0207678_10112958
1380 Ga0207678_10159510
1381 Ga0207708_10002748
1382 Ga0207708_10018053
1383 Ga0207708_10048486
1384 Ga0207702_10026502
1385 Ga0207702_10176552
1386 Ga0207702_10237089
1387 Ga0207702_10286038
1388 Ga0207641_10006287
1389 Ga0207641_10053257
1390 Ga0207641_10274649
1391 Ga0207648_10003365
1392 Ga0207648_10006303
1393 Ga0207648_10042779
1394 Ga0207676_10013324
1395 Ga0207676_10183895
1396 Ga0207674_10023885
1397 Ga0207674_10047854
1398 Ga0207674_10331663
1399 Ga0207675_100004008
1400 Ga0207675_100045522
1401 Ga0207683_10000274
1402 Ga0207683_10005903
1403 Ga0207683_10025275
1404 Ga0207683_10154753
1405 Ga0207698_10067335
1406 Ga0207698_10416439
1407 Ga0207698_10507500
1408 Ga0209996_1011097
1409 Ga0210002_1019822
1410 Ga0209971_1009446
1411 Ga0209966_1003812
1412 Ga0209998_10000845
1413 Ga0209974_10005778
1414 Ga0207428_10001592
1415 Ga0268266_10025407
1416 Ga0268266_10045475
1417 Ga0268265_10078047
1418 Ga0268265_10225098
1419 Ga0268264_10010815
1420 Ga0268264_10018602
1421 Ga0268264_10340709
1422 Ga0268264_10834109
1423 Ga0265318_10010865
1424 Ga0265328_10024780
1425 Ga0265320_10039805
1426 Ga0265325_10000053
1427 Ga0265329_10011841
1428 Ga0265340_10026434
1429 Ga0265340_10150493
1430 Ga0265339_10112314
1431 Ga0265316_10040955
1432 Ga0265316_10156098
1433 Ga0265316_10185435
1434 Ga0307513_10146529
1435 Ga0265313_10021409
1436 Ga0265313_10028044
1437 Ga0265313_10039983
1438 Ga0265313_10042605
1439 Ga0265313_10049442
1440 Ga0316579_10016702
1441 Ga0265314_10064843
1442 Ga0265342_10000518
1443 Ga0373948_0020831
1444 Ga0373950_0002923
1445 Ga0373958_0000164
1446 Ga0373958_0002465
1447 Ga0373959_0001690
1448 Ga0373926_0056031
1449 Ga0373928_0001377
1450 Ga0373929_0001028
1451 Ga0373940_0008662
1452 Ga0373940_0023024
1453 Ga0373944_0044641
1454 Ga0373949_0009783
1455 Ga0373949_0011027
1456 Ga0373951_0001467
1457 Ga0373951_0009850
1458 Ga0373952_0000292
1459 Ga0373952_0005480
1460 Ga0373923_0035655
1461 Ga0373932_0002291
1462 Ga0373932_0003964
1463 Ga0373932_0017384
1464 Ga0373939_0001821
1465 Ga0373939_0012022
1466 Ga0373939_0012263
1467 Ga0373941_0000983
1468 Ga0373941_0025573
1469 Ga0373945_0044159
1470 Ga0373953_0107126
1471 Ga0373954_0036706
1472 Ga0373957_0140312
1473 Ga0373960_0004413
1474 Ga0373943_0156582
1475 Ga0373946_0117900
1476 Ga0373942_0006267
1477 Ga0373961_0004306
1478 Ga0373962_0002831
1479 Ga0373962_0004616
1480 Ga0373924_0025743
1481 Ga0373924_0136218
1482 Ga0373931_0003138
1483 Ga0373931_0054400
1484 Ga0373935_0188118
1485 Ga0373935_0431947
1486 Ga0373927_0049835
1487 Ga0373927_0094513
1488 Ga0373933_0012915
1489 Ga0373933_0453406
1490 Ga0373947_0096813
1491 Ga0373947_0159607
1492 Ga0373937_0002979
1493 Ga0373937_0031439
1494 Ga0373937_0034566
1495 Ga0373937_0050723
1496 Ga0373937_0129816
1497 Ga0373937_0533252
1498 Ga0373925_0210053
1499 Ga0395900_0971672
1500 Ga0395898_0439103
1501 Ga0395905_0301087
1502 Ga0436364_0336407
1503 Ga0395901_0183204
1504 Ga0395901_1228684
1505 Ga0436365_1171847
1506 Ga0439453_0000038
1507 Ga0439441_022252
1508 Ga0439455_0033007
1509 Ga0439459_0074535
1510 Ga0439464_0008371
1511 Ga0439460_0010277
1512 Ga0451577_0427936
1513 Ga0439440_0008135
1514 Ga0466968_0120417
1515 Ga0466960_0104840
1516 Ga0451576_0055704
1517 Ga0495592_0050832
1518 Ga0495603_0028052
1519 Ga0495638_0104840
1520 Ga0495641_0119944
1521 Ga0495651_0020033
1522 Ga0495653_0174274
1523 Ga0495580_0010013
1524 Ga0495582_0018246
1525 Ga0495639_0130392
1526 Ga0495662_0027889
1527 Ga0495664_0030331
1528 Ga0495584_0074023
1529 Ga0495608_0019894
1530 Ga0495618_0107975
1531 Ga0495628_0195141
1532 Ga0495628_0472243
1533 Ga0495630_0056924
1534 Ga0495632_0082612
1535 Ga0495666_0031958
1536 Ga0495652_0059083
1537 Ga0495652_0084712
1538 Ga0495640_0054577
1539 Ga0495640_0220229
1540 Ga0495587_0190662
1541 Ga0495598_0001611
1542 Ga0495598_0101142
1543 Ga0495645_0251121
1544 Ga0495667_0121301
1545 Ga0495667_0214121
1546 Ga0495668_0411227
1547 Ga0495634_0151140
1548 Ga0495635_0014508
1549 Ga0495635_0083023
1550 Ga0495659_0074367
1551 Ga0495661_0346132
1552 Ga0495657_0039179
1553 Ga0495599_0138251
1554 Ga0495646_0014727
1555 Ga0495647_0025963
1556 Ga0495647_0151596
1557 Ga0495658_0028224
1558 Ga0495613_0561261
1559 Ga0495589_0206502
1560 Ga0495600_0018126
1561 Ga0495581_0055023
1562 Ga0495604_0218833
1563 Ga0495604_0237887
1564 Ga0495604_0297581
1565 Ga0495674_0155404
1566 Ga0495674_0204619
1567 Ga0495674_0288918
1568 Ga0495680_0021675
1569 Ga0495680_0352938
1570 Ga0495675_0114418
1571 Ga0495675_0162056
1572 Ga0495602_0036446
1573 Ga0496100_0003675
1574 Ga0496101_0001773
1575 Ga0496101_0011849
1576 Ga0496101_0014644
1577 Ga0496102_0001904
1578 Ga0496102_0100023
1579 Ga0496102_0212394
1580 Ga0496102_0587698
1581 Ga0496102_0680950
1582 Ga0496103_0001021
1583 Ga0496103_0005324
1584 Ga0496103_0127166
1585 Ga0496104_0001263
1586 Ga0496104_0050329
1587 Ga0496104_0075765
1588 Ga0496104_0132864
1589 Ga0496104_0886231
1590 Ga0496105_0004984
1591 Ga0496105_0053068
1592 Ga0496105_0094935
1593 Ga0496105_0323920
1594 Ga0496105_0617798
1595 Ga0496106_0002628
1596 Ga0496106_0045337
1597 Ga0496106_0061632
1598 Ga0496106_0238318
1599 Ga0496106_0285592
1600 Ga0496107_0000236
1601 Ga0496107_0049407
1602 Ga0496107_0053424
1603 Ga0496107_0099804
1604 Ga0496107_0120324
1605 Ga0496107_0198406
1606 Ga0496108_0003388
1607 Ga0496108_0022997
1608 Ga0496108_0035092
1609 Ga0496108_0462155
1610 Ga0496109_0037467
1611 Ga0496109_0080887
1612 Ga0496109_0083716
1613 Ga0496109_0085820
1614 Ga0496109_0393277
1615 Ga0496110_0004352
1616 Ga0496110_0078643
1617 Ga0496110_0395400
1618 Ga0496110_0667981
1619 Ga0496111_0001756
1620 Ga0496111_0126324
1621 Ga0496111_0148239
1622 Ga0496112_0005669
1623 Ga0496112_0077435
1624 Ga0496113_0021874
1625 Ga0496113_0127702
1626 Ga0496113_0198643
1627 Ga0496114_0002646
1628 Ga0496114_0147587
1629 Ga0496114_0155495
1630 Ga0496115_0005597
1631 Ga0496115_0040996
1632 Ga0496115_0109599
1633 Ga0496115_0136882
1634 Ga0496115_0259437
1635 Ga0501031_0198670
1636 Ga0501031_0232862
1637 Ga0501032_0016084
1638 Ga0501032_0043822
1639 Ga0501032_0071433
1640 Ga0501032_0180878
1641 Ga0501033_0214878
1642 Ga0501034_0000499
1643 Ga0501034_0009608
1644 Ga0501034_0134450
1645 Ga0501034_0215630
1646 Ga0501036_0007398
1647 Ga0501036_0009764
1648 Ga0501036_0012348
1649 Ga0501036_0131644
1650 Ga0501036_0432528
1651 Ga0501036_0635171
1652 Ga0501037_0024974
1653 Ga0501037_0051020
1654 Ga0501037_0056031
1655 Ga0501037_0560181
1656 Ga0501038_0035923
1657 Ga0501038_0152298
1658 Ga0501038_0273766
1659 Ga0501039_0104501
1660 Ga0501039_0233072
1661 Ga0501039_0262812
1662 Ga0501040_0125243
1663 Ga0501042_0223183
1664 Ga0501043_0005754
1665 Ga0501043_0008504
1666 Ga0501043_0011982
1667 Ga0501043_0042246
1668 Ga0501043_0113119
1669 Ga0501043_0179409
1670 Ga0501046_0062627
1671 Ga0501046_0072062
1672 Ga0501046_0083772
1673 Ga0501046_0170329
1674 Ga0501046_0327756
1675 Ga0501047_0002024
1676 Ga0501047_0041290
1677 Ga0501047_0062852
1678 Ga0501047_0077885
1679 Ga0501047_0114702
1680 Ga0501047_0153238
1681 Ga0501048_0004059
1682 Ga0501067_0082459
1683 Ga0501067_0270368
1684 Ga0501068_0020626
1685 Ga0501068_0090238
1686 Ga0501068_0213840
1687 Ga0501069_0016777
1688 Ga0501070_0004251
1689 Ga0501070_0006750
1690 Ga0501070_0045798
1691 Ga0501070_0070352
1692 Ga0501070_0456724
1693 Ga0501070_0505704
1694 Ga0501071_0502129
1695 Ga0501072_0179975
1696 Ga0501073_0086972
1697 Ga0501073_0103694
1698 Ga0501073_0191402
1699 Ga0501073_0261827
1700 Ga0501074_0057844
1701 Ga0501074_0064261
1702 Ga0501074_0085347
1703 Ga0501074_0414306
1704 Ga0501075_0285254
1705 Ga0501076_0031419
1706 Ga0501076_0206375
1707 Ga0501079_0060978
1708 Ga0501079_0136693
1709 Ga0501079_0457862
1710 Ga0501079_0781986
1711 Ga0501080_0002821
1712 Ga0501080_0119895
1713 Ga0501080_0319221
1714 Ga0501083_0020404
1715 Ga0501083_0038865
1716 Ga0501083_0065021
1717 Ga0501083_0554275
1718 Ga0501035_0000267
1719 Ga0501035_0056076
1720 Ga0501035_0106239
1721 Ga0501035_0146968
1722 Ga0501044_0018785
1723 Ga0501044_0108203
1724 Ga0501044_0180339
1725 Ga0501044_0182169
1726 Ga0501044_0219016
1727 Ga0501044_0225061
1728 Ga0501044_0417186
1729 Ga0501044_0529607
1730 Ga0501045_0098632
1731 Ga0501045_0523311
1732 nmdc:mga05p37_141876_c1
1733 nmdc:mga05p37_9183_c1
1734 nmdc:mga0qj67_10820_c1
1735 nmdc:mga0qj67_243628_c1
1736 nmdc:mga0qj67_540679_c1
1737 nmdc:mga06r32_173500_c1
1738 nmdc:mga06r32_664848_c1
1739 nmdc:mga08y16_29557_c1
1740 nmdc:mga08y16_413561_c1
1741 nmdc:mga0n895_196205_c1
1742 nmdc:mga0n895_258203_c1
1743 nmdc:mga0n895_289077_c1
1744 nmdc:mga0n895_336714_c1
1745 nmdc:mga0n895_38629_c1
1746 nmdc:mga0n895_677052_c1
1747 nmdc:mga0rr50_223321_c1
1748 nmdc:mga08x19_247378_c1
1749 nmdc:mga08x19_252421_c1
1750 nmdc:mga08x19_317731_c1
1751 nmdc:mga0a205_30249_c1
1752 nmdc:mga0a205_8069_c1
1753 Ga0495601_0000239
1754 Ga0495601_0016186
1755 Ga0495601_0041202
1756 Ga0495601_0081394
1757 Ga0495601_0213035
1758 Ga0495612_0013490
1759 Ga0495595_0126243
1760 Ga0495619_0015834
1761 Ga0495619_0020761
1762 Ga0495619_0089778
1763 Ga0495619_0135735
1764 Ga0495619_0237444
1765 Ga0495619_0271059
1766 Ga0500643_002282
1767 Ga0500644_0000531
1768 Ga0500651_0064307
1769 Ga0500566_0020733
1770 Ga0500595_000029
1771 Ga0500616_0000006
1772 Ga0500645_000143
1773 Ga0501084_0133044
1774 Ga0501084_0159614
1775 Ga0501082_0056787
1776 Ga0501082_0142893
1777 Ga0501082_0171208
1778 Ga0501082_0256389
1779 Ga0530510_0139099
1780 Ga0530510_0395263
1781 2643755356
1782 8054565198

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02581

TMP-TENI

Thiamine monophosphate synthase

19

205

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xi3-assembly1.cif.gz_B thiamine phosphate pyrophosphorylase from pyrococcus furiosus pfu-1255191-001 0.923 3 213
1g4p-assembly2.cif.gz_B thiamin phosphate synthase 0.9152 5 214
1g4e-assembly1.cif.gz_A thiamin phosphate synthase 0.9147 3 215
3nm3-assembly1.cif.gz_A the crystal structure of candida glabrata thi6, a bifunctional enzyme involved in thiamin biosyhthesis of eukaryotes 0.9147 4 210
3nl3-assembly1.cif.gz_A the crystal structure of candida glabrata thi6, a bifunctional enzyme involved in thiamin biosyhthesis of eukaryotes 0.9145 3 208
ID Description Score Start End Superfamily
af_P40386_1_220_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9462 1 209 3.20.20.70
af_Q5AEJ1_1_231_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9359 1 209 3.20.20.70
af_A0A1D6MYJ2_339_548_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9245 4 210 3.20.20.70
1xi3B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.923 3 213 3.20.20.70
3nm3D01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9145 4 210 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A363TJV3-F1-model_v4 Thiamine-phosphate synthase (TP synthase) (TPS) (EC 2.5.1.3) (Thiamine-phosphate pyrophosphorylase) (TMP pyrophosphorylase) (TMP-PPase) 0.9906 3 219 GO:0000287
GO:0004789
GO:0005737
GO:0009228
GO:0009229
AF-A0A537L9Q3-F1-model_v4 Thiamine-phosphate synthase (TP synthase) (TPS) (EC 2.5.1.3) (Thiamine-phosphate pyrophosphorylase) (TMP pyrophosphorylase) (TMP-PPase) 0.9875 3 215 GO:0000287
GO:0004789
GO:0005737
GO:0009228
GO:0009229
AF-A0A0H5BNN8-F1-model_v4 Thiamine-phosphate synthase (TP synthase) (TPS) (EC 2.5.1.3) (Thiamine-phosphate pyrophosphorylase) (TMP pyrophosphorylase) (TMP-PPase) 0.9857 1 214 GO:0000287
GO:0004789
GO:0005737
GO:0009228
GO:0009229
AF-A0A7V2RTX2-F1-model_v4 Thiamine phosphate synthase 0.9811 51 219 GO:0004789
GO:0005737
GO:0009228
GO:0046872
AF-A0A2N6ASD1-F1-model_v4 Thiamine-phosphate synthase (TP synthase) (TPS) (EC 2.5.1.3) (Thiamine-phosphate pyrophosphorylase) (TMP pyrophosphorylase) (TMP-PPase) 0.9716 3 217 GO:0000287
GO:0004789
GO:0005737
GO:0009228
GO:0009229

Map