F484471

General Info

Members Datasets Scaffolds Average Seq Length
879 394 833 155

Family's Representative Sequence

Representative Sequence 3300048922|Ga0496119_0000344|Ga0496119_0000344_62357_62881
Length 174
Sequence MVQRVTSFVALKEVYVVRRIDGIDQNILRELQEDGRITNVELSKRVGISAPPCLRRVRSLEEDGIIRGYRALLDEKKLGFDLMAFAMVHLVSQAEADLSAFSEQVQRWPLVRSCWMLSGEVDFLLLCVAPDLRTFQSFVLELTGAPNVRNVKTALTLKQAKDAPVVPMEGVPQG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
3 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
4 2558860280 Kutzneria sp. 744 Isolate Unclassified
5 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
6 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
7 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
8 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
9 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
10 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
11 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
12 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
13 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
14 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
15 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
16 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
17 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
18 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
19 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
20 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
21 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
22 2842882022 Bacillus sp. R-71893 Isolate Unclassified
23 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
24 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
25 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
26 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
27 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
28 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
29 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
30 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
31 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
32 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
33 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
34 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
35 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
36 2929004312 Priestia megaterium 1104 Isolate Unclassified
37 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
38 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
39 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
40 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
41 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
42 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
43 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
44 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
45 3300001432 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
46 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
47 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
48 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
49 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
50 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
51 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
52 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
53 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
54 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
55 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
56 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
57 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
58 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
59 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
60 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
61 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
62 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
63 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
64 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
65 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
66 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
67 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
68 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
69 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
70 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
71 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
72 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
74 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
75 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
76 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
77 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
78 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
79 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
80 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
81 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
82 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
83 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
84 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
85 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
86 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
87 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
88 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
89 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
90 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
91 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
92 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
93 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
94 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
95 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
96 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
97 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
98 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
99 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
100 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
101 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
102 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
103 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
104 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
105 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
106 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
107 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
108 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
109 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
110 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
111 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
112 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
113 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
114 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
115 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
116 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
117 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
118 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
119 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
120 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
121 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
122 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
123 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
124 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
125 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
126 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
127 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
128 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
129 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
130 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
131 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
132 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
133 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
134 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
135 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
136 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
137 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
138 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
139 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
140 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
141 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
142 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
143 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
144 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
145 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
146 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
147 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
148 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
149 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
150 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
151 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
152 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
153 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
154 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
155 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
156 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
157 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
158 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
159 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
162 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
164 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
165 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
166 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
168 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
169 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
170 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
172 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
173 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
175 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
225 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
230 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
231 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
232 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
233 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
234 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
235 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
236 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
237 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
238 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
239 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
240 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
241 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
242 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
243 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
244 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
245 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
246 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
247 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
248 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
249 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
250 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
251 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
252 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
253 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
254 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
255 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
256 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
257 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
258 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
259 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
260 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
261 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
262 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
263 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
264 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
265 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
266 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
267 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
268 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
269 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
270 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
271 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
272 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
273 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
274 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
275 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
276 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
277 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
278 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
279 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
280 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
281 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
282 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
283 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
284 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
285 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
286 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
287 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
288 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
289 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
290 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
291 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
292 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
293 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
294 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
295 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
296 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
297 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
298 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
299 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
300 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
301 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
302 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
303 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
304 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
305 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
306 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
307 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
308 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
309 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
310 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
311 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
312 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
313 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
314 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
315 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
316 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
317 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
318 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
319 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
320 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
321 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
322 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
323 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
324 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
325 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
326 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
327 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
328 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
329 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
330 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
331 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
332 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
333 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
334 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
335 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
336 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
337 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
338 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
350 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
351 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
353 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
354 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
355 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
356 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
357 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
358 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
359 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
360 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
361 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
362 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
363 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
364 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
365 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
366 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
367 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
368 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
369 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
370 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
371 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
372 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
373 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
374 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
375 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
376 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
377 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
378 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
379 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
380 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
381 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
382 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
383 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
384 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
385 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
386 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
387 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
388 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
389 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
390 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
391 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
392 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
393 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
394 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.77
Metatranscriptomes 0
Isolates 5.23

Biome Distribution

Category Percentage (%)
Aerial Root 0.57
Bulb 0
Endosphere 19.68
Nodule 0.23
Rhizoplane 5.35
Rhizosphere 64.62
Stem 0
Stem Tuber 0
Unclassified 9.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2139260 2162886007 Bacteria 32362
2 SwRhRL2b_contig_2638822 2162886007 Bacteria 2305
3 SwRhRL2b_contig_3219086 2162886007 Bacteria 1214
4 SwRhRL2b_contig_3748734 2162886007 Bacteria 1440
5 SwRhRL2b_contig_887096 2162886007 Bacteria 970
6 JGI24034J14986_101037 3300001432 Bacteria 1628
7 JGI24736J21556_1000031 3300001904 Bacteria 24133
8 JGI24741J21665_1017119 3300001915 Bacteria 1174
9 JGI24752J21851_1000036 3300001976 Bacteria 15708
10 JGI24740J21852_10007875 3300001979 Bacteria 4297
11 JGI24739J22299_10003686 3300001989 Bacteria 5843
12 JGI24739J22299_10017629 3300001989 Bacteria 2573
13 JGI24737J22298_10007725 3300001990 Bacteria 3624
14 JGI24750J21931_1000424 3300002070 Bacteria 6905
15 JGI24748J21848_1000029 3300002074 Bacteria 90134
16 JGI24748J21848_1010040 3300002074 Bacteria 1115
17 JGI24738J21930_10002292 3300002075 Bacteria 5055
18 JGI24738J21930_10008464 3300002075 Bacteria 2341
19 JGI24034J26672_10000006 3300002239 Bacteria 294495
20 JGI24034J26672_10010366 3300002239 Bacteria 1384
21 JGI24742J22300_10002270 3300002244 Bacteria 3069
22 JGI25152J39213_1025184 3300002773 Bacteria 989
23 JGI25150J39212_1000020 3300002774 Bacteria 134928
24 JGI25159J45721_1044908 3300002987 Bacteria 627
25 JGI25151J46595_10001678 3300003187 Bacteria 14501
26 JGI25151J46595_10010952 3300003187 Bacteria 4192
27 JGI25151J46595_10011677 3300003187 Bacteria 4028
28 JGI25151J46595_10014794 3300003187 Bacteria 3463
29 JGI25151J46595_10015684 3300003187 Bacteria 3329
30 JGI25165J46597_1000053 3300003214 Bacteria 235857
31 JGI25153J46596_10000017 3300003215 Bacteria 274325
32 Ga0055532_1000115 3300003758 Bacteria 85554
33 Ga0055535_1004854 3300003761 Bacteria 3126
34 Ga0055535_1013750 3300003761 Bacteria 1184
35 Ga0055536_1001565 3300003781 Bacteria 13693
36 Ga0055536_1010951 3300003781 Bacteria 3532
37 Ga0055534_1017663 3300003784 Bacteria 1257
38 Ga0055528_1003541 3300003790 Bacteria 7784
39 Ga0055530_10000095 3300003791 Bacteria 74707
40 Ga0055530_10010511 3300003791 Bacteria 3414
41 Ga0055540_1009149 3300003792 Bacteria 3464
42 Ga0055531_10001802 3300003794 Bacteria 15217
43 Ga0055531_10002920 3300003794 Bacteria 11126
44 Ga0055531_10022710 3300003794 Bacteria 2380
45 Ga0055541_1000733 3300003841 Bacteria 8349
46 JGI25405J52794_10001431 3300003911 Bacteria 3922
47 Ga0065704_10000190 3300005289 Bacteria 213919
48 Ga0065704_10003249 3300005289 Bacteria 4618
49 Ga0065704_10095003 3300005289 Bacteria 2512
50 Ga0065704_10143789 3300005289 Bacteria 1492
51 Ga0065704_10145587 3300005289 Bacteria 1475
52 Ga0065704_10316801 3300005289 Bacteria 859
53 Ga0065707_10090604 3300005295 Bacteria 4108
54 Ga0065707_10111706 3300005295 Bacteria 2386
55 Ga0065707_10154342 3300005295 Bacteria 1624
56 Ga0070658_10000371 3300005327 Bacteria 39178
57 Ga0070658_10012881 3300005327 Bacteria 6713
58 Ga0070658_10051560 3300005327 Bacteria 3334
59 Ga0070658_10071384 3300005327 Bacteria 2844
60 Ga0070658_10212206 3300005327 Bacteria 1636
61 Ga0070683_100006345 3300005329 Bacteria 9915
62 Ga0070683_100453623 3300005329 Bacteria 1223
63 Ga0070690_100000002 3300005330 Bacteria 176748
64 Ga0070670_100000168 3300005331 Bacteria 59111
65 Ga0070670_100155116 3300005331 Bacteria 1983
66 Ga0070670_100327523 3300005331 Bacteria 1343
67 Ga0068869_100132712 3300005334 Bacteria 1916
68 Ga0070666_10000014 3300005335 Bacteria 224479
69 Ga0070680_100634730 3300005336 Bacteria 917
70 Ga0070682_100276235 3300005337 Bacteria 1223
71 Ga0070682_101065597 3300005337 Bacteria 675
72 Ga0070660_100002018 3300005339 Bacteria 13999
73 Ga0070660_100073658 3300005339 Bacteria 2671
74 Ga0070660_100194506 3300005339 Bacteria 1643
75 Ga0070660_100218824 3300005339 Bacteria 1547
76 Ga0070689_100033303 3300005340 Bacteria 3925
77 Ga0070691_10208696 3300005341 Bacteria 1030
78 Ga0070687_100190789 3300005343 Bacteria 1235
79 Ga0070661_100020845 3300005344 Bacteria 4677
80 Ga0070692_10068259 3300005345 Bacteria 1889
81 Ga0070668_100014755 3300005347 Bacteria 5840
82 Ga0070668_100016256 3300005347 Bacteria 5565
83 Ga0070668_100043654 3300005347 Bacteria 3438
84 Ga0070668_100335559 3300005347 Bacteria 1276
85 Ga0070669_100000184 3300005353 Bacteria 54362
86 Ga0070669_100000839 3300005353 Bacteria 22301
87 Ga0070669_100022491 3300005353 Bacteria 4507
88 Ga0070669_100080190 3300005353 Bacteria 2429
89 Ga0070669_100096449 3300005353 Bacteria 2225
90 Ga0070671_100000686 3300005355 Bacteria 24340
91 Ga0070671_100004299 3300005355 Bacteria 11274
92 Ga0070671_100255540 3300005355 Bacteria 1489
93 Ga0070671_100473123 3300005355 Bacteria 1076
94 Ga0070671_101557935 3300005355 Bacteria 585
95 Ga0070688_100019885 3300005365 Bacteria 3895
96 Ga0070659_100003327 3300005366 Bacteria 11439
97 Ga0070659_100178489 3300005366 Bacteria 1742
98 Ga0070667_100000290 3300005367 Bacteria 56841
99 Ga0070667_100000472 3300005367 Bacteria 41248
100 Ga0070667_100001767 3300005367 Bacteria 19258
101 Ga0070667_100002350 3300005367 Bacteria 16565
102 Ga0070667_100012128 3300005367 Bacteria 7134
103 Ga0070667_100035034 3300005367 Bacteria 4204
104 Ga0070708_100629496 3300005445 Bacteria 1011
105 Ga0070663_100205680 3300005455 Bacteria 1539
106 Ga0070663_100247240 3300005455 Bacteria 1410
107 Ga0070678_101149545 3300005456 Bacteria 718
108 Ga0070662_100000992 3300005457 Bacteria 17362
109 Ga0070662_100027322 3300005457 Bacteria 3959
110 Ga0070662_100134929 3300005457 Bacteria 1907
111 Ga0070681_10058148 3300005458 Bacteria 3846
112 Ga0070685_10000056 3300005466 Bacteria 68183
113 Ga0070706_100430942 3300005467 Bacteria 1227
114 Ga0070679_100030942 3300005530 Bacteria 5287
115 Ga0070679_100031798 3300005530 Bacteria 5218
116 Ga0070679_100049007 3300005530 Bacteria 4207
117 Ga0070679_100152916 3300005530 Bacteria 2284
118 Ga0070679_100697722 3300005530 Bacteria 958
119 Ga0070684_101156365 3300005535 Bacteria 728
120 Ga0068853_100008448 3300005539 Bacteria 8273
121 Ga0068853_100012276 3300005539 Bacteria 6966
122 Ga0068853_100013171 3300005539 Bacteria 6749
123 Ga0068853_100243348 3300005539 Bacteria 1649
124 Ga0068853_100311825 3300005539 Bacteria 1456
125 Ga0068853_100428357 3300005539 Bacteria 1242
126 Ga0068853_100963837 3300005539 Bacteria 820
127 Ga0070686_100000002 3300005544 Bacteria 336303
128 Ga0070665_100000025 3300005548 Bacteria 367488
129 Ga0070665_100000076 3300005548 Bacteria 189228
130 Ga0070665_100005505 3300005548 Bacteria 13037
131 Ga0070665_100045652 3300005548 Bacteria 4400
132 Ga0070704_100406164 3300005549 Bacteria 1163
133 Ga0068855_100046850 3300005563 Bacteria 5110
134 Ga0068855_100253307 3300005563 Bacteria 1963
135 Ga0068855_100289651 3300005563 Bacteria 1816
136 Ga0068855_100588600 3300005563 Bacteria 1201
137 Ga0068855_100648909 3300005563 Bacteria 1134
138 Ga0068855_101412377 3300005563 Bacteria 717
139 Ga0070664_100010887 3300005564 Bacteria 7376
140 Ga0070664_100240706 3300005564 Bacteria 1624
141 Ga0068857_100088803 3300005577 Bacteria 2765
142 Ga0068857_100179407 3300005577 Bacteria 1927
143 Ga0068857_100195436 3300005577 Bacteria 1843
144 Ga0068857_100229812 3300005577 Bacteria 1696
145 Ga0068857_100233204 3300005577 Bacteria 1684
146 Ga0068857_100859217 3300005577 Bacteria 868
147 Ga0068854_100004727 3300005578 Bacteria 8584
148 Ga0068854_100039497 3300005578 Bacteria 3325
149 Ga0068854_100361610 3300005578 Bacteria 1191
150 Ga0068854_100607981 3300005578 Bacteria 934
151 Ga0068856_100001125 3300005614 Bacteria 28271
152 Ga0068856_100011802 3300005614 Bacteria 8468
153 Ga0068856_100132888 3300005614 Bacteria 2494
154 Ga0068852_100000083 3300005616 Bacteria 65822
155 Ga0068852_100023139 3300005616 Bacteria 4995
156 Ga0068852_100028520 3300005616 Bacteria 4571
157 Ga0068852_100266764 3300005616 Bacteria 1646
158 Ga0068852_100435229 3300005616 Bacteria 1296
159 Ga0068852_100803667 3300005616 Bacteria 955
160 Ga0068852_100908872 3300005616 Bacteria 897
161 Ga0068852_100973101 3300005616 Bacteria 867
162 Ga0068859_100061439 3300005617 Bacteria 3786
163 Ga0068864_100000063 3300005618 Bacteria 119845
164 Ga0068864_100004504 3300005618 Bacteria 11457
165 Ga0068864_100022037 3300005618 Bacteria 5339
166 Ga0068864_100035463 3300005618 Bacteria 4247
167 Ga0068864_100693797 3300005618 Bacteria 994
168 Ga0068864_100745331 3300005618 Bacteria 960
169 Ga0068861_100004572 3300005719 Bacteria 9290
170 Ga0068861_101246335 3300005719 Bacteria 721
171 Ga0068851_10183942 3300005834 Bacteria 1158
172 Ga0068863_100000014 3300005841 Bacteria 216135
173 Ga0068863_100000062 3300005841 Bacteria 119845
174 Ga0068863_100000070 3300005841 Bacteria 115715
175 Ga0068863_100080373 3300005841 Bacteria 3088
176 Ga0068863_100342066 3300005841 Bacteria 1455
177 Ga0068863_100648183 3300005841 Bacteria 1047
178 Ga0068858_100000313 3300005842 Bacteria 51649
179 Ga0068858_100002369 3300005842 Bacteria 19058
180 Ga0068858_100003260 3300005842 Bacteria 16176
181 Ga0068858_100156431 3300005842 Bacteria 2145
182 Ga0068858_100353831 3300005842 Bacteria 1407
183 Ga0068858_101165476 3300005842 Bacteria 757
184 Ga0068860_100000001 3300005843 Bacteria 703043
185 Ga0068860_100000007 3300005843 Bacteria 429329
186 Ga0068860_100011780 3300005843 Bacteria 8619
187 Ga0068860_100029781 3300005843 Bacteria 5251
188 Ga0068862_100000020 3300005844 Bacteria 219516
189 Ga0068862_100000069 3300005844 Bacteria 122535
190 Ga0068862_100012958 3300005844 Bacteria 6898
191 Ga0068862_100062551 3300005844 Bacteria 3201
192 Ga0068862_100081269 3300005844 Bacteria 2811
193 Ga0081455_10001124 3300005937 Bacteria 33435
194 Ga0075365_10067981 3300006038 Bacteria 2393
195 Ga0075368_10000199 3300006042 Bacteria 16601
196 Ga0075368_10092963 3300006042 Bacteria 1234
197 Ga0075363_100009342 3300006048 Bacteria 4608
198 Ga0075363_100017436 3300006048 Bacteria 3561
199 Ga0075364_10002598 3300006051 Bacteria 10133
200 Ga0075364_10102269 3300006051 Bacteria 1908
201 Ga0075364_10151087 3300006051 Bacteria 1565
202 Ga0075364_10551599 3300006051 Bacteria 788
203 Ga0075364_10611915 3300006051 Bacteria 744
204 Ga0075362_10000041 3300006177 Bacteria 45834
205 Ga0075362_10046036 3300006177 Bacteria 1939
206 Ga0075367_10022138 3300006178 Bacteria 3561
207 Ga0075367_10648801 3300006178 Bacteria 671
208 Ga0075369_10000994 3300006186 Bacteria 9454
209 Ga0075369_10120093 3300006186 Bacteria 1189
210 Ga0075366_10000150 3300006195 Bacteria 29547
211 Ga0075366_10028344 3300006195 Bacteria 3287
212 Ga0075366_10217878 3300006195 Bacteria 1163
213 Ga0075366_10436965 3300006195 Bacteria 807
214 Ga0075370_10000003 3300006353 Bacteria 133163
215 Ga0075370_10018925 3300006353 Bacteria 3740
216 Ga0075370_10033548 3300006353 Bacteria 2875
217 Ga0075370_10036616 3300006353 Bacteria 2757
218 Ga0075370_10093820 3300006353 Bacteria 1733
219 Ga0075370_10158613 3300006353 Bacteria 1327
220 Ga0075370_10502340 3300006353 Bacteria 732
221 Ga0097620_100061439 3300006931 Bacteria 3786
222 Ga0079104_1027201 3300006946 Bacteria 1469
223 Ga0105251_10001315 3300009011 Bacteria 21467
224 Ga0105251_10006102 3300009011 Bacteria 7763
225 Ga0105251_10007785 3300009011 Bacteria 6528
226 Ga0105251_10052664 3300009011 Bacteria 1937
227 Ga0105244_10016502 3300009036 Bacteria 4204
228 Ga0105250_10002953 3300009092 Bacteria 8277
229 Ga0105250_10021336 3300009092 Bacteria 2615
230 Ga0105250_10104782 3300009092 Bacteria 1156
231 Ga0105250_10142772 3300009092 Bacteria 993
232 Ga0105250_10148598 3300009092 Bacteria 974
233 Ga0105250_10189082 3300009092 Bacteria 866
234 Ga0105240_10029936 3300009093 Bacteria 7084
235 Ga0105247_10050332 3300009101 Bacteria 2563
236 Ga0105247_10056551 3300009101 Bacteria 2423
237 Ga0105247_10087521 3300009101 Bacteria 1973
238 Ga0105243_10114789 3300009148 Bacteria 2260
239 Ga0105241_10130650 3300009174 Bacteria 2033
240 Ga0105248_10000284 3300009177 Bacteria 59750
241 Ga0105248_10004661 3300009177 Bacteria 15178
242 Ga0105248_10048387 3300009177 Bacteria 4770
243 Ga0105248_10104896 3300009177 Bacteria 3187
244 Ga0105248_10157534 3300009177 Bacteria 2562
245 Ga0105237_10788457 3300009545 Bacteria 957
246 Ga0105238_10058547 3300009551 Bacteria 3861
247 Ga0105238_10078333 3300009551 Bacteria 3295
248 Ga0105238_10121889 3300009551 Bacteria 2587
249 Ga0105238_10435814 3300009551 Bacteria 1306
250 Ga0105238_11443078 3300009551 Bacteria 716
251 Ga0105238_11605734 3300009551 Bacteria 680
252 Ga0105249_10000005 3300009553 Bacteria 362467
253 Ga0105249_10000160 3300009553 Bacteria 81883
254 Ga0105249_10136026 3300009553 Bacteria 2351
255 Ga0105249_10463585 3300009553 Bacteria 1307
256 Ga0105249_11242858 3300009553 Bacteria 816
257 Ga0105246_10011029 3300011119 Bacteria 5600
258 Ga0105246_10803155 3300011119 Bacteria 835
259 Ga0157373_10053241 3300013100 Bacteria 2878
260 Ga0157373_10116318 3300013100 Bacteria 1879
261 Ga0157371_10001947 3300013102 Bacteria 20528
262 Ga0157371_10171692 3300013102 Bacteria 1549
263 Ga0157371_10444426 3300013102 Bacteria 953
264 Ga0157370_10010227 3300013104 Bacteria 9906
265 Ga0157370_10583082 3300013104 Bacteria 1024
266 Ga0157370_10989143 3300013104 Bacteria 762
267 Ga0157369_10000968 3300013105 Bacteria 36428
268 Ga0157369_10031914 3300013105 Bacteria 5796
269 Ga0157374_10027466 3300013296 Bacteria 5135
270 Ga0157374_10476509 3300013296 Bacteria 1251
271 Ga0157378_10065632 3300013297 Bacteria 3249
272 Ga0157378_10417725 3300013297 Bacteria 1325
273 Ga0157378_10938346 3300013297 Bacteria 897
274 Ga0163162_10030993 3300013306 Bacteria 5302
275 Ga0163162_10040293 3300013306 Bacteria 4671
276 Ga0163162_10097636 3300013306 Bacteria 3026
277 Ga0163162_10371029 3300013306 Bacteria 1564
278 Ga0163162_10641933 3300013306 Bacteria 1186
279 Ga0157372_10001238 3300013307 Bacteria 27605
280 Ga0157372_10062791 3300013307 Bacteria 4163
281 Ga0157372_10124496 3300013307 Bacteria 2963
282 Ga0157372_10356831 3300013307 Bacteria 1703
283 Ga0157375_10748286 3300013308 Bacteria 1129
284 Ga0163163_10094960 3300014325 Bacteria 3001
285 Ga0157377_10328575 3300014745 Bacteria 1018
286 Ga0157377_10373619 3300014745 Bacteria 963
287 Ga0157379_10037286 3300014968 Bacteria 4334
288 Ga0157379_10083251 3300014968 Bacteria 2867
289 Ga0163161_10000115 3300017792 Bacteria 76319
290 Ga0163161_10026756 3300017792 Bacteria 4088
291 Ga0163161_10626923 3300017792 Bacteria 889
292 Ga0163161_11072191 3300017792 Bacteria 691
293 Ga0209566_100042 3300025225 Bacteria 287384
294 Ga0209147_100088 3300025229 Bacteria 179728
295 Ga0209147_105356 3300025229 Bacteria 1934
296 Ga0209437_105443 3300025233 Bacteria 2170
297 Ga0209258_100827 3300025242 Bacteria 17191
298 Ga0209258_103603 3300025242 Bacteria 3266
299 Ga0207425_1000022 3300025245 Bacteria 355305
300 Ga0209129_1001473 3300025258 Bacteria 13099
301 Ga0209233_1000119 3300025261 Bacteria 235924
302 Ga0209455_1013376 3300025272 Bacteria 1907
303 Ga0209673_1002724 3300025273 Bacteria 11656
304 Ga0209130_1017142 3300025284 Bacteria 1734
305 Ga0209675_1000025 3300025291 Bacteria 294102
306 Ga0209676_1000198 3300025292 Bacteria 134708
307 Ga0209676_1000228 3300025292 Bacteria 123024
308 Ga0209676_1000362 3300025292 Bacteria 85770
309 Ga0209676_1005754 3300025292 Bacteria 6352
310 Ga0209676_1032137 3300025292 Bacteria 1582
311 Ga0209025_1000842 3300025294 Bacteria 48558
312 Ga0209025_1001397 3300025294 Bacteria 32105
313 Ga0209025_1001925 3300025294 Bacteria 24064
314 Ga0209025_1003543 3300025294 Bacteria 14640
315 Ga0209025_1008600 3300025294 Bacteria 7310
316 Ga0209025_1009349 3300025294 Bacteria 6852
317 Ga0209025_1010389 3300025294 Bacteria 6312
318 Ga0209758_1000004 3300025297 Bacteria 1375322
319 Ga0209050_1000001 3300025298 Bacteria 3563507
320 Ga0209050_1000367 3300025298 Bacteria 86573
321 Ga0209050_1000728 3300025298 Bacteria 47923
322 Ga0209050_1011865 3300025298 Bacteria 4072
323 Ga0209050_1072117 3300025298 Bacteria 766
324 Ga0207426_1011617 3300025302 Bacteria 3344
325 Ga0209051_1000246 3300025303 Bacteria 91170
326 Ga0209257_1000229 3300025304 Bacteria 133121
327 Ga0209257_1000596 3300025304 Bacteria 59951
328 Ga0209257_1008070 3300025304 Bacteria 6128
329 Ga0207697_10106721 3300025315 Bacteria 1197
330 Ga0207656_10160934 3300025321 Bacteria 1068
331 Ga0207696_1004520 3300025711 Bacteria 5976
332 Ga0207696_1011155 3300025711 Bacteria 3251
333 Ga0207696_1031305 3300025711 Bacteria 1610
334 Ga0207696_1031890 3300025711 Bacteria 1590
335 Ga0207655_1005646 3300025728 Bacteria 8461
336 Ga0207655_1013231 3300025728 Bacteria 4751
337 Ga0207713_1007454 3300025735 Bacteria 6454
338 Ga0207713_1010725 3300025735 Bacteria 5048
339 Ga0207713_1014855 3300025735 Bacteria 4019
340 Ga0207713_1021570 3300025735 Bacteria 3083
341 Ga0207713_1046744 3300025735 Bacteria 1758
342 Ga0207710_10044681 3300025900 Bacteria 1973
343 Ga0207710_10137611 3300025900 Bacteria 1177
344 Ga0207680_10000004 3300025903 Bacteria 827324
345 Ga0207680_10081041 3300025903 Bacteria 2039
346 Ga0207680_10210525 3300025903 Bacteria 1329
347 Ga0207647_10000555 3300025904 Bacteria 29646
348 Ga0207647_10069787 3300025904 Bacteria 2124
349 Ga0207705_10000004 3300025909 Bacteria 705756
350 Ga0207705_10026510 3300025909 Bacteria 4133
351 Ga0207705_10063556 3300025909 Bacteria 2667
352 Ga0207705_10268542 3300025909 Bacteria 1304
353 Ga0207684_10760646 3300025910 Bacteria 821
354 Ga0207654_10004092 3300025911 Bacteria 7346
355 Ga0207654_10393046 3300025911 Bacteria 963
356 Ga0207707_10051378 3300025912 Bacteria 3589
357 Ga0207695_10003879 3300025913 Bacteria 20700
358 Ga0207695_10012208 3300025913 Bacteria 10316
359 Ga0207671_10001983 3300025914 Bacteria 22572
360 Ga0207660_10131387 3300025917 Bacteria 1906
361 Ga0207657_10001614 3300025919 Bacteria 24260
362 Ga0207657_10037866 3300025919 Bacteria 4301
363 Ga0207649_10026472 3300025920 Bacteria 3393
364 Ga0207652_10018883 3300025921 Bacteria 5659
365 Ga0207652_10021249 3300025921 Bacteria 5356
366 Ga0207652_10056452 3300025921 Bacteria 3380
367 Ga0207681_10000130 3300025923 Bacteria 61067
368 Ga0207681_10000140 3300025923 Bacteria 60064
369 Ga0207681_10010126 3300025923 Bacteria 5770
370 Ga0207681_10333281 3300025923 Bacteria 1210
371 Ga0207681_10511467 3300025923 Bacteria 984
372 Ga0207681_10792267 3300025923 Bacteria 791
373 Ga0207694_10005262 3300025924 Bacteria 9967
374 Ga0207694_10007000 3300025924 Bacteria 8562
375 Ga0207694_10046380 3300025924 Bacteria 3359
376 Ga0207694_10103465 3300025924 Bacteria 2258
377 Ga0207694_10534438 3300025924 Bacteria 983
378 Ga0207650_10000142 3300025925 Bacteria 87599
379 Ga0207650_10057847 3300025925 Bacteria 2885
380 Ga0207650_10086523 3300025925 Bacteria 2386
381 Ga0207650_10354042 3300025925 Bacteria 1208
382 Ga0207687_10000259 3300025927 Bacteria 36055
383 Ga0207644_10000811 3300025931 Bacteria 19839
384 Ga0207644_10000818 3300025931 Bacteria 19768
385 Ga0207644_10006799 3300025931 Bacteria 7454
386 Ga0207644_10325543 3300025931 Bacteria 1243
387 Ga0207644_10851638 3300025931 Bacteria 763
388 Ga0207690_10000894 3300025932 Bacteria 19034
389 Ga0207690_10904539 3300025932 Bacteria 732
390 Ga0207706_10000035 3300025933 Bacteria 138894
391 Ga0207706_10009604 3300025933 Bacteria 8880
392 Ga0207706_10095537 3300025933 Bacteria 2614
393 Ga0207709_10314763 3300025935 Bacteria 1169
394 Ga0207709_10429189 3300025935 Bacteria 1017
395 Ga0207670_10039261 3300025936 Bacteria 3099
396 Ga0207711_10000017 3300025941 Bacteria 441730
397 Ga0207711_10071888 3300025941 Bacteria 3003
398 Ga0207711_10202664 3300025941 Bacteria 1811
399 Ga0207689_10117467 3300025942 Bacteria 2187
400 Ga0207661_10132887 3300025944 Bacteria 2134
401 Ga0207661_10170932 3300025944 Bacteria 1892
402 Ga0207679_10070830 3300025945 Bacteria 2628
403 Ga0207667_10016664 3300025949 Bacteria 8293
404 Ga0207667_10056319 3300025949 Bacteria 4130
405 Ga0207667_10090978 3300025949 Bacteria 3153
406 Ga0207667_10093031 3300025949 Bacteria 3114
407 Ga0207667_10392664 3300025949 Bacteria 1413
408 Ga0207667_11041425 3300025949 Bacteria 804
409 Ga0207712_10000001 3300025961 Bacteria 750309
410 Ga0207712_10000527 3300025961 Bacteria 31373
411 Ga0207712_10189723 3300025961 Bacteria 1621
412 Ga0207668_10006786 3300025972 Bacteria 6779
413 Ga0207668_10027876 3300025972 Bacteria 3685
414 Ga0207668_10032021 3300025972 Bacteria 3470
415 Ga0207668_10048371 3300025972 Bacteria 2918
416 Ga0207640_10001101 3300025981 Bacteria 14929
417 Ga0207640_10014152 3300025981 Bacteria 4586
418 Ga0207640_10015711 3300025981 Bacteria 4387
419 Ga0207640_10105323 3300025981 Bacteria 1987
420 Ga0207640_10528614 3300025981 Bacteria 987
421 Ga0207640_11080116 3300025981 Bacteria 709
422 Ga0207640_11259434 3300025981 Bacteria 659
423 Ga0207658_10000133 3300025986 Bacteria 78402
424 Ga0207658_10001207 3300025986 Bacteria 20562
425 Ga0207658_10001257 3300025986 Bacteria 20066
426 Ga0207658_10003755 3300025986 Bacteria 10697
427 Ga0207658_10012197 3300025986 Bacteria 5864
428 Ga0207658_10053887 3300025986 Bacteria 2974
429 Ga0207677_11453050 3300026023 Bacteria 632
430 Ga0207703_10000961 3300026035 Bacteria 27866
431 Ga0207703_10001460 3300026035 Bacteria 21567
432 Ga0207703_10002071 3300026035 Bacteria 17638
433 Ga0207703_10025076 3300026035 Bacteria 4690
434 Ga0207703_10051426 3300026035 Bacteria 3339
435 Ga0207703_10116628 3300026035 Bacteria 2286
436 Ga0207703_10325827 3300026035 Bacteria 1408
437 Ga0207639_10001012 3300026041 Bacteria 19116
438 Ga0207639_10007855 3300026041 Bacteria 7287
439 Ga0207639_10111311 3300026041 Bacteria 2232
440 Ga0207639_10184052 3300026041 Bacteria 1779
441 Ga0207639_10538988 3300026041 Bacteria 1070
442 Ga0207639_10916894 3300026041 Bacteria 819
443 Ga0207678_10028298 3300026067 Bacteria 4893
444 Ga0207678_10106424 3300026067 Bacteria 2393
445 Ga0207702_10043320 3300026078 Bacteria 3779
446 Ga0207702_10139976 3300026078 Bacteria 2188
447 Ga0207641_10000022 3300026088 Bacteria 279334
448 Ga0207641_10000033 3300026088 Bacteria 219261
449 Ga0207641_10000126 3300026088 Bacteria 112607
450 Ga0207641_10020015 3300026088 Bacteria 5494
451 Ga0207676_10000056 3300026095 Bacteria 124484
452 Ga0207676_10011444 3300026095 Bacteria 6341
453 Ga0207676_10337223 3300026095 Bacteria 1389
454 Ga0207676_11395351 3300026095 Bacteria 696
455 Ga0207674_10019205 3300026116 Bacteria 7410
456 Ga0207674_10023877 3300026116 Bacteria 6540
457 Ga0207674_10045037 3300026116 Bacteria 4541
458 Ga0207674_10073006 3300026116 Bacteria 3445
459 Ga0207674_10128780 3300026116 Bacteria 2496
460 Ga0207674_10187178 3300026116 Bacteria 2020
461 Ga0207674_10315125 3300026116 Bacteria 1513
462 Ga0207675_100004034 3300026118 Bacteria 14233
463 Ga0207675_101291922 3300026118 Bacteria 750
464 Ga0207698_10000789 3300026142 Bacteria 18471
465 Ga0207698_10025403 3300026142 Bacteria 4173
466 Ga0207698_10041250 3300026142 Bacteria 3437
467 Ga0207698_10273943 3300026142 Bacteria 1557
468 Ga0209982_1070845 3300027552 Bacteria 571
469 Ga0209813_10000065 3300027866 Bacteria 42169
470 Ga0209813_10070003 3300027866 Bacteria 1138
471 Ga0209974_10014350 3300027876 Bacteria 2636
472 Ga0209974_10065284 3300027876 Bacteria 1236
473 Ga0268266_10000028 3300028379 Bacteria 425294
474 Ga0268266_10000317 3300028379 Bacteria 76446
475 Ga0268266_10011921 3300028379 Bacteria 7529
476 Ga0268266_10027588 3300028379 Bacteria 4827
477 Ga0268265_10000044 3300028380 Bacteria 182545
478 Ga0268265_10000071 3300028380 Bacteria 132890
479 Ga0268265_10004791 3300028380 Bacteria 9326
480 Ga0268265_10008961 3300028380 Bacteria 6767
481 Ga0268265_10319921 3300028380 Bacteria 1404
482 Ga0268264_10000006 3300028381 Bacteria 827324
483 Ga0268264_10000077 3300028381 Bacteria 252597
484 Ga0268264_10009226 3300028381 Bacteria 8172
485 Ga0268264_10021239 3300028381 Bacteria 5304
486 Ga0237817_10090 3300030083 Bacteria 27984
487 Ga0265331_10133611 3300031250 Bacteria 1131
488 Ga0307513_10097855 3300031456 Bacteria 2968
489 Ga0307509_10068266 3300031507 Bacteria 3721
490 Ga0307408_100281517 3300031548 Bacteria 1385
491 Ga0307408_100316845 3300031548 Bacteria 1312
492 Ga0307408_100885506 3300031548 Bacteria 816
493 Ga0307508_10000858 3300031616 Bacteria 35331
494 Ga0316575_10167435 3300031665 Bacteria 910
495 Ga0307405_10236709 3300031731 Bacteria 1349
496 Ga0307405_10700828 3300031731 Bacteria 838
497 Ga0307413_10555867 3300031824 Bacteria 932
498 Ga0307410_10012162 3300031852 Bacteria 4961
499 Ga0307410_10117311 3300031852 Bacteria 1935
500 Ga0307406_10033048 3300031901 Bacteria 3163
501 Ga0307406_10143048 3300031901 Bacteria 1696
502 Ga0307406_10225051 3300031901 Bacteria 1397
503 Ga0307406_10234405 3300031901 Bacteria 1373
504 Ga0307407_10216287 3300031903 Bacteria 1293
505 Ga0307412_10005487 3300031911 Bacteria 7122
506 Ga0307412_10093964 3300031911 Bacteria 2105
507 Ga0307412_10173219 3300031911 Bacteria 1615
508 Ga0307412_10247951 3300031911 Bacteria 1381
509 Ga0307412_10397806 3300031911 Bacteria 1120
510 Ga0307416_101276032 3300032002 Bacteria 840
511 Ga0307416_102036845 3300032002 Bacteria 676
512 Ga0307414_10000918 3300032004 Bacteria 15065
513 Ga0307414_10011317 3300032004 Bacteria 5227
514 Ga0307414_10025158 3300032004 Bacteria 3808
515 Ga0307414_10032511 3300032004 Bacteria 3436
516 Ga0307414_10202579 3300032004 Bacteria 1615
517 Ga0307414_10221998 3300032004 Bacteria 1552
518 Ga0307414_10255086 3300032004 Bacteria 1460
519 Ga0307414_10280158 3300032004 Bacteria 1400
520 Ga0307414_10318250 3300032004 Bacteria 1323
521 Ga0307414_11194778 3300032004 Bacteria 704
522 Ga0307411_10005827 3300032005 Bacteria 6105
523 Ga0307411_10014776 3300032005 Bacteria 4358
524 Ga0307411_10081670 3300032005 Bacteria 2227
525 Ga0307415_100155593 3300032126 Bacteria 1765
526 Ga0307510_10065943 3300033180 Bacteria 3660
527 Ga0373932_0075523 3300035112 Bacteria 1054
528 Ga0316582_0163214 3300036647 Bacteria 1510
529 Ga0316582_0233726 3300036647 Bacteria 1258
530 Ga0316584_0144004 3300036712 Bacteria 1776
531 Ga0316584_0200377 3300036712 Bacteria 1473
532 Ga0395900_0007717 3300037418 Bacteria 11096
533 Ga0395900_0287508 3300037418 Bacteria 1634
534 Ga0395900_0647893 3300037418 Bacteria 993
535 Ga0395898_0023846 3300037466 Bacteria 6176
536 Ga0316581_0041398 3300037588 Bacteria 1404
537 Ga0436364_0420330 3300037853 Bacteria 1196
538 Ga0395901_0008908 3300038443 Bacteria 10163
539 Ga0395901_0042433 3300038443 Bacteria 4716
540 Ga0436363_0349297 3300039450 Bacteria 1778
541 Ga0451791_1703147 3300041451 Bacteria 695
542 Ga0451793_1141815 3300041452 Bacteria 523
543 Ga0451793_1456958 3300041452 Bacteria 542
544 Ga0451807_1257146 3300041486 Bacteria 869
545 Ga0451833_0856020 3300041491 Bacteria 635
546 Ga0451837_0749401 3300041494 Bacteria 814
547 Ga0451839_1354034 3300041496 Bacteria 621
548 Ga0451841_0840733 3300041498 Bacteria 1072
549 Ga0451847_0010677 3300041503 Bacteria 709
550 Ga0451853_0254844 3300041512 Bacteria 887
551 Ga0450894_053352 3300042131 Bacteria 599
552 Ga0466969_0002301 3300044656 Bacteria 10198
553 Ga0466969_0009087 3300044656 Bacteria 5268
554 Ga0466966_0004002 3300044684 Bacteria 9734
555 Ga0466961_0044870 3300044693 Bacteria 2828
556 Ga0453684_0353812 3300044712 Bacteria 1655
557 Ga0453684_0478380 3300044712 Bacteria 1382
558 Ga0466970_0031996 3300044765 Bacteria 2779
559 Ga0466959_0001964 3300045049 Bacteria 12968
560 Ga0451576_0000007 3300045051 Bacteria 782228
561 Ga0495627_000158 3300046453 Bacteria 77210
562 Ga0495638_0001382 3300046460 Bacteria 22126
563 Ga0495638_0044272 3300046460 Bacteria 2804
564 Ga0495638_0245109 3300046460 Bacteria 990
565 Ga0495651_0003251 3300046462 Bacteria 12469
566 Ga0495650_0000831 3300046471 Bacteria 37263
567 Ga0495662_0223583 3300046476 Bacteria 928
568 Ga0495585_0109441 3300046492 Bacteria 1471
569 Ga0495585_0123344 3300046492 Bacteria 1369
570 Ga0495594_0390088 3300046499 Bacteria 792
571 Ga0495596_0000539 3300046500 Bacteria 23771
572 Ga0495607_0021094 3300046501 Bacteria 4103
573 Ga0495607_0382615 3300046501 Bacteria 643
574 Ga0495583_0012555 3300046506 Bacteria 4784
575 Ga0495583_0013765 3300046506 Bacteria 4493
576 Ga0495606_0003910 3300046507 Bacteria 15336
577 Ga0495606_0083175 3300046507 Bacteria 1985
578 Ga0495606_0308935 3300046507 Bacteria 854
579 Ga0495610_0000020 3300046512 Bacteria 344007
580 Ga0495610_0000377 3300046512 Bacteria 46011
581 Ga0495610_0005814 3300046512 Bacteria 8669
582 Ga0495620_0009442 3300046515 Bacteria 5190
583 Ga0495628_0301069 3300046516 Bacteria 1187
584 Ga0495632_0001745 3300046519 Bacteria 17628
585 Ga0495632_0071947 3300046519 Bacteria 1660
586 Ga0495632_0149293 3300046519 Bacteria 1081
587 Ga0495643_0000007 3300046522 Bacteria 383435
588 Ga0495643_0007169 3300046522 Bacteria 7233
589 Ga0495643_0009816 3300046522 Bacteria 5921
590 Ga0495643_0031602 3300046522 Bacteria 2946
591 Ga0495643_0079094 3300046522 Bacteria 1715
592 Ga0495643_0142655 3300046522 Bacteria 1193
593 Ga0495648_0067804 3300046524 Bacteria 2085
594 Ga0495648_0087932 3300046524 Bacteria 1748
595 Ga0495648_0104429 3300046524 Bacteria 1556
596 Ga0495663_0065775 3300046525 Bacteria 1146
597 Ga0495663_0172099 3300046525 Bacteria 747
598 Ga0495663_0277522 3300046525 Bacteria 600
599 Ga0495652_0002206 3300046529 Bacteria 20433
600 Ga0495654_0000374 3300046530 Bacteria 38569
601 Ga0495654_0082873 3300046530 Bacteria 1500
602 Ga0495654_0134778 3300046530 Bacteria 1105
603 Ga0495609_0015309 3300046538 Bacteria 3591
604 Ga0495633_0061326 3300046558 Bacteria 1761
605 Ga0495668_0000001 3300046616 Bacteria 1013420
606 Ga0495668_0006149 3300046616 Bacteria 7944
607 Ga0495668_0092432 3300046616 Bacteria 1657
608 Ga0495625_0000064 3300046660 Bacteria 174730
609 Ga0495625_0000234 3300046660 Bacteria 86768
610 Ga0495625_0010229 3300046660 Bacteria 7779
611 Ga0495588_0275591 3300046674 Bacteria 886
612 Ga0495623_0173384 3300046679 Bacteria 1258
613 Ga0495670_0058817 3300046691 Bacteria 1929
614 Ga0495670_0141020 3300046691 Bacteria 1260
615 Ga0495670_0157714 3300046691 Bacteria 1191
616 Ga0495671_0300610 3300046692 Bacteria 772
617 Ga0495600_0154713 3300046809 Bacteria 1483
618 Ga0495604_0007438 3300047317 Bacteria 8679
619 Ga0495675_0012675 3300047444 Bacteria 5306
620 Ga0495685_116284 3300047447 Bacteria 879
621 Ga0495673_0170009 3300047469 Bacteria 831
622 Ga0495673_0173776 3300047469 Bacteria 819
623 Ga0495681_0000094 3300047470 Bacteria 77400
624 Ga0495686_0000145 3300047472 Bacteria 141946
625 Ga0495686_0027507 3300047472 Bacteria 3712
626 Ga0495686_0027888 3300047472 Bacteria 3681
627 Ga0495686_0048172 3300047472 Bacteria 2688
628 Ga0495686_0175411 3300047472 Bacteria 1245
629 Ga0495615_0000033 3300048090 Bacteria 45796
630 Ga0496100_0011591 3300048903 Bacteria 5022
631 Ga0496100_0061354 3300048903 Bacteria 2477
632 Ga0496100_0801751 3300048903 Bacteria 738
633 Ga0496101_0009157 3300048904 Bacteria 6498
634 Ga0496101_0161863 3300048904 Bacteria 1716
635 Ga0496101_0203804 3300048904 Bacteria 1530
636 Ga0496101_0603190 3300048904 Bacteria 868
637 Ga0496102_0000267 3300048905 Bacteria 66761
638 Ga0496102_0783994 3300048905 Bacteria 875
639 Ga0496102_0890281 3300048905 Bacteria 812
640 Ga0496103_0000139 3300048906 Bacteria 75158
641 Ga0496103_0014470 3300048906 Bacteria 4684
642 Ga0496103_0026678 3300048906 Bacteria 3496
643 Ga0496103_0035486 3300048906 Bacteria 3053
644 Ga0496103_0353879 3300048906 Bacteria 944
645 Ga0496104_0001261 3300048907 Bacteria 21786
646 Ga0496104_0005335 3300048907 Bacteria 11245
647 Ga0496104_0051151 3300048907 Bacteria 3899
648 Ga0496104_0286807 3300048907 Bacteria 1559
649 Ga0496105_0004419 3300048908 Bacteria 10585
650 Ga0496105_0004449 3300048908 Bacteria 10552
651 Ga0496105_0006672 3300048908 Bacteria 8886
652 Ga0496105_0357718 3300048908 Bacteria 1165
653 Ga0496106_0664981 3300048909 Bacteria 832
654 Ga0496106_1505658 3300048909 Bacteria 517
655 Ga0496107_0006170 3300048910 Bacteria 8232
656 Ga0496108_0090157 3300048911 Bacteria 2606
657 Ga0496108_1186244 3300048911 Bacteria 646
658 Ga0496109_0017830 3300048912 Bacteria 6228
659 Ga0496109_0201779 3300048912 Bacteria 1870
660 Ga0496110_0057248 3300048913 Bacteria 3431
661 Ga0496110_0068444 3300048913 Bacteria 3142
662 Ga0496111_0002045 3300048914 Bacteria 12011
663 Ga0496111_0014834 3300048914 Bacteria 5333
664 Ga0496111_0903153 3300048914 Bacteria 636
665 Ga0496112_0588958 3300048915 Bacteria 1044
666 Ga0496112_0600219 3300048915 Bacteria 1033
667 Ga0496113_0007197 3300048916 Bacteria 7131
668 Ga0496113_0110664 3300048916 Bacteria 2137
669 Ga0496114_0023283 3300048917 Bacteria 5054
670 Ga0496114_0056565 3300048917 Bacteria 3274
671 Ga0496114_0241100 3300048917 Bacteria 1590
672 Ga0496116_0013857 3300048919 Bacteria 6473
673 Ga0496117_0009437 3300048920 Bacteria 9079
674 Ga0496117_0034849 3300048920 Bacteria 3786
675 Ga0496117_0102213 3300048920 Bacteria 1810
676 Ga0496117_0128287 3300048920 Bacteria 1543
677 Ga0496117_0220842 3300048920 Bacteria 1055
678 Ga0496118_0003648 3300048921 Bacteria 19124
679 Ga0496118_0006964 3300048921 Bacteria 12206
680 Ga0496118_0020455 3300048921 Bacteria 5868
681 Ga0496118_0083218 3300048921 Bacteria 2238
682 Ga0496118_0084791 3300048921 Bacteria 2209
683 Ga0496118_0190308 3300048921 Bacteria 1228
684 Ga0496119_0000077 3300048922 Bacteria 143108
685 Ga0496119_0000344 3300048922 Bacteria 65097
686 Ga0496119_0012840 3300048922 Bacteria 6755
687 Ga0496119_0066703 3300048922 Bacteria 2125
688 Ga0496120_0005768 3300048923 Bacteria 9727
689 Ga0496120_0205030 3300048923 Bacteria 952
690 Ga0496121_0000022 3300048924 Bacteria 472849
691 Ga0496121_0000222 3300048924 Bacteria 123595
692 Ga0496121_0002362 3300048924 Bacteria 29040
693 Ga0496121_0009408 3300048924 Bacteria 11239
694 Ga0496121_0058612 3300048924 Bacteria 3181
695 Ga0496121_0685237 3300048924 Bacteria 619
696 Ga0496122_0002268 3300048925 Bacteria 27820
697 Ga0496122_0006858 3300048925 Bacteria 12900
698 Ga0496122_0008242 3300048925 Bacteria 11310
699 Ga0496122_0011513 3300048925 Bacteria 8947
700 Ga0496122_0016389 3300048925 Bacteria 7014
701 Ga0496123_0003406 3300048926 Bacteria 17901
702 Ga0496123_0005241 3300048926 Bacteria 13168
703 Ga0496123_0005963 3300048926 Bacteria 11998
704 Ga0496123_0016981 3300048926 Bacteria 5876
705 Ga0496124_0006200 3300048927 Bacteria 13103
706 Ga0496124_0183938 3300048927 Bacteria 1605
707 Ga0496124_0263061 3300048927 Bacteria 1268
708 Ga0496125_0007827 3300048928 Bacteria 11295
709 Ga0496125_0016149 3300048928 Bacteria 7180
710 Ga0496125_0028887 3300048928 Bacteria 4995
711 Ga0496125_0042962 3300048928 Bacteria 3843
712 Ga0496126_0000079 3300048929 Bacteria 222463
713 Ga0496126_0000619 3300048929 Bacteria 66827
714 Ga0496126_0003256 3300048929 Bacteria 20755
715 Ga0496126_0004371 3300048929 Bacteria 16942
716 Ga0496126_0026032 3300048929 Bacteria 5617
717 Ga0496126_0042184 3300048929 Bacteria 4215
718 Ga0496126_0563927 3300048929 Bacteria 902
719 Ga0495678_026512 3300049459 Bacteria 2473
720 Ga0495682_0132776 3300049460 Bacteria 890
721 Ga0501300_034046 3300049523 Bacteria 756
722 Ga0501032_0006527 3300049569 Bacteria 8567
723 Ga0501033_0004215 3300049570 Bacteria 11571
724 Ga0501033_0031389 3300049570 Bacteria 3992
725 Ga0501034_0010865 3300049571 Bacteria 9457
726 Ga0501034_0326993 3300049571 Bacteria 1465
727 Ga0501036_0025362 3300049572 Bacteria 5001
728 Ga0501037_0009034 3300049573 Bacteria 7304
729 Ga0501038_0017668 3300049574 Bacteria 6447
730 Ga0501039_0091478 3300049575 Bacteria 2371
731 Ga0501043_1161883 3300049579 Bacteria 543
732 Ga0501046_0067378 3300049580 Bacteria 2788
733 Ga0501047_0004376 3300049581 Bacteria 13293
734 Ga0501047_0119971 3300049581 Bacteria 2512
735 Ga0501047_0414497 3300049581 Bacteria 1179
736 Ga0501047_0431344 3300049581 Bacteria 1149
737 Ga0501048_0186999 3300049582 Bacteria 1468
738 Ga0501080_0323625 3300049742 Bacteria 1395
739 Ga0501083_0743537 3300049744 Bacteria 638
740 Ga0501035_0017712 3300049822 Bacteria 6570
741 Ga0501035_0167219 3300049822 Bacteria 1901
742 Ga0501035_0853382 3300049822 Bacteria 724
743 Ga0501044_0000098 3300049823 Bacteria 107528
744 Ga0501044_0007203 3300049823 Bacteria 12234
745 Ga0501044_0030831 3300049823 Bacteria 5647
746 Ga0501044_0205691 3300049823 Bacteria 1925
747 Ga0501044_0319955 3300049823 Bacteria 1476
748 nmdc:mga03683_149_c1 3300050489 Bacteria 23934
749 nmdc:mga03683_30_c1 3300050489 Bacteria 71765
750 nmdc:mga03n38_147852_c1 3300050490 Bacteria 1180
751 nmdc:mga03n38_6284_c1 3300050490 Bacteria 4116
752 nmdc:mga00v17_125984_c1 3300050491 Bacteria 1634
753 nmdc:mga00v17_798_c1 3300050491 Bacteria 17178
754 nmdc:mga00v17_83529_c1 3300050491 Bacteria 1998
755 nmdc:mga0k408_17004_c1 3300050493 Bacteria 4043
756 nmdc:mga0k408_2730_c1 3300050493 Bacteria 9376
757 nmdc:mga0k408_328445_c1 3300050493 Bacteria 912
758 nmdc:mga0k408_49594_c1 3300050493 Bacteria 2430
759 nmdc:mga0k408_563438_c1 3300050493 Bacteria 673
760 nmdc:mga06z11_149346_c1 3300050494 Bacteria 1327
761 nmdc:mga06z11_61_c1 3300050494 Bacteria 46697
762 nmdc:mga04h51_1140_c1 3300050495 Bacteria 6137
763 nmdc:mga04h51_49320_c1 3300050495 Bacteria 1406
764 nmdc:mga07m45_155417_c1 3300050496 Bacteria 1327
765 nmdc:mga07m45_19103_c1 3300050496 Bacteria 3709
766 nmdc:mga07m45_238675_c1 3300050496 Bacteria 1058
767 nmdc:mga07m45_29618_c2 3300050496 Bacteria 1449
768 nmdc:mga07m45_368022_c1 3300050496 Bacteria 835
769 nmdc:mga07m45_3935_c1 3300050496 Bacteria 7223
770 nmdc:mga07m45_4960_c1 3300050496 Bacteria 6565
771 nmdc:mga07m45_6_c1 3300050496 Bacteria 260521
772 nmdc:mga0rr50_1197089_c1 3300050513 Bacteria 645
773 nmdc:mga0sz30_114985_c1 3300050516 Bacteria 1181
774 nmdc:mga0sz30_138_c1 3300050516 Bacteria 26910
775 Ga0500643_000001 3300053087 Bacteria 1440111
776 Ga0500643_004834 3300053087 Bacteria 5953
777 Ga0500643_063823 3300053087 Bacteria 1030
778 Ga0500647_0014953 3300053091 Bacteria 3540
779 Ga0500651_0176403 3300053093 Bacteria 1271
780 Ga0500556_0000122 3300053104 Bacteria 67150
781 Ga0500562_048940 3300053108 Bacteria 1129
782 Ga0500592_005142 3300053116 Bacteria 2080
783 Ga0500592_013611 3300053116 Bacteria 1304
784 Ga0500592_051448 3300053116 Bacteria 670
785 Ga0500594_0063912 3300053118 Bacteria 1067
786 Ga0500595_000472 3300053119 Bacteria 24818
787 Ga0500595_007244 3300053119 Bacteria 4614
788 Ga0500607_000287 3300053121 Bacteria 48083
789 Ga0500607_000802 3300053121 Bacteria 30266
790 Ga0500608_001154 3300053122 Bacteria 9395
791 Ga0500618_037319 3300053125 Bacteria 1123
792 Ga0500652_004515 3300053131 Bacteria 4313
793 Ga0500652_119944 3300053131 Bacteria 1099
794 Ga0500652_254584 3300053131 Bacteria 694
795 Ga0500658_0001199 3300053134 Bacteria 10547
796 Ga0500658_0089523 3300053134 Bacteria 1329
797 Ga0500559_0002605 3300053136 Bacteria 9209
798 Ga0500559_0010186 3300053136 Bacteria 4042
799 Ga0500559_0016106 3300053136 Bacteria 3157
800 Ga0500559_0036136 3300053136 Bacteria 2135
801 Ga0500559_0098195 3300053136 Bacteria 1347
802 Ga0500559_0104037 3300053136 Bacteria 1310
803 Ga0500559_0384310 3300053136 Bacteria 654
804 Ga0500564_002032 3300053138 Bacteria 7302
805 Ga0500568_0002610 3300053139 Bacteria 10480
806 Ga0500568_0036903 3300053139 Bacteria 1986
807 Ga0500568_0097327 3300053139 Bacteria 1106
808 Ga0500568_0135285 3300053139 Bacteria 915
809 Ga0500568_0184394 3300053139 Bacteria 767
810 Ga0500573_0000082 3300053140 Bacteria 45547
811 Ga0500573_0197675 3300053140 Bacteria 1070
812 Ga0500573_0314262 3300053140 Bacteria 777
813 Ga0500573_0461430 3300053140 Bacteria 584
814 Ga0500577_0010263 3300053142 Bacteria 2751
815 Ga0500588_0130445 3300053146 Bacteria 894
816 Ga0500590_000142 3300053148 Bacteria 19990
817 Ga0500590_034104 3300053148 Bacteria 2636
818 Ga0500604_0030279 3300053151 Bacteria 1582
819 Ga0500604_0050022 3300053151 Bacteria 1287
820 Ga0500616_0004405 3300053153 Bacteria 10045
821 Ga0500616_0015221 3300053153 Bacteria 4403
822 Ga0500616_0049565 3300053153 Bacteria 2221
823 Ga0500619_247062 3300053154 Bacteria 588
824 Ga0500622_0014303 3300053156 Bacteria 4264
825 Ga0500627_0000004 3300053158 Bacteria 174208
826 Ga0500627_0000231 3300053158 Bacteria 15882
827 Ga0500630_250872 3300053159 Bacteria 628
828 Ga0500637_0071845 3300053178 Bacteria 1990
829 Ga0500625_000022 3300053729 Bacteria 78028
830 Ga0500625_065684 3300053729 Bacteria 1631
831 Ga0500645_003394 3300053730 Bacteria 6499
832 Ga0500645_029629 3300053730 Bacteria 1651
833 Ga0466962_0018926 3300061719 Bacteria 3309

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025302 Ga0207426_1011617 Ga0207426_10116173 125
2 3300048905 Ga0496102_0783994 Ga0496102_0783994_74_460 125
3 3300048909 Ga0496106_1505658 Ga0496106_1505658_47_433 125
4 3300048914 Ga0496111_0903153 Ga0496111_0903153_48_434 125
5 3300048915 Ga0496112_0588958 Ga0496112_0588958_390_776 125
6 3300048920 Ga0496117_0102213 Ga0496117_0102213_1038_1424 125
7 3300048922 Ga0496119_0012840 Ga0496119_0012840_2279_2665 125
8 3300002987 JGI25159J45721_1044908 JGI25159J45721_10449081 133
9 3300003758 Ga0055532_1000115 Ga0055532_100011539 133
10 3300025229 Ga0209147_100088 Ga0209147_100088126 133
11 iso_pu_bacteria 2842882022 2842883595 140
12 iso_pu_bacteria 2904524088 2904525384 140
13 iso_pu_bacteria 2919143609 2919146035 140
14 iso_pu_bacteria 2919517244 2919517959 140
15 iso_pu_bacteria 2928093941 2928097123 140
16 iso_pu_bacteria 2929004312 2929010097 140
17 iso_pu_bacteria 2960375949 2960380431 140
18 iso_pu_bacteria 8022893055 8022896689 140
19 3300003187 JGI25151J46595_10011677 JGI25151J46595_100116775 141
20 3300003187 JGI25151J46595_10014794 JGI25151J46595_100147944 141
21 3300003187 JGI25151J46595_10015684 JGI25151J46595_100156844 141
22 3300003761 Ga0055535_1004854 Ga0055535_10048544 141
23 3300003761 Ga0055535_1013750 Ga0055535_10137502 141
24 3300003841 Ga0055541_1000733 Ga0055541_10007338 141
25 3300009092 Ga0105250_10104782 Ga0105250_101047821 141
26 3300025225 Ga0209566_100042 Ga0209566_100042230 141
27 3300025242 Ga0209258_100827 Ga0209258_1008274 141
28 3300025242 Ga0209258_103603 Ga0209258_1036034 141
29 3300025284 Ga0209130_1017142 Ga0209130_10171423 141
30 3300025292 Ga0209676_1005754 Ga0209676_10057542 141
31 3300025294 Ga0209025_1001397 Ga0209025_100139722 141
32 3300025294 Ga0209025_1001925 Ga0209025_100192524 141
33 3300025294 Ga0209025_1010389 Ga0209025_10103896 141
34 3300025711 Ga0207696_1031890 Ga0207696_10318901 141
35 3300030083 Ga0237817_10090 Ga0237817_1009021 141
36 3300003187 JGI25151J46595_10001678 JGI25151J46595_1000167814 144
37 3300003187 JGI25151J46595_10010952 JGI25151J46595_100109523 144
38 3300003790 Ga0055528_1003541 Ga0055528_10035416 144
39 3300009011 Ga0105251_10007785 Ga0105251_100077858 144
40 3300009036 Ga0105244_10016502 Ga0105244_100165025 144
41 3300009092 Ga0105250_10002953 Ga0105250_100029533 144
42 3300009092 Ga0105250_10021336 Ga0105250_100213362 144
43 3300011119 Ga0105246_10011029 Ga0105246_100110295 144
44 3300013296 Ga0157374_10027466 Ga0157374_100274667 144
45 3300013297 Ga0157378_10417725 Ga0157378_104177252 144
46 3300014745 Ga0157377_10373619 Ga0157377_103736192 144
47 3300025229 Ga0209147_105356 Ga0209147_1053563 144
48 3300025273 Ga0209673_1002724 Ga0209673_100272417 144
49 3300025294 Ga0209025_1003543 Ga0209025_100354315 144
50 3300025294 Ga0209025_1009349 Ga0209025_10093496 144
51 3300025711 Ga0207696_1011155 Ga0207696_10111552 144
52 3300025711 Ga0207696_1031305 Ga0207696_10313052 144
53 3300025728 Ga0207655_1005646 Ga0207655_100564612 144
54 3300025728 Ga0207655_1013231 Ga0207655_10132312 144
55 3300025735 Ga0207713_1007454 Ga0207713_10074548 144
56 3300025735 Ga0207713_1046744 Ga0207713_10467442 144
57 3300046492 Ga0495585_0109441 Ga0495585_0109441_317_760 144
58 3300048903 Ga0496100_0061354 Ga0496100_0061354_1619_2062 144
59 3300048904 Ga0496101_0009157 Ga0496101_0009157_2335_2778 144
60 3300048905 Ga0496102_0890281 Ga0496102_0890281_225_668 144
61 3300048906 Ga0496103_0026678 Ga0496103_0026678_2187_2630 144
62 3300048907 Ga0496104_0005335 Ga0496104_0005335_8719_9162 144
63 3300048908 Ga0496105_0006672 Ga0496105_0006672_222_665 144
64 3300048910 Ga0496107_0006170 Ga0496107_0006170_7641_8084 144
65 3300048911 Ga0496108_0090157 Ga0496108_0090157_53_496 144
66 3300048912 Ga0496109_0017830 Ga0496109_0017830_2193_2636 144
67 3300048913 Ga0496110_0057248 Ga0496110_0057248_1619_2062 144
68 3300048914 Ga0496111_0002045 Ga0496111_0002045_2257_2700 144
69 3300048916 Ga0496113_0110664 Ga0496113_0110664_1370_1813 144
70 3300048917 Ga0496114_0241100 Ga0496114_0241100_729_1172 144
71 3300048919 Ga0496116_0013857 Ga0496116_0013857_2044_2487 144
72 3300048925 Ga0496122_0016389 Ga0496122_0016389_3878_4321 144
73 3300048928 Ga0496125_0042962 Ga0496125_0042962_2149_2592 144
74 3300048929 Ga0496126_0026032 Ga0496126_0026032_4950_5393 144
75 3300031548 Ga0307408_100281517 Ga0307408_1002815172 146
76 3300031852 Ga0307410_10117311 Ga0307410_101173112 146
77 3300031901 Ga0307406_10143048 Ga0307406_101430482 146
78 3300031903 Ga0307407_10216287 Ga0307407_102162872 146
79 3300032002 Ga0307416_102036845 Ga0307416_1020368451 146
80 3300032004 Ga0307414_10255086 Ga0307414_102550862 146
81 3300032005 Ga0307411_10014776 Ga0307411_100147762 146
82 iso_pu_bacteria 2558860280 2559431598 147
83 3300031548 Ga0307408_100885506 Ga0307408_1008855061 148
84 3300031731 Ga0307405_10700828 Ga0307405_107008281 148
85 3300031852 Ga0307410_10012162 Ga0307410_100121622 148
86 3300031901 Ga0307406_10033048 Ga0307406_100330482 148
87 3300032002 Ga0307416_101276032 Ga0307416_1012760321 148
88 3300032004 Ga0307414_10318250 Ga0307414_103182502 148
89 3300032005 Ga0307411_10005827 Ga0307411_100058272 148
90 3300032126 Ga0307415_100155593 Ga0307415_1001555932 148
91 3300046462 Ga0495651_0003251 Ga0495651_0003251_2338_2796 149
92 3300046516 Ga0495628_0301069 Ga0495628_0301069_579_1037 149
93 3300046529 Ga0495652_0002206 Ga0495652_0002206_3378_3836 149
94 3300046809 Ga0495600_0154713 Ga0495600_0154713_43_501 149
95 iso_pu_bacteria 2599185354 2600201360 149
96 iso_pu_bacteria 2751185897 2753764538 149
97 iso_pu_bacteria 2830075706 2830077851 149
98 iso_pu_bacteria 2885429604 2885430055 149
99 iso_pu_bacteria 2928027323 2928027916 149
100 iso_pu_bacteria 2946787523 2946788108 149
101 iso_pu_bacteria 2984555340 2984558708 149
102 iso_pu_bacteria 2984564862 2984566786 149
103 iso_pu_bacteria 2990265787 2990266621 149
104 iso_pu_bacteria 2993356040 2993357974 149
105 iso_pu_bacteria 2993693658 2993695580 149
106 3300009011 Ga0105251_10006102 Ga0105251_100061022 150
107 3300009101 Ga0105247_10087521 Ga0105247_100875212 150
108 3300014968 Ga0157379_10037286 Ga0157379_100372863 150
109 iso_pu_bacteria 2510917021 2511128434 150
110 iso_pu_bacteria 2513237087 2513590826 150
111 iso_pu_bacteria 2738541275 2738709836 150
112 iso_pu_bacteria 2738541301 2738848261 150
113 iso_pu_bacteria 2738541304 2738863990 150
114 iso_pu_bacteria 2738543022 2739296508 150
115 iso_pu_bacteria 2738543033 2739358186 150
116 iso_pu_bacteria 2739367664 2739650439 150
117 iso_pu_bacteria 2739367865 2740028912 150
118 iso_pu_bacteria 2818991438 2819553198 150
119 iso_pu_bacteria 2828305725 2828307001 150
120 iso_pu_bacteria 2896253425 2896256664 150
121 iso_pu_bacteria 2919138771 2919140035 150
122 iso_pu_bacteria 2919450847 2919454962 150
123 iso_pu_bacteria 2928100450 2928101384 150
124 iso_pu_bacteria 2928959182 2928960204 150
125 iso_pu_bacteria 3000865235 3000865411 150
126 iso_pu_bacteria 8001845381 8001849292 150
127 iso_pu_bacteria 8054302542 8054305669 150
128 3300001915 JGI24741J21665_1017119 JGI24741J21665_10171192 151
129 3300001989 JGI24739J22299_10003686 JGI24739J22299_100036863 151
130 3300002075 JGI24738J21930_10008464 JGI24738J21930_100084642 151
131 3300003911 JGI25405J52794_10001431 JGI25405J52794_100014314 151
132 3300005456 Ga0070678_101149545 Ga0070678_1011495451 151
133 3300005457 Ga0070662_100027322 Ga0070662_1000273222 151
134 3300005539 Ga0068853_100008448 Ga0068853_1000084486 151
135 3300005539 Ga0068853_100013171 Ga0068853_1000131714 151
136 3300005563 Ga0068855_100588600 Ga0068855_1005886002 151
137 3300005577 Ga0068857_100088803 Ga0068857_1000888033 151
138 3300005578 Ga0068854_100039497 Ga0068854_1000394973 151
139 3300005616 Ga0068852_100435229 Ga0068852_1004352292 151
140 3300005937 Ga0081455_10001124 Ga0081455_100011247 151
141 3300009551 Ga0105238_10058547 Ga0105238_100585472 151
142 3300009551 Ga0105238_10078333 Ga0105238_100783333 151
143 3300013297 Ga0157378_10065632 Ga0157378_100656323 151
144 3300025924 Ga0207694_10103465 Ga0207694_101034652 151
145 3300025933 Ga0207706_10009604 Ga0207706_100096045 151
146 3300025981 Ga0207640_11080116 Ga0207640_110801162 151
147 3300026041 Ga0207639_10007855 Ga0207639_100078555 151
148 3300026041 Ga0207639_10916894 Ga0207639_109168942 151
149 3300026116 Ga0207674_10019205 Ga0207674_100192055 151
150 3300026142 Ga0207698_10273943 Ga0207698_102739432 151
151 3300031548 Ga0307408_100316845 Ga0307408_1003168452 151
152 3300031731 Ga0307405_10236709 Ga0307405_102367091 151
153 3300031911 Ga0307412_10173219 Ga0307412_101732192 151
154 3300044656 Ga0466969_0002301 Ga0466969_0002301_7899_8369 151
155 3300044656 Ga0466969_0009087 Ga0466969_0009087_3792_4262 151
156 3300044684 Ga0466966_0004002 Ga0466966_0004002_3370_3840 151
157 3300044693 Ga0466961_0044870 Ga0466961_0044870_750_1220 151
158 3300044765 Ga0466970_0031996 Ga0466970_0031996_33_503 151
159 3300045049 Ga0466959_0001964 Ga0466959_0001964_9072_9542 151
160 3300046476 Ga0495662_0223583 Ga0495662_0223583_23_484 151
161 3300046499 Ga0495594_0390088 Ga0495594_0390088_54_515 151
162 3300046525 Ga0495663_0065775 Ga0495663_0065775_217_675 151
163 3300046530 Ga0495654_0000374 Ga0495654_0000374_931_1389 151
164 3300046616 Ga0495668_0006149 Ga0495668_0006149_3479_3937 151
165 3300046679 Ga0495623_0173384 Ga0495623_0173384_645_1106 151
166 3300047317 Ga0495604_0007438 Ga0495604_0007438_4679_5140 151
167 3300047444 Ga0495675_0012675 Ga0495675_0012675_4488_4949 151
168 3300047447 Ga0495685_116284 Ga0495685_116284_279_737 151
169 3300048921 Ga0496118_0084791 Ga0496118_0084791_223_684 151
170 3300049459 Ga0495678_026512 Ga0495678_026512_816_1274 151
171 3300053116 Ga0500592_013611 Ga0500592_013611_311_769 151
172 3300053116 Ga0500592_051448 Ga0500592_051448_76_534 151
173 3300053139 Ga0500568_0036903 Ga0500568_0036903_973_1431 151
174 3300053151 Ga0500604_0030279 Ga0500604_0030279_513_971 151
175 3300053158 Ga0500627_0000231 Ga0500627_0000231_659_1117 151
176 3300061719 Ga0466962_0018926 Ga0466962_0018926_1997_2467 151
177 3300001432 JGI24034J14986_101037 JGI24034J14986_1010372 152
178 3300001976 JGI24752J21851_1000036 JGI24752J21851_100003613 152
179 3300002070 JGI24750J21931_1000424 JGI24750J21931_10004245 152
180 3300002074 JGI24748J21848_1000029 JGI24748J21848_100002943 152
181 3300002239 JGI24034J26672_10000006 JGI24034J26672_10000006190 152
182 3300002244 JGI24742J22300_10002270 JGI24742J22300_100022702 152
183 3300005330 Ga0070690_100000002 Ga0070690_100000002163 152
184 3300005335 Ga0070666_10000014 Ga0070666_1000001424 152
185 3300005340 Ga0070689_100033303 Ga0070689_1000333032 152
186 3300005347 Ga0070668_100043654 Ga0070668_1000436541 152
187 3300005353 Ga0070669_100000839 Ga0070669_1000008392 152
188 3300005365 Ga0070688_100019885 Ga0070688_1000198852 152
189 3300005367 Ga0070667_100012128 Ga0070667_1000121282 152
190 3300005466 Ga0070685_10000056 Ga0070685_1000005624 152
191 3300005544 Ga0070686_100000002 Ga0070686_100000002143 152
192 3300005548 Ga0070665_100000025 Ga0070665_100000025192 152
193 3300005549 Ga0070704_100406164 Ga0070704_1004061642 152
194 3300005618 Ga0068864_100022037 Ga0068864_1000220372 152
195 3300005719 Ga0068861_100004572 Ga0068861_1000045725 152
196 3300005841 Ga0068863_100000070 Ga0068863_10000007033 152
197 3300005842 Ga0068858_100003260 Ga0068858_1000032604 152
198 3300005843 Ga0068860_100000001 Ga0068860_100000001532 152
199 3300005844 Ga0068862_100000020 Ga0068862_100000020223 152
200 3300009011 Ga0105251_10052664 Ga0105251_100526642 152
201 3300009092 Ga0105250_10189082 Ga0105250_101890821 152
202 3300009551 Ga0105238_11443078 Ga0105238_114430781 152
203 3300009553 Ga0105249_10000005 Ga0105249_10000005210 152
204 3300013306 Ga0163162_10097636 Ga0163162_100976362 152
205 3300014968 Ga0157379_10083251 Ga0157379_100832512 152
206 3300017792 Ga0163161_10000115 Ga0163161_1000011542 152
207 3300025903 Ga0207680_10000004 Ga0207680_10000004337 152
208 3300025923 Ga0207681_10000130 Ga0207681_1000013015 152
209 3300025925 Ga0207650_10057847 Ga0207650_100578473 152
210 3300025931 Ga0207644_10006799 Ga0207644_100067998 152
211 3300025936 Ga0207670_10039261 Ga0207670_100392612 152
212 3300025961 Ga0207712_10000001 Ga0207712_10000001211 152
213 3300025972 Ga0207668_10032021 Ga0207668_100320212 152
214 3300025986 Ga0207658_10001207 Ga0207658_1000120714 152
215 3300026035 Ga0207703_10001460 Ga0207703_100014602 152
216 3300026088 Ga0207641_10000033 Ga0207641_10000033143 152
217 3300026095 Ga0207676_10337223 Ga0207676_103372232 152
218 3300026118 Ga0207675_100004034 Ga0207675_1000040348 152
219 3300028379 Ga0268266_10000028 Ga0268266_10000028194 152
220 3300028380 Ga0268265_10000071 Ga0268265_1000007142 152
221 3300028381 Ga0268264_10000006 Ga0268264_10000006337 152
222 3300039450 Ga0436363_0349297 Ga0436363_0349297_357_821 152
223 3300048903 Ga0496100_0801751 Ga0496100_0801751_34_498 152
224 3300048909 Ga0496106_0664981 Ga0496106_0664981_292_756 152
225 3300053131 Ga0500652_004515 Ga0500652_004515_361_861 152
226 iso_pu_bacteria 2643221560 2643823345 152
227 iso_pu_bacteria 2852653556 2852655249 152
228 iso_pu_bacteria 2852680915 2852681181 152
229 2162886007 SwRhRL2b_contig_3219086 SwRhRL2b_0452.00008210 153
230 3300001904 JGI24736J21556_1000031 JGI24736J21556_100003117 153
231 3300001979 JGI24740J21852_10007875 JGI24740J21852_100078753 153
232 3300001989 JGI24739J22299_10017629 JGI24739J22299_100176292 153
233 3300001990 JGI24737J22298_10007725 JGI24737J22298_100077252 153
234 3300002773 JGI25152J39213_1025184 JGI25152J39213_10251842 153
235 3300002774 JGI25150J39212_1000020 JGI25150J39212_100002096 153
236 3300003214 JGI25165J46597_1000053 JGI25165J46597_1000053177 153
237 3300003215 JGI25153J46596_10000017 JGI25153J46596_10000017120 153
238 3300003781 Ga0055536_1010951 Ga0055536_10109513 153
239 3300003791 Ga0055530_10010511 Ga0055530_100105112 153
240 3300003792 Ga0055540_1009149 Ga0055540_10091492 153
241 3300005289 Ga0065704_10143789 Ga0065704_101437892 153
242 3300005295 Ga0065707_10111706 Ga0065707_101117062 153
243 3300005331 Ga0070670_100000168 Ga0070670_10000016831 153
244 3300005334 Ga0068869_100132712 Ga0068869_1001327122 153
245 3300005337 Ga0070682_100276235 Ga0070682_1002762352 153
246 3300005337 Ga0070682_101065597 Ga0070682_1010655971 153
247 3300005339 Ga0070660_100194506 Ga0070660_1001945062 153
248 3300005347 Ga0070668_100335559 Ga0070668_1003355591 153
249 3300005367 Ga0070667_100000290 Ga0070667_10000029065 153
250 3300005367 Ga0070667_100001767 Ga0070667_1000017678 153
251 3300005457 Ga0070662_100134929 Ga0070662_1001349292 153
252 3300005539 Ga0068853_100243348 Ga0068853_1002433481 153
253 3300005539 Ga0068853_100428357 Ga0068853_1004283572 153
254 3300005539 Ga0068853_100963837 Ga0068853_1009638371 153
255 3300005564 Ga0070664_100240706 Ga0070664_1002407062 153
256 3300005577 Ga0068857_100195436 Ga0068857_1001954361 153
257 3300005577 Ga0068857_100229812 Ga0068857_1002298121 153
258 3300005616 Ga0068852_100023139 Ga0068852_1000231392 153
259 3300005616 Ga0068852_100803667 Ga0068852_1008036671 153
260 3300005617 Ga0068859_100061439 Ga0068859_1000614392 153
261 3300005618 Ga0068864_100000063 Ga0068864_100000063106 153
262 3300005618 Ga0068864_100004504 Ga0068864_1000045045 153
263 3300005618 Ga0068864_100693797 Ga0068864_1006937971 153
264 3300005719 Ga0068861_101246335 Ga0068861_1012463352 153
265 3300005841 Ga0068863_100000062 Ga0068863_100000062106 153
266 3300005841 Ga0068863_100080373 Ga0068863_1000803732 153
267 3300005842 Ga0068858_100000313 Ga0068858_10000031316 153
268 3300005842 Ga0068858_100002369 Ga0068858_1000023693 153
269 3300005842 Ga0068858_100353831 Ga0068858_1003538311 153
270 3300005844 Ga0068862_100000069 Ga0068862_100000069110 153
271 3300006051 Ga0075364_10611915 Ga0075364_106119151 153
272 3300006931 Ga0097620_100061439 Ga0097620_1000614392 153
273 3300009177 Ga0105248_10000284 Ga0105248_1000028436 153
274 3300009551 Ga0105238_10435814 Ga0105238_104358141 153
275 3300009553 Ga0105249_10000160 Ga0105249_100001605 153
276 3300009553 Ga0105249_11242858 Ga0105249_112428582 153
277 3300011119 Ga0105246_10803155 Ga0105246_108031551 153
278 3300013105 Ga0157369_10031914 Ga0157369_100319146 153
279 3300013306 Ga0163162_10030993 Ga0163162_100309933 153
280 3300013306 Ga0163162_10040293 Ga0163162_100402935 153
281 3300013306 Ga0163162_10371029 Ga0163162_103710291 153
282 3300013307 Ga0157372_10124496 Ga0157372_101244963 153
283 3300014325 Ga0163163_10094960 Ga0163163_100949603 153
284 3300017792 Ga0163161_10626923 Ga0163161_106269231 153
285 3300017792 Ga0163161_11072191 Ga0163161_110721911 153
286 3300025233 Ga0209437_105443 Ga0209437_1054431 153
287 3300025245 Ga0207425_1000022 Ga0207425_1000022168 153
288 3300025258 Ga0209129_1001473 Ga0209129_10014739 153
289 3300025261 Ga0209233_1000119 Ga0209233_100011957 153
290 3300025272 Ga0209455_1013376 Ga0209455_10133762 153
291 3300025294 Ga0209025_1000842 Ga0209025_10008422 153
292 3300025297 Ga0209758_1000004 Ga0209758_1000004795 153
293 3300025298 Ga0209050_1000001 Ga0209050_10000012814 153
294 3300025303 Ga0209051_1000246 Ga0209051_100024614 153
295 3300025315 Ga0207697_10106721 Ga0207697_101067212 153
296 3300025735 Ga0207713_1014855 Ga0207713_10148552 153
297 3300025900 Ga0207710_10044681 Ga0207710_100446812 153
298 3300025904 Ga0207647_10000555 Ga0207647_1000055521 153
299 3300025911 Ga0207654_10004092 Ga0207654_100040924 153
300 3300025911 Ga0207654_10393046 Ga0207654_103930462 153
301 3300025913 Ga0207695_10003879 Ga0207695_1000387913 153
302 3300025914 Ga0207671_10001983 Ga0207671_1000198314 153
303 3300025924 Ga0207694_10005262 Ga0207694_100052625 153
304 3300025924 Ga0207694_10007000 Ga0207694_100070004 153
305 3300025924 Ga0207694_10534438 Ga0207694_105344382 153
306 3300025925 Ga0207650_10000142 Ga0207650_1000014283 153
307 3300025927 Ga0207687_10000259 Ga0207687_100002594 153
308 3300025933 Ga0207706_10095537 Ga0207706_100955372 153
309 3300025935 Ga0207709_10314763 Ga0207709_103147631 153
310 3300025941 Ga0207711_10000017 Ga0207711_10000017376 153
311 3300025942 Ga0207689_10117467 Ga0207689_101174672 153
312 3300025949 Ga0207667_10016664 Ga0207667_100166646 153
313 3300025961 Ga0207712_10000527 Ga0207712_100005276 153
314 3300025981 Ga0207640_10014152 Ga0207640_100141525 153
315 3300025981 Ga0207640_10105323 Ga0207640_101053231 153
316 3300025986 Ga0207658_10000133 Ga0207658_1000013384 153
317 3300026023 Ga0207677_11453050 Ga0207677_114530501 153
318 3300026035 Ga0207703_10000961 Ga0207703_1000096116 153
319 3300026035 Ga0207703_10002071 Ga0207703_100020719 153
320 3300026035 Ga0207703_10325827 Ga0207703_103258271 153
321 3300026041 Ga0207639_10111311 Ga0207639_101113112 153
322 3300026041 Ga0207639_10184052 Ga0207639_101840522 153
323 3300026067 Ga0207678_10028298 Ga0207678_100282984 153
324 3300026078 Ga0207702_10139976 Ga0207702_101399762 153
325 3300026088 Ga0207641_10000022 Ga0207641_10000022121 153
326 3300026095 Ga0207676_10000056 Ga0207676_1000005636 153
327 3300026095 Ga0207676_10011444 Ga0207676_100114447 153
328 3300026095 Ga0207676_11395351 Ga0207676_113953511 153
329 3300026116 Ga0207674_10045037 Ga0207674_100450373 153
330 3300026116 Ga0207674_10073006 Ga0207674_100730063 153
331 3300026118 Ga0207675_101291922 Ga0207675_1012919221 153
332 3300026142 Ga0207698_10025403 Ga0207698_100254031 153
333 3300028380 Ga0268265_10000044 Ga0268265_10000044104 153
334 3300031456 Ga0307513_10097855 Ga0307513_100978553 153
335 3300031507 Ga0307509_10068266 Ga0307509_100682663 153
336 3300031616 Ga0307508_10000858 Ga0307508_1000085814 153
337 3300031911 Ga0307412_10397806 Ga0307412_103978062 153
338 3300033180 Ga0307510_10065943 Ga0307510_100659432 153
339 3300037418 Ga0395900_0007717 Ga0395900_0007717_5238_5741 153
340 3300037418 Ga0395900_0287508 Ga0395900_0287508_317_820 153
341 3300037418 Ga0395900_0647893 Ga0395900_0647893_164_667 153
342 3300037466 Ga0395898_0023846 Ga0395898_0023846_2396_2899 153
343 3300037853 Ga0436364_0420330 Ga0436364_0420330_379_846 153
344 3300038443 Ga0395901_0008908 Ga0395901_0008908_2528_3031 153
345 3300038443 Ga0395901_0042433 Ga0395901_0042433_1023_1526 153
346 3300041451 Ga0451791_1703147 Ga0451791_1703147_24_494 153
347 3300041452 Ga0451793_1141815 Ga0451793_1141815_22_489 153
348 3300041452 Ga0451793_1456958 Ga0451793_1456958_42_509 153
349 3300041486 Ga0451807_1257146 Ga0451807_1257146_395_859 153
350 3300045051 Ga0451576_0000007 Ga0451576_0000007_578371_578832 153
351 3300046460 Ga0495638_0001382 Ga0495638_0001382_15816_16283 153
352 3300046492 Ga0495585_0123344 Ga0495585_0123344_249_716 153
353 3300046506 Ga0495583_0013765 Ga0495583_0013765_3742_4209 153
354 3300046524 Ga0495648_0067804 Ga0495648_0067804_1373_1840 153
355 3300046524 Ga0495648_0087932 Ga0495648_0087932_143_610 153
356 3300046524 Ga0495648_0104429 Ga0495648_0104429_12_479 153
357 3300046616 Ga0495668_0092432 Ga0495668_0092432_340_807 153
358 3300046660 Ga0495625_0000064 Ga0495625_0000064_22221_22688 153
359 3300046691 Ga0495670_0058817 Ga0495670_0058817_561_1028 153
360 3300046691 Ga0495670_0157714 Ga0495670_0157714_219_686 153
361 3300047472 Ga0495686_0027507 Ga0495686_0027507_2819_3286 153
362 3300047472 Ga0495686_0048172 Ga0495686_0048172_987_1454 153
363 3300048904 Ga0496101_0203804 Ga0496101_0203804_639_1109 153
364 3300048906 Ga0496103_0035486 Ga0496103_0035486_332_802 153
365 3300048921 Ga0496118_0003648 Ga0496118_0003648_4808_5278 153
366 3300049579 Ga0501043_1161883 Ga0501043_1161883_24_485 153
367 3300053087 Ga0500643_004834 Ga0500643_004834_3477_3944 153
368 3300053093 Ga0500651_0176403 Ga0500651_0176403_113_580 153
369 3300053108 Ga0500562_048940 Ga0500562_048940_468_935 153
370 3300053119 Ga0500595_000472 Ga0500595_000472_15266_15730 153
371 3300053131 Ga0500652_119944 Ga0500652_119944_583_1050 153
372 3300053131 Ga0500652_254584 Ga0500652_254584_179_646 153
373 3300053134 Ga0500658_0001199 Ga0500658_0001199_5108_5575 153
374 3300053136 Ga0500559_0010186 Ga0500559_0010186_235_702 153
375 3300053136 Ga0500559_0016106 Ga0500559_0016106_2229_2693 153
376 3300053136 Ga0500559_0098195 Ga0500559_0098195_119_583 153
377 3300053139 Ga0500568_0097327 Ga0500568_0097327_271_738 153
378 3300053139 Ga0500568_0184394 Ga0500568_0184394_278_739 153
379 3300053140 Ga0500573_0000082 Ga0500573_0000082_36041_36505 153
380 3300053153 Ga0500616_0015221 Ga0500616_0015221_637_1104 153
381 3300053730 Ga0500645_029629 Ga0500645_029629_481_948 153
382 iso_pu_bacteria 2643221563 2643835689 153
383 iso_pu_bacteria 2643221601 2644019783 153
384 iso_pu_bacteria 2643221608 2644056615 153
385 iso_pu_bacteria 2643221631 2644180327 153
386 2162886007 SwRhRL2b_contig_2638822 SwRhRL2b_0808.00004470 154
387 2162886007 SwRhRL2b_contig_3748734 SwRhRL2b_0199.00005000 154
388 3300002074 JGI24748J21848_1010040 JGI24748J21848_10100402 154
389 3300002239 JGI24034J26672_10010366 JGI24034J26672_100103662 154
390 3300003781 Ga0055536_1001565 Ga0055536_10015657 154
391 3300003784 Ga0055534_1017663 Ga0055534_10176632 154
392 3300003791 Ga0055530_10000095 Ga0055530_1000009534 154
393 3300003794 Ga0055531_10001802 Ga0055531_100018027 154
394 3300005289 Ga0065704_10003249 Ga0065704_100032493 154
395 3300005289 Ga0065704_10145587 Ga0065704_101455871 154
396 3300005289 Ga0065704_10316801 Ga0065704_103168012 154
397 3300005295 Ga0065707_10090604 Ga0065707_100906042 154
398 3300005295 Ga0065707_10154342 Ga0065707_101543422 154
399 3300005327 Ga0070658_10000371 Ga0070658_100003712 154
400 3300005327 Ga0070658_10012881 Ga0070658_100128817 154
401 3300005327 Ga0070658_10051560 Ga0070658_100515602 154
402 3300005327 Ga0070658_10071384 Ga0070658_100713842 154
403 3300005327 Ga0070658_10212206 Ga0070658_102122062 154
404 3300005329 Ga0070683_100006345 Ga0070683_1000063459 154
405 3300005329 Ga0070683_100453623 Ga0070683_1004536232 154
406 3300005331 Ga0070670_100155116 Ga0070670_1001551162 154
407 3300005339 Ga0070660_100002018 Ga0070660_1000020185 154
408 3300005339 Ga0070660_100218824 Ga0070660_1002188242 154
409 3300005341 Ga0070691_10208696 Ga0070691_102086961 154
410 3300005343 Ga0070687_100190789 Ga0070687_1001907892 154
411 3300005344 Ga0070661_100020845 Ga0070661_1000208456 154
412 3300005345 Ga0070692_10068259 Ga0070692_100682592 154
413 3300005347 Ga0070668_100016256 Ga0070668_1000162563 154
414 3300005353 Ga0070669_100000184 Ga0070669_10000018427 154
415 3300005353 Ga0070669_100080190 Ga0070669_1000801901 154
416 3300005355 Ga0070671_100004299 Ga0070671_1000042998 154
417 3300005355 Ga0070671_100255540 Ga0070671_1002555401 154
418 3300005355 Ga0070671_100473123 Ga0070671_1004731232 154
419 3300005366 Ga0070659_100003327 Ga0070659_1000033273 154
420 3300005366 Ga0070659_100178489 Ga0070659_1001784892 154
421 3300005367 Ga0070667_100000472 Ga0070667_10000047226 154
422 3300005367 Ga0070667_100035034 Ga0070667_1000350343 154
423 3300005445 Ga0070708_100629496 Ga0070708_1006294961 154
424 3300005455 Ga0070663_100247240 Ga0070663_1002472401 154
425 3300005457 Ga0070662_100000992 Ga0070662_10000099214 154
426 3300005458 Ga0070681_10058148 Ga0070681_100581482 154
427 3300005467 Ga0070706_100430942 Ga0070706_1004309421 154
428 3300005530 Ga0070679_100030942 Ga0070679_1000309423 154
429 3300005530 Ga0070679_100031798 Ga0070679_1000317985 154
430 3300005530 Ga0070679_100049007 Ga0070679_1000490072 154
431 3300005530 Ga0070679_100152916 Ga0070679_1001529162 154
432 3300005535 Ga0070684_101156365 Ga0070684_1011563651 154
433 3300005539 Ga0068853_100012276 Ga0068853_1000122761 154
434 3300005539 Ga0068853_100311825 Ga0068853_1003118251 154
435 3300005548 Ga0070665_100045652 Ga0070665_1000456522 154
436 3300005563 Ga0068855_100046850 Ga0068855_1000468503 154
437 3300005563 Ga0068855_100253307 Ga0068855_1002533073 154
438 3300005563 Ga0068855_100289651 Ga0068855_1002896512 154
439 3300005563 Ga0068855_100648909 Ga0068855_1006489092 154
440 3300005563 Ga0068855_101412377 Ga0068855_1014123771 154
441 3300005564 Ga0070664_100010887 Ga0070664_1000108878 154
442 3300005577 Ga0068857_100179407 Ga0068857_1001794071 154
443 3300005577 Ga0068857_100233204 Ga0068857_1002332041 154
444 3300005577 Ga0068857_100859217 Ga0068857_1008592172 154
445 3300005578 Ga0068854_100004727 Ga0068854_1000047272 154
446 3300005578 Ga0068854_100361610 Ga0068854_1003616101 154
447 3300005578 Ga0068854_100607981 Ga0068854_1006079811 154
448 3300005614 Ga0068856_100001125 Ga0068856_1000011256 154
449 3300005614 Ga0068856_100011802 Ga0068856_1000118024 154
450 3300005614 Ga0068856_100132888 Ga0068856_1001328882 154
451 3300005616 Ga0068852_100000083 Ga0068852_10000008348 154
452 3300005616 Ga0068852_100028520 Ga0068852_1000285203 154
453 3300005616 Ga0068852_100266764 Ga0068852_1002667642 154
454 3300005616 Ga0068852_100973101 Ga0068852_1009731011 154
455 3300005618 Ga0068864_100745331 Ga0068864_1007453311 154
456 3300005834 Ga0068851_10183942 Ga0068851_101839422 154
457 3300005842 Ga0068858_101165476 Ga0068858_1011654762 154
458 3300005843 Ga0068860_100011780 Ga0068860_1000117809 154
459 3300005844 Ga0068862_100081269 Ga0068862_1000812691 154
460 3300006038 Ga0075365_10067981 Ga0075365_100679815 154
461 3300006042 Ga0075368_10000199 Ga0075368_100001992 154
462 3300006042 Ga0075368_10092963 Ga0075368_100929632 154
463 3300006048 Ga0075363_100009342 Ga0075363_1000093425 154
464 3300006048 Ga0075363_100017436 Ga0075363_1000174363 154
465 3300006051 Ga0075364_10002598 Ga0075364_100025984 154
466 3300006051 Ga0075364_10151087 Ga0075364_101510871 154
467 3300006177 Ga0075362_10000041 Ga0075362_1000004116 154
468 3300006177 Ga0075362_10046036 Ga0075362_100460362 154
469 3300006178 Ga0075367_10022138 Ga0075367_100221383 154
470 3300006178 Ga0075367_10648801 Ga0075367_106488012 154
471 3300006186 Ga0075369_10000994 Ga0075369_1000099410 154
472 3300006186 Ga0075369_10120093 Ga0075369_101200931 154
473 3300006195 Ga0075366_10000150 Ga0075366_1000015026 154
474 3300006195 Ga0075366_10028344 Ga0075366_100283445 154
475 3300006195 Ga0075366_10217878 Ga0075366_102178782 154
476 3300006195 Ga0075366_10436965 Ga0075366_104369651 154
477 3300006353 Ga0075370_10000003 Ga0075370_10000003105 154
478 3300006353 Ga0075370_10018925 Ga0075370_100189252 154
479 3300006353 Ga0075370_10033548 Ga0075370_100335485 154
480 3300006353 Ga0075370_10036616 Ga0075370_100366164 154
481 3300006353 Ga0075370_10093820 Ga0075370_100938202 154
482 3300006353 Ga0075370_10158613 Ga0075370_101586131 154
483 3300006353 Ga0075370_10502340 Ga0075370_105023401 154
484 3300006946 Ga0079104_1027201 Ga0079104_10272012 154
485 3300009092 Ga0105250_10142772 Ga0105250_101427721 154
486 3300009093 Ga0105240_10029936 Ga0105240_1002993610 154
487 3300009101 Ga0105247_10056551 Ga0105247_100565512 154
488 3300009148 Ga0105243_10114789 Ga0105243_101147893 154
489 3300009174 Ga0105241_10130650 Ga0105241_101306503 154
490 3300009177 Ga0105248_10048387 Ga0105248_100483873 154
491 3300009177 Ga0105248_10157534 Ga0105248_101575341 154
492 3300009545 Ga0105237_10788457 Ga0105237_107884572 154
493 3300009551 Ga0105238_10121889 Ga0105238_101218892 154
494 3300009551 Ga0105238_11605734 Ga0105238_116057342 154
495 3300009553 Ga0105249_10136026 Ga0105249_101360263 154
496 3300013100 Ga0157373_10053241 Ga0157373_100532413 154
497 3300013100 Ga0157373_10116318 Ga0157373_101163183 154
498 3300013102 Ga0157371_10001947 Ga0157371_1000194714 154
499 3300013102 Ga0157371_10171692 Ga0157371_101716922 154
500 3300013102 Ga0157371_10444426 Ga0157371_104444262 154
501 3300013104 Ga0157370_10010227 Ga0157370_100102277 154
502 3300013104 Ga0157370_10583082 Ga0157370_105830822 154
503 3300013104 Ga0157370_10989143 Ga0157370_109891432 154
504 3300013105 Ga0157369_10000968 Ga0157369_1000096813 154
505 3300013306 Ga0163162_10641933 Ga0163162_106419332 154
506 3300013307 Ga0157372_10001238 Ga0157372_1000123810 154
507 3300013307 Ga0157372_10356831 Ga0157372_103568312 154
508 3300013308 Ga0157375_10748286 Ga0157375_107482861 154
509 3300025291 Ga0209675_1000025 Ga0209675_100002593 154
510 3300025292 Ga0209676_1000198 Ga0209676_100019887 154
511 3300025292 Ga0209676_1000362 Ga0209676_100036234 154
512 3300025294 Ga0209025_1008600 Ga0209025_10086007 154
513 3300025298 Ga0209050_1000367 Ga0209050_100036748 154
514 3300025298 Ga0209050_1000728 Ga0209050_100072810 154
515 3300025298 Ga0209050_1011865 Ga0209050_10118652 154
516 3300025304 Ga0209257_1000596 Ga0209257_100059624 154
517 3300025321 Ga0207656_10160934 Ga0207656_101609342 154
518 3300025711 Ga0207696_1004520 Ga0207696_10045203 154
519 3300025735 Ga0207713_1010725 Ga0207713_10107251 154
520 3300025900 Ga0207710_10137611 Ga0207710_101376111 154
521 3300025903 Ga0207680_10210525 Ga0207680_102105252 154
522 3300025904 Ga0207647_10069787 Ga0207647_100697872 154
523 3300025909 Ga0207705_10000004 Ga0207705_1000000464 154
524 3300025909 Ga0207705_10026510 Ga0207705_100265102 154
525 3300025909 Ga0207705_10063556 Ga0207705_100635562 154
526 3300025909 Ga0207705_10268542 Ga0207705_102685423 154
527 3300025910 Ga0207684_10760646 Ga0207684_107606461 154
528 3300025912 Ga0207707_10051378 Ga0207707_100513783 154
529 3300025913 Ga0207695_10012208 Ga0207695_100122084 154
530 3300025917 Ga0207660_10131387 Ga0207660_101313873 154
531 3300025919 Ga0207657_10001614 Ga0207657_1000161423 154
532 3300025919 Ga0207657_10037866 Ga0207657_100378666 154
533 3300025920 Ga0207649_10026472 Ga0207649_100264722 154
534 3300025921 Ga0207652_10018883 Ga0207652_100188834 154
535 3300025921 Ga0207652_10021249 Ga0207652_100212496 154
536 3300025921 Ga0207652_10056452 Ga0207652_100564526 154
537 3300025923 Ga0207681_10000140 Ga0207681_1000014035 154
538 3300025923 Ga0207681_10511467 Ga0207681_105114671 154
539 3300025923 Ga0207681_10792267 Ga0207681_107922671 154
540 3300025924 Ga0207694_10046380 Ga0207694_100463804 154
541 3300025925 Ga0207650_10354042 Ga0207650_103540421 154
542 3300025931 Ga0207644_10000811 Ga0207644_1000081114 154
543 3300025931 Ga0207644_10325543 Ga0207644_103255432 154
544 3300025931 Ga0207644_10851638 Ga0207644_108516381 154
545 3300025932 Ga0207690_10000894 Ga0207690_1000089410 154
546 3300025933 Ga0207706_10000035 Ga0207706_100000356 154
547 3300025935 Ga0207709_10429189 Ga0207709_104291892 154
548 3300025941 Ga0207711_10071888 Ga0207711_100718883 154
549 3300025941 Ga0207711_10202664 Ga0207711_102026641 154
550 3300025944 Ga0207661_10132887 Ga0207661_101328873 154
551 3300025944 Ga0207661_10170932 Ga0207661_101709323 154
552 3300025945 Ga0207679_10070830 Ga0207679_100708302 154
553 3300025949 Ga0207667_10056319 Ga0207667_100563193 154
554 3300025949 Ga0207667_10090978 Ga0207667_100909781 154
555 3300025949 Ga0207667_10093031 Ga0207667_100930313 154
556 3300025949 Ga0207667_10392664 Ga0207667_103926642 154
557 3300025949 Ga0207667_11041425 Ga0207667_110414251 154
558 3300025961 Ga0207712_10189723 Ga0207712_101897232 154
559 3300025972 Ga0207668_10006786 Ga0207668_100067863 154
560 3300025972 Ga0207668_10048371 Ga0207668_100483714 154
561 3300025981 Ga0207640_10001101 Ga0207640_1000110111 154
562 3300025981 Ga0207640_10015711 Ga0207640_100157112 154
563 3300025981 Ga0207640_10528614 Ga0207640_105286142 154
564 3300025981 Ga0207640_11259434 Ga0207640_112594341 154
565 3300025986 Ga0207658_10001257 Ga0207658_1000125717 154
566 3300025986 Ga0207658_10053887 Ga0207658_100538873 154
567 3300026035 Ga0207703_10025076 Ga0207703_100250763 154
568 3300026041 Ga0207639_10001012 Ga0207639_1000101210 154
569 3300026041 Ga0207639_10538988 Ga0207639_105389883 154
570 3300026067 Ga0207678_10106424 Ga0207678_101064242 154
571 3300026078 Ga0207702_10043320 Ga0207702_100433204 154
572 3300026116 Ga0207674_10023877 Ga0207674_100238775 154
573 3300026116 Ga0207674_10128780 Ga0207674_101287803 154
574 3300026116 Ga0207674_10187178 Ga0207674_101871781 154
575 3300026116 Ga0207674_10315125 Ga0207674_103151254 154
576 3300026142 Ga0207698_10000789 Ga0207698_100007898 154
577 3300026142 Ga0207698_10041250 Ga0207698_100412502 154
578 3300027552 Ga0209982_1070845 Ga0209982_10708451 154
579 3300027866 Ga0209813_10000065 Ga0209813_100000656 154
580 3300027866 Ga0209813_10070003 Ga0209813_100700032 154
581 3300027876 Ga0209974_10014350 Ga0209974_100143502 154
582 3300027876 Ga0209974_10065284 Ga0209974_100652841 154
583 3300028379 Ga0268266_10027588 Ga0268266_100275885 154
584 3300028380 Ga0268265_10319921 Ga0268265_103199211 154
585 3300028381 Ga0268264_10021239 Ga0268264_100212394 154
586 3300031250 Ga0265331_10133611 Ga0265331_101336112 154
587 3300031665 Ga0316575_10167435 Ga0316575_101674352 154
588 3300031824 Ga0307413_10555867 Ga0307413_105558671 154
589 3300031901 Ga0307406_10234405 Ga0307406_102344051 154
590 3300031911 Ga0307412_10005487 Ga0307412_100054874 154
591 3300031911 Ga0307412_10247951 Ga0307412_102479511 154
592 3300032004 Ga0307414_10000918 Ga0307414_100009184 154
593 3300032004 Ga0307414_10011317 Ga0307414_100113172 154
594 3300032004 Ga0307414_10025158 Ga0307414_100251582 154
595 3300032004 Ga0307414_10202579 Ga0307414_102025792 154
596 3300032004 Ga0307414_10221998 Ga0307414_102219982 154
597 3300032004 Ga0307414_10280158 Ga0307414_102801582 154
598 3300032004 Ga0307414_11194778 Ga0307414_111947781 154
599 3300032005 Ga0307411_10081670 Ga0307411_100816702 154
600 3300035112 Ga0373932_0075523 Ga0373932_0075523_86_550 154
601 3300036647 Ga0316582_0163214 Ga0316582_0163214_384_848 154
602 3300036647 Ga0316582_0233726 Ga0316582_0233726_377_841 154
603 3300036712 Ga0316584_0144004 Ga0316584_0144004_312_776 154
604 3300036712 Ga0316584_0200377 Ga0316584_0200377_933_1397 154
605 3300037588 Ga0316581_0041398 Ga0316581_0041398_304_768 154
606 3300041491 Ga0451833_0856020 Ga0451833_0856020_161_625 154
607 3300041494 Ga0451837_0749401 Ga0451837_0749401_258_722 154
608 3300041496 Ga0451839_1354034 Ga0451839_1354034_111_575 154
609 3300041498 Ga0451841_0840733 Ga0451841_0840733_530_1009 154
610 3300041512 Ga0451853_0254844 Ga0451853_0254844_202_666 154
611 3300044712 Ga0453684_0353812 Ga0453684_0353812_497_961 154
612 3300044712 Ga0453684_0478380 Ga0453684_0478380_477_941 154
613 3300046453 Ga0495627_000158 Ga0495627_000158_16434_16898 154
614 3300046460 Ga0495638_0245109 Ga0495638_0245109_171_635 154
615 3300046471 Ga0495650_0000831 Ga0495650_0000831_20093_20557 154
616 3300046500 Ga0495596_0000539 Ga0495596_0000539_6689_7153 154
617 3300046501 Ga0495607_0021094 Ga0495607_0021094_2690_3154 154
618 3300046501 Ga0495607_0382615 Ga0495607_0382615_115_579 154
619 3300046506 Ga0495583_0012555 Ga0495583_0012555_3848_4312 154
620 3300046507 Ga0495606_0003910 Ga0495606_0003910_2900_3379 154
621 3300046507 Ga0495606_0083175 Ga0495606_0083175_13_477 154
622 3300046512 Ga0495610_0000020 Ga0495610_0000020_273030_273494 154
623 3300046515 Ga0495620_0009442 Ga0495620_0009442_3699_4163 154
624 3300046519 Ga0495632_0001745 Ga0495632_0001745_11399_11863 154
625 3300046519 Ga0495632_0071947 Ga0495632_0071947_362_826 154
626 3300046522 Ga0495643_0007169 Ga0495643_0007169_4282_4746 154
627 3300046522 Ga0495643_0009816 Ga0495643_0009816_2267_2731 154
628 3300046522 Ga0495643_0142655 Ga0495643_0142655_364_828 154
629 3300046525 Ga0495663_0277522 Ga0495663_0277522_35_502 154
630 3300046530 Ga0495654_0082873 Ga0495654_0082873_704_1171 154
631 3300046530 Ga0495654_0134778 Ga0495654_0134778_320_784 154
632 3300046538 Ga0495609_0015309 Ga0495609_0015309_357_821 154
633 3300046616 Ga0495668_0000001 Ga0495668_0000001_479820_480293 154
634 3300046660 Ga0495625_0010229 Ga0495625_0010229_6407_6871 154
635 3300046674 Ga0495588_0275591 Ga0495588_0275591_321_812 154
636 3300046691 Ga0495670_0141020 Ga0495670_0141020_257_721 154
637 3300046692 Ga0495671_0300610 Ga0495671_0300610_249_713 154
638 3300047469 Ga0495673_0170009 Ga0495673_0170009_302_781 154
639 3300047469 Ga0495673_0173776 Ga0495673_0173776_322_786 154
640 3300047470 Ga0495681_0000094 Ga0495681_0000094_16624_17088 154
641 3300047472 Ga0495686_0000145 Ga0495686_0000145_13889_14368 154
642 3300047472 Ga0495686_0175411 Ga0495686_0175411_119_583 154
643 3300048090 Ga0495615_0000033 Ga0495615_0000033_20918_21382 154
644 3300048903 Ga0496100_0011591 Ga0496100_0011591_705_1172 154
645 3300048904 Ga0496101_0161863 Ga0496101_0161863_527_994 154
646 3300048904 Ga0496101_0603190 Ga0496101_0603190_12_476 154
647 3300048905 Ga0496102_0000267 Ga0496102_0000267_34254_34721 154
648 3300048906 Ga0496103_0000139 Ga0496103_0000139_3377_3844 154
649 3300048907 Ga0496104_0001261 Ga0496104_0001261_16616_17083 154
650 3300048907 Ga0496104_0286807 Ga0496104_0286807_419_886 154
651 3300048908 Ga0496105_0004449 Ga0496105_0004449_2597_3064 154
652 3300048908 Ga0496105_0357718 Ga0496105_0357718_563_1027 154
653 3300048911 Ga0496108_1186244 Ga0496108_1186244_166_633 154
654 3300048912 Ga0496109_0201779 Ga0496109_0201779_1263_1730 154
655 3300048913 Ga0496110_0068444 Ga0496110_0068444_1977_2444 154
656 3300048914 Ga0496111_0014834 Ga0496111_0014834_178_645 154
657 3300048915 Ga0496112_0600219 Ga0496112_0600219_398_865 154
658 3300048916 Ga0496113_0007197 Ga0496113_0007197_3824_4291 154
659 3300048917 Ga0496114_0023283 Ga0496114_0023283_348_815 154
660 3300048917 Ga0496114_0056565 Ga0496114_0056565_680_1144 154
661 3300048920 Ga0496117_0009437 Ga0496117_0009437_344_811 154
662 3300048921 Ga0496118_0006964 Ga0496118_0006964_11704_12171 154
663 3300048922 Ga0496119_0000077 Ga0496119_0000077_515_982 154
664 3300048922 Ga0496119_0000344 Ga0496119_0000344_62357_62881 154
665 3300048923 Ga0496120_0005768 Ga0496120_0005768_7499_7966 154
666 3300048924 Ga0496121_0000022 Ga0496121_0000022_139716_140192 154
667 3300048924 Ga0496121_0058612 Ga0496121_0058612_2305_2772 154
668 3300048925 Ga0496122_0002268 Ga0496122_0002268_4081_4605 154
669 3300048925 Ga0496122_0006858 Ga0496122_0006858_2615_3082 154
670 3300048925 Ga0496122_0011513 Ga0496122_0011513_4521_4985 154
671 3300048926 Ga0496123_0003406 Ga0496123_0003406_2177_2701 154
672 3300048926 Ga0496123_0005963 Ga0496123_0005963_5057_5521 154
673 3300048926 Ga0496123_0016981 Ga0496123_0016981_706_1173 154
674 3300048927 Ga0496124_0006200 Ga0496124_0006200_246_713 154
675 3300048927 Ga0496124_0263061 Ga0496124_0263061_194_661 154
676 3300048928 Ga0496125_0028887 Ga0496125_0028887_4014_4481 154
677 3300048929 Ga0496126_0000619 Ga0496126_0000619_34235_34702 154
678 3300048929 Ga0496126_0003256 Ga0496126_0003256_13587_14054 154
679 3300048929 Ga0496126_0004371 Ga0496126_0004371_36_503 154
680 3300048929 Ga0496126_0563927 Ga0496126_0563927_78_551 154
681 3300049460 Ga0495682_0132776 Ga0495682_0132776_369_836 154
682 3300049581 Ga0501047_0414497 Ga0501047_0414497_181_645 154
683 3300049581 Ga0501047_0431344 Ga0501047_0431344_95_607 154
684 3300049582 Ga0501048_0186999 Ga0501048_0186999_157_630 154
685 3300049742 Ga0501080_0323625 Ga0501080_0323625_907_1377 154
686 3300049744 Ga0501083_0743537 Ga0501083_0743537_142_609 154
687 3300049822 Ga0501035_0017712 Ga0501035_0017712_3527_4000 154
688 3300049822 Ga0501035_0853382 Ga0501035_0853382_198_662 154
689 3300049823 Ga0501044_0205691 Ga0501044_0205691_97_561 154
690 3300049823 Ga0501044_0319955 Ga0501044_0319955_561_1025 154
691 3300050489 nmdc:mga03683_149_c1 nmdc:mga03683_149_c1_3800_4276 154
692 3300050489 nmdc:mga03683_30_c1 nmdc:mga03683_30_c1_13197_13661 154
693 3300050490 nmdc:mga03n38_147852_c1 nmdc:mga03n38_147852_c1_400_876 154
694 3300050490 nmdc:mga03n38_6284_c1 nmdc:mga03n38_6284_c1_3120_3584 154
695 3300050491 nmdc:mga00v17_125984_c1 nmdc:mga00v17_125984_c1_789_1253 154
696 3300050491 nmdc:mga00v17_798_c1 nmdc:mga00v17_798_c1_8018_8482 154
697 3300050491 nmdc:mga00v17_83529_c1 nmdc:mga00v17_83529_c1_367_843 154
698 3300050493 nmdc:mga0k408_17004_c1 nmdc:mga0k408_17004_c1_240_704 154
699 3300050493 nmdc:mga0k408_2730_c1 nmdc:mga0k408_2730_c1_5554_6018 154
700 3300050493 nmdc:mga0k408_328445_c1 nmdc:mga0k408_328445_c1_48_512 154
701 3300050493 nmdc:mga0k408_49594_c1 nmdc:mga0k408_49594_c1_1735_2199 154
702 3300050493 nmdc:mga0k408_563438_c1 nmdc:mga0k408_563438_c1_28_495 154
703 3300050494 nmdc:mga06z11_149346_c1 nmdc:mga06z11_149346_c1_106_570 154
704 3300050494 nmdc:mga06z11_61_c1 nmdc:mga06z11_61_c1_30884_31360 154
705 3300050495 nmdc:mga04h51_1140_c1 nmdc:mga04h51_1140_c1_4099_4575 154
706 3300050495 nmdc:mga04h51_49320_c1 nmdc:mga04h51_49320_c1_512_976 154
707 3300050496 nmdc:mga07m45_155417_c1 nmdc:mga07m45_155417_c1_658_1122 154
708 3300050496 nmdc:mga07m45_19103_c1 nmdc:mga07m45_19103_c1_1490_1954 154
709 3300050496 nmdc:mga07m45_238675_c1 nmdc:mga07m45_238675_c1_46_510 154
710 3300050496 nmdc:mga07m45_29618_c2 nmdc:mga07m45_29618_c2_298_762 154
711 3300050496 nmdc:mga07m45_3935_c1 nmdc:mga07m45_3935_c1_4215_4691 154
712 3300050496 nmdc:mga07m45_4960_c1 nmdc:mga07m45_4960_c1_5439_5903 154
713 3300050496 nmdc:mga07m45_6_c1 nmdc:mga07m45_6_c1_37027_37491 154
714 3300050516 nmdc:mga0sz30_114985_c1 nmdc:mga0sz30_114985_c1_24_500 154
715 3300050516 nmdc:mga0sz30_138_c1 nmdc:mga0sz30_138_c1_17419_17883 154
716 3300053087 Ga0500643_063823 Ga0500643_063823_249_713 154
717 3300053091 Ga0500647_0014953 Ga0500647_0014953_1842_2309 154
718 3300053104 Ga0500556_0000122 Ga0500556_0000122_60601_61125 154
719 3300053116 Ga0500592_005142 Ga0500592_005142_372_845 154
720 3300053118 Ga0500594_0063912 Ga0500594_0063912_561_1028 154
721 3300053119 Ga0500595_007244 Ga0500595_007244_3234_3698 154
722 3300053121 Ga0500607_000287 Ga0500607_000287_24395_24871 154
723 3300053121 Ga0500607_000802 Ga0500607_000802_10831_11295 154
724 3300053122 Ga0500608_001154 Ga0500608_001154_4248_4715 154
725 3300053125 Ga0500618_037319 Ga0500618_037319_254_721 154
726 3300053136 Ga0500559_0002605 Ga0500559_0002605_2109_2573 154
727 3300053136 Ga0500559_0036136 Ga0500559_0036136_752_1219 154
728 3300053136 Ga0500559_0384310 Ga0500559_0384310_155_622 154
729 3300053138 Ga0500564_002032 Ga0500564_002032_4704_5171 154
730 3300053139 Ga0500568_0002610 Ga0500568_0002610_9015_9488 154
731 3300053140 Ga0500573_0314262 Ga0500573_0314262_89_556 154
732 3300053140 Ga0500573_0461430 Ga0500573_0461430_58_522 154
733 3300053142 Ga0500577_0010263 Ga0500577_0010263_209_688 154
734 3300053146 Ga0500588_0130445 Ga0500588_0130445_96_560 154
735 3300053148 Ga0500590_000142 Ga0500590_000142_3306_3773 154
736 3300053148 Ga0500590_034104 Ga0500590_034104_1553_2017 154
737 3300053151 Ga0500604_0050022 Ga0500604_0050022_86_559 154
738 3300053154 Ga0500619_247062 Ga0500619_247062_42_509 154
739 3300053156 Ga0500622_0014303 Ga0500622_0014303_2694_3158 154
740 3300053158 Ga0500627_0000004 Ga0500627_0000004_155729_156202 154
741 3300053159 Ga0500630_250872 Ga0500630_250872_94_561 154
742 3300053178 Ga0500637_0071845 Ga0500637_0071845_895_1359 154
743 3300053729 Ga0500625_000022 Ga0500625_000022_17162_17629 154
744 3300053729 Ga0500625_065684 Ga0500625_065684_1073_1540 154
745 3300053730 Ga0500645_003394 Ga0500645_003394_3017_3481 154
746 3300003794 Ga0055531_10002920 Ga0055531_1000292010 155
747 3300003794 Ga0055531_10022710 Ga0055531_100227102 155
748 3300025292 Ga0209676_1000228 Ga0209676_100022811 155
749 3300025292 Ga0209676_1032137 Ga0209676_10321371 155
750 3300025298 Ga0209050_1072117 Ga0209050_10721171 155
751 3300025304 Ga0209257_1000229 Ga0209257_1000229105 155
752 3300025304 Ga0209257_1008070 Ga0209257_10080707 155
753 3300031901 Ga0307406_10225051 Ga0307406_102250512 155
754 3300031911 Ga0307412_10093964 Ga0307412_100939642 155
755 3300032004 Ga0307414_10032511 Ga0307414_100325112 155
756 3300046522 Ga0495643_0031602 Ga0495643_0031602_1610_2086 155
757 3300046525 Ga0495663_0172099 Ga0495663_0172099_223_699 155
758 3300046660 Ga0495625_0000234 Ga0495625_0000234_75088_75564 155
759 3300049523 Ga0501300_034046 Ga0501300_034046_49_525 155
760 3300049569 Ga0501032_0006527 Ga0501032_0006527_3518_3994 155
761 3300049570 Ga0501033_0004215 Ga0501033_0004215_7042_7518 155
762 3300049570 Ga0501033_0031389 Ga0501033_0031389_2947_3423 155
763 3300049571 Ga0501034_0010865 Ga0501034_0010865_3779_4255 155
764 3300049571 Ga0501034_0326993 Ga0501034_0326993_856_1332 155
765 3300049572 Ga0501036_0025362 Ga0501036_0025362_125_601 155
766 3300049573 Ga0501037_0009034 Ga0501037_0009034_4245_4721 155
767 3300049574 Ga0501038_0017668 Ga0501038_0017668_1137_1613 155
768 3300049575 Ga0501039_0091478 Ga0501039_0091478_1474_1950 155
769 3300049580 Ga0501046_0067378 Ga0501046_0067378_847_1323 155
770 3300049581 Ga0501047_0004376 Ga0501047_0004376_7544_8020 155
771 3300049581 Ga0501047_0119971 Ga0501047_0119971_1544_2020 155
772 3300049822 Ga0501035_0167219 Ga0501035_0167219_973_1449 155
773 3300049823 Ga0501044_0007203 Ga0501044_0007203_11293_11769 155
774 3300049823 Ga0501044_0030831 Ga0501044_0030831_2123_2599 155
775 3300053134 Ga0500658_0089523 Ga0500658_0089523_419_895 155
776 2162886007 SwRhRL2b_contig_887096 SwRhRL2b_0781.00006290 156
777 3300005289 Ga0065704_10095003 Ga0065704_100950032 156
778 3300005331 Ga0070670_100327523 Ga0070670_1003275232 156
779 3300005336 Ga0070680_100634730 Ga0070680_1006347301 156
780 3300005347 Ga0070668_100014755 Ga0070668_1000147559 156
781 3300005353 Ga0070669_100022491 Ga0070669_1000224912 156
782 3300005353 Ga0070669_100096449 Ga0070669_1000964493 156
783 3300005355 Ga0070671_100000686 Ga0070671_1000006863 156
784 3300005355 Ga0070671_101557935 Ga0070671_1015579351 156
785 3300005367 Ga0070667_100002350 Ga0070667_10000235011 156
786 3300005548 Ga0070665_100000076 Ga0070665_100000076127 156
787 3300005548 Ga0070665_100005505 Ga0070665_10000550511 156
788 3300005618 Ga0068864_100035463 Ga0068864_1000354634 156
789 3300005841 Ga0068863_100000014 Ga0068863_10000001462 156
790 3300005841 Ga0068863_100342066 Ga0068863_1003420662 156
791 3300005841 Ga0068863_100648183 Ga0068863_1006481832 156
792 3300005842 Ga0068858_100156431 Ga0068858_1001564312 156
793 3300005843 Ga0068860_100000007 Ga0068860_100000007173 156
794 3300005843 Ga0068860_100029781 Ga0068860_1000297812 156
795 3300005844 Ga0068862_100012958 Ga0068862_1000129582 156
796 3300005844 Ga0068862_100062551 Ga0068862_1000625512 156
797 3300006051 Ga0075364_10102269 Ga0075364_101022692 156
798 3300006051 Ga0075364_10551599 Ga0075364_105515992 156
799 3300009011 Ga0105251_10001315 Ga0105251_1000131515 156
800 3300009092 Ga0105250_10148598 Ga0105250_101485981 156
801 3300009101 Ga0105247_10050332 Ga0105247_100503322 156
802 3300009177 Ga0105248_10004661 Ga0105248_1000466113 156
803 3300009177 Ga0105248_10104896 Ga0105248_101048963 156
804 3300009553 Ga0105249_10463585 Ga0105249_104635851 156
805 3300025735 Ga0207713_1021570 Ga0207713_10215702 156
806 3300025903 Ga0207680_10081041 Ga0207680_100810413 156
807 3300025923 Ga0207681_10010126 Ga0207681_100101265 156
808 3300025923 Ga0207681_10333281 Ga0207681_103332811 156
809 3300025925 Ga0207650_10086523 Ga0207650_100865231 156
810 3300025931 Ga0207644_10000818 Ga0207644_1000081812 156
811 3300025972 Ga0207668_10027876 Ga0207668_100278763 156
812 3300025986 Ga0207658_10003755 Ga0207658_100037555 156
813 3300025986 Ga0207658_10012197 Ga0207658_100121972 156
814 3300026035 Ga0207703_10051426 Ga0207703_100514262 156
815 3300026035 Ga0207703_10116628 Ga0207703_101166282 156
816 3300026088 Ga0207641_10000126 Ga0207641_1000012641 156
817 3300026088 Ga0207641_10020015 Ga0207641_100200157 156
818 3300028379 Ga0268266_10000317 Ga0268266_1000031743 156
819 3300028379 Ga0268266_10011921 Ga0268266_100119216 156
820 3300028380 Ga0268265_10004791 Ga0268265_100047912 156
821 3300028380 Ga0268265_10008961 Ga0268265_100089617 156
822 3300028381 Ga0268264_10000077 Ga0268264_1000007766 156
823 3300028381 Ga0268264_10009226 Ga0268264_100092268 156
824 3300046460 Ga0495638_0044272 Ga0495638_0044272_101_586 156
825 3300047472 Ga0495686_0027888 Ga0495686_0027888_3138_3623 156
826 3300048906 Ga0496103_0014470 Ga0496103_0014470_1050_1526 156
827 3300048906 Ga0496103_0353879 Ga0496103_0353879_274_747 156
828 3300048907 Ga0496104_0051151 Ga0496104_0051151_2693_3166 156
829 3300048908 Ga0496105_0004419 Ga0496105_0004419_583_1056 156
830 3300048920 Ga0496117_0034849 Ga0496117_0034849_1909_2385 156
831 3300048920 Ga0496117_0220842 Ga0496117_0220842_397_867 156
832 3300048921 Ga0496118_0083218 Ga0496118_0083218_900_1376 156
833 3300048921 Ga0496118_0190308 Ga0496118_0190308_23_493 156
834 3300048922 Ga0496119_0066703 Ga0496119_0066703_432_908 156
835 3300048923 Ga0496120_0205030 Ga0496120_0205030_158_634 156
836 3300048924 Ga0496121_0009408 Ga0496121_0009408_10631_11107 156
837 3300048924 Ga0496121_0685237 Ga0496121_0685237_90_563 156
838 3300048927 Ga0496124_0183938 Ga0496124_0183938_998_1474 156
839 3300048928 Ga0496125_0016149 Ga0496125_0016149_1932_2408 156
840 3300048929 Ga0496126_0042184 Ga0496126_0042184_129_605 156
841 3300053153 Ga0500616_0049565 Ga0500616_0049565_316_801 156
842 3300002075 JGI24738J21930_10002292 JGI24738J21930_100022924 157
843 3300005616 Ga0068852_100908872 Ga0068852_1009088722 157
844 3300025932 Ga0207690_10904539 Ga0207690_109045392 157
845 3300041503 Ga0451847_0010677 Ga0451847_0010677_175_648 157
846 3300050496 nmdc:mga07m45_368022_c1 nmdc:mga07m45_368022_c1_81_596 157
847 3300050513 nmdc:mga0rr50_1197089_c1 nmdc:mga0rr50_1197089_c1_20_535 157
848 3300053087 Ga0500643_000001 Ga0500643_000001_849426_849920 157
849 3300053136 Ga0500559_0104037 Ga0500559_0104037_456_974 157
850 3300053139 Ga0500568_0135285 Ga0500568_0135285_195_671 157
851 3300053140 Ga0500573_0197675 Ga0500573_0197675_167_661 157
852 3300005339 Ga0070660_100073658 Ga0070660_1000736583 158
853 3300005455 Ga0070663_100205680 Ga0070663_1002056802 158
854 3300005530 Ga0070679_100697722 Ga0070679_1006977222 158
855 3300042131 Ga0450894_053352 Ga0450894_053352_16_537 158
856 3300013307 Ga0157372_10062791 Ga0157372_100627912 160
857 3300017792 Ga0163161_10026756 Ga0163161_100267562 160
858 3300048921 Ga0496118_0020455 Ga0496118_0020455_4472_5026 160
859 3300048924 Ga0496121_0000222 Ga0496121_0000222_75894_76448 160
860 3300053153 Ga0500616_0004405 Ga0500616_0004405_4154_4711 160
861 3300013296 Ga0157374_10476509 Ga0157374_104765092 162
862 3300013297 Ga0157378_10938346 Ga0157378_109383461 162
863 3300014745 Ga0157377_10328575 Ga0157377_103285752 162
864 3300049823 Ga0501044_0000098 Ga0501044_0000098_10555_11139 162
865 3300046512 Ga0495610_0000377 Ga0495610_0000377_37897_38397 165
866 3300046522 Ga0495643_0000007 Ga0495643_0000007_332501_333001 165
867 3300046558 Ga0495633_0061326 Ga0495633_0061326_1111_1611 165
868 3300046507 Ga0495606_0308935 Ga0495606_0308935_133_639 166
869 3300046512 Ga0495610_0005814 Ga0495610_0005814_1681_2187 166
870 3300046519 Ga0495632_0149293 Ga0495632_0149293_325_828 166
871 3300046522 Ga0495643_0079094 Ga0495643_0079094_144_650 166
872 3300048920 Ga0496117_0128287 Ga0496117_0128287_210_728 167
873 3300048924 Ga0496121_0002362 Ga0496121_0002362_24953_25471 167
874 3300048925 Ga0496122_0008242 Ga0496122_0008242_9751_10269 167
875 3300048926 Ga0496123_0005241 Ga0496123_0005241_243_761 167
876 3300048928 Ga0496125_0007827 Ga0496125_0007827_5915_6433 167
877 3300048929 Ga0496126_0000079 Ga0496126_0000079_292_810 167
878 2162886007 SwRhRL2b_contig_2139260 SwRhRL2b_0471.00005670 170
879 3300005289 Ga0065704_10000190 Ga0065704_10000190126 170

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13404

HTH_AsnC-type

AsnC-type helix-turn-helix domain

20

61

0.98

PF13412

HTH_24

Winged helix-turn-helix DNA-binding

20

67

0.97

PF01037

AsnC_trans_reg

Lrp/AsnC ligand binding domain

86

159

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2p5v-assembly1.cif.gz_A crystal structure of transcriptional regulator nmb0573 from neisseria meningitidis 0.9345 18 169
2w25-assembly1.cif.gz_B crystal structure of glu104ala mutant 0.9241 19 163
2ivm-assembly1.cif.gz_A crystal structure of a transcriptional regulator 0.9186 19 163
2zny-assembly2.cif.gz_C crystal structure of the ffrp 0.9164 20 168
2gqq-assembly1.cif.gz_A-2 crystal structure of e. coli leucine-responsive regulatory protein (lrp) 0.9159 20 170
ID Description Score Start End Superfamily
4pcqA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9597 24 72 1.10.10.10
2qz8D01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9572 21 71 1.10.10.10
2p5vE01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9566 21 71 1.10.10.10
2p6sE01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9562 21 71 1.10.10.10
2p6sB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9559 21 71 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1H5U0L5-F1-model_v4 Lrp/AsnC family transcriptional regulator, leucine-responsive regulatory protein 0.9679 17 163 GO:0005829
GO:0043200
GO:0043565
AF-A0A3N7C0L3-F1-model_v4 AsnC family transcriptional regulator 0.964 17 169 GO:0005829
GO:0043200
GO:0043565
AF-A0A5E8KUL6-F1-model_v4 deleted 0.9617 18 169
AF-A0A1K1RDQ7-F1-model_v4 Lrp/AsnC family transcriptional regulator, leucine-responsive regulatory protein 0.9608 20 169 GO:0005829
GO:0043200
GO:0043565
AF-A0A381VKJ2-F1-model_v4 HTH asnC-type domain-containing protein 0.9605 20 170 GO:0005829
GO:0043200
GO:0043565

Feature Viewer

pLDDT pTM Quality
87.18 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map