F484471
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 879 | 394 | 833 | 155 |
Family's Representative Sequence
| Representative Sequence | 3300048922|Ga0496119_0000344|Ga0496119_0000344_62357_62881 |
| Length | 174 |
| Sequence | MVQRVTSFVALKEVYVVRRIDGIDQNILRELQEDGRITNVELSKRVGISAPPCLRRVRSLEEDGIIRGYRALLDEKKLGFDLMAFAMVHLVSQAEADLSAFSEQVQRWPLVRSCWMLSGEVDFLLLCVAPDLRTFQSFVLELTGAPNVRNVKTALTLKQAKDAPVVPMEGVPQG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 3 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 4 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 5 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 6 | 2643221560 | Sphingopyxis sp. Root1497 | Isolate | Unclassified |
| 7 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 8 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 9 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 10 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 11 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 12 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 13 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 14 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 15 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 16 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 17 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 18 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 19 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 20 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 21 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 22 | 2842882022 | Bacillus sp. R-71893 | Isolate | Unclassified |
| 23 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 24 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 25 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 26 | 2896253425 | Aurantiacibacter rhizosphaerae GH3-10 | Isolate | Rhizosphere |
| 27 | 2904524088 | Priestia megaterium 1428 | Isolate | Rhizosphere |
| 28 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 29 | 2919143609 | Priestia megaterium 1751 | Isolate | Rhizosphere |
| 30 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 31 | 2919517244 | Priestia aryabhattai 3820 | Isolate | Unclassified |
| 32 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 33 | 2928093941 | Priestia aryabhattai 1389 | Isolate | Rhizosphere |
| 34 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 35 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 36 | 2929004312 | Priestia megaterium 1104 | Isolate | Unclassified |
| 37 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 38 | 2960375949 | Priestia megaterium AFS067084 | Isolate | Unclassified |
| 39 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 40 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 41 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 42 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 43 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
| 44 | 3000865235 | Altericroceibacterium indicum DSM 18604 | Isolate | Rhizosphere |
| 45 | 3300001432 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 46 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 47 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 48 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 49 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 50 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 51 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 52 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 53 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 54 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 55 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 56 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 57 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 58 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 59 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 60 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 61 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 62 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 63 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 64 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 65 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 66 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 67 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 68 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 69 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 70 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 71 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 72 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 73 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 74 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 75 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 77 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 78 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 80 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 82 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 83 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 85 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 87 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 93 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 100 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 101 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 102 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 103 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 104 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 105 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 106 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 108 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 109 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 111 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 112 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 113 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 114 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 115 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 116 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 117 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 118 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 119 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 120 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 121 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 122 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 123 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 124 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 125 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 126 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 127 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 128 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 129 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 130 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 131 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 132 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 134 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 164 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 165 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 168 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 170 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 225 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300030083 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 | Metagenome | Unclassified |
| 230 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 231 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 232 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 233 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 234 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 235 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 236 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 237 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 238 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 239 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 240 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 241 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 242 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 243 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 244 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 245 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 246 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 247 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 248 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 249 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 250 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 251 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 252 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 253 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 254 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 255 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 256 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 257 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 258 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 259 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 260 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 261 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 262 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 263 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 264 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 265 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 266 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 267 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 268 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 269 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 270 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 271 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 272 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 273 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 310 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 311 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 312 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 313 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 314 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 315 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 316 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 317 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 318 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 319 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 320 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 321 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 322 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 323 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 324 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 325 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 326 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 327 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 328 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 329 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 330 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 331 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 332 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 333 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 334 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 335 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 338 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 354 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 355 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 356 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 357 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 358 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 359 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 360 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 362 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 363 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 364 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 365 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 366 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 367 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 368 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 369 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 370 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 371 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 372 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 373 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 374 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 375 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 376 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 377 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 378 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 379 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 380 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 381 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 382 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 383 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 384 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 385 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 386 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 387 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 388 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 389 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 390 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 391 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 392 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
| 393 | 8022893055 | Bacillus aryabhattai AFS007213 | Isolate | Unclassified |
| 394 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.77 |
| Metatranscriptomes | 0 |
| Isolates | 5.23 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.57 |
| Bulb | 0 |
| Endosphere | 19.68 |
| Nodule | 0.23 |
| Rhizoplane | 5.35 |
| Rhizosphere | 64.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.56 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2139260 | 2162886007 | Bacteria | 32362 |
| 2 | SwRhRL2b_contig_2638822 | 2162886007 | Bacteria | 2305 |
| 3 | SwRhRL2b_contig_3219086 | 2162886007 | Bacteria | 1214 |
| 4 | SwRhRL2b_contig_3748734 | 2162886007 | Bacteria | 1440 |
| 5 | SwRhRL2b_contig_887096 | 2162886007 | Bacteria | 970 |
| 6 | JGI24034J14986_101037 | 3300001432 | Bacteria | 1628 |
| 7 | JGI24736J21556_1000031 | 3300001904 | Bacteria | 24133 |
| 8 | JGI24741J21665_1017119 | 3300001915 | Bacteria | 1174 |
| 9 | JGI24752J21851_1000036 | 3300001976 | Bacteria | 15708 |
| 10 | JGI24740J21852_10007875 | 3300001979 | Bacteria | 4297 |
| 11 | JGI24739J22299_10003686 | 3300001989 | Bacteria | 5843 |
| 12 | JGI24739J22299_10017629 | 3300001989 | Bacteria | 2573 |
| 13 | JGI24737J22298_10007725 | 3300001990 | Bacteria | 3624 |
| 14 | JGI24750J21931_1000424 | 3300002070 | Bacteria | 6905 |
| 15 | JGI24748J21848_1000029 | 3300002074 | Bacteria | 90134 |
| 16 | JGI24748J21848_1010040 | 3300002074 | Bacteria | 1115 |
| 17 | JGI24738J21930_10002292 | 3300002075 | Bacteria | 5055 |
| 18 | JGI24738J21930_10008464 | 3300002075 | Bacteria | 2341 |
| 19 | JGI24034J26672_10000006 | 3300002239 | Bacteria | 294495 |
| 20 | JGI24034J26672_10010366 | 3300002239 | Bacteria | 1384 |
| 21 | JGI24742J22300_10002270 | 3300002244 | Bacteria | 3069 |
| 22 | JGI25152J39213_1025184 | 3300002773 | Bacteria | 989 |
| 23 | JGI25150J39212_1000020 | 3300002774 | Bacteria | 134928 |
| 24 | JGI25159J45721_1044908 | 3300002987 | Bacteria | 627 |
| 25 | JGI25151J46595_10001678 | 3300003187 | Bacteria | 14501 |
| 26 | JGI25151J46595_10010952 | 3300003187 | Bacteria | 4192 |
| 27 | JGI25151J46595_10011677 | 3300003187 | Bacteria | 4028 |
| 28 | JGI25151J46595_10014794 | 3300003187 | Bacteria | 3463 |
| 29 | JGI25151J46595_10015684 | 3300003187 | Bacteria | 3329 |
| 30 | JGI25165J46597_1000053 | 3300003214 | Bacteria | 235857 |
| 31 | JGI25153J46596_10000017 | 3300003215 | Bacteria | 274325 |
| 32 | Ga0055532_1000115 | 3300003758 | Bacteria | 85554 |
| 33 | Ga0055535_1004854 | 3300003761 | Bacteria | 3126 |
| 34 | Ga0055535_1013750 | 3300003761 | Bacteria | 1184 |
| 35 | Ga0055536_1001565 | 3300003781 | Bacteria | 13693 |
| 36 | Ga0055536_1010951 | 3300003781 | Bacteria | 3532 |
| 37 | Ga0055534_1017663 | 3300003784 | Bacteria | 1257 |
| 38 | Ga0055528_1003541 | 3300003790 | Bacteria | 7784 |
| 39 | Ga0055530_10000095 | 3300003791 | Bacteria | 74707 |
| 40 | Ga0055530_10010511 | 3300003791 | Bacteria | 3414 |
| 41 | Ga0055540_1009149 | 3300003792 | Bacteria | 3464 |
| 42 | Ga0055531_10001802 | 3300003794 | Bacteria | 15217 |
| 43 | Ga0055531_10002920 | 3300003794 | Bacteria | 11126 |
| 44 | Ga0055531_10022710 | 3300003794 | Bacteria | 2380 |
| 45 | Ga0055541_1000733 | 3300003841 | Bacteria | 8349 |
| 46 | JGI25405J52794_10001431 | 3300003911 | Bacteria | 3922 |
| 47 | Ga0065704_10000190 | 3300005289 | Bacteria | 213919 |
| 48 | Ga0065704_10003249 | 3300005289 | Bacteria | 4618 |
| 49 | Ga0065704_10095003 | 3300005289 | Bacteria | 2512 |
| 50 | Ga0065704_10143789 | 3300005289 | Bacteria | 1492 |
| 51 | Ga0065704_10145587 | 3300005289 | Bacteria | 1475 |
| 52 | Ga0065704_10316801 | 3300005289 | Bacteria | 859 |
| 53 | Ga0065707_10090604 | 3300005295 | Bacteria | 4108 |
| 54 | Ga0065707_10111706 | 3300005295 | Bacteria | 2386 |
| 55 | Ga0065707_10154342 | 3300005295 | Bacteria | 1624 |
| 56 | Ga0070658_10000371 | 3300005327 | Bacteria | 39178 |
| 57 | Ga0070658_10012881 | 3300005327 | Bacteria | 6713 |
| 58 | Ga0070658_10051560 | 3300005327 | Bacteria | 3334 |
| 59 | Ga0070658_10071384 | 3300005327 | Bacteria | 2844 |
| 60 | Ga0070658_10212206 | 3300005327 | Bacteria | 1636 |
| 61 | Ga0070683_100006345 | 3300005329 | Bacteria | 9915 |
| 62 | Ga0070683_100453623 | 3300005329 | Bacteria | 1223 |
| 63 | Ga0070690_100000002 | 3300005330 | Bacteria | 176748 |
| 64 | Ga0070670_100000168 | 3300005331 | Bacteria | 59111 |
| 65 | Ga0070670_100155116 | 3300005331 | Bacteria | 1983 |
| 66 | Ga0070670_100327523 | 3300005331 | Bacteria | 1343 |
| 67 | Ga0068869_100132712 | 3300005334 | Bacteria | 1916 |
| 68 | Ga0070666_10000014 | 3300005335 | Bacteria | 224479 |
| 69 | Ga0070680_100634730 | 3300005336 | Bacteria | 917 |
| 70 | Ga0070682_100276235 | 3300005337 | Bacteria | 1223 |
| 71 | Ga0070682_101065597 | 3300005337 | Bacteria | 675 |
| 72 | Ga0070660_100002018 | 3300005339 | Bacteria | 13999 |
| 73 | Ga0070660_100073658 | 3300005339 | Bacteria | 2671 |
| 74 | Ga0070660_100194506 | 3300005339 | Bacteria | 1643 |
| 75 | Ga0070660_100218824 | 3300005339 | Bacteria | 1547 |
| 76 | Ga0070689_100033303 | 3300005340 | Bacteria | 3925 |
| 77 | Ga0070691_10208696 | 3300005341 | Bacteria | 1030 |
| 78 | Ga0070687_100190789 | 3300005343 | Bacteria | 1235 |
| 79 | Ga0070661_100020845 | 3300005344 | Bacteria | 4677 |
| 80 | Ga0070692_10068259 | 3300005345 | Bacteria | 1889 |
| 81 | Ga0070668_100014755 | 3300005347 | Bacteria | 5840 |
| 82 | Ga0070668_100016256 | 3300005347 | Bacteria | 5565 |
| 83 | Ga0070668_100043654 | 3300005347 | Bacteria | 3438 |
| 84 | Ga0070668_100335559 | 3300005347 | Bacteria | 1276 |
| 85 | Ga0070669_100000184 | 3300005353 | Bacteria | 54362 |
| 86 | Ga0070669_100000839 | 3300005353 | Bacteria | 22301 |
| 87 | Ga0070669_100022491 | 3300005353 | Bacteria | 4507 |
| 88 | Ga0070669_100080190 | 3300005353 | Bacteria | 2429 |
| 89 | Ga0070669_100096449 | 3300005353 | Bacteria | 2225 |
| 90 | Ga0070671_100000686 | 3300005355 | Bacteria | 24340 |
| 91 | Ga0070671_100004299 | 3300005355 | Bacteria | 11274 |
| 92 | Ga0070671_100255540 | 3300005355 | Bacteria | 1489 |
| 93 | Ga0070671_100473123 | 3300005355 | Bacteria | 1076 |
| 94 | Ga0070671_101557935 | 3300005355 | Bacteria | 585 |
| 95 | Ga0070688_100019885 | 3300005365 | Bacteria | 3895 |
| 96 | Ga0070659_100003327 | 3300005366 | Bacteria | 11439 |
| 97 | Ga0070659_100178489 | 3300005366 | Bacteria | 1742 |
| 98 | Ga0070667_100000290 | 3300005367 | Bacteria | 56841 |
| 99 | Ga0070667_100000472 | 3300005367 | Bacteria | 41248 |
| 100 | Ga0070667_100001767 | 3300005367 | Bacteria | 19258 |
| 101 | Ga0070667_100002350 | 3300005367 | Bacteria | 16565 |
| 102 | Ga0070667_100012128 | 3300005367 | Bacteria | 7134 |
| 103 | Ga0070667_100035034 | 3300005367 | Bacteria | 4204 |
| 104 | Ga0070708_100629496 | 3300005445 | Bacteria | 1011 |
| 105 | Ga0070663_100205680 | 3300005455 | Bacteria | 1539 |
| 106 | Ga0070663_100247240 | 3300005455 | Bacteria | 1410 |
| 107 | Ga0070678_101149545 | 3300005456 | Bacteria | 718 |
| 108 | Ga0070662_100000992 | 3300005457 | Bacteria | 17362 |
| 109 | Ga0070662_100027322 | 3300005457 | Bacteria | 3959 |
| 110 | Ga0070662_100134929 | 3300005457 | Bacteria | 1907 |
| 111 | Ga0070681_10058148 | 3300005458 | Bacteria | 3846 |
| 112 | Ga0070685_10000056 | 3300005466 | Bacteria | 68183 |
| 113 | Ga0070706_100430942 | 3300005467 | Bacteria | 1227 |
| 114 | Ga0070679_100030942 | 3300005530 | Bacteria | 5287 |
| 115 | Ga0070679_100031798 | 3300005530 | Bacteria | 5218 |
| 116 | Ga0070679_100049007 | 3300005530 | Bacteria | 4207 |
| 117 | Ga0070679_100152916 | 3300005530 | Bacteria | 2284 |
| 118 | Ga0070679_100697722 | 3300005530 | Bacteria | 958 |
| 119 | Ga0070684_101156365 | 3300005535 | Bacteria | 728 |
| 120 | Ga0068853_100008448 | 3300005539 | Bacteria | 8273 |
| 121 | Ga0068853_100012276 | 3300005539 | Bacteria | 6966 |
| 122 | Ga0068853_100013171 | 3300005539 | Bacteria | 6749 |
| 123 | Ga0068853_100243348 | 3300005539 | Bacteria | 1649 |
| 124 | Ga0068853_100311825 | 3300005539 | Bacteria | 1456 |
| 125 | Ga0068853_100428357 | 3300005539 | Bacteria | 1242 |
| 126 | Ga0068853_100963837 | 3300005539 | Bacteria | 820 |
| 127 | Ga0070686_100000002 | 3300005544 | Bacteria | 336303 |
| 128 | Ga0070665_100000025 | 3300005548 | Bacteria | 367488 |
| 129 | Ga0070665_100000076 | 3300005548 | Bacteria | 189228 |
| 130 | Ga0070665_100005505 | 3300005548 | Bacteria | 13037 |
| 131 | Ga0070665_100045652 | 3300005548 | Bacteria | 4400 |
| 132 | Ga0070704_100406164 | 3300005549 | Bacteria | 1163 |
| 133 | Ga0068855_100046850 | 3300005563 | Bacteria | 5110 |
| 134 | Ga0068855_100253307 | 3300005563 | Bacteria | 1963 |
| 135 | Ga0068855_100289651 | 3300005563 | Bacteria | 1816 |
| 136 | Ga0068855_100588600 | 3300005563 | Bacteria | 1201 |
| 137 | Ga0068855_100648909 | 3300005563 | Bacteria | 1134 |
| 138 | Ga0068855_101412377 | 3300005563 | Bacteria | 717 |
| 139 | Ga0070664_100010887 | 3300005564 | Bacteria | 7376 |
| 140 | Ga0070664_100240706 | 3300005564 | Bacteria | 1624 |
| 141 | Ga0068857_100088803 | 3300005577 | Bacteria | 2765 |
| 142 | Ga0068857_100179407 | 3300005577 | Bacteria | 1927 |
| 143 | Ga0068857_100195436 | 3300005577 | Bacteria | 1843 |
| 144 | Ga0068857_100229812 | 3300005577 | Bacteria | 1696 |
| 145 | Ga0068857_100233204 | 3300005577 | Bacteria | 1684 |
| 146 | Ga0068857_100859217 | 3300005577 | Bacteria | 868 |
| 147 | Ga0068854_100004727 | 3300005578 | Bacteria | 8584 |
| 148 | Ga0068854_100039497 | 3300005578 | Bacteria | 3325 |
| 149 | Ga0068854_100361610 | 3300005578 | Bacteria | 1191 |
| 150 | Ga0068854_100607981 | 3300005578 | Bacteria | 934 |
| 151 | Ga0068856_100001125 | 3300005614 | Bacteria | 28271 |
| 152 | Ga0068856_100011802 | 3300005614 | Bacteria | 8468 |
| 153 | Ga0068856_100132888 | 3300005614 | Bacteria | 2494 |
| 154 | Ga0068852_100000083 | 3300005616 | Bacteria | 65822 |
| 155 | Ga0068852_100023139 | 3300005616 | Bacteria | 4995 |
| 156 | Ga0068852_100028520 | 3300005616 | Bacteria | 4571 |
| 157 | Ga0068852_100266764 | 3300005616 | Bacteria | 1646 |
| 158 | Ga0068852_100435229 | 3300005616 | Bacteria | 1296 |
| 159 | Ga0068852_100803667 | 3300005616 | Bacteria | 955 |
| 160 | Ga0068852_100908872 | 3300005616 | Bacteria | 897 |
| 161 | Ga0068852_100973101 | 3300005616 | Bacteria | 867 |
| 162 | Ga0068859_100061439 | 3300005617 | Bacteria | 3786 |
| 163 | Ga0068864_100000063 | 3300005618 | Bacteria | 119845 |
| 164 | Ga0068864_100004504 | 3300005618 | Bacteria | 11457 |
| 165 | Ga0068864_100022037 | 3300005618 | Bacteria | 5339 |
| 166 | Ga0068864_100035463 | 3300005618 | Bacteria | 4247 |
| 167 | Ga0068864_100693797 | 3300005618 | Bacteria | 994 |
| 168 | Ga0068864_100745331 | 3300005618 | Bacteria | 960 |
| 169 | Ga0068861_100004572 | 3300005719 | Bacteria | 9290 |
| 170 | Ga0068861_101246335 | 3300005719 | Bacteria | 721 |
| 171 | Ga0068851_10183942 | 3300005834 | Bacteria | 1158 |
| 172 | Ga0068863_100000014 | 3300005841 | Bacteria | 216135 |
| 173 | Ga0068863_100000062 | 3300005841 | Bacteria | 119845 |
| 174 | Ga0068863_100000070 | 3300005841 | Bacteria | 115715 |
| 175 | Ga0068863_100080373 | 3300005841 | Bacteria | 3088 |
| 176 | Ga0068863_100342066 | 3300005841 | Bacteria | 1455 |
| 177 | Ga0068863_100648183 | 3300005841 | Bacteria | 1047 |
| 178 | Ga0068858_100000313 | 3300005842 | Bacteria | 51649 |
| 179 | Ga0068858_100002369 | 3300005842 | Bacteria | 19058 |
| 180 | Ga0068858_100003260 | 3300005842 | Bacteria | 16176 |
| 181 | Ga0068858_100156431 | 3300005842 | Bacteria | 2145 |
| 182 | Ga0068858_100353831 | 3300005842 | Bacteria | 1407 |
| 183 | Ga0068858_101165476 | 3300005842 | Bacteria | 757 |
| 184 | Ga0068860_100000001 | 3300005843 | Bacteria | 703043 |
| 185 | Ga0068860_100000007 | 3300005843 | Bacteria | 429329 |
| 186 | Ga0068860_100011780 | 3300005843 | Bacteria | 8619 |
| 187 | Ga0068860_100029781 | 3300005843 | Bacteria | 5251 |
| 188 | Ga0068862_100000020 | 3300005844 | Bacteria | 219516 |
| 189 | Ga0068862_100000069 | 3300005844 | Bacteria | 122535 |
| 190 | Ga0068862_100012958 | 3300005844 | Bacteria | 6898 |
| 191 | Ga0068862_100062551 | 3300005844 | Bacteria | 3201 |
| 192 | Ga0068862_100081269 | 3300005844 | Bacteria | 2811 |
| 193 | Ga0081455_10001124 | 3300005937 | Bacteria | 33435 |
| 194 | Ga0075365_10067981 | 3300006038 | Bacteria | 2393 |
| 195 | Ga0075368_10000199 | 3300006042 | Bacteria | 16601 |
| 196 | Ga0075368_10092963 | 3300006042 | Bacteria | 1234 |
| 197 | Ga0075363_100009342 | 3300006048 | Bacteria | 4608 |
| 198 | Ga0075363_100017436 | 3300006048 | Bacteria | 3561 |
| 199 | Ga0075364_10002598 | 3300006051 | Bacteria | 10133 |
| 200 | Ga0075364_10102269 | 3300006051 | Bacteria | 1908 |
| 201 | Ga0075364_10151087 | 3300006051 | Bacteria | 1565 |
| 202 | Ga0075364_10551599 | 3300006051 | Bacteria | 788 |
| 203 | Ga0075364_10611915 | 3300006051 | Bacteria | 744 |
| 204 | Ga0075362_10000041 | 3300006177 | Bacteria | 45834 |
| 205 | Ga0075362_10046036 | 3300006177 | Bacteria | 1939 |
| 206 | Ga0075367_10022138 | 3300006178 | Bacteria | 3561 |
| 207 | Ga0075367_10648801 | 3300006178 | Bacteria | 671 |
| 208 | Ga0075369_10000994 | 3300006186 | Bacteria | 9454 |
| 209 | Ga0075369_10120093 | 3300006186 | Bacteria | 1189 |
| 210 | Ga0075366_10000150 | 3300006195 | Bacteria | 29547 |
| 211 | Ga0075366_10028344 | 3300006195 | Bacteria | 3287 |
| 212 | Ga0075366_10217878 | 3300006195 | Bacteria | 1163 |
| 213 | Ga0075366_10436965 | 3300006195 | Bacteria | 807 |
| 214 | Ga0075370_10000003 | 3300006353 | Bacteria | 133163 |
| 215 | Ga0075370_10018925 | 3300006353 | Bacteria | 3740 |
| 216 | Ga0075370_10033548 | 3300006353 | Bacteria | 2875 |
| 217 | Ga0075370_10036616 | 3300006353 | Bacteria | 2757 |
| 218 | Ga0075370_10093820 | 3300006353 | Bacteria | 1733 |
| 219 | Ga0075370_10158613 | 3300006353 | Bacteria | 1327 |
| 220 | Ga0075370_10502340 | 3300006353 | Bacteria | 732 |
| 221 | Ga0097620_100061439 | 3300006931 | Bacteria | 3786 |
| 222 | Ga0079104_1027201 | 3300006946 | Bacteria | 1469 |
| 223 | Ga0105251_10001315 | 3300009011 | Bacteria | 21467 |
| 224 | Ga0105251_10006102 | 3300009011 | Bacteria | 7763 |
| 225 | Ga0105251_10007785 | 3300009011 | Bacteria | 6528 |
| 226 | Ga0105251_10052664 | 3300009011 | Bacteria | 1937 |
| 227 | Ga0105244_10016502 | 3300009036 | Bacteria | 4204 |
| 228 | Ga0105250_10002953 | 3300009092 | Bacteria | 8277 |
| 229 | Ga0105250_10021336 | 3300009092 | Bacteria | 2615 |
| 230 | Ga0105250_10104782 | 3300009092 | Bacteria | 1156 |
| 231 | Ga0105250_10142772 | 3300009092 | Bacteria | 993 |
| 232 | Ga0105250_10148598 | 3300009092 | Bacteria | 974 |
| 233 | Ga0105250_10189082 | 3300009092 | Bacteria | 866 |
| 234 | Ga0105240_10029936 | 3300009093 | Bacteria | 7084 |
| 235 | Ga0105247_10050332 | 3300009101 | Bacteria | 2563 |
| 236 | Ga0105247_10056551 | 3300009101 | Bacteria | 2423 |
| 237 | Ga0105247_10087521 | 3300009101 | Bacteria | 1973 |
| 238 | Ga0105243_10114789 | 3300009148 | Bacteria | 2260 |
| 239 | Ga0105241_10130650 | 3300009174 | Bacteria | 2033 |
| 240 | Ga0105248_10000284 | 3300009177 | Bacteria | 59750 |
| 241 | Ga0105248_10004661 | 3300009177 | Bacteria | 15178 |
| 242 | Ga0105248_10048387 | 3300009177 | Bacteria | 4770 |
| 243 | Ga0105248_10104896 | 3300009177 | Bacteria | 3187 |
| 244 | Ga0105248_10157534 | 3300009177 | Bacteria | 2562 |
| 245 | Ga0105237_10788457 | 3300009545 | Bacteria | 957 |
| 246 | Ga0105238_10058547 | 3300009551 | Bacteria | 3861 |
| 247 | Ga0105238_10078333 | 3300009551 | Bacteria | 3295 |
| 248 | Ga0105238_10121889 | 3300009551 | Bacteria | 2587 |
| 249 | Ga0105238_10435814 | 3300009551 | Bacteria | 1306 |
| 250 | Ga0105238_11443078 | 3300009551 | Bacteria | 716 |
| 251 | Ga0105238_11605734 | 3300009551 | Bacteria | 680 |
| 252 | Ga0105249_10000005 | 3300009553 | Bacteria | 362467 |
| 253 | Ga0105249_10000160 | 3300009553 | Bacteria | 81883 |
| 254 | Ga0105249_10136026 | 3300009553 | Bacteria | 2351 |
| 255 | Ga0105249_10463585 | 3300009553 | Bacteria | 1307 |
| 256 | Ga0105249_11242858 | 3300009553 | Bacteria | 816 |
| 257 | Ga0105246_10011029 | 3300011119 | Bacteria | 5600 |
| 258 | Ga0105246_10803155 | 3300011119 | Bacteria | 835 |
| 259 | Ga0157373_10053241 | 3300013100 | Bacteria | 2878 |
| 260 | Ga0157373_10116318 | 3300013100 | Bacteria | 1879 |
| 261 | Ga0157371_10001947 | 3300013102 | Bacteria | 20528 |
| 262 | Ga0157371_10171692 | 3300013102 | Bacteria | 1549 |
| 263 | Ga0157371_10444426 | 3300013102 | Bacteria | 953 |
| 264 | Ga0157370_10010227 | 3300013104 | Bacteria | 9906 |
| 265 | Ga0157370_10583082 | 3300013104 | Bacteria | 1024 |
| 266 | Ga0157370_10989143 | 3300013104 | Bacteria | 762 |
| 267 | Ga0157369_10000968 | 3300013105 | Bacteria | 36428 |
| 268 | Ga0157369_10031914 | 3300013105 | Bacteria | 5796 |
| 269 | Ga0157374_10027466 | 3300013296 | Bacteria | 5135 |
| 270 | Ga0157374_10476509 | 3300013296 | Bacteria | 1251 |
| 271 | Ga0157378_10065632 | 3300013297 | Bacteria | 3249 |
| 272 | Ga0157378_10417725 | 3300013297 | Bacteria | 1325 |
| 273 | Ga0157378_10938346 | 3300013297 | Bacteria | 897 |
| 274 | Ga0163162_10030993 | 3300013306 | Bacteria | 5302 |
| 275 | Ga0163162_10040293 | 3300013306 | Bacteria | 4671 |
| 276 | Ga0163162_10097636 | 3300013306 | Bacteria | 3026 |
| 277 | Ga0163162_10371029 | 3300013306 | Bacteria | 1564 |
| 278 | Ga0163162_10641933 | 3300013306 | Bacteria | 1186 |
| 279 | Ga0157372_10001238 | 3300013307 | Bacteria | 27605 |
| 280 | Ga0157372_10062791 | 3300013307 | Bacteria | 4163 |
| 281 | Ga0157372_10124496 | 3300013307 | Bacteria | 2963 |
| 282 | Ga0157372_10356831 | 3300013307 | Bacteria | 1703 |
| 283 | Ga0157375_10748286 | 3300013308 | Bacteria | 1129 |
| 284 | Ga0163163_10094960 | 3300014325 | Bacteria | 3001 |
| 285 | Ga0157377_10328575 | 3300014745 | Bacteria | 1018 |
| 286 | Ga0157377_10373619 | 3300014745 | Bacteria | 963 |
| 287 | Ga0157379_10037286 | 3300014968 | Bacteria | 4334 |
| 288 | Ga0157379_10083251 | 3300014968 | Bacteria | 2867 |
| 289 | Ga0163161_10000115 | 3300017792 | Bacteria | 76319 |
| 290 | Ga0163161_10026756 | 3300017792 | Bacteria | 4088 |
| 291 | Ga0163161_10626923 | 3300017792 | Bacteria | 889 |
| 292 | Ga0163161_11072191 | 3300017792 | Bacteria | 691 |
| 293 | Ga0209566_100042 | 3300025225 | Bacteria | 287384 |
| 294 | Ga0209147_100088 | 3300025229 | Bacteria | 179728 |
| 295 | Ga0209147_105356 | 3300025229 | Bacteria | 1934 |
| 296 | Ga0209437_105443 | 3300025233 | Bacteria | 2170 |
| 297 | Ga0209258_100827 | 3300025242 | Bacteria | 17191 |
| 298 | Ga0209258_103603 | 3300025242 | Bacteria | 3266 |
| 299 | Ga0207425_1000022 | 3300025245 | Bacteria | 355305 |
| 300 | Ga0209129_1001473 | 3300025258 | Bacteria | 13099 |
| 301 | Ga0209233_1000119 | 3300025261 | Bacteria | 235924 |
| 302 | Ga0209455_1013376 | 3300025272 | Bacteria | 1907 |
| 303 | Ga0209673_1002724 | 3300025273 | Bacteria | 11656 |
| 304 | Ga0209130_1017142 | 3300025284 | Bacteria | 1734 |
| 305 | Ga0209675_1000025 | 3300025291 | Bacteria | 294102 |
| 306 | Ga0209676_1000198 | 3300025292 | Bacteria | 134708 |
| 307 | Ga0209676_1000228 | 3300025292 | Bacteria | 123024 |
| 308 | Ga0209676_1000362 | 3300025292 | Bacteria | 85770 |
| 309 | Ga0209676_1005754 | 3300025292 | Bacteria | 6352 |
| 310 | Ga0209676_1032137 | 3300025292 | Bacteria | 1582 |
| 311 | Ga0209025_1000842 | 3300025294 | Bacteria | 48558 |
| 312 | Ga0209025_1001397 | 3300025294 | Bacteria | 32105 |
| 313 | Ga0209025_1001925 | 3300025294 | Bacteria | 24064 |
| 314 | Ga0209025_1003543 | 3300025294 | Bacteria | 14640 |
| 315 | Ga0209025_1008600 | 3300025294 | Bacteria | 7310 |
| 316 | Ga0209025_1009349 | 3300025294 | Bacteria | 6852 |
| 317 | Ga0209025_1010389 | 3300025294 | Bacteria | 6312 |
| 318 | Ga0209758_1000004 | 3300025297 | Bacteria | 1375322 |
| 319 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 320 | Ga0209050_1000367 | 3300025298 | Bacteria | 86573 |
| 321 | Ga0209050_1000728 | 3300025298 | Bacteria | 47923 |
| 322 | Ga0209050_1011865 | 3300025298 | Bacteria | 4072 |
| 323 | Ga0209050_1072117 | 3300025298 | Bacteria | 766 |
| 324 | Ga0207426_1011617 | 3300025302 | Bacteria | 3344 |
| 325 | Ga0209051_1000246 | 3300025303 | Bacteria | 91170 |
| 326 | Ga0209257_1000229 | 3300025304 | Bacteria | 133121 |
| 327 | Ga0209257_1000596 | 3300025304 | Bacteria | 59951 |
| 328 | Ga0209257_1008070 | 3300025304 | Bacteria | 6128 |
| 329 | Ga0207697_10106721 | 3300025315 | Bacteria | 1197 |
| 330 | Ga0207656_10160934 | 3300025321 | Bacteria | 1068 |
| 331 | Ga0207696_1004520 | 3300025711 | Bacteria | 5976 |
| 332 | Ga0207696_1011155 | 3300025711 | Bacteria | 3251 |
| 333 | Ga0207696_1031305 | 3300025711 | Bacteria | 1610 |
| 334 | Ga0207696_1031890 | 3300025711 | Bacteria | 1590 |
| 335 | Ga0207655_1005646 | 3300025728 | Bacteria | 8461 |
| 336 | Ga0207655_1013231 | 3300025728 | Bacteria | 4751 |
| 337 | Ga0207713_1007454 | 3300025735 | Bacteria | 6454 |
| 338 | Ga0207713_1010725 | 3300025735 | Bacteria | 5048 |
| 339 | Ga0207713_1014855 | 3300025735 | Bacteria | 4019 |
| 340 | Ga0207713_1021570 | 3300025735 | Bacteria | 3083 |
| 341 | Ga0207713_1046744 | 3300025735 | Bacteria | 1758 |
| 342 | Ga0207710_10044681 | 3300025900 | Bacteria | 1973 |
| 343 | Ga0207710_10137611 | 3300025900 | Bacteria | 1177 |
| 344 | Ga0207680_10000004 | 3300025903 | Bacteria | 827324 |
| 345 | Ga0207680_10081041 | 3300025903 | Bacteria | 2039 |
| 346 | Ga0207680_10210525 | 3300025903 | Bacteria | 1329 |
| 347 | Ga0207647_10000555 | 3300025904 | Bacteria | 29646 |
| 348 | Ga0207647_10069787 | 3300025904 | Bacteria | 2124 |
| 349 | Ga0207705_10000004 | 3300025909 | Bacteria | 705756 |
| 350 | Ga0207705_10026510 | 3300025909 | Bacteria | 4133 |
| 351 | Ga0207705_10063556 | 3300025909 | Bacteria | 2667 |
| 352 | Ga0207705_10268542 | 3300025909 | Bacteria | 1304 |
| 353 | Ga0207684_10760646 | 3300025910 | Bacteria | 821 |
| 354 | Ga0207654_10004092 | 3300025911 | Bacteria | 7346 |
| 355 | Ga0207654_10393046 | 3300025911 | Bacteria | 963 |
| 356 | Ga0207707_10051378 | 3300025912 | Bacteria | 3589 |
| 357 | Ga0207695_10003879 | 3300025913 | Bacteria | 20700 |
| 358 | Ga0207695_10012208 | 3300025913 | Bacteria | 10316 |
| 359 | Ga0207671_10001983 | 3300025914 | Bacteria | 22572 |
| 360 | Ga0207660_10131387 | 3300025917 | Bacteria | 1906 |
| 361 | Ga0207657_10001614 | 3300025919 | Bacteria | 24260 |
| 362 | Ga0207657_10037866 | 3300025919 | Bacteria | 4301 |
| 363 | Ga0207649_10026472 | 3300025920 | Bacteria | 3393 |
| 364 | Ga0207652_10018883 | 3300025921 | Bacteria | 5659 |
| 365 | Ga0207652_10021249 | 3300025921 | Bacteria | 5356 |
| 366 | Ga0207652_10056452 | 3300025921 | Bacteria | 3380 |
| 367 | Ga0207681_10000130 | 3300025923 | Bacteria | 61067 |
| 368 | Ga0207681_10000140 | 3300025923 | Bacteria | 60064 |
| 369 | Ga0207681_10010126 | 3300025923 | Bacteria | 5770 |
| 370 | Ga0207681_10333281 | 3300025923 | Bacteria | 1210 |
| 371 | Ga0207681_10511467 | 3300025923 | Bacteria | 984 |
| 372 | Ga0207681_10792267 | 3300025923 | Bacteria | 791 |
| 373 | Ga0207694_10005262 | 3300025924 | Bacteria | 9967 |
| 374 | Ga0207694_10007000 | 3300025924 | Bacteria | 8562 |
| 375 | Ga0207694_10046380 | 3300025924 | Bacteria | 3359 |
| 376 | Ga0207694_10103465 | 3300025924 | Bacteria | 2258 |
| 377 | Ga0207694_10534438 | 3300025924 | Bacteria | 983 |
| 378 | Ga0207650_10000142 | 3300025925 | Bacteria | 87599 |
| 379 | Ga0207650_10057847 | 3300025925 | Bacteria | 2885 |
| 380 | Ga0207650_10086523 | 3300025925 | Bacteria | 2386 |
| 381 | Ga0207650_10354042 | 3300025925 | Bacteria | 1208 |
| 382 | Ga0207687_10000259 | 3300025927 | Bacteria | 36055 |
| 383 | Ga0207644_10000811 | 3300025931 | Bacteria | 19839 |
| 384 | Ga0207644_10000818 | 3300025931 | Bacteria | 19768 |
| 385 | Ga0207644_10006799 | 3300025931 | Bacteria | 7454 |
| 386 | Ga0207644_10325543 | 3300025931 | Bacteria | 1243 |
| 387 | Ga0207644_10851638 | 3300025931 | Bacteria | 763 |
| 388 | Ga0207690_10000894 | 3300025932 | Bacteria | 19034 |
| 389 | Ga0207690_10904539 | 3300025932 | Bacteria | 732 |
| 390 | Ga0207706_10000035 | 3300025933 | Bacteria | 138894 |
| 391 | Ga0207706_10009604 | 3300025933 | Bacteria | 8880 |
| 392 | Ga0207706_10095537 | 3300025933 | Bacteria | 2614 |
| 393 | Ga0207709_10314763 | 3300025935 | Bacteria | 1169 |
| 394 | Ga0207709_10429189 | 3300025935 | Bacteria | 1017 |
| 395 | Ga0207670_10039261 | 3300025936 | Bacteria | 3099 |
| 396 | Ga0207711_10000017 | 3300025941 | Bacteria | 441730 |
| 397 | Ga0207711_10071888 | 3300025941 | Bacteria | 3003 |
| 398 | Ga0207711_10202664 | 3300025941 | Bacteria | 1811 |
| 399 | Ga0207689_10117467 | 3300025942 | Bacteria | 2187 |
| 400 | Ga0207661_10132887 | 3300025944 | Bacteria | 2134 |
| 401 | Ga0207661_10170932 | 3300025944 | Bacteria | 1892 |
| 402 | Ga0207679_10070830 | 3300025945 | Bacteria | 2628 |
| 403 | Ga0207667_10016664 | 3300025949 | Bacteria | 8293 |
| 404 | Ga0207667_10056319 | 3300025949 | Bacteria | 4130 |
| 405 | Ga0207667_10090978 | 3300025949 | Bacteria | 3153 |
| 406 | Ga0207667_10093031 | 3300025949 | Bacteria | 3114 |
| 407 | Ga0207667_10392664 | 3300025949 | Bacteria | 1413 |
| 408 | Ga0207667_11041425 | 3300025949 | Bacteria | 804 |
| 409 | Ga0207712_10000001 | 3300025961 | Bacteria | 750309 |
| 410 | Ga0207712_10000527 | 3300025961 | Bacteria | 31373 |
| 411 | Ga0207712_10189723 | 3300025961 | Bacteria | 1621 |
| 412 | Ga0207668_10006786 | 3300025972 | Bacteria | 6779 |
| 413 | Ga0207668_10027876 | 3300025972 | Bacteria | 3685 |
| 414 | Ga0207668_10032021 | 3300025972 | Bacteria | 3470 |
| 415 | Ga0207668_10048371 | 3300025972 | Bacteria | 2918 |
| 416 | Ga0207640_10001101 | 3300025981 | Bacteria | 14929 |
| 417 | Ga0207640_10014152 | 3300025981 | Bacteria | 4586 |
| 418 | Ga0207640_10015711 | 3300025981 | Bacteria | 4387 |
| 419 | Ga0207640_10105323 | 3300025981 | Bacteria | 1987 |
| 420 | Ga0207640_10528614 | 3300025981 | Bacteria | 987 |
| 421 | Ga0207640_11080116 | 3300025981 | Bacteria | 709 |
| 422 | Ga0207640_11259434 | 3300025981 | Bacteria | 659 |
| 423 | Ga0207658_10000133 | 3300025986 | Bacteria | 78402 |
| 424 | Ga0207658_10001207 | 3300025986 | Bacteria | 20562 |
| 425 | Ga0207658_10001257 | 3300025986 | Bacteria | 20066 |
| 426 | Ga0207658_10003755 | 3300025986 | Bacteria | 10697 |
| 427 | Ga0207658_10012197 | 3300025986 | Bacteria | 5864 |
| 428 | Ga0207658_10053887 | 3300025986 | Bacteria | 2974 |
| 429 | Ga0207677_11453050 | 3300026023 | Bacteria | 632 |
| 430 | Ga0207703_10000961 | 3300026035 | Bacteria | 27866 |
| 431 | Ga0207703_10001460 | 3300026035 | Bacteria | 21567 |
| 432 | Ga0207703_10002071 | 3300026035 | Bacteria | 17638 |
| 433 | Ga0207703_10025076 | 3300026035 | Bacteria | 4690 |
| 434 | Ga0207703_10051426 | 3300026035 | Bacteria | 3339 |
| 435 | Ga0207703_10116628 | 3300026035 | Bacteria | 2286 |
| 436 | Ga0207703_10325827 | 3300026035 | Bacteria | 1408 |
| 437 | Ga0207639_10001012 | 3300026041 | Bacteria | 19116 |
| 438 | Ga0207639_10007855 | 3300026041 | Bacteria | 7287 |
| 439 | Ga0207639_10111311 | 3300026041 | Bacteria | 2232 |
| 440 | Ga0207639_10184052 | 3300026041 | Bacteria | 1779 |
| 441 | Ga0207639_10538988 | 3300026041 | Bacteria | 1070 |
| 442 | Ga0207639_10916894 | 3300026041 | Bacteria | 819 |
| 443 | Ga0207678_10028298 | 3300026067 | Bacteria | 4893 |
| 444 | Ga0207678_10106424 | 3300026067 | Bacteria | 2393 |
| 445 | Ga0207702_10043320 | 3300026078 | Bacteria | 3779 |
| 446 | Ga0207702_10139976 | 3300026078 | Bacteria | 2188 |
| 447 | Ga0207641_10000022 | 3300026088 | Bacteria | 279334 |
| 448 | Ga0207641_10000033 | 3300026088 | Bacteria | 219261 |
| 449 | Ga0207641_10000126 | 3300026088 | Bacteria | 112607 |
| 450 | Ga0207641_10020015 | 3300026088 | Bacteria | 5494 |
| 451 | Ga0207676_10000056 | 3300026095 | Bacteria | 124484 |
| 452 | Ga0207676_10011444 | 3300026095 | Bacteria | 6341 |
| 453 | Ga0207676_10337223 | 3300026095 | Bacteria | 1389 |
| 454 | Ga0207676_11395351 | 3300026095 | Bacteria | 696 |
| 455 | Ga0207674_10019205 | 3300026116 | Bacteria | 7410 |
| 456 | Ga0207674_10023877 | 3300026116 | Bacteria | 6540 |
| 457 | Ga0207674_10045037 | 3300026116 | Bacteria | 4541 |
| 458 | Ga0207674_10073006 | 3300026116 | Bacteria | 3445 |
| 459 | Ga0207674_10128780 | 3300026116 | Bacteria | 2496 |
| 460 | Ga0207674_10187178 | 3300026116 | Bacteria | 2020 |
| 461 | Ga0207674_10315125 | 3300026116 | Bacteria | 1513 |
| 462 | Ga0207675_100004034 | 3300026118 | Bacteria | 14233 |
| 463 | Ga0207675_101291922 | 3300026118 | Bacteria | 750 |
| 464 | Ga0207698_10000789 | 3300026142 | Bacteria | 18471 |
| 465 | Ga0207698_10025403 | 3300026142 | Bacteria | 4173 |
| 466 | Ga0207698_10041250 | 3300026142 | Bacteria | 3437 |
| 467 | Ga0207698_10273943 | 3300026142 | Bacteria | 1557 |
| 468 | Ga0209982_1070845 | 3300027552 | Bacteria | 571 |
| 469 | Ga0209813_10000065 | 3300027866 | Bacteria | 42169 |
| 470 | Ga0209813_10070003 | 3300027866 | Bacteria | 1138 |
| 471 | Ga0209974_10014350 | 3300027876 | Bacteria | 2636 |
| 472 | Ga0209974_10065284 | 3300027876 | Bacteria | 1236 |
| 473 | Ga0268266_10000028 | 3300028379 | Bacteria | 425294 |
| 474 | Ga0268266_10000317 | 3300028379 | Bacteria | 76446 |
| 475 | Ga0268266_10011921 | 3300028379 | Bacteria | 7529 |
| 476 | Ga0268266_10027588 | 3300028379 | Bacteria | 4827 |
| 477 | Ga0268265_10000044 | 3300028380 | Bacteria | 182545 |
| 478 | Ga0268265_10000071 | 3300028380 | Bacteria | 132890 |
| 479 | Ga0268265_10004791 | 3300028380 | Bacteria | 9326 |
| 480 | Ga0268265_10008961 | 3300028380 | Bacteria | 6767 |
| 481 | Ga0268265_10319921 | 3300028380 | Bacteria | 1404 |
| 482 | Ga0268264_10000006 | 3300028381 | Bacteria | 827324 |
| 483 | Ga0268264_10000077 | 3300028381 | Bacteria | 252597 |
| 484 | Ga0268264_10009226 | 3300028381 | Bacteria | 8172 |
| 485 | Ga0268264_10021239 | 3300028381 | Bacteria | 5304 |
| 486 | Ga0237817_10090 | 3300030083 | Bacteria | 27984 |
| 487 | Ga0265331_10133611 | 3300031250 | Bacteria | 1131 |
| 488 | Ga0307513_10097855 | 3300031456 | Bacteria | 2968 |
| 489 | Ga0307509_10068266 | 3300031507 | Bacteria | 3721 |
| 490 | Ga0307408_100281517 | 3300031548 | Bacteria | 1385 |
| 491 | Ga0307408_100316845 | 3300031548 | Bacteria | 1312 |
| 492 | Ga0307408_100885506 | 3300031548 | Bacteria | 816 |
| 493 | Ga0307508_10000858 | 3300031616 | Bacteria | 35331 |
| 494 | Ga0316575_10167435 | 3300031665 | Bacteria | 910 |
| 495 | Ga0307405_10236709 | 3300031731 | Bacteria | 1349 |
| 496 | Ga0307405_10700828 | 3300031731 | Bacteria | 838 |
| 497 | Ga0307413_10555867 | 3300031824 | Bacteria | 932 |
| 498 | Ga0307410_10012162 | 3300031852 | Bacteria | 4961 |
| 499 | Ga0307410_10117311 | 3300031852 | Bacteria | 1935 |
| 500 | Ga0307406_10033048 | 3300031901 | Bacteria | 3163 |
| 501 | Ga0307406_10143048 | 3300031901 | Bacteria | 1696 |
| 502 | Ga0307406_10225051 | 3300031901 | Bacteria | 1397 |
| 503 | Ga0307406_10234405 | 3300031901 | Bacteria | 1373 |
| 504 | Ga0307407_10216287 | 3300031903 | Bacteria | 1293 |
| 505 | Ga0307412_10005487 | 3300031911 | Bacteria | 7122 |
| 506 | Ga0307412_10093964 | 3300031911 | Bacteria | 2105 |
| 507 | Ga0307412_10173219 | 3300031911 | Bacteria | 1615 |
| 508 | Ga0307412_10247951 | 3300031911 | Bacteria | 1381 |
| 509 | Ga0307412_10397806 | 3300031911 | Bacteria | 1120 |
| 510 | Ga0307416_101276032 | 3300032002 | Bacteria | 840 |
| 511 | Ga0307416_102036845 | 3300032002 | Bacteria | 676 |
| 512 | Ga0307414_10000918 | 3300032004 | Bacteria | 15065 |
| 513 | Ga0307414_10011317 | 3300032004 | Bacteria | 5227 |
| 514 | Ga0307414_10025158 | 3300032004 | Bacteria | 3808 |
| 515 | Ga0307414_10032511 | 3300032004 | Bacteria | 3436 |
| 516 | Ga0307414_10202579 | 3300032004 | Bacteria | 1615 |
| 517 | Ga0307414_10221998 | 3300032004 | Bacteria | 1552 |
| 518 | Ga0307414_10255086 | 3300032004 | Bacteria | 1460 |
| 519 | Ga0307414_10280158 | 3300032004 | Bacteria | 1400 |
| 520 | Ga0307414_10318250 | 3300032004 | Bacteria | 1323 |
| 521 | Ga0307414_11194778 | 3300032004 | Bacteria | 704 |
| 522 | Ga0307411_10005827 | 3300032005 | Bacteria | 6105 |
| 523 | Ga0307411_10014776 | 3300032005 | Bacteria | 4358 |
| 524 | Ga0307411_10081670 | 3300032005 | Bacteria | 2227 |
| 525 | Ga0307415_100155593 | 3300032126 | Bacteria | 1765 |
| 526 | Ga0307510_10065943 | 3300033180 | Bacteria | 3660 |
| 527 | Ga0373932_0075523 | 3300035112 | Bacteria | 1054 |
| 528 | Ga0316582_0163214 | 3300036647 | Bacteria | 1510 |
| 529 | Ga0316582_0233726 | 3300036647 | Bacteria | 1258 |
| 530 | Ga0316584_0144004 | 3300036712 | Bacteria | 1776 |
| 531 | Ga0316584_0200377 | 3300036712 | Bacteria | 1473 |
| 532 | Ga0395900_0007717 | 3300037418 | Bacteria | 11096 |
| 533 | Ga0395900_0287508 | 3300037418 | Bacteria | 1634 |
| 534 | Ga0395900_0647893 | 3300037418 | Bacteria | 993 |
| 535 | Ga0395898_0023846 | 3300037466 | Bacteria | 6176 |
| 536 | Ga0316581_0041398 | 3300037588 | Bacteria | 1404 |
| 537 | Ga0436364_0420330 | 3300037853 | Bacteria | 1196 |
| 538 | Ga0395901_0008908 | 3300038443 | Bacteria | 10163 |
| 539 | Ga0395901_0042433 | 3300038443 | Bacteria | 4716 |
| 540 | Ga0436363_0349297 | 3300039450 | Bacteria | 1778 |
| 541 | Ga0451791_1703147 | 3300041451 | Bacteria | 695 |
| 542 | Ga0451793_1141815 | 3300041452 | Bacteria | 523 |
| 543 | Ga0451793_1456958 | 3300041452 | Bacteria | 542 |
| 544 | Ga0451807_1257146 | 3300041486 | Bacteria | 869 |
| 545 | Ga0451833_0856020 | 3300041491 | Bacteria | 635 |
| 546 | Ga0451837_0749401 | 3300041494 | Bacteria | 814 |
| 547 | Ga0451839_1354034 | 3300041496 | Bacteria | 621 |
| 548 | Ga0451841_0840733 | 3300041498 | Bacteria | 1072 |
| 549 | Ga0451847_0010677 | 3300041503 | Bacteria | 709 |
| 550 | Ga0451853_0254844 | 3300041512 | Bacteria | 887 |
| 551 | Ga0450894_053352 | 3300042131 | Bacteria | 599 |
| 552 | Ga0466969_0002301 | 3300044656 | Bacteria | 10198 |
| 553 | Ga0466969_0009087 | 3300044656 | Bacteria | 5268 |
| 554 | Ga0466966_0004002 | 3300044684 | Bacteria | 9734 |
| 555 | Ga0466961_0044870 | 3300044693 | Bacteria | 2828 |
| 556 | Ga0453684_0353812 | 3300044712 | Bacteria | 1655 |
| 557 | Ga0453684_0478380 | 3300044712 | Bacteria | 1382 |
| 558 | Ga0466970_0031996 | 3300044765 | Bacteria | 2779 |
| 559 | Ga0466959_0001964 | 3300045049 | Bacteria | 12968 |
| 560 | Ga0451576_0000007 | 3300045051 | Bacteria | 782228 |
| 561 | Ga0495627_000158 | 3300046453 | Bacteria | 77210 |
| 562 | Ga0495638_0001382 | 3300046460 | Bacteria | 22126 |
| 563 | Ga0495638_0044272 | 3300046460 | Bacteria | 2804 |
| 564 | Ga0495638_0245109 | 3300046460 | Bacteria | 990 |
| 565 | Ga0495651_0003251 | 3300046462 | Bacteria | 12469 |
| 566 | Ga0495650_0000831 | 3300046471 | Bacteria | 37263 |
| 567 | Ga0495662_0223583 | 3300046476 | Bacteria | 928 |
| 568 | Ga0495585_0109441 | 3300046492 | Bacteria | 1471 |
| 569 | Ga0495585_0123344 | 3300046492 | Bacteria | 1369 |
| 570 | Ga0495594_0390088 | 3300046499 | Bacteria | 792 |
| 571 | Ga0495596_0000539 | 3300046500 | Bacteria | 23771 |
| 572 | Ga0495607_0021094 | 3300046501 | Bacteria | 4103 |
| 573 | Ga0495607_0382615 | 3300046501 | Bacteria | 643 |
| 574 | Ga0495583_0012555 | 3300046506 | Bacteria | 4784 |
| 575 | Ga0495583_0013765 | 3300046506 | Bacteria | 4493 |
| 576 | Ga0495606_0003910 | 3300046507 | Bacteria | 15336 |
| 577 | Ga0495606_0083175 | 3300046507 | Bacteria | 1985 |
| 578 | Ga0495606_0308935 | 3300046507 | Bacteria | 854 |
| 579 | Ga0495610_0000020 | 3300046512 | Bacteria | 344007 |
| 580 | Ga0495610_0000377 | 3300046512 | Bacteria | 46011 |
| 581 | Ga0495610_0005814 | 3300046512 | Bacteria | 8669 |
| 582 | Ga0495620_0009442 | 3300046515 | Bacteria | 5190 |
| 583 | Ga0495628_0301069 | 3300046516 | Bacteria | 1187 |
| 584 | Ga0495632_0001745 | 3300046519 | Bacteria | 17628 |
| 585 | Ga0495632_0071947 | 3300046519 | Bacteria | 1660 |
| 586 | Ga0495632_0149293 | 3300046519 | Bacteria | 1081 |
| 587 | Ga0495643_0000007 | 3300046522 | Bacteria | 383435 |
| 588 | Ga0495643_0007169 | 3300046522 | Bacteria | 7233 |
| 589 | Ga0495643_0009816 | 3300046522 | Bacteria | 5921 |
| 590 | Ga0495643_0031602 | 3300046522 | Bacteria | 2946 |
| 591 | Ga0495643_0079094 | 3300046522 | Bacteria | 1715 |
| 592 | Ga0495643_0142655 | 3300046522 | Bacteria | 1193 |
| 593 | Ga0495648_0067804 | 3300046524 | Bacteria | 2085 |
| 594 | Ga0495648_0087932 | 3300046524 | Bacteria | 1748 |
| 595 | Ga0495648_0104429 | 3300046524 | Bacteria | 1556 |
| 596 | Ga0495663_0065775 | 3300046525 | Bacteria | 1146 |
| 597 | Ga0495663_0172099 | 3300046525 | Bacteria | 747 |
| 598 | Ga0495663_0277522 | 3300046525 | Bacteria | 600 |
| 599 | Ga0495652_0002206 | 3300046529 | Bacteria | 20433 |
| 600 | Ga0495654_0000374 | 3300046530 | Bacteria | 38569 |
| 601 | Ga0495654_0082873 | 3300046530 | Bacteria | 1500 |
| 602 | Ga0495654_0134778 | 3300046530 | Bacteria | 1105 |
| 603 | Ga0495609_0015309 | 3300046538 | Bacteria | 3591 |
| 604 | Ga0495633_0061326 | 3300046558 | Bacteria | 1761 |
| 605 | Ga0495668_0000001 | 3300046616 | Bacteria | 1013420 |
| 606 | Ga0495668_0006149 | 3300046616 | Bacteria | 7944 |
| 607 | Ga0495668_0092432 | 3300046616 | Bacteria | 1657 |
| 608 | Ga0495625_0000064 | 3300046660 | Bacteria | 174730 |
| 609 | Ga0495625_0000234 | 3300046660 | Bacteria | 86768 |
| 610 | Ga0495625_0010229 | 3300046660 | Bacteria | 7779 |
| 611 | Ga0495588_0275591 | 3300046674 | Bacteria | 886 |
| 612 | Ga0495623_0173384 | 3300046679 | Bacteria | 1258 |
| 613 | Ga0495670_0058817 | 3300046691 | Bacteria | 1929 |
| 614 | Ga0495670_0141020 | 3300046691 | Bacteria | 1260 |
| 615 | Ga0495670_0157714 | 3300046691 | Bacteria | 1191 |
| 616 | Ga0495671_0300610 | 3300046692 | Bacteria | 772 |
| 617 | Ga0495600_0154713 | 3300046809 | Bacteria | 1483 |
| 618 | Ga0495604_0007438 | 3300047317 | Bacteria | 8679 |
| 619 | Ga0495675_0012675 | 3300047444 | Bacteria | 5306 |
| 620 | Ga0495685_116284 | 3300047447 | Bacteria | 879 |
| 621 | Ga0495673_0170009 | 3300047469 | Bacteria | 831 |
| 622 | Ga0495673_0173776 | 3300047469 | Bacteria | 819 |
| 623 | Ga0495681_0000094 | 3300047470 | Bacteria | 77400 |
| 624 | Ga0495686_0000145 | 3300047472 | Bacteria | 141946 |
| 625 | Ga0495686_0027507 | 3300047472 | Bacteria | 3712 |
| 626 | Ga0495686_0027888 | 3300047472 | Bacteria | 3681 |
| 627 | Ga0495686_0048172 | 3300047472 | Bacteria | 2688 |
| 628 | Ga0495686_0175411 | 3300047472 | Bacteria | 1245 |
| 629 | Ga0495615_0000033 | 3300048090 | Bacteria | 45796 |
| 630 | Ga0496100_0011591 | 3300048903 | Bacteria | 5022 |
| 631 | Ga0496100_0061354 | 3300048903 | Bacteria | 2477 |
| 632 | Ga0496100_0801751 | 3300048903 | Bacteria | 738 |
| 633 | Ga0496101_0009157 | 3300048904 | Bacteria | 6498 |
| 634 | Ga0496101_0161863 | 3300048904 | Bacteria | 1716 |
| 635 | Ga0496101_0203804 | 3300048904 | Bacteria | 1530 |
| 636 | Ga0496101_0603190 | 3300048904 | Bacteria | 868 |
| 637 | Ga0496102_0000267 | 3300048905 | Bacteria | 66761 |
| 638 | Ga0496102_0783994 | 3300048905 | Bacteria | 875 |
| 639 | Ga0496102_0890281 | 3300048905 | Bacteria | 812 |
| 640 | Ga0496103_0000139 | 3300048906 | Bacteria | 75158 |
| 641 | Ga0496103_0014470 | 3300048906 | Bacteria | 4684 |
| 642 | Ga0496103_0026678 | 3300048906 | Bacteria | 3496 |
| 643 | Ga0496103_0035486 | 3300048906 | Bacteria | 3053 |
| 644 | Ga0496103_0353879 | 3300048906 | Bacteria | 944 |
| 645 | Ga0496104_0001261 | 3300048907 | Bacteria | 21786 |
| 646 | Ga0496104_0005335 | 3300048907 | Bacteria | 11245 |
| 647 | Ga0496104_0051151 | 3300048907 | Bacteria | 3899 |
| 648 | Ga0496104_0286807 | 3300048907 | Bacteria | 1559 |
| 649 | Ga0496105_0004419 | 3300048908 | Bacteria | 10585 |
| 650 | Ga0496105_0004449 | 3300048908 | Bacteria | 10552 |
| 651 | Ga0496105_0006672 | 3300048908 | Bacteria | 8886 |
| 652 | Ga0496105_0357718 | 3300048908 | Bacteria | 1165 |
| 653 | Ga0496106_0664981 | 3300048909 | Bacteria | 832 |
| 654 | Ga0496106_1505658 | 3300048909 | Bacteria | 517 |
| 655 | Ga0496107_0006170 | 3300048910 | Bacteria | 8232 |
| 656 | Ga0496108_0090157 | 3300048911 | Bacteria | 2606 |
| 657 | Ga0496108_1186244 | 3300048911 | Bacteria | 646 |
| 658 | Ga0496109_0017830 | 3300048912 | Bacteria | 6228 |
| 659 | Ga0496109_0201779 | 3300048912 | Bacteria | 1870 |
| 660 | Ga0496110_0057248 | 3300048913 | Bacteria | 3431 |
| 661 | Ga0496110_0068444 | 3300048913 | Bacteria | 3142 |
| 662 | Ga0496111_0002045 | 3300048914 | Bacteria | 12011 |
| 663 | Ga0496111_0014834 | 3300048914 | Bacteria | 5333 |
| 664 | Ga0496111_0903153 | 3300048914 | Bacteria | 636 |
| 665 | Ga0496112_0588958 | 3300048915 | Bacteria | 1044 |
| 666 | Ga0496112_0600219 | 3300048915 | Bacteria | 1033 |
| 667 | Ga0496113_0007197 | 3300048916 | Bacteria | 7131 |
| 668 | Ga0496113_0110664 | 3300048916 | Bacteria | 2137 |
| 669 | Ga0496114_0023283 | 3300048917 | Bacteria | 5054 |
| 670 | Ga0496114_0056565 | 3300048917 | Bacteria | 3274 |
| 671 | Ga0496114_0241100 | 3300048917 | Bacteria | 1590 |
| 672 | Ga0496116_0013857 | 3300048919 | Bacteria | 6473 |
| 673 | Ga0496117_0009437 | 3300048920 | Bacteria | 9079 |
| 674 | Ga0496117_0034849 | 3300048920 | Bacteria | 3786 |
| 675 | Ga0496117_0102213 | 3300048920 | Bacteria | 1810 |
| 676 | Ga0496117_0128287 | 3300048920 | Bacteria | 1543 |
| 677 | Ga0496117_0220842 | 3300048920 | Bacteria | 1055 |
| 678 | Ga0496118_0003648 | 3300048921 | Bacteria | 19124 |
| 679 | Ga0496118_0006964 | 3300048921 | Bacteria | 12206 |
| 680 | Ga0496118_0020455 | 3300048921 | Bacteria | 5868 |
| 681 | Ga0496118_0083218 | 3300048921 | Bacteria | 2238 |
| 682 | Ga0496118_0084791 | 3300048921 | Bacteria | 2209 |
| 683 | Ga0496118_0190308 | 3300048921 | Bacteria | 1228 |
| 684 | Ga0496119_0000077 | 3300048922 | Bacteria | 143108 |
| 685 | Ga0496119_0000344 | 3300048922 | Bacteria | 65097 |
| 686 | Ga0496119_0012840 | 3300048922 | Bacteria | 6755 |
| 687 | Ga0496119_0066703 | 3300048922 | Bacteria | 2125 |
| 688 | Ga0496120_0005768 | 3300048923 | Bacteria | 9727 |
| 689 | Ga0496120_0205030 | 3300048923 | Bacteria | 952 |
| 690 | Ga0496121_0000022 | 3300048924 | Bacteria | 472849 |
| 691 | Ga0496121_0000222 | 3300048924 | Bacteria | 123595 |
| 692 | Ga0496121_0002362 | 3300048924 | Bacteria | 29040 |
| 693 | Ga0496121_0009408 | 3300048924 | Bacteria | 11239 |
| 694 | Ga0496121_0058612 | 3300048924 | Bacteria | 3181 |
| 695 | Ga0496121_0685237 | 3300048924 | Bacteria | 619 |
| 696 | Ga0496122_0002268 | 3300048925 | Bacteria | 27820 |
| 697 | Ga0496122_0006858 | 3300048925 | Bacteria | 12900 |
| 698 | Ga0496122_0008242 | 3300048925 | Bacteria | 11310 |
| 699 | Ga0496122_0011513 | 3300048925 | Bacteria | 8947 |
| 700 | Ga0496122_0016389 | 3300048925 | Bacteria | 7014 |
| 701 | Ga0496123_0003406 | 3300048926 | Bacteria | 17901 |
| 702 | Ga0496123_0005241 | 3300048926 | Bacteria | 13168 |
| 703 | Ga0496123_0005963 | 3300048926 | Bacteria | 11998 |
| 704 | Ga0496123_0016981 | 3300048926 | Bacteria | 5876 |
| 705 | Ga0496124_0006200 | 3300048927 | Bacteria | 13103 |
| 706 | Ga0496124_0183938 | 3300048927 | Bacteria | 1605 |
| 707 | Ga0496124_0263061 | 3300048927 | Bacteria | 1268 |
| 708 | Ga0496125_0007827 | 3300048928 | Bacteria | 11295 |
| 709 | Ga0496125_0016149 | 3300048928 | Bacteria | 7180 |
| 710 | Ga0496125_0028887 | 3300048928 | Bacteria | 4995 |
| 711 | Ga0496125_0042962 | 3300048928 | Bacteria | 3843 |
| 712 | Ga0496126_0000079 | 3300048929 | Bacteria | 222463 |
| 713 | Ga0496126_0000619 | 3300048929 | Bacteria | 66827 |
| 714 | Ga0496126_0003256 | 3300048929 | Bacteria | 20755 |
| 715 | Ga0496126_0004371 | 3300048929 | Bacteria | 16942 |
| 716 | Ga0496126_0026032 | 3300048929 | Bacteria | 5617 |
| 717 | Ga0496126_0042184 | 3300048929 | Bacteria | 4215 |
| 718 | Ga0496126_0563927 | 3300048929 | Bacteria | 902 |
| 719 | Ga0495678_026512 | 3300049459 | Bacteria | 2473 |
| 720 | Ga0495682_0132776 | 3300049460 | Bacteria | 890 |
| 721 | Ga0501300_034046 | 3300049523 | Bacteria | 756 |
| 722 | Ga0501032_0006527 | 3300049569 | Bacteria | 8567 |
| 723 | Ga0501033_0004215 | 3300049570 | Bacteria | 11571 |
| 724 | Ga0501033_0031389 | 3300049570 | Bacteria | 3992 |
| 725 | Ga0501034_0010865 | 3300049571 | Bacteria | 9457 |
| 726 | Ga0501034_0326993 | 3300049571 | Bacteria | 1465 |
| 727 | Ga0501036_0025362 | 3300049572 | Bacteria | 5001 |
| 728 | Ga0501037_0009034 | 3300049573 | Bacteria | 7304 |
| 729 | Ga0501038_0017668 | 3300049574 | Bacteria | 6447 |
| 730 | Ga0501039_0091478 | 3300049575 | Bacteria | 2371 |
| 731 | Ga0501043_1161883 | 3300049579 | Bacteria | 543 |
| 732 | Ga0501046_0067378 | 3300049580 | Bacteria | 2788 |
| 733 | Ga0501047_0004376 | 3300049581 | Bacteria | 13293 |
| 734 | Ga0501047_0119971 | 3300049581 | Bacteria | 2512 |
| 735 | Ga0501047_0414497 | 3300049581 | Bacteria | 1179 |
| 736 | Ga0501047_0431344 | 3300049581 | Bacteria | 1149 |
| 737 | Ga0501048_0186999 | 3300049582 | Bacteria | 1468 |
| 738 | Ga0501080_0323625 | 3300049742 | Bacteria | 1395 |
| 739 | Ga0501083_0743537 | 3300049744 | Bacteria | 638 |
| 740 | Ga0501035_0017712 | 3300049822 | Bacteria | 6570 |
| 741 | Ga0501035_0167219 | 3300049822 | Bacteria | 1901 |
| 742 | Ga0501035_0853382 | 3300049822 | Bacteria | 724 |
| 743 | Ga0501044_0000098 | 3300049823 | Bacteria | 107528 |
| 744 | Ga0501044_0007203 | 3300049823 | Bacteria | 12234 |
| 745 | Ga0501044_0030831 | 3300049823 | Bacteria | 5647 |
| 746 | Ga0501044_0205691 | 3300049823 | Bacteria | 1925 |
| 747 | Ga0501044_0319955 | 3300049823 | Bacteria | 1476 |
| 748 | nmdc:mga03683_149_c1 | 3300050489 | Bacteria | 23934 |
| 749 | nmdc:mga03683_30_c1 | 3300050489 | Bacteria | 71765 |
| 750 | nmdc:mga03n38_147852_c1 | 3300050490 | Bacteria | 1180 |
| 751 | nmdc:mga03n38_6284_c1 | 3300050490 | Bacteria | 4116 |
| 752 | nmdc:mga00v17_125984_c1 | 3300050491 | Bacteria | 1634 |
| 753 | nmdc:mga00v17_798_c1 | 3300050491 | Bacteria | 17178 |
| 754 | nmdc:mga00v17_83529_c1 | 3300050491 | Bacteria | 1998 |
| 755 | nmdc:mga0k408_17004_c1 | 3300050493 | Bacteria | 4043 |
| 756 | nmdc:mga0k408_2730_c1 | 3300050493 | Bacteria | 9376 |
| 757 | nmdc:mga0k408_328445_c1 | 3300050493 | Bacteria | 912 |
| 758 | nmdc:mga0k408_49594_c1 | 3300050493 | Bacteria | 2430 |
| 759 | nmdc:mga0k408_563438_c1 | 3300050493 | Bacteria | 673 |
| 760 | nmdc:mga06z11_149346_c1 | 3300050494 | Bacteria | 1327 |
| 761 | nmdc:mga06z11_61_c1 | 3300050494 | Bacteria | 46697 |
| 762 | nmdc:mga04h51_1140_c1 | 3300050495 | Bacteria | 6137 |
| 763 | nmdc:mga04h51_49320_c1 | 3300050495 | Bacteria | 1406 |
| 764 | nmdc:mga07m45_155417_c1 | 3300050496 | Bacteria | 1327 |
| 765 | nmdc:mga07m45_19103_c1 | 3300050496 | Bacteria | 3709 |
| 766 | nmdc:mga07m45_238675_c1 | 3300050496 | Bacteria | 1058 |
| 767 | nmdc:mga07m45_29618_c2 | 3300050496 | Bacteria | 1449 |
| 768 | nmdc:mga07m45_368022_c1 | 3300050496 | Bacteria | 835 |
| 769 | nmdc:mga07m45_3935_c1 | 3300050496 | Bacteria | 7223 |
| 770 | nmdc:mga07m45_4960_c1 | 3300050496 | Bacteria | 6565 |
| 771 | nmdc:mga07m45_6_c1 | 3300050496 | Bacteria | 260521 |
| 772 | nmdc:mga0rr50_1197089_c1 | 3300050513 | Bacteria | 645 |
| 773 | nmdc:mga0sz30_114985_c1 | 3300050516 | Bacteria | 1181 |
| 774 | nmdc:mga0sz30_138_c1 | 3300050516 | Bacteria | 26910 |
| 775 | Ga0500643_000001 | 3300053087 | Bacteria | 1440111 |
| 776 | Ga0500643_004834 | 3300053087 | Bacteria | 5953 |
| 777 | Ga0500643_063823 | 3300053087 | Bacteria | 1030 |
| 778 | Ga0500647_0014953 | 3300053091 | Bacteria | 3540 |
| 779 | Ga0500651_0176403 | 3300053093 | Bacteria | 1271 |
| 780 | Ga0500556_0000122 | 3300053104 | Bacteria | 67150 |
| 781 | Ga0500562_048940 | 3300053108 | Bacteria | 1129 |
| 782 | Ga0500592_005142 | 3300053116 | Bacteria | 2080 |
| 783 | Ga0500592_013611 | 3300053116 | Bacteria | 1304 |
| 784 | Ga0500592_051448 | 3300053116 | Bacteria | 670 |
| 785 | Ga0500594_0063912 | 3300053118 | Bacteria | 1067 |
| 786 | Ga0500595_000472 | 3300053119 | Bacteria | 24818 |
| 787 | Ga0500595_007244 | 3300053119 | Bacteria | 4614 |
| 788 | Ga0500607_000287 | 3300053121 | Bacteria | 48083 |
| 789 | Ga0500607_000802 | 3300053121 | Bacteria | 30266 |
| 790 | Ga0500608_001154 | 3300053122 | Bacteria | 9395 |
| 791 | Ga0500618_037319 | 3300053125 | Bacteria | 1123 |
| 792 | Ga0500652_004515 | 3300053131 | Bacteria | 4313 |
| 793 | Ga0500652_119944 | 3300053131 | Bacteria | 1099 |
| 794 | Ga0500652_254584 | 3300053131 | Bacteria | 694 |
| 795 | Ga0500658_0001199 | 3300053134 | Bacteria | 10547 |
| 796 | Ga0500658_0089523 | 3300053134 | Bacteria | 1329 |
| 797 | Ga0500559_0002605 | 3300053136 | Bacteria | 9209 |
| 798 | Ga0500559_0010186 | 3300053136 | Bacteria | 4042 |
| 799 | Ga0500559_0016106 | 3300053136 | Bacteria | 3157 |
| 800 | Ga0500559_0036136 | 3300053136 | Bacteria | 2135 |
| 801 | Ga0500559_0098195 | 3300053136 | Bacteria | 1347 |
| 802 | Ga0500559_0104037 | 3300053136 | Bacteria | 1310 |
| 803 | Ga0500559_0384310 | 3300053136 | Bacteria | 654 |
| 804 | Ga0500564_002032 | 3300053138 | Bacteria | 7302 |
| 805 | Ga0500568_0002610 | 3300053139 | Bacteria | 10480 |
| 806 | Ga0500568_0036903 | 3300053139 | Bacteria | 1986 |
| 807 | Ga0500568_0097327 | 3300053139 | Bacteria | 1106 |
| 808 | Ga0500568_0135285 | 3300053139 | Bacteria | 915 |
| 809 | Ga0500568_0184394 | 3300053139 | Bacteria | 767 |
| 810 | Ga0500573_0000082 | 3300053140 | Bacteria | 45547 |
| 811 | Ga0500573_0197675 | 3300053140 | Bacteria | 1070 |
| 812 | Ga0500573_0314262 | 3300053140 | Bacteria | 777 |
| 813 | Ga0500573_0461430 | 3300053140 | Bacteria | 584 |
| 814 | Ga0500577_0010263 | 3300053142 | Bacteria | 2751 |
| 815 | Ga0500588_0130445 | 3300053146 | Bacteria | 894 |
| 816 | Ga0500590_000142 | 3300053148 | Bacteria | 19990 |
| 817 | Ga0500590_034104 | 3300053148 | Bacteria | 2636 |
| 818 | Ga0500604_0030279 | 3300053151 | Bacteria | 1582 |
| 819 | Ga0500604_0050022 | 3300053151 | Bacteria | 1287 |
| 820 | Ga0500616_0004405 | 3300053153 | Bacteria | 10045 |
| 821 | Ga0500616_0015221 | 3300053153 | Bacteria | 4403 |
| 822 | Ga0500616_0049565 | 3300053153 | Bacteria | 2221 |
| 823 | Ga0500619_247062 | 3300053154 | Bacteria | 588 |
| 824 | Ga0500622_0014303 | 3300053156 | Bacteria | 4264 |
| 825 | Ga0500627_0000004 | 3300053158 | Bacteria | 174208 |
| 826 | Ga0500627_0000231 | 3300053158 | Bacteria | 15882 |
| 827 | Ga0500630_250872 | 3300053159 | Bacteria | 628 |
| 828 | Ga0500637_0071845 | 3300053178 | Bacteria | 1990 |
| 829 | Ga0500625_000022 | 3300053729 | Bacteria | 78028 |
| 830 | Ga0500625_065684 | 3300053729 | Bacteria | 1631 |
| 831 | Ga0500645_003394 | 3300053730 | Bacteria | 6499 |
| 832 | Ga0500645_029629 | 3300053730 | Bacteria | 1651 |
| 833 | Ga0466962_0018926 | 3300061719 | Bacteria | 3309 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025302 | Ga0207426_1011617 | Ga0207426_10116173 | 125 |
| 2 | 3300048905 | Ga0496102_0783994 | Ga0496102_0783994_74_460 | 125 |
| 3 | 3300048909 | Ga0496106_1505658 | Ga0496106_1505658_47_433 | 125 |
| 4 | 3300048914 | Ga0496111_0903153 | Ga0496111_0903153_48_434 | 125 |
| 5 | 3300048915 | Ga0496112_0588958 | Ga0496112_0588958_390_776 | 125 |
| 6 | 3300048920 | Ga0496117_0102213 | Ga0496117_0102213_1038_1424 | 125 |
| 7 | 3300048922 | Ga0496119_0012840 | Ga0496119_0012840_2279_2665 | 125 |
| 8 | 3300002987 | JGI25159J45721_1044908 | JGI25159J45721_10449081 | 133 |
| 9 | 3300003758 | Ga0055532_1000115 | Ga0055532_100011539 | 133 |
| 10 | 3300025229 | Ga0209147_100088 | Ga0209147_100088126 | 133 |
| 11 | iso_pu_bacteria | 2842882022 | 2842883595 | 140 |
| 12 | iso_pu_bacteria | 2904524088 | 2904525384 | 140 |
| 13 | iso_pu_bacteria | 2919143609 | 2919146035 | 140 |
| 14 | iso_pu_bacteria | 2919517244 | 2919517959 | 140 |
| 15 | iso_pu_bacteria | 2928093941 | 2928097123 | 140 |
| 16 | iso_pu_bacteria | 2929004312 | 2929010097 | 140 |
| 17 | iso_pu_bacteria | 2960375949 | 2960380431 | 140 |
| 18 | iso_pu_bacteria | 8022893055 | 8022896689 | 140 |
| 19 | 3300003187 | JGI25151J46595_10011677 | JGI25151J46595_100116775 | 141 |
| 20 | 3300003187 | JGI25151J46595_10014794 | JGI25151J46595_100147944 | 141 |
| 21 | 3300003187 | JGI25151J46595_10015684 | JGI25151J46595_100156844 | 141 |
| 22 | 3300003761 | Ga0055535_1004854 | Ga0055535_10048544 | 141 |
| 23 | 3300003761 | Ga0055535_1013750 | Ga0055535_10137502 | 141 |
| 24 | 3300003841 | Ga0055541_1000733 | Ga0055541_10007338 | 141 |
| 25 | 3300009092 | Ga0105250_10104782 | Ga0105250_101047821 | 141 |
| 26 | 3300025225 | Ga0209566_100042 | Ga0209566_100042230 | 141 |
| 27 | 3300025242 | Ga0209258_100827 | Ga0209258_1008274 | 141 |
| 28 | 3300025242 | Ga0209258_103603 | Ga0209258_1036034 | 141 |
| 29 | 3300025284 | Ga0209130_1017142 | Ga0209130_10171423 | 141 |
| 30 | 3300025292 | Ga0209676_1005754 | Ga0209676_10057542 | 141 |
| 31 | 3300025294 | Ga0209025_1001397 | Ga0209025_100139722 | 141 |
| 32 | 3300025294 | Ga0209025_1001925 | Ga0209025_100192524 | 141 |
| 33 | 3300025294 | Ga0209025_1010389 | Ga0209025_10103896 | 141 |
| 34 | 3300025711 | Ga0207696_1031890 | Ga0207696_10318901 | 141 |
| 35 | 3300030083 | Ga0237817_10090 | Ga0237817_1009021 | 141 |
| 36 | 3300003187 | JGI25151J46595_10001678 | JGI25151J46595_1000167814 | 144 |
| 37 | 3300003187 | JGI25151J46595_10010952 | JGI25151J46595_100109523 | 144 |
| 38 | 3300003790 | Ga0055528_1003541 | Ga0055528_10035416 | 144 |
| 39 | 3300009011 | Ga0105251_10007785 | Ga0105251_100077858 | 144 |
| 40 | 3300009036 | Ga0105244_10016502 | Ga0105244_100165025 | 144 |
| 41 | 3300009092 | Ga0105250_10002953 | Ga0105250_100029533 | 144 |
| 42 | 3300009092 | Ga0105250_10021336 | Ga0105250_100213362 | 144 |
| 43 | 3300011119 | Ga0105246_10011029 | Ga0105246_100110295 | 144 |
| 44 | 3300013296 | Ga0157374_10027466 | Ga0157374_100274667 | 144 |
| 45 | 3300013297 | Ga0157378_10417725 | Ga0157378_104177252 | 144 |
| 46 | 3300014745 | Ga0157377_10373619 | Ga0157377_103736192 | 144 |
| 47 | 3300025229 | Ga0209147_105356 | Ga0209147_1053563 | 144 |
| 48 | 3300025273 | Ga0209673_1002724 | Ga0209673_100272417 | 144 |
| 49 | 3300025294 | Ga0209025_1003543 | Ga0209025_100354315 | 144 |
| 50 | 3300025294 | Ga0209025_1009349 | Ga0209025_10093496 | 144 |
| 51 | 3300025711 | Ga0207696_1011155 | Ga0207696_10111552 | 144 |
| 52 | 3300025711 | Ga0207696_1031305 | Ga0207696_10313052 | 144 |
| 53 | 3300025728 | Ga0207655_1005646 | Ga0207655_100564612 | 144 |
| 54 | 3300025728 | Ga0207655_1013231 | Ga0207655_10132312 | 144 |
| 55 | 3300025735 | Ga0207713_1007454 | Ga0207713_10074548 | 144 |
| 56 | 3300025735 | Ga0207713_1046744 | Ga0207713_10467442 | 144 |
| 57 | 3300046492 | Ga0495585_0109441 | Ga0495585_0109441_317_760 | 144 |
| 58 | 3300048903 | Ga0496100_0061354 | Ga0496100_0061354_1619_2062 | 144 |
| 59 | 3300048904 | Ga0496101_0009157 | Ga0496101_0009157_2335_2778 | 144 |
| 60 | 3300048905 | Ga0496102_0890281 | Ga0496102_0890281_225_668 | 144 |
| 61 | 3300048906 | Ga0496103_0026678 | Ga0496103_0026678_2187_2630 | 144 |
| 62 | 3300048907 | Ga0496104_0005335 | Ga0496104_0005335_8719_9162 | 144 |
| 63 | 3300048908 | Ga0496105_0006672 | Ga0496105_0006672_222_665 | 144 |
| 64 | 3300048910 | Ga0496107_0006170 | Ga0496107_0006170_7641_8084 | 144 |
| 65 | 3300048911 | Ga0496108_0090157 | Ga0496108_0090157_53_496 | 144 |
| 66 | 3300048912 | Ga0496109_0017830 | Ga0496109_0017830_2193_2636 | 144 |
| 67 | 3300048913 | Ga0496110_0057248 | Ga0496110_0057248_1619_2062 | 144 |
| 68 | 3300048914 | Ga0496111_0002045 | Ga0496111_0002045_2257_2700 | 144 |
| 69 | 3300048916 | Ga0496113_0110664 | Ga0496113_0110664_1370_1813 | 144 |
| 70 | 3300048917 | Ga0496114_0241100 | Ga0496114_0241100_729_1172 | 144 |
| 71 | 3300048919 | Ga0496116_0013857 | Ga0496116_0013857_2044_2487 | 144 |
| 72 | 3300048925 | Ga0496122_0016389 | Ga0496122_0016389_3878_4321 | 144 |
| 73 | 3300048928 | Ga0496125_0042962 | Ga0496125_0042962_2149_2592 | 144 |
| 74 | 3300048929 | Ga0496126_0026032 | Ga0496126_0026032_4950_5393 | 144 |
| 75 | 3300031548 | Ga0307408_100281517 | Ga0307408_1002815172 | 146 |
| 76 | 3300031852 | Ga0307410_10117311 | Ga0307410_101173112 | 146 |
| 77 | 3300031901 | Ga0307406_10143048 | Ga0307406_101430482 | 146 |
| 78 | 3300031903 | Ga0307407_10216287 | Ga0307407_102162872 | 146 |
| 79 | 3300032002 | Ga0307416_102036845 | Ga0307416_1020368451 | 146 |
| 80 | 3300032004 | Ga0307414_10255086 | Ga0307414_102550862 | 146 |
| 81 | 3300032005 | Ga0307411_10014776 | Ga0307411_100147762 | 146 |
| 82 | iso_pu_bacteria | 2558860280 | 2559431598 | 147 |
| 83 | 3300031548 | Ga0307408_100885506 | Ga0307408_1008855061 | 148 |
| 84 | 3300031731 | Ga0307405_10700828 | Ga0307405_107008281 | 148 |
| 85 | 3300031852 | Ga0307410_10012162 | Ga0307410_100121622 | 148 |
| 86 | 3300031901 | Ga0307406_10033048 | Ga0307406_100330482 | 148 |
| 87 | 3300032002 | Ga0307416_101276032 | Ga0307416_1012760321 | 148 |
| 88 | 3300032004 | Ga0307414_10318250 | Ga0307414_103182502 | 148 |
| 89 | 3300032005 | Ga0307411_10005827 | Ga0307411_100058272 | 148 |
| 90 | 3300032126 | Ga0307415_100155593 | Ga0307415_1001555932 | 148 |
| 91 | 3300046462 | Ga0495651_0003251 | Ga0495651_0003251_2338_2796 | 149 |
| 92 | 3300046516 | Ga0495628_0301069 | Ga0495628_0301069_579_1037 | 149 |
| 93 | 3300046529 | Ga0495652_0002206 | Ga0495652_0002206_3378_3836 | 149 |
| 94 | 3300046809 | Ga0495600_0154713 | Ga0495600_0154713_43_501 | 149 |
| 95 | iso_pu_bacteria | 2599185354 | 2600201360 | 149 |
| 96 | iso_pu_bacteria | 2751185897 | 2753764538 | 149 |
| 97 | iso_pu_bacteria | 2830075706 | 2830077851 | 149 |
| 98 | iso_pu_bacteria | 2885429604 | 2885430055 | 149 |
| 99 | iso_pu_bacteria | 2928027323 | 2928027916 | 149 |
| 100 | iso_pu_bacteria | 2946787523 | 2946788108 | 149 |
| 101 | iso_pu_bacteria | 2984555340 | 2984558708 | 149 |
| 102 | iso_pu_bacteria | 2984564862 | 2984566786 | 149 |
| 103 | iso_pu_bacteria | 2990265787 | 2990266621 | 149 |
| 104 | iso_pu_bacteria | 2993356040 | 2993357974 | 149 |
| 105 | iso_pu_bacteria | 2993693658 | 2993695580 | 149 |
| 106 | 3300009011 | Ga0105251_10006102 | Ga0105251_100061022 | 150 |
| 107 | 3300009101 | Ga0105247_10087521 | Ga0105247_100875212 | 150 |
| 108 | 3300014968 | Ga0157379_10037286 | Ga0157379_100372863 | 150 |
| 109 | iso_pu_bacteria | 2510917021 | 2511128434 | 150 |
| 110 | iso_pu_bacteria | 2513237087 | 2513590826 | 150 |
| 111 | iso_pu_bacteria | 2738541275 | 2738709836 | 150 |
| 112 | iso_pu_bacteria | 2738541301 | 2738848261 | 150 |
| 113 | iso_pu_bacteria | 2738541304 | 2738863990 | 150 |
| 114 | iso_pu_bacteria | 2738543022 | 2739296508 | 150 |
| 115 | iso_pu_bacteria | 2738543033 | 2739358186 | 150 |
| 116 | iso_pu_bacteria | 2739367664 | 2739650439 | 150 |
| 117 | iso_pu_bacteria | 2739367865 | 2740028912 | 150 |
| 118 | iso_pu_bacteria | 2818991438 | 2819553198 | 150 |
| 119 | iso_pu_bacteria | 2828305725 | 2828307001 | 150 |
| 120 | iso_pu_bacteria | 2896253425 | 2896256664 | 150 |
| 121 | iso_pu_bacteria | 2919138771 | 2919140035 | 150 |
| 122 | iso_pu_bacteria | 2919450847 | 2919454962 | 150 |
| 123 | iso_pu_bacteria | 2928100450 | 2928101384 | 150 |
| 124 | iso_pu_bacteria | 2928959182 | 2928960204 | 150 |
| 125 | iso_pu_bacteria | 3000865235 | 3000865411 | 150 |
| 126 | iso_pu_bacteria | 8001845381 | 8001849292 | 150 |
| 127 | iso_pu_bacteria | 8054302542 | 8054305669 | 150 |
| 128 | 3300001915 | JGI24741J21665_1017119 | JGI24741J21665_10171192 | 151 |
| 129 | 3300001989 | JGI24739J22299_10003686 | JGI24739J22299_100036863 | 151 |
| 130 | 3300002075 | JGI24738J21930_10008464 | JGI24738J21930_100084642 | 151 |
| 131 | 3300003911 | JGI25405J52794_10001431 | JGI25405J52794_100014314 | 151 |
| 132 | 3300005456 | Ga0070678_101149545 | Ga0070678_1011495451 | 151 |
| 133 | 3300005457 | Ga0070662_100027322 | Ga0070662_1000273222 | 151 |
| 134 | 3300005539 | Ga0068853_100008448 | Ga0068853_1000084486 | 151 |
| 135 | 3300005539 | Ga0068853_100013171 | Ga0068853_1000131714 | 151 |
| 136 | 3300005563 | Ga0068855_100588600 | Ga0068855_1005886002 | 151 |
| 137 | 3300005577 | Ga0068857_100088803 | Ga0068857_1000888033 | 151 |
| 138 | 3300005578 | Ga0068854_100039497 | Ga0068854_1000394973 | 151 |
| 139 | 3300005616 | Ga0068852_100435229 | Ga0068852_1004352292 | 151 |
| 140 | 3300005937 | Ga0081455_10001124 | Ga0081455_100011247 | 151 |
| 141 | 3300009551 | Ga0105238_10058547 | Ga0105238_100585472 | 151 |
| 142 | 3300009551 | Ga0105238_10078333 | Ga0105238_100783333 | 151 |
| 143 | 3300013297 | Ga0157378_10065632 | Ga0157378_100656323 | 151 |
| 144 | 3300025924 | Ga0207694_10103465 | Ga0207694_101034652 | 151 |
| 145 | 3300025933 | Ga0207706_10009604 | Ga0207706_100096045 | 151 |
| 146 | 3300025981 | Ga0207640_11080116 | Ga0207640_110801162 | 151 |
| 147 | 3300026041 | Ga0207639_10007855 | Ga0207639_100078555 | 151 |
| 148 | 3300026041 | Ga0207639_10916894 | Ga0207639_109168942 | 151 |
| 149 | 3300026116 | Ga0207674_10019205 | Ga0207674_100192055 | 151 |
| 150 | 3300026142 | Ga0207698_10273943 | Ga0207698_102739432 | 151 |
| 151 | 3300031548 | Ga0307408_100316845 | Ga0307408_1003168452 | 151 |
| 152 | 3300031731 | Ga0307405_10236709 | Ga0307405_102367091 | 151 |
| 153 | 3300031911 | Ga0307412_10173219 | Ga0307412_101732192 | 151 |
| 154 | 3300044656 | Ga0466969_0002301 | Ga0466969_0002301_7899_8369 | 151 |
| 155 | 3300044656 | Ga0466969_0009087 | Ga0466969_0009087_3792_4262 | 151 |
| 156 | 3300044684 | Ga0466966_0004002 | Ga0466966_0004002_3370_3840 | 151 |
| 157 | 3300044693 | Ga0466961_0044870 | Ga0466961_0044870_750_1220 | 151 |
| 158 | 3300044765 | Ga0466970_0031996 | Ga0466970_0031996_33_503 | 151 |
| 159 | 3300045049 | Ga0466959_0001964 | Ga0466959_0001964_9072_9542 | 151 |
| 160 | 3300046476 | Ga0495662_0223583 | Ga0495662_0223583_23_484 | 151 |
| 161 | 3300046499 | Ga0495594_0390088 | Ga0495594_0390088_54_515 | 151 |
| 162 | 3300046525 | Ga0495663_0065775 | Ga0495663_0065775_217_675 | 151 |
| 163 | 3300046530 | Ga0495654_0000374 | Ga0495654_0000374_931_1389 | 151 |
| 164 | 3300046616 | Ga0495668_0006149 | Ga0495668_0006149_3479_3937 | 151 |
| 165 | 3300046679 | Ga0495623_0173384 | Ga0495623_0173384_645_1106 | 151 |
| 166 | 3300047317 | Ga0495604_0007438 | Ga0495604_0007438_4679_5140 | 151 |
| 167 | 3300047444 | Ga0495675_0012675 | Ga0495675_0012675_4488_4949 | 151 |
| 168 | 3300047447 | Ga0495685_116284 | Ga0495685_116284_279_737 | 151 |
| 169 | 3300048921 | Ga0496118_0084791 | Ga0496118_0084791_223_684 | 151 |
| 170 | 3300049459 | Ga0495678_026512 | Ga0495678_026512_816_1274 | 151 |
| 171 | 3300053116 | Ga0500592_013611 | Ga0500592_013611_311_769 | 151 |
| 172 | 3300053116 | Ga0500592_051448 | Ga0500592_051448_76_534 | 151 |
| 173 | 3300053139 | Ga0500568_0036903 | Ga0500568_0036903_973_1431 | 151 |
| 174 | 3300053151 | Ga0500604_0030279 | Ga0500604_0030279_513_971 | 151 |
| 175 | 3300053158 | Ga0500627_0000231 | Ga0500627_0000231_659_1117 | 151 |
| 176 | 3300061719 | Ga0466962_0018926 | Ga0466962_0018926_1997_2467 | 151 |
| 177 | 3300001432 | JGI24034J14986_101037 | JGI24034J14986_1010372 | 152 |
| 178 | 3300001976 | JGI24752J21851_1000036 | JGI24752J21851_100003613 | 152 |
| 179 | 3300002070 | JGI24750J21931_1000424 | JGI24750J21931_10004245 | 152 |
| 180 | 3300002074 | JGI24748J21848_1000029 | JGI24748J21848_100002943 | 152 |
| 181 | 3300002239 | JGI24034J26672_10000006 | JGI24034J26672_10000006190 | 152 |
| 182 | 3300002244 | JGI24742J22300_10002270 | JGI24742J22300_100022702 | 152 |
| 183 | 3300005330 | Ga0070690_100000002 | Ga0070690_100000002163 | 152 |
| 184 | 3300005335 | Ga0070666_10000014 | Ga0070666_1000001424 | 152 |
| 185 | 3300005340 | Ga0070689_100033303 | Ga0070689_1000333032 | 152 |
| 186 | 3300005347 | Ga0070668_100043654 | Ga0070668_1000436541 | 152 |
| 187 | 3300005353 | Ga0070669_100000839 | Ga0070669_1000008392 | 152 |
| 188 | 3300005365 | Ga0070688_100019885 | Ga0070688_1000198852 | 152 |
| 189 | 3300005367 | Ga0070667_100012128 | Ga0070667_1000121282 | 152 |
| 190 | 3300005466 | Ga0070685_10000056 | Ga0070685_1000005624 | 152 |
| 191 | 3300005544 | Ga0070686_100000002 | Ga0070686_100000002143 | 152 |
| 192 | 3300005548 | Ga0070665_100000025 | Ga0070665_100000025192 | 152 |
| 193 | 3300005549 | Ga0070704_100406164 | Ga0070704_1004061642 | 152 |
| 194 | 3300005618 | Ga0068864_100022037 | Ga0068864_1000220372 | 152 |
| 195 | 3300005719 | Ga0068861_100004572 | Ga0068861_1000045725 | 152 |
| 196 | 3300005841 | Ga0068863_100000070 | Ga0068863_10000007033 | 152 |
| 197 | 3300005842 | Ga0068858_100003260 | Ga0068858_1000032604 | 152 |
| 198 | 3300005843 | Ga0068860_100000001 | Ga0068860_100000001532 | 152 |
| 199 | 3300005844 | Ga0068862_100000020 | Ga0068862_100000020223 | 152 |
| 200 | 3300009011 | Ga0105251_10052664 | Ga0105251_100526642 | 152 |
| 201 | 3300009092 | Ga0105250_10189082 | Ga0105250_101890821 | 152 |
| 202 | 3300009551 | Ga0105238_11443078 | Ga0105238_114430781 | 152 |
| 203 | 3300009553 | Ga0105249_10000005 | Ga0105249_10000005210 | 152 |
| 204 | 3300013306 | Ga0163162_10097636 | Ga0163162_100976362 | 152 |
| 205 | 3300014968 | Ga0157379_10083251 | Ga0157379_100832512 | 152 |
| 206 | 3300017792 | Ga0163161_10000115 | Ga0163161_1000011542 | 152 |
| 207 | 3300025903 | Ga0207680_10000004 | Ga0207680_10000004337 | 152 |
| 208 | 3300025923 | Ga0207681_10000130 | Ga0207681_1000013015 | 152 |
| 209 | 3300025925 | Ga0207650_10057847 | Ga0207650_100578473 | 152 |
| 210 | 3300025931 | Ga0207644_10006799 | Ga0207644_100067998 | 152 |
| 211 | 3300025936 | Ga0207670_10039261 | Ga0207670_100392612 | 152 |
| 212 | 3300025961 | Ga0207712_10000001 | Ga0207712_10000001211 | 152 |
| 213 | 3300025972 | Ga0207668_10032021 | Ga0207668_100320212 | 152 |
| 214 | 3300025986 | Ga0207658_10001207 | Ga0207658_1000120714 | 152 |
| 215 | 3300026035 | Ga0207703_10001460 | Ga0207703_100014602 | 152 |
| 216 | 3300026088 | Ga0207641_10000033 | Ga0207641_10000033143 | 152 |
| 217 | 3300026095 | Ga0207676_10337223 | Ga0207676_103372232 | 152 |
| 218 | 3300026118 | Ga0207675_100004034 | Ga0207675_1000040348 | 152 |
| 219 | 3300028379 | Ga0268266_10000028 | Ga0268266_10000028194 | 152 |
| 220 | 3300028380 | Ga0268265_10000071 | Ga0268265_1000007142 | 152 |
| 221 | 3300028381 | Ga0268264_10000006 | Ga0268264_10000006337 | 152 |
| 222 | 3300039450 | Ga0436363_0349297 | Ga0436363_0349297_357_821 | 152 |
| 223 | 3300048903 | Ga0496100_0801751 | Ga0496100_0801751_34_498 | 152 |
| 224 | 3300048909 | Ga0496106_0664981 | Ga0496106_0664981_292_756 | 152 |
| 225 | 3300053131 | Ga0500652_004515 | Ga0500652_004515_361_861 | 152 |
| 226 | iso_pu_bacteria | 2643221560 | 2643823345 | 152 |
| 227 | iso_pu_bacteria | 2852653556 | 2852655249 | 152 |
| 228 | iso_pu_bacteria | 2852680915 | 2852681181 | 152 |
| 229 | 2162886007 | SwRhRL2b_contig_3219086 | SwRhRL2b_0452.00008210 | 153 |
| 230 | 3300001904 | JGI24736J21556_1000031 | JGI24736J21556_100003117 | 153 |
| 231 | 3300001979 | JGI24740J21852_10007875 | JGI24740J21852_100078753 | 153 |
| 232 | 3300001989 | JGI24739J22299_10017629 | JGI24739J22299_100176292 | 153 |
| 233 | 3300001990 | JGI24737J22298_10007725 | JGI24737J22298_100077252 | 153 |
| 234 | 3300002773 | JGI25152J39213_1025184 | JGI25152J39213_10251842 | 153 |
| 235 | 3300002774 | JGI25150J39212_1000020 | JGI25150J39212_100002096 | 153 |
| 236 | 3300003214 | JGI25165J46597_1000053 | JGI25165J46597_1000053177 | 153 |
| 237 | 3300003215 | JGI25153J46596_10000017 | JGI25153J46596_10000017120 | 153 |
| 238 | 3300003781 | Ga0055536_1010951 | Ga0055536_10109513 | 153 |
| 239 | 3300003791 | Ga0055530_10010511 | Ga0055530_100105112 | 153 |
| 240 | 3300003792 | Ga0055540_1009149 | Ga0055540_10091492 | 153 |
| 241 | 3300005289 | Ga0065704_10143789 | Ga0065704_101437892 | 153 |
| 242 | 3300005295 | Ga0065707_10111706 | Ga0065707_101117062 | 153 |
| 243 | 3300005331 | Ga0070670_100000168 | Ga0070670_10000016831 | 153 |
| 244 | 3300005334 | Ga0068869_100132712 | Ga0068869_1001327122 | 153 |
| 245 | 3300005337 | Ga0070682_100276235 | Ga0070682_1002762352 | 153 |
| 246 | 3300005337 | Ga0070682_101065597 | Ga0070682_1010655971 | 153 |
| 247 | 3300005339 | Ga0070660_100194506 | Ga0070660_1001945062 | 153 |
| 248 | 3300005347 | Ga0070668_100335559 | Ga0070668_1003355591 | 153 |
| 249 | 3300005367 | Ga0070667_100000290 | Ga0070667_10000029065 | 153 |
| 250 | 3300005367 | Ga0070667_100001767 | Ga0070667_1000017678 | 153 |
| 251 | 3300005457 | Ga0070662_100134929 | Ga0070662_1001349292 | 153 |
| 252 | 3300005539 | Ga0068853_100243348 | Ga0068853_1002433481 | 153 |
| 253 | 3300005539 | Ga0068853_100428357 | Ga0068853_1004283572 | 153 |
| 254 | 3300005539 | Ga0068853_100963837 | Ga0068853_1009638371 | 153 |
| 255 | 3300005564 | Ga0070664_100240706 | Ga0070664_1002407062 | 153 |
| 256 | 3300005577 | Ga0068857_100195436 | Ga0068857_1001954361 | 153 |
| 257 | 3300005577 | Ga0068857_100229812 | Ga0068857_1002298121 | 153 |
| 258 | 3300005616 | Ga0068852_100023139 | Ga0068852_1000231392 | 153 |
| 259 | 3300005616 | Ga0068852_100803667 | Ga0068852_1008036671 | 153 |
| 260 | 3300005617 | Ga0068859_100061439 | Ga0068859_1000614392 | 153 |
| 261 | 3300005618 | Ga0068864_100000063 | Ga0068864_100000063106 | 153 |
| 262 | 3300005618 | Ga0068864_100004504 | Ga0068864_1000045045 | 153 |
| 263 | 3300005618 | Ga0068864_100693797 | Ga0068864_1006937971 | 153 |
| 264 | 3300005719 | Ga0068861_101246335 | Ga0068861_1012463352 | 153 |
| 265 | 3300005841 | Ga0068863_100000062 | Ga0068863_100000062106 | 153 |
| 266 | 3300005841 | Ga0068863_100080373 | Ga0068863_1000803732 | 153 |
| 267 | 3300005842 | Ga0068858_100000313 | Ga0068858_10000031316 | 153 |
| 268 | 3300005842 | Ga0068858_100002369 | Ga0068858_1000023693 | 153 |
| 269 | 3300005842 | Ga0068858_100353831 | Ga0068858_1003538311 | 153 |
| 270 | 3300005844 | Ga0068862_100000069 | Ga0068862_100000069110 | 153 |
| 271 | 3300006051 | Ga0075364_10611915 | Ga0075364_106119151 | 153 |
| 272 | 3300006931 | Ga0097620_100061439 | Ga0097620_1000614392 | 153 |
| 273 | 3300009177 | Ga0105248_10000284 | Ga0105248_1000028436 | 153 |
| 274 | 3300009551 | Ga0105238_10435814 | Ga0105238_104358141 | 153 |
| 275 | 3300009553 | Ga0105249_10000160 | Ga0105249_100001605 | 153 |
| 276 | 3300009553 | Ga0105249_11242858 | Ga0105249_112428582 | 153 |
| 277 | 3300011119 | Ga0105246_10803155 | Ga0105246_108031551 | 153 |
| 278 | 3300013105 | Ga0157369_10031914 | Ga0157369_100319146 | 153 |
| 279 | 3300013306 | Ga0163162_10030993 | Ga0163162_100309933 | 153 |
| 280 | 3300013306 | Ga0163162_10040293 | Ga0163162_100402935 | 153 |
| 281 | 3300013306 | Ga0163162_10371029 | Ga0163162_103710291 | 153 |
| 282 | 3300013307 | Ga0157372_10124496 | Ga0157372_101244963 | 153 |
| 283 | 3300014325 | Ga0163163_10094960 | Ga0163163_100949603 | 153 |
| 284 | 3300017792 | Ga0163161_10626923 | Ga0163161_106269231 | 153 |
| 285 | 3300017792 | Ga0163161_11072191 | Ga0163161_110721911 | 153 |
| 286 | 3300025233 | Ga0209437_105443 | Ga0209437_1054431 | 153 |
| 287 | 3300025245 | Ga0207425_1000022 | Ga0207425_1000022168 | 153 |
| 288 | 3300025258 | Ga0209129_1001473 | Ga0209129_10014739 | 153 |
| 289 | 3300025261 | Ga0209233_1000119 | Ga0209233_100011957 | 153 |
| 290 | 3300025272 | Ga0209455_1013376 | Ga0209455_10133762 | 153 |
| 291 | 3300025294 | Ga0209025_1000842 | Ga0209025_10008422 | 153 |
| 292 | 3300025297 | Ga0209758_1000004 | Ga0209758_1000004795 | 153 |
| 293 | 3300025298 | Ga0209050_1000001 | Ga0209050_10000012814 | 153 |
| 294 | 3300025303 | Ga0209051_1000246 | Ga0209051_100024614 | 153 |
| 295 | 3300025315 | Ga0207697_10106721 | Ga0207697_101067212 | 153 |
| 296 | 3300025735 | Ga0207713_1014855 | Ga0207713_10148552 | 153 |
| 297 | 3300025900 | Ga0207710_10044681 | Ga0207710_100446812 | 153 |
| 298 | 3300025904 | Ga0207647_10000555 | Ga0207647_1000055521 | 153 |
| 299 | 3300025911 | Ga0207654_10004092 | Ga0207654_100040924 | 153 |
| 300 | 3300025911 | Ga0207654_10393046 | Ga0207654_103930462 | 153 |
| 301 | 3300025913 | Ga0207695_10003879 | Ga0207695_1000387913 | 153 |
| 302 | 3300025914 | Ga0207671_10001983 | Ga0207671_1000198314 | 153 |
| 303 | 3300025924 | Ga0207694_10005262 | Ga0207694_100052625 | 153 |
| 304 | 3300025924 | Ga0207694_10007000 | Ga0207694_100070004 | 153 |
| 305 | 3300025924 | Ga0207694_10534438 | Ga0207694_105344382 | 153 |
| 306 | 3300025925 | Ga0207650_10000142 | Ga0207650_1000014283 | 153 |
| 307 | 3300025927 | Ga0207687_10000259 | Ga0207687_100002594 | 153 |
| 308 | 3300025933 | Ga0207706_10095537 | Ga0207706_100955372 | 153 |
| 309 | 3300025935 | Ga0207709_10314763 | Ga0207709_103147631 | 153 |
| 310 | 3300025941 | Ga0207711_10000017 | Ga0207711_10000017376 | 153 |
| 311 | 3300025942 | Ga0207689_10117467 | Ga0207689_101174672 | 153 |
| 312 | 3300025949 | Ga0207667_10016664 | Ga0207667_100166646 | 153 |
| 313 | 3300025961 | Ga0207712_10000527 | Ga0207712_100005276 | 153 |
| 314 | 3300025981 | Ga0207640_10014152 | Ga0207640_100141525 | 153 |
| 315 | 3300025981 | Ga0207640_10105323 | Ga0207640_101053231 | 153 |
| 316 | 3300025986 | Ga0207658_10000133 | Ga0207658_1000013384 | 153 |
| 317 | 3300026023 | Ga0207677_11453050 | Ga0207677_114530501 | 153 |
| 318 | 3300026035 | Ga0207703_10000961 | Ga0207703_1000096116 | 153 |
| 319 | 3300026035 | Ga0207703_10002071 | Ga0207703_100020719 | 153 |
| 320 | 3300026035 | Ga0207703_10325827 | Ga0207703_103258271 | 153 |
| 321 | 3300026041 | Ga0207639_10111311 | Ga0207639_101113112 | 153 |
| 322 | 3300026041 | Ga0207639_10184052 | Ga0207639_101840522 | 153 |
| 323 | 3300026067 | Ga0207678_10028298 | Ga0207678_100282984 | 153 |
| 324 | 3300026078 | Ga0207702_10139976 | Ga0207702_101399762 | 153 |
| 325 | 3300026088 | Ga0207641_10000022 | Ga0207641_10000022121 | 153 |
| 326 | 3300026095 | Ga0207676_10000056 | Ga0207676_1000005636 | 153 |
| 327 | 3300026095 | Ga0207676_10011444 | Ga0207676_100114447 | 153 |
| 328 | 3300026095 | Ga0207676_11395351 | Ga0207676_113953511 | 153 |
| 329 | 3300026116 | Ga0207674_10045037 | Ga0207674_100450373 | 153 |
| 330 | 3300026116 | Ga0207674_10073006 | Ga0207674_100730063 | 153 |
| 331 | 3300026118 | Ga0207675_101291922 | Ga0207675_1012919221 | 153 |
| 332 | 3300026142 | Ga0207698_10025403 | Ga0207698_100254031 | 153 |
| 333 | 3300028380 | Ga0268265_10000044 | Ga0268265_10000044104 | 153 |
| 334 | 3300031456 | Ga0307513_10097855 | Ga0307513_100978553 | 153 |
| 335 | 3300031507 | Ga0307509_10068266 | Ga0307509_100682663 | 153 |
| 336 | 3300031616 | Ga0307508_10000858 | Ga0307508_1000085814 | 153 |
| 337 | 3300031911 | Ga0307412_10397806 | Ga0307412_103978062 | 153 |
| 338 | 3300033180 | Ga0307510_10065943 | Ga0307510_100659432 | 153 |
| 339 | 3300037418 | Ga0395900_0007717 | Ga0395900_0007717_5238_5741 | 153 |
| 340 | 3300037418 | Ga0395900_0287508 | Ga0395900_0287508_317_820 | 153 |
| 341 | 3300037418 | Ga0395900_0647893 | Ga0395900_0647893_164_667 | 153 |
| 342 | 3300037466 | Ga0395898_0023846 | Ga0395898_0023846_2396_2899 | 153 |
| 343 | 3300037853 | Ga0436364_0420330 | Ga0436364_0420330_379_846 | 153 |
| 344 | 3300038443 | Ga0395901_0008908 | Ga0395901_0008908_2528_3031 | 153 |
| 345 | 3300038443 | Ga0395901_0042433 | Ga0395901_0042433_1023_1526 | 153 |
| 346 | 3300041451 | Ga0451791_1703147 | Ga0451791_1703147_24_494 | 153 |
| 347 | 3300041452 | Ga0451793_1141815 | Ga0451793_1141815_22_489 | 153 |
| 348 | 3300041452 | Ga0451793_1456958 | Ga0451793_1456958_42_509 | 153 |
| 349 | 3300041486 | Ga0451807_1257146 | Ga0451807_1257146_395_859 | 153 |
| 350 | 3300045051 | Ga0451576_0000007 | Ga0451576_0000007_578371_578832 | 153 |
| 351 | 3300046460 | Ga0495638_0001382 | Ga0495638_0001382_15816_16283 | 153 |
| 352 | 3300046492 | Ga0495585_0123344 | Ga0495585_0123344_249_716 | 153 |
| 353 | 3300046506 | Ga0495583_0013765 | Ga0495583_0013765_3742_4209 | 153 |
| 354 | 3300046524 | Ga0495648_0067804 | Ga0495648_0067804_1373_1840 | 153 |
| 355 | 3300046524 | Ga0495648_0087932 | Ga0495648_0087932_143_610 | 153 |
| 356 | 3300046524 | Ga0495648_0104429 | Ga0495648_0104429_12_479 | 153 |
| 357 | 3300046616 | Ga0495668_0092432 | Ga0495668_0092432_340_807 | 153 |
| 358 | 3300046660 | Ga0495625_0000064 | Ga0495625_0000064_22221_22688 | 153 |
| 359 | 3300046691 | Ga0495670_0058817 | Ga0495670_0058817_561_1028 | 153 |
| 360 | 3300046691 | Ga0495670_0157714 | Ga0495670_0157714_219_686 | 153 |
| 361 | 3300047472 | Ga0495686_0027507 | Ga0495686_0027507_2819_3286 | 153 |
| 362 | 3300047472 | Ga0495686_0048172 | Ga0495686_0048172_987_1454 | 153 |
| 363 | 3300048904 | Ga0496101_0203804 | Ga0496101_0203804_639_1109 | 153 |
| 364 | 3300048906 | Ga0496103_0035486 | Ga0496103_0035486_332_802 | 153 |
| 365 | 3300048921 | Ga0496118_0003648 | Ga0496118_0003648_4808_5278 | 153 |
| 366 | 3300049579 | Ga0501043_1161883 | Ga0501043_1161883_24_485 | 153 |
| 367 | 3300053087 | Ga0500643_004834 | Ga0500643_004834_3477_3944 | 153 |
| 368 | 3300053093 | Ga0500651_0176403 | Ga0500651_0176403_113_580 | 153 |
| 369 | 3300053108 | Ga0500562_048940 | Ga0500562_048940_468_935 | 153 |
| 370 | 3300053119 | Ga0500595_000472 | Ga0500595_000472_15266_15730 | 153 |
| 371 | 3300053131 | Ga0500652_119944 | Ga0500652_119944_583_1050 | 153 |
| 372 | 3300053131 | Ga0500652_254584 | Ga0500652_254584_179_646 | 153 |
| 373 | 3300053134 | Ga0500658_0001199 | Ga0500658_0001199_5108_5575 | 153 |
| 374 | 3300053136 | Ga0500559_0010186 | Ga0500559_0010186_235_702 | 153 |
| 375 | 3300053136 | Ga0500559_0016106 | Ga0500559_0016106_2229_2693 | 153 |
| 376 | 3300053136 | Ga0500559_0098195 | Ga0500559_0098195_119_583 | 153 |
| 377 | 3300053139 | Ga0500568_0097327 | Ga0500568_0097327_271_738 | 153 |
| 378 | 3300053139 | Ga0500568_0184394 | Ga0500568_0184394_278_739 | 153 |
| 379 | 3300053140 | Ga0500573_0000082 | Ga0500573_0000082_36041_36505 | 153 |
| 380 | 3300053153 | Ga0500616_0015221 | Ga0500616_0015221_637_1104 | 153 |
| 381 | 3300053730 | Ga0500645_029629 | Ga0500645_029629_481_948 | 153 |
| 382 | iso_pu_bacteria | 2643221563 | 2643835689 | 153 |
| 383 | iso_pu_bacteria | 2643221601 | 2644019783 | 153 |
| 384 | iso_pu_bacteria | 2643221608 | 2644056615 | 153 |
| 385 | iso_pu_bacteria | 2643221631 | 2644180327 | 153 |
| 386 | 2162886007 | SwRhRL2b_contig_2638822 | SwRhRL2b_0808.00004470 | 154 |
| 387 | 2162886007 | SwRhRL2b_contig_3748734 | SwRhRL2b_0199.00005000 | 154 |
| 388 | 3300002074 | JGI24748J21848_1010040 | JGI24748J21848_10100402 | 154 |
| 389 | 3300002239 | JGI24034J26672_10010366 | JGI24034J26672_100103662 | 154 |
| 390 | 3300003781 | Ga0055536_1001565 | Ga0055536_10015657 | 154 |
| 391 | 3300003784 | Ga0055534_1017663 | Ga0055534_10176632 | 154 |
| 392 | 3300003791 | Ga0055530_10000095 | Ga0055530_1000009534 | 154 |
| 393 | 3300003794 | Ga0055531_10001802 | Ga0055531_100018027 | 154 |
| 394 | 3300005289 | Ga0065704_10003249 | Ga0065704_100032493 | 154 |
| 395 | 3300005289 | Ga0065704_10145587 | Ga0065704_101455871 | 154 |
| 396 | 3300005289 | Ga0065704_10316801 | Ga0065704_103168012 | 154 |
| 397 | 3300005295 | Ga0065707_10090604 | Ga0065707_100906042 | 154 |
| 398 | 3300005295 | Ga0065707_10154342 | Ga0065707_101543422 | 154 |
| 399 | 3300005327 | Ga0070658_10000371 | Ga0070658_100003712 | 154 |
| 400 | 3300005327 | Ga0070658_10012881 | Ga0070658_100128817 | 154 |
| 401 | 3300005327 | Ga0070658_10051560 | Ga0070658_100515602 | 154 |
| 402 | 3300005327 | Ga0070658_10071384 | Ga0070658_100713842 | 154 |
| 403 | 3300005327 | Ga0070658_10212206 | Ga0070658_102122062 | 154 |
| 404 | 3300005329 | Ga0070683_100006345 | Ga0070683_1000063459 | 154 |
| 405 | 3300005329 | Ga0070683_100453623 | Ga0070683_1004536232 | 154 |
| 406 | 3300005331 | Ga0070670_100155116 | Ga0070670_1001551162 | 154 |
| 407 | 3300005339 | Ga0070660_100002018 | Ga0070660_1000020185 | 154 |
| 408 | 3300005339 | Ga0070660_100218824 | Ga0070660_1002188242 | 154 |
| 409 | 3300005341 | Ga0070691_10208696 | Ga0070691_102086961 | 154 |
| 410 | 3300005343 | Ga0070687_100190789 | Ga0070687_1001907892 | 154 |
| 411 | 3300005344 | Ga0070661_100020845 | Ga0070661_1000208456 | 154 |
| 412 | 3300005345 | Ga0070692_10068259 | Ga0070692_100682592 | 154 |
| 413 | 3300005347 | Ga0070668_100016256 | Ga0070668_1000162563 | 154 |
| 414 | 3300005353 | Ga0070669_100000184 | Ga0070669_10000018427 | 154 |
| 415 | 3300005353 | Ga0070669_100080190 | Ga0070669_1000801901 | 154 |
| 416 | 3300005355 | Ga0070671_100004299 | Ga0070671_1000042998 | 154 |
| 417 | 3300005355 | Ga0070671_100255540 | Ga0070671_1002555401 | 154 |
| 418 | 3300005355 | Ga0070671_100473123 | Ga0070671_1004731232 | 154 |
| 419 | 3300005366 | Ga0070659_100003327 | Ga0070659_1000033273 | 154 |
| 420 | 3300005366 | Ga0070659_100178489 | Ga0070659_1001784892 | 154 |
| 421 | 3300005367 | Ga0070667_100000472 | Ga0070667_10000047226 | 154 |
| 422 | 3300005367 | Ga0070667_100035034 | Ga0070667_1000350343 | 154 |
| 423 | 3300005445 | Ga0070708_100629496 | Ga0070708_1006294961 | 154 |
| 424 | 3300005455 | Ga0070663_100247240 | Ga0070663_1002472401 | 154 |
| 425 | 3300005457 | Ga0070662_100000992 | Ga0070662_10000099214 | 154 |
| 426 | 3300005458 | Ga0070681_10058148 | Ga0070681_100581482 | 154 |
| 427 | 3300005467 | Ga0070706_100430942 | Ga0070706_1004309421 | 154 |
| 428 | 3300005530 | Ga0070679_100030942 | Ga0070679_1000309423 | 154 |
| 429 | 3300005530 | Ga0070679_100031798 | Ga0070679_1000317985 | 154 |
| 430 | 3300005530 | Ga0070679_100049007 | Ga0070679_1000490072 | 154 |
| 431 | 3300005530 | Ga0070679_100152916 | Ga0070679_1001529162 | 154 |
| 432 | 3300005535 | Ga0070684_101156365 | Ga0070684_1011563651 | 154 |
| 433 | 3300005539 | Ga0068853_100012276 | Ga0068853_1000122761 | 154 |
| 434 | 3300005539 | Ga0068853_100311825 | Ga0068853_1003118251 | 154 |
| 435 | 3300005548 | Ga0070665_100045652 | Ga0070665_1000456522 | 154 |
| 436 | 3300005563 | Ga0068855_100046850 | Ga0068855_1000468503 | 154 |
| 437 | 3300005563 | Ga0068855_100253307 | Ga0068855_1002533073 | 154 |
| 438 | 3300005563 | Ga0068855_100289651 | Ga0068855_1002896512 | 154 |
| 439 | 3300005563 | Ga0068855_100648909 | Ga0068855_1006489092 | 154 |
| 440 | 3300005563 | Ga0068855_101412377 | Ga0068855_1014123771 | 154 |
| 441 | 3300005564 | Ga0070664_100010887 | Ga0070664_1000108878 | 154 |
| 442 | 3300005577 | Ga0068857_100179407 | Ga0068857_1001794071 | 154 |
| 443 | 3300005577 | Ga0068857_100233204 | Ga0068857_1002332041 | 154 |
| 444 | 3300005577 | Ga0068857_100859217 | Ga0068857_1008592172 | 154 |
| 445 | 3300005578 | Ga0068854_100004727 | Ga0068854_1000047272 | 154 |
| 446 | 3300005578 | Ga0068854_100361610 | Ga0068854_1003616101 | 154 |
| 447 | 3300005578 | Ga0068854_100607981 | Ga0068854_1006079811 | 154 |
| 448 | 3300005614 | Ga0068856_100001125 | Ga0068856_1000011256 | 154 |
| 449 | 3300005614 | Ga0068856_100011802 | Ga0068856_1000118024 | 154 |
| 450 | 3300005614 | Ga0068856_100132888 | Ga0068856_1001328882 | 154 |
| 451 | 3300005616 | Ga0068852_100000083 | Ga0068852_10000008348 | 154 |
| 452 | 3300005616 | Ga0068852_100028520 | Ga0068852_1000285203 | 154 |
| 453 | 3300005616 | Ga0068852_100266764 | Ga0068852_1002667642 | 154 |
| 454 | 3300005616 | Ga0068852_100973101 | Ga0068852_1009731011 | 154 |
| 455 | 3300005618 | Ga0068864_100745331 | Ga0068864_1007453311 | 154 |
| 456 | 3300005834 | Ga0068851_10183942 | Ga0068851_101839422 | 154 |
| 457 | 3300005842 | Ga0068858_101165476 | Ga0068858_1011654762 | 154 |
| 458 | 3300005843 | Ga0068860_100011780 | Ga0068860_1000117809 | 154 |
| 459 | 3300005844 | Ga0068862_100081269 | Ga0068862_1000812691 | 154 |
| 460 | 3300006038 | Ga0075365_10067981 | Ga0075365_100679815 | 154 |
| 461 | 3300006042 | Ga0075368_10000199 | Ga0075368_100001992 | 154 |
| 462 | 3300006042 | Ga0075368_10092963 | Ga0075368_100929632 | 154 |
| 463 | 3300006048 | Ga0075363_100009342 | Ga0075363_1000093425 | 154 |
| 464 | 3300006048 | Ga0075363_100017436 | Ga0075363_1000174363 | 154 |
| 465 | 3300006051 | Ga0075364_10002598 | Ga0075364_100025984 | 154 |
| 466 | 3300006051 | Ga0075364_10151087 | Ga0075364_101510871 | 154 |
| 467 | 3300006177 | Ga0075362_10000041 | Ga0075362_1000004116 | 154 |
| 468 | 3300006177 | Ga0075362_10046036 | Ga0075362_100460362 | 154 |
| 469 | 3300006178 | Ga0075367_10022138 | Ga0075367_100221383 | 154 |
| 470 | 3300006178 | Ga0075367_10648801 | Ga0075367_106488012 | 154 |
| 471 | 3300006186 | Ga0075369_10000994 | Ga0075369_1000099410 | 154 |
| 472 | 3300006186 | Ga0075369_10120093 | Ga0075369_101200931 | 154 |
| 473 | 3300006195 | Ga0075366_10000150 | Ga0075366_1000015026 | 154 |
| 474 | 3300006195 | Ga0075366_10028344 | Ga0075366_100283445 | 154 |
| 475 | 3300006195 | Ga0075366_10217878 | Ga0075366_102178782 | 154 |
| 476 | 3300006195 | Ga0075366_10436965 | Ga0075366_104369651 | 154 |
| 477 | 3300006353 | Ga0075370_10000003 | Ga0075370_10000003105 | 154 |
| 478 | 3300006353 | Ga0075370_10018925 | Ga0075370_100189252 | 154 |
| 479 | 3300006353 | Ga0075370_10033548 | Ga0075370_100335485 | 154 |
| 480 | 3300006353 | Ga0075370_10036616 | Ga0075370_100366164 | 154 |
| 481 | 3300006353 | Ga0075370_10093820 | Ga0075370_100938202 | 154 |
| 482 | 3300006353 | Ga0075370_10158613 | Ga0075370_101586131 | 154 |
| 483 | 3300006353 | Ga0075370_10502340 | Ga0075370_105023401 | 154 |
| 484 | 3300006946 | Ga0079104_1027201 | Ga0079104_10272012 | 154 |
| 485 | 3300009092 | Ga0105250_10142772 | Ga0105250_101427721 | 154 |
| 486 | 3300009093 | Ga0105240_10029936 | Ga0105240_1002993610 | 154 |
| 487 | 3300009101 | Ga0105247_10056551 | Ga0105247_100565512 | 154 |
| 488 | 3300009148 | Ga0105243_10114789 | Ga0105243_101147893 | 154 |
| 489 | 3300009174 | Ga0105241_10130650 | Ga0105241_101306503 | 154 |
| 490 | 3300009177 | Ga0105248_10048387 | Ga0105248_100483873 | 154 |
| 491 | 3300009177 | Ga0105248_10157534 | Ga0105248_101575341 | 154 |
| 492 | 3300009545 | Ga0105237_10788457 | Ga0105237_107884572 | 154 |
| 493 | 3300009551 | Ga0105238_10121889 | Ga0105238_101218892 | 154 |
| 494 | 3300009551 | Ga0105238_11605734 | Ga0105238_116057342 | 154 |
| 495 | 3300009553 | Ga0105249_10136026 | Ga0105249_101360263 | 154 |
| 496 | 3300013100 | Ga0157373_10053241 | Ga0157373_100532413 | 154 |
| 497 | 3300013100 | Ga0157373_10116318 | Ga0157373_101163183 | 154 |
| 498 | 3300013102 | Ga0157371_10001947 | Ga0157371_1000194714 | 154 |
| 499 | 3300013102 | Ga0157371_10171692 | Ga0157371_101716922 | 154 |
| 500 | 3300013102 | Ga0157371_10444426 | Ga0157371_104444262 | 154 |
| 501 | 3300013104 | Ga0157370_10010227 | Ga0157370_100102277 | 154 |
| 502 | 3300013104 | Ga0157370_10583082 | Ga0157370_105830822 | 154 |
| 503 | 3300013104 | Ga0157370_10989143 | Ga0157370_109891432 | 154 |
| 504 | 3300013105 | Ga0157369_10000968 | Ga0157369_1000096813 | 154 |
| 505 | 3300013306 | Ga0163162_10641933 | Ga0163162_106419332 | 154 |
| 506 | 3300013307 | Ga0157372_10001238 | Ga0157372_1000123810 | 154 |
| 507 | 3300013307 | Ga0157372_10356831 | Ga0157372_103568312 | 154 |
| 508 | 3300013308 | Ga0157375_10748286 | Ga0157375_107482861 | 154 |
| 509 | 3300025291 | Ga0209675_1000025 | Ga0209675_100002593 | 154 |
| 510 | 3300025292 | Ga0209676_1000198 | Ga0209676_100019887 | 154 |
| 511 | 3300025292 | Ga0209676_1000362 | Ga0209676_100036234 | 154 |
| 512 | 3300025294 | Ga0209025_1008600 | Ga0209025_10086007 | 154 |
| 513 | 3300025298 | Ga0209050_1000367 | Ga0209050_100036748 | 154 |
| 514 | 3300025298 | Ga0209050_1000728 | Ga0209050_100072810 | 154 |
| 515 | 3300025298 | Ga0209050_1011865 | Ga0209050_10118652 | 154 |
| 516 | 3300025304 | Ga0209257_1000596 | Ga0209257_100059624 | 154 |
| 517 | 3300025321 | Ga0207656_10160934 | Ga0207656_101609342 | 154 |
| 518 | 3300025711 | Ga0207696_1004520 | Ga0207696_10045203 | 154 |
| 519 | 3300025735 | Ga0207713_1010725 | Ga0207713_10107251 | 154 |
| 520 | 3300025900 | Ga0207710_10137611 | Ga0207710_101376111 | 154 |
| 521 | 3300025903 | Ga0207680_10210525 | Ga0207680_102105252 | 154 |
| 522 | 3300025904 | Ga0207647_10069787 | Ga0207647_100697872 | 154 |
| 523 | 3300025909 | Ga0207705_10000004 | Ga0207705_1000000464 | 154 |
| 524 | 3300025909 | Ga0207705_10026510 | Ga0207705_100265102 | 154 |
| 525 | 3300025909 | Ga0207705_10063556 | Ga0207705_100635562 | 154 |
| 526 | 3300025909 | Ga0207705_10268542 | Ga0207705_102685423 | 154 |
| 527 | 3300025910 | Ga0207684_10760646 | Ga0207684_107606461 | 154 |
| 528 | 3300025912 | Ga0207707_10051378 | Ga0207707_100513783 | 154 |
| 529 | 3300025913 | Ga0207695_10012208 | Ga0207695_100122084 | 154 |
| 530 | 3300025917 | Ga0207660_10131387 | Ga0207660_101313873 | 154 |
| 531 | 3300025919 | Ga0207657_10001614 | Ga0207657_1000161423 | 154 |
| 532 | 3300025919 | Ga0207657_10037866 | Ga0207657_100378666 | 154 |
| 533 | 3300025920 | Ga0207649_10026472 | Ga0207649_100264722 | 154 |
| 534 | 3300025921 | Ga0207652_10018883 | Ga0207652_100188834 | 154 |
| 535 | 3300025921 | Ga0207652_10021249 | Ga0207652_100212496 | 154 |
| 536 | 3300025921 | Ga0207652_10056452 | Ga0207652_100564526 | 154 |
| 537 | 3300025923 | Ga0207681_10000140 | Ga0207681_1000014035 | 154 |
| 538 | 3300025923 | Ga0207681_10511467 | Ga0207681_105114671 | 154 |
| 539 | 3300025923 | Ga0207681_10792267 | Ga0207681_107922671 | 154 |
| 540 | 3300025924 | Ga0207694_10046380 | Ga0207694_100463804 | 154 |
| 541 | 3300025925 | Ga0207650_10354042 | Ga0207650_103540421 | 154 |
| 542 | 3300025931 | Ga0207644_10000811 | Ga0207644_1000081114 | 154 |
| 543 | 3300025931 | Ga0207644_10325543 | Ga0207644_103255432 | 154 |
| 544 | 3300025931 | Ga0207644_10851638 | Ga0207644_108516381 | 154 |
| 545 | 3300025932 | Ga0207690_10000894 | Ga0207690_1000089410 | 154 |
| 546 | 3300025933 | Ga0207706_10000035 | Ga0207706_100000356 | 154 |
| 547 | 3300025935 | Ga0207709_10429189 | Ga0207709_104291892 | 154 |
| 548 | 3300025941 | Ga0207711_10071888 | Ga0207711_100718883 | 154 |
| 549 | 3300025941 | Ga0207711_10202664 | Ga0207711_102026641 | 154 |
| 550 | 3300025944 | Ga0207661_10132887 | Ga0207661_101328873 | 154 |
| 551 | 3300025944 | Ga0207661_10170932 | Ga0207661_101709323 | 154 |
| 552 | 3300025945 | Ga0207679_10070830 | Ga0207679_100708302 | 154 |
| 553 | 3300025949 | Ga0207667_10056319 | Ga0207667_100563193 | 154 |
| 554 | 3300025949 | Ga0207667_10090978 | Ga0207667_100909781 | 154 |
| 555 | 3300025949 | Ga0207667_10093031 | Ga0207667_100930313 | 154 |
| 556 | 3300025949 | Ga0207667_10392664 | Ga0207667_103926642 | 154 |
| 557 | 3300025949 | Ga0207667_11041425 | Ga0207667_110414251 | 154 |
| 558 | 3300025961 | Ga0207712_10189723 | Ga0207712_101897232 | 154 |
| 559 | 3300025972 | Ga0207668_10006786 | Ga0207668_100067863 | 154 |
| 560 | 3300025972 | Ga0207668_10048371 | Ga0207668_100483714 | 154 |
| 561 | 3300025981 | Ga0207640_10001101 | Ga0207640_1000110111 | 154 |
| 562 | 3300025981 | Ga0207640_10015711 | Ga0207640_100157112 | 154 |
| 563 | 3300025981 | Ga0207640_10528614 | Ga0207640_105286142 | 154 |
| 564 | 3300025981 | Ga0207640_11259434 | Ga0207640_112594341 | 154 |
| 565 | 3300025986 | Ga0207658_10001257 | Ga0207658_1000125717 | 154 |
| 566 | 3300025986 | Ga0207658_10053887 | Ga0207658_100538873 | 154 |
| 567 | 3300026035 | Ga0207703_10025076 | Ga0207703_100250763 | 154 |
| 568 | 3300026041 | Ga0207639_10001012 | Ga0207639_1000101210 | 154 |
| 569 | 3300026041 | Ga0207639_10538988 | Ga0207639_105389883 | 154 |
| 570 | 3300026067 | Ga0207678_10106424 | Ga0207678_101064242 | 154 |
| 571 | 3300026078 | Ga0207702_10043320 | Ga0207702_100433204 | 154 |
| 572 | 3300026116 | Ga0207674_10023877 | Ga0207674_100238775 | 154 |
| 573 | 3300026116 | Ga0207674_10128780 | Ga0207674_101287803 | 154 |
| 574 | 3300026116 | Ga0207674_10187178 | Ga0207674_101871781 | 154 |
| 575 | 3300026116 | Ga0207674_10315125 | Ga0207674_103151254 | 154 |
| 576 | 3300026142 | Ga0207698_10000789 | Ga0207698_100007898 | 154 |
| 577 | 3300026142 | Ga0207698_10041250 | Ga0207698_100412502 | 154 |
| 578 | 3300027552 | Ga0209982_1070845 | Ga0209982_10708451 | 154 |
| 579 | 3300027866 | Ga0209813_10000065 | Ga0209813_100000656 | 154 |
| 580 | 3300027866 | Ga0209813_10070003 | Ga0209813_100700032 | 154 |
| 581 | 3300027876 | Ga0209974_10014350 | Ga0209974_100143502 | 154 |
| 582 | 3300027876 | Ga0209974_10065284 | Ga0209974_100652841 | 154 |
| 583 | 3300028379 | Ga0268266_10027588 | Ga0268266_100275885 | 154 |
| 584 | 3300028380 | Ga0268265_10319921 | Ga0268265_103199211 | 154 |
| 585 | 3300028381 | Ga0268264_10021239 | Ga0268264_100212394 | 154 |
| 586 | 3300031250 | Ga0265331_10133611 | Ga0265331_101336112 | 154 |
| 587 | 3300031665 | Ga0316575_10167435 | Ga0316575_101674352 | 154 |
| 588 | 3300031824 | Ga0307413_10555867 | Ga0307413_105558671 | 154 |
| 589 | 3300031901 | Ga0307406_10234405 | Ga0307406_102344051 | 154 |
| 590 | 3300031911 | Ga0307412_10005487 | Ga0307412_100054874 | 154 |
| 591 | 3300031911 | Ga0307412_10247951 | Ga0307412_102479511 | 154 |
| 592 | 3300032004 | Ga0307414_10000918 | Ga0307414_100009184 | 154 |
| 593 | 3300032004 | Ga0307414_10011317 | Ga0307414_100113172 | 154 |
| 594 | 3300032004 | Ga0307414_10025158 | Ga0307414_100251582 | 154 |
| 595 | 3300032004 | Ga0307414_10202579 | Ga0307414_102025792 | 154 |
| 596 | 3300032004 | Ga0307414_10221998 | Ga0307414_102219982 | 154 |
| 597 | 3300032004 | Ga0307414_10280158 | Ga0307414_102801582 | 154 |
| 598 | 3300032004 | Ga0307414_11194778 | Ga0307414_111947781 | 154 |
| 599 | 3300032005 | Ga0307411_10081670 | Ga0307411_100816702 | 154 |
| 600 | 3300035112 | Ga0373932_0075523 | Ga0373932_0075523_86_550 | 154 |
| 601 | 3300036647 | Ga0316582_0163214 | Ga0316582_0163214_384_848 | 154 |
| 602 | 3300036647 | Ga0316582_0233726 | Ga0316582_0233726_377_841 | 154 |
| 603 | 3300036712 | Ga0316584_0144004 | Ga0316584_0144004_312_776 | 154 |
| 604 | 3300036712 | Ga0316584_0200377 | Ga0316584_0200377_933_1397 | 154 |
| 605 | 3300037588 | Ga0316581_0041398 | Ga0316581_0041398_304_768 | 154 |
| 606 | 3300041491 | Ga0451833_0856020 | Ga0451833_0856020_161_625 | 154 |
| 607 | 3300041494 | Ga0451837_0749401 | Ga0451837_0749401_258_722 | 154 |
| 608 | 3300041496 | Ga0451839_1354034 | Ga0451839_1354034_111_575 | 154 |
| 609 | 3300041498 | Ga0451841_0840733 | Ga0451841_0840733_530_1009 | 154 |
| 610 | 3300041512 | Ga0451853_0254844 | Ga0451853_0254844_202_666 | 154 |
| 611 | 3300044712 | Ga0453684_0353812 | Ga0453684_0353812_497_961 | 154 |
| 612 | 3300044712 | Ga0453684_0478380 | Ga0453684_0478380_477_941 | 154 |
| 613 | 3300046453 | Ga0495627_000158 | Ga0495627_000158_16434_16898 | 154 |
| 614 | 3300046460 | Ga0495638_0245109 | Ga0495638_0245109_171_635 | 154 |
| 615 | 3300046471 | Ga0495650_0000831 | Ga0495650_0000831_20093_20557 | 154 |
| 616 | 3300046500 | Ga0495596_0000539 | Ga0495596_0000539_6689_7153 | 154 |
| 617 | 3300046501 | Ga0495607_0021094 | Ga0495607_0021094_2690_3154 | 154 |
| 618 | 3300046501 | Ga0495607_0382615 | Ga0495607_0382615_115_579 | 154 |
| 619 | 3300046506 | Ga0495583_0012555 | Ga0495583_0012555_3848_4312 | 154 |
| 620 | 3300046507 | Ga0495606_0003910 | Ga0495606_0003910_2900_3379 | 154 |
| 621 | 3300046507 | Ga0495606_0083175 | Ga0495606_0083175_13_477 | 154 |
| 622 | 3300046512 | Ga0495610_0000020 | Ga0495610_0000020_273030_273494 | 154 |
| 623 | 3300046515 | Ga0495620_0009442 | Ga0495620_0009442_3699_4163 | 154 |
| 624 | 3300046519 | Ga0495632_0001745 | Ga0495632_0001745_11399_11863 | 154 |
| 625 | 3300046519 | Ga0495632_0071947 | Ga0495632_0071947_362_826 | 154 |
| 626 | 3300046522 | Ga0495643_0007169 | Ga0495643_0007169_4282_4746 | 154 |
| 627 | 3300046522 | Ga0495643_0009816 | Ga0495643_0009816_2267_2731 | 154 |
| 628 | 3300046522 | Ga0495643_0142655 | Ga0495643_0142655_364_828 | 154 |
| 629 | 3300046525 | Ga0495663_0277522 | Ga0495663_0277522_35_502 | 154 |
| 630 | 3300046530 | Ga0495654_0082873 | Ga0495654_0082873_704_1171 | 154 |
| 631 | 3300046530 | Ga0495654_0134778 | Ga0495654_0134778_320_784 | 154 |
| 632 | 3300046538 | Ga0495609_0015309 | Ga0495609_0015309_357_821 | 154 |
| 633 | 3300046616 | Ga0495668_0000001 | Ga0495668_0000001_479820_480293 | 154 |
| 634 | 3300046660 | Ga0495625_0010229 | Ga0495625_0010229_6407_6871 | 154 |
| 635 | 3300046674 | Ga0495588_0275591 | Ga0495588_0275591_321_812 | 154 |
| 636 | 3300046691 | Ga0495670_0141020 | Ga0495670_0141020_257_721 | 154 |
| 637 | 3300046692 | Ga0495671_0300610 | Ga0495671_0300610_249_713 | 154 |
| 638 | 3300047469 | Ga0495673_0170009 | Ga0495673_0170009_302_781 | 154 |
| 639 | 3300047469 | Ga0495673_0173776 | Ga0495673_0173776_322_786 | 154 |
| 640 | 3300047470 | Ga0495681_0000094 | Ga0495681_0000094_16624_17088 | 154 |
| 641 | 3300047472 | Ga0495686_0000145 | Ga0495686_0000145_13889_14368 | 154 |
| 642 | 3300047472 | Ga0495686_0175411 | Ga0495686_0175411_119_583 | 154 |
| 643 | 3300048090 | Ga0495615_0000033 | Ga0495615_0000033_20918_21382 | 154 |
| 644 | 3300048903 | Ga0496100_0011591 | Ga0496100_0011591_705_1172 | 154 |
| 645 | 3300048904 | Ga0496101_0161863 | Ga0496101_0161863_527_994 | 154 |
| 646 | 3300048904 | Ga0496101_0603190 | Ga0496101_0603190_12_476 | 154 |
| 647 | 3300048905 | Ga0496102_0000267 | Ga0496102_0000267_34254_34721 | 154 |
| 648 | 3300048906 | Ga0496103_0000139 | Ga0496103_0000139_3377_3844 | 154 |
| 649 | 3300048907 | Ga0496104_0001261 | Ga0496104_0001261_16616_17083 | 154 |
| 650 | 3300048907 | Ga0496104_0286807 | Ga0496104_0286807_419_886 | 154 |
| 651 | 3300048908 | Ga0496105_0004449 | Ga0496105_0004449_2597_3064 | 154 |
| 652 | 3300048908 | Ga0496105_0357718 | Ga0496105_0357718_563_1027 | 154 |
| 653 | 3300048911 | Ga0496108_1186244 | Ga0496108_1186244_166_633 | 154 |
| 654 | 3300048912 | Ga0496109_0201779 | Ga0496109_0201779_1263_1730 | 154 |
| 655 | 3300048913 | Ga0496110_0068444 | Ga0496110_0068444_1977_2444 | 154 |
| 656 | 3300048914 | Ga0496111_0014834 | Ga0496111_0014834_178_645 | 154 |
| 657 | 3300048915 | Ga0496112_0600219 | Ga0496112_0600219_398_865 | 154 |
| 658 | 3300048916 | Ga0496113_0007197 | Ga0496113_0007197_3824_4291 | 154 |
| 659 | 3300048917 | Ga0496114_0023283 | Ga0496114_0023283_348_815 | 154 |
| 660 | 3300048917 | Ga0496114_0056565 | Ga0496114_0056565_680_1144 | 154 |
| 661 | 3300048920 | Ga0496117_0009437 | Ga0496117_0009437_344_811 | 154 |
| 662 | 3300048921 | Ga0496118_0006964 | Ga0496118_0006964_11704_12171 | 154 |
| 663 | 3300048922 | Ga0496119_0000077 | Ga0496119_0000077_515_982 | 154 |
| 664 | 3300048922 | Ga0496119_0000344 | Ga0496119_0000344_62357_62881 | 154 |
| 665 | 3300048923 | Ga0496120_0005768 | Ga0496120_0005768_7499_7966 | 154 |
| 666 | 3300048924 | Ga0496121_0000022 | Ga0496121_0000022_139716_140192 | 154 |
| 667 | 3300048924 | Ga0496121_0058612 | Ga0496121_0058612_2305_2772 | 154 |
| 668 | 3300048925 | Ga0496122_0002268 | Ga0496122_0002268_4081_4605 | 154 |
| 669 | 3300048925 | Ga0496122_0006858 | Ga0496122_0006858_2615_3082 | 154 |
| 670 | 3300048925 | Ga0496122_0011513 | Ga0496122_0011513_4521_4985 | 154 |
| 671 | 3300048926 | Ga0496123_0003406 | Ga0496123_0003406_2177_2701 | 154 |
| 672 | 3300048926 | Ga0496123_0005963 | Ga0496123_0005963_5057_5521 | 154 |
| 673 | 3300048926 | Ga0496123_0016981 | Ga0496123_0016981_706_1173 | 154 |
| 674 | 3300048927 | Ga0496124_0006200 | Ga0496124_0006200_246_713 | 154 |
| 675 | 3300048927 | Ga0496124_0263061 | Ga0496124_0263061_194_661 | 154 |
| 676 | 3300048928 | Ga0496125_0028887 | Ga0496125_0028887_4014_4481 | 154 |
| 677 | 3300048929 | Ga0496126_0000619 | Ga0496126_0000619_34235_34702 | 154 |
| 678 | 3300048929 | Ga0496126_0003256 | Ga0496126_0003256_13587_14054 | 154 |
| 679 | 3300048929 | Ga0496126_0004371 | Ga0496126_0004371_36_503 | 154 |
| 680 | 3300048929 | Ga0496126_0563927 | Ga0496126_0563927_78_551 | 154 |
| 681 | 3300049460 | Ga0495682_0132776 | Ga0495682_0132776_369_836 | 154 |
| 682 | 3300049581 | Ga0501047_0414497 | Ga0501047_0414497_181_645 | 154 |
| 683 | 3300049581 | Ga0501047_0431344 | Ga0501047_0431344_95_607 | 154 |
| 684 | 3300049582 | Ga0501048_0186999 | Ga0501048_0186999_157_630 | 154 |
| 685 | 3300049742 | Ga0501080_0323625 | Ga0501080_0323625_907_1377 | 154 |
| 686 | 3300049744 | Ga0501083_0743537 | Ga0501083_0743537_142_609 | 154 |
| 687 | 3300049822 | Ga0501035_0017712 | Ga0501035_0017712_3527_4000 | 154 |
| 688 | 3300049822 | Ga0501035_0853382 | Ga0501035_0853382_198_662 | 154 |
| 689 | 3300049823 | Ga0501044_0205691 | Ga0501044_0205691_97_561 | 154 |
| 690 | 3300049823 | Ga0501044_0319955 | Ga0501044_0319955_561_1025 | 154 |
| 691 | 3300050489 | nmdc:mga03683_149_c1 | nmdc:mga03683_149_c1_3800_4276 | 154 |
| 692 | 3300050489 | nmdc:mga03683_30_c1 | nmdc:mga03683_30_c1_13197_13661 | 154 |
| 693 | 3300050490 | nmdc:mga03n38_147852_c1 | nmdc:mga03n38_147852_c1_400_876 | 154 |
| 694 | 3300050490 | nmdc:mga03n38_6284_c1 | nmdc:mga03n38_6284_c1_3120_3584 | 154 |
| 695 | 3300050491 | nmdc:mga00v17_125984_c1 | nmdc:mga00v17_125984_c1_789_1253 | 154 |
| 696 | 3300050491 | nmdc:mga00v17_798_c1 | nmdc:mga00v17_798_c1_8018_8482 | 154 |
| 697 | 3300050491 | nmdc:mga00v17_83529_c1 | nmdc:mga00v17_83529_c1_367_843 | 154 |
| 698 | 3300050493 | nmdc:mga0k408_17004_c1 | nmdc:mga0k408_17004_c1_240_704 | 154 |
| 699 | 3300050493 | nmdc:mga0k408_2730_c1 | nmdc:mga0k408_2730_c1_5554_6018 | 154 |
| 700 | 3300050493 | nmdc:mga0k408_328445_c1 | nmdc:mga0k408_328445_c1_48_512 | 154 |
| 701 | 3300050493 | nmdc:mga0k408_49594_c1 | nmdc:mga0k408_49594_c1_1735_2199 | 154 |
| 702 | 3300050493 | nmdc:mga0k408_563438_c1 | nmdc:mga0k408_563438_c1_28_495 | 154 |
| 703 | 3300050494 | nmdc:mga06z11_149346_c1 | nmdc:mga06z11_149346_c1_106_570 | 154 |
| 704 | 3300050494 | nmdc:mga06z11_61_c1 | nmdc:mga06z11_61_c1_30884_31360 | 154 |
| 705 | 3300050495 | nmdc:mga04h51_1140_c1 | nmdc:mga04h51_1140_c1_4099_4575 | 154 |
| 706 | 3300050495 | nmdc:mga04h51_49320_c1 | nmdc:mga04h51_49320_c1_512_976 | 154 |
| 707 | 3300050496 | nmdc:mga07m45_155417_c1 | nmdc:mga07m45_155417_c1_658_1122 | 154 |
| 708 | 3300050496 | nmdc:mga07m45_19103_c1 | nmdc:mga07m45_19103_c1_1490_1954 | 154 |
| 709 | 3300050496 | nmdc:mga07m45_238675_c1 | nmdc:mga07m45_238675_c1_46_510 | 154 |
| 710 | 3300050496 | nmdc:mga07m45_29618_c2 | nmdc:mga07m45_29618_c2_298_762 | 154 |
| 711 | 3300050496 | nmdc:mga07m45_3935_c1 | nmdc:mga07m45_3935_c1_4215_4691 | 154 |
| 712 | 3300050496 | nmdc:mga07m45_4960_c1 | nmdc:mga07m45_4960_c1_5439_5903 | 154 |
| 713 | 3300050496 | nmdc:mga07m45_6_c1 | nmdc:mga07m45_6_c1_37027_37491 | 154 |
| 714 | 3300050516 | nmdc:mga0sz30_114985_c1 | nmdc:mga0sz30_114985_c1_24_500 | 154 |
| 715 | 3300050516 | nmdc:mga0sz30_138_c1 | nmdc:mga0sz30_138_c1_17419_17883 | 154 |
| 716 | 3300053087 | Ga0500643_063823 | Ga0500643_063823_249_713 | 154 |
| 717 | 3300053091 | Ga0500647_0014953 | Ga0500647_0014953_1842_2309 | 154 |
| 718 | 3300053104 | Ga0500556_0000122 | Ga0500556_0000122_60601_61125 | 154 |
| 719 | 3300053116 | Ga0500592_005142 | Ga0500592_005142_372_845 | 154 |
| 720 | 3300053118 | Ga0500594_0063912 | Ga0500594_0063912_561_1028 | 154 |
| 721 | 3300053119 | Ga0500595_007244 | Ga0500595_007244_3234_3698 | 154 |
| 722 | 3300053121 | Ga0500607_000287 | Ga0500607_000287_24395_24871 | 154 |
| 723 | 3300053121 | Ga0500607_000802 | Ga0500607_000802_10831_11295 | 154 |
| 724 | 3300053122 | Ga0500608_001154 | Ga0500608_001154_4248_4715 | 154 |
| 725 | 3300053125 | Ga0500618_037319 | Ga0500618_037319_254_721 | 154 |
| 726 | 3300053136 | Ga0500559_0002605 | Ga0500559_0002605_2109_2573 | 154 |
| 727 | 3300053136 | Ga0500559_0036136 | Ga0500559_0036136_752_1219 | 154 |
| 728 | 3300053136 | Ga0500559_0384310 | Ga0500559_0384310_155_622 | 154 |
| 729 | 3300053138 | Ga0500564_002032 | Ga0500564_002032_4704_5171 | 154 |
| 730 | 3300053139 | Ga0500568_0002610 | Ga0500568_0002610_9015_9488 | 154 |
| 731 | 3300053140 | Ga0500573_0314262 | Ga0500573_0314262_89_556 | 154 |
| 732 | 3300053140 | Ga0500573_0461430 | Ga0500573_0461430_58_522 | 154 |
| 733 | 3300053142 | Ga0500577_0010263 | Ga0500577_0010263_209_688 | 154 |
| 734 | 3300053146 | Ga0500588_0130445 | Ga0500588_0130445_96_560 | 154 |
| 735 | 3300053148 | Ga0500590_000142 | Ga0500590_000142_3306_3773 | 154 |
| 736 | 3300053148 | Ga0500590_034104 | Ga0500590_034104_1553_2017 | 154 |
| 737 | 3300053151 | Ga0500604_0050022 | Ga0500604_0050022_86_559 | 154 |
| 738 | 3300053154 | Ga0500619_247062 | Ga0500619_247062_42_509 | 154 |
| 739 | 3300053156 | Ga0500622_0014303 | Ga0500622_0014303_2694_3158 | 154 |
| 740 | 3300053158 | Ga0500627_0000004 | Ga0500627_0000004_155729_156202 | 154 |
| 741 | 3300053159 | Ga0500630_250872 | Ga0500630_250872_94_561 | 154 |
| 742 | 3300053178 | Ga0500637_0071845 | Ga0500637_0071845_895_1359 | 154 |
| 743 | 3300053729 | Ga0500625_000022 | Ga0500625_000022_17162_17629 | 154 |
| 744 | 3300053729 | Ga0500625_065684 | Ga0500625_065684_1073_1540 | 154 |
| 745 | 3300053730 | Ga0500645_003394 | Ga0500645_003394_3017_3481 | 154 |
| 746 | 3300003794 | Ga0055531_10002920 | Ga0055531_1000292010 | 155 |
| 747 | 3300003794 | Ga0055531_10022710 | Ga0055531_100227102 | 155 |
| 748 | 3300025292 | Ga0209676_1000228 | Ga0209676_100022811 | 155 |
| 749 | 3300025292 | Ga0209676_1032137 | Ga0209676_10321371 | 155 |
| 750 | 3300025298 | Ga0209050_1072117 | Ga0209050_10721171 | 155 |
| 751 | 3300025304 | Ga0209257_1000229 | Ga0209257_1000229105 | 155 |
| 752 | 3300025304 | Ga0209257_1008070 | Ga0209257_10080707 | 155 |
| 753 | 3300031901 | Ga0307406_10225051 | Ga0307406_102250512 | 155 |
| 754 | 3300031911 | Ga0307412_10093964 | Ga0307412_100939642 | 155 |
| 755 | 3300032004 | Ga0307414_10032511 | Ga0307414_100325112 | 155 |
| 756 | 3300046522 | Ga0495643_0031602 | Ga0495643_0031602_1610_2086 | 155 |
| 757 | 3300046525 | Ga0495663_0172099 | Ga0495663_0172099_223_699 | 155 |
| 758 | 3300046660 | Ga0495625_0000234 | Ga0495625_0000234_75088_75564 | 155 |
| 759 | 3300049523 | Ga0501300_034046 | Ga0501300_034046_49_525 | 155 |
| 760 | 3300049569 | Ga0501032_0006527 | Ga0501032_0006527_3518_3994 | 155 |
| 761 | 3300049570 | Ga0501033_0004215 | Ga0501033_0004215_7042_7518 | 155 |
| 762 | 3300049570 | Ga0501033_0031389 | Ga0501033_0031389_2947_3423 | 155 |
| 763 | 3300049571 | Ga0501034_0010865 | Ga0501034_0010865_3779_4255 | 155 |
| 764 | 3300049571 | Ga0501034_0326993 | Ga0501034_0326993_856_1332 | 155 |
| 765 | 3300049572 | Ga0501036_0025362 | Ga0501036_0025362_125_601 | 155 |
| 766 | 3300049573 | Ga0501037_0009034 | Ga0501037_0009034_4245_4721 | 155 |
| 767 | 3300049574 | Ga0501038_0017668 | Ga0501038_0017668_1137_1613 | 155 |
| 768 | 3300049575 | Ga0501039_0091478 | Ga0501039_0091478_1474_1950 | 155 |
| 769 | 3300049580 | Ga0501046_0067378 | Ga0501046_0067378_847_1323 | 155 |
| 770 | 3300049581 | Ga0501047_0004376 | Ga0501047_0004376_7544_8020 | 155 |
| 771 | 3300049581 | Ga0501047_0119971 | Ga0501047_0119971_1544_2020 | 155 |
| 772 | 3300049822 | Ga0501035_0167219 | Ga0501035_0167219_973_1449 | 155 |
| 773 | 3300049823 | Ga0501044_0007203 | Ga0501044_0007203_11293_11769 | 155 |
| 774 | 3300049823 | Ga0501044_0030831 | Ga0501044_0030831_2123_2599 | 155 |
| 775 | 3300053134 | Ga0500658_0089523 | Ga0500658_0089523_419_895 | 155 |
| 776 | 2162886007 | SwRhRL2b_contig_887096 | SwRhRL2b_0781.00006290 | 156 |
| 777 | 3300005289 | Ga0065704_10095003 | Ga0065704_100950032 | 156 |
| 778 | 3300005331 | Ga0070670_100327523 | Ga0070670_1003275232 | 156 |
| 779 | 3300005336 | Ga0070680_100634730 | Ga0070680_1006347301 | 156 |
| 780 | 3300005347 | Ga0070668_100014755 | Ga0070668_1000147559 | 156 |
| 781 | 3300005353 | Ga0070669_100022491 | Ga0070669_1000224912 | 156 |
| 782 | 3300005353 | Ga0070669_100096449 | Ga0070669_1000964493 | 156 |
| 783 | 3300005355 | Ga0070671_100000686 | Ga0070671_1000006863 | 156 |
| 784 | 3300005355 | Ga0070671_101557935 | Ga0070671_1015579351 | 156 |
| 785 | 3300005367 | Ga0070667_100002350 | Ga0070667_10000235011 | 156 |
| 786 | 3300005548 | Ga0070665_100000076 | Ga0070665_100000076127 | 156 |
| 787 | 3300005548 | Ga0070665_100005505 | Ga0070665_10000550511 | 156 |
| 788 | 3300005618 | Ga0068864_100035463 | Ga0068864_1000354634 | 156 |
| 789 | 3300005841 | Ga0068863_100000014 | Ga0068863_10000001462 | 156 |
| 790 | 3300005841 | Ga0068863_100342066 | Ga0068863_1003420662 | 156 |
| 791 | 3300005841 | Ga0068863_100648183 | Ga0068863_1006481832 | 156 |
| 792 | 3300005842 | Ga0068858_100156431 | Ga0068858_1001564312 | 156 |
| 793 | 3300005843 | Ga0068860_100000007 | Ga0068860_100000007173 | 156 |
| 794 | 3300005843 | Ga0068860_100029781 | Ga0068860_1000297812 | 156 |
| 795 | 3300005844 | Ga0068862_100012958 | Ga0068862_1000129582 | 156 |
| 796 | 3300005844 | Ga0068862_100062551 | Ga0068862_1000625512 | 156 |
| 797 | 3300006051 | Ga0075364_10102269 | Ga0075364_101022692 | 156 |
| 798 | 3300006051 | Ga0075364_10551599 | Ga0075364_105515992 | 156 |
| 799 | 3300009011 | Ga0105251_10001315 | Ga0105251_1000131515 | 156 |
| 800 | 3300009092 | Ga0105250_10148598 | Ga0105250_101485981 | 156 |
| 801 | 3300009101 | Ga0105247_10050332 | Ga0105247_100503322 | 156 |
| 802 | 3300009177 | Ga0105248_10004661 | Ga0105248_1000466113 | 156 |
| 803 | 3300009177 | Ga0105248_10104896 | Ga0105248_101048963 | 156 |
| 804 | 3300009553 | Ga0105249_10463585 | Ga0105249_104635851 | 156 |
| 805 | 3300025735 | Ga0207713_1021570 | Ga0207713_10215702 | 156 |
| 806 | 3300025903 | Ga0207680_10081041 | Ga0207680_100810413 | 156 |
| 807 | 3300025923 | Ga0207681_10010126 | Ga0207681_100101265 | 156 |
| 808 | 3300025923 | Ga0207681_10333281 | Ga0207681_103332811 | 156 |
| 809 | 3300025925 | Ga0207650_10086523 | Ga0207650_100865231 | 156 |
| 810 | 3300025931 | Ga0207644_10000818 | Ga0207644_1000081812 | 156 |
| 811 | 3300025972 | Ga0207668_10027876 | Ga0207668_100278763 | 156 |
| 812 | 3300025986 | Ga0207658_10003755 | Ga0207658_100037555 | 156 |
| 813 | 3300025986 | Ga0207658_10012197 | Ga0207658_100121972 | 156 |
| 814 | 3300026035 | Ga0207703_10051426 | Ga0207703_100514262 | 156 |
| 815 | 3300026035 | Ga0207703_10116628 | Ga0207703_101166282 | 156 |
| 816 | 3300026088 | Ga0207641_10000126 | Ga0207641_1000012641 | 156 |
| 817 | 3300026088 | Ga0207641_10020015 | Ga0207641_100200157 | 156 |
| 818 | 3300028379 | Ga0268266_10000317 | Ga0268266_1000031743 | 156 |
| 819 | 3300028379 | Ga0268266_10011921 | Ga0268266_100119216 | 156 |
| 820 | 3300028380 | Ga0268265_10004791 | Ga0268265_100047912 | 156 |
| 821 | 3300028380 | Ga0268265_10008961 | Ga0268265_100089617 | 156 |
| 822 | 3300028381 | Ga0268264_10000077 | Ga0268264_1000007766 | 156 |
| 823 | 3300028381 | Ga0268264_10009226 | Ga0268264_100092268 | 156 |
| 824 | 3300046460 | Ga0495638_0044272 | Ga0495638_0044272_101_586 | 156 |
| 825 | 3300047472 | Ga0495686_0027888 | Ga0495686_0027888_3138_3623 | 156 |
| 826 | 3300048906 | Ga0496103_0014470 | Ga0496103_0014470_1050_1526 | 156 |
| 827 | 3300048906 | Ga0496103_0353879 | Ga0496103_0353879_274_747 | 156 |
| 828 | 3300048907 | Ga0496104_0051151 | Ga0496104_0051151_2693_3166 | 156 |
| 829 | 3300048908 | Ga0496105_0004419 | Ga0496105_0004419_583_1056 | 156 |
| 830 | 3300048920 | Ga0496117_0034849 | Ga0496117_0034849_1909_2385 | 156 |
| 831 | 3300048920 | Ga0496117_0220842 | Ga0496117_0220842_397_867 | 156 |
| 832 | 3300048921 | Ga0496118_0083218 | Ga0496118_0083218_900_1376 | 156 |
| 833 | 3300048921 | Ga0496118_0190308 | Ga0496118_0190308_23_493 | 156 |
| 834 | 3300048922 | Ga0496119_0066703 | Ga0496119_0066703_432_908 | 156 |
| 835 | 3300048923 | Ga0496120_0205030 | Ga0496120_0205030_158_634 | 156 |
| 836 | 3300048924 | Ga0496121_0009408 | Ga0496121_0009408_10631_11107 | 156 |
| 837 | 3300048924 | Ga0496121_0685237 | Ga0496121_0685237_90_563 | 156 |
| 838 | 3300048927 | Ga0496124_0183938 | Ga0496124_0183938_998_1474 | 156 |
| 839 | 3300048928 | Ga0496125_0016149 | Ga0496125_0016149_1932_2408 | 156 |
| 840 | 3300048929 | Ga0496126_0042184 | Ga0496126_0042184_129_605 | 156 |
| 841 | 3300053153 | Ga0500616_0049565 | Ga0500616_0049565_316_801 | 156 |
| 842 | 3300002075 | JGI24738J21930_10002292 | JGI24738J21930_100022924 | 157 |
| 843 | 3300005616 | Ga0068852_100908872 | Ga0068852_1009088722 | 157 |
| 844 | 3300025932 | Ga0207690_10904539 | Ga0207690_109045392 | 157 |
| 845 | 3300041503 | Ga0451847_0010677 | Ga0451847_0010677_175_648 | 157 |
| 846 | 3300050496 | nmdc:mga07m45_368022_c1 | nmdc:mga07m45_368022_c1_81_596 | 157 |
| 847 | 3300050513 | nmdc:mga0rr50_1197089_c1 | nmdc:mga0rr50_1197089_c1_20_535 | 157 |
| 848 | 3300053087 | Ga0500643_000001 | Ga0500643_000001_849426_849920 | 157 |
| 849 | 3300053136 | Ga0500559_0104037 | Ga0500559_0104037_456_974 | 157 |
| 850 | 3300053139 | Ga0500568_0135285 | Ga0500568_0135285_195_671 | 157 |
| 851 | 3300053140 | Ga0500573_0197675 | Ga0500573_0197675_167_661 | 157 |
| 852 | 3300005339 | Ga0070660_100073658 | Ga0070660_1000736583 | 158 |
| 853 | 3300005455 | Ga0070663_100205680 | Ga0070663_1002056802 | 158 |
| 854 | 3300005530 | Ga0070679_100697722 | Ga0070679_1006977222 | 158 |
| 855 | 3300042131 | Ga0450894_053352 | Ga0450894_053352_16_537 | 158 |
| 856 | 3300013307 | Ga0157372_10062791 | Ga0157372_100627912 | 160 |
| 857 | 3300017792 | Ga0163161_10026756 | Ga0163161_100267562 | 160 |
| 858 | 3300048921 | Ga0496118_0020455 | Ga0496118_0020455_4472_5026 | 160 |
| 859 | 3300048924 | Ga0496121_0000222 | Ga0496121_0000222_75894_76448 | 160 |
| 860 | 3300053153 | Ga0500616_0004405 | Ga0500616_0004405_4154_4711 | 160 |
| 861 | 3300013296 | Ga0157374_10476509 | Ga0157374_104765092 | 162 |
| 862 | 3300013297 | Ga0157378_10938346 | Ga0157378_109383461 | 162 |
| 863 | 3300014745 | Ga0157377_10328575 | Ga0157377_103285752 | 162 |
| 864 | 3300049823 | Ga0501044_0000098 | Ga0501044_0000098_10555_11139 | 162 |
| 865 | 3300046512 | Ga0495610_0000377 | Ga0495610_0000377_37897_38397 | 165 |
| 866 | 3300046522 | Ga0495643_0000007 | Ga0495643_0000007_332501_333001 | 165 |
| 867 | 3300046558 | Ga0495633_0061326 | Ga0495633_0061326_1111_1611 | 165 |
| 868 | 3300046507 | Ga0495606_0308935 | Ga0495606_0308935_133_639 | 166 |
| 869 | 3300046512 | Ga0495610_0005814 | Ga0495610_0005814_1681_2187 | 166 |
| 870 | 3300046519 | Ga0495632_0149293 | Ga0495632_0149293_325_828 | 166 |
| 871 | 3300046522 | Ga0495643_0079094 | Ga0495643_0079094_144_650 | 166 |
| 872 | 3300048920 | Ga0496117_0128287 | Ga0496117_0128287_210_728 | 167 |
| 873 | 3300048924 | Ga0496121_0002362 | Ga0496121_0002362_24953_25471 | 167 |
| 874 | 3300048925 | Ga0496122_0008242 | Ga0496122_0008242_9751_10269 | 167 |
| 875 | 3300048926 | Ga0496123_0005241 | Ga0496123_0005241_243_761 | 167 |
| 876 | 3300048928 | Ga0496125_0007827 | Ga0496125_0007827_5915_6433 | 167 |
| 877 | 3300048929 | Ga0496126_0000079 | Ga0496126_0000079_292_810 | 167 |
| 878 | 2162886007 | SwRhRL2b_contig_2139260 | SwRhRL2b_0471.00005670 | 170 |
| 879 | 3300005289 | Ga0065704_10000190 | Ga0065704_10000190126 | 170 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2p5v-assembly1.cif.gz_A | crystal structure of transcriptional regulator nmb0573 from neisseria meningitidis | 0.9345 | 18 | 169 |
| 2w25-assembly1.cif.gz_B | crystal structure of glu104ala mutant | 0.9241 | 19 | 163 |
| 2ivm-assembly1.cif.gz_A | crystal structure of a transcriptional regulator | 0.9186 | 19 | 163 |
| 2zny-assembly2.cif.gz_C | crystal structure of the ffrp | 0.9164 | 20 | 168 |
| 2gqq-assembly1.cif.gz_A-2 | crystal structure of e. coli leucine-responsive regulatory protein (lrp) | 0.9159 | 20 | 170 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4pcqA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9597 | 24 | 72 | 1.10.10.10 |
| 2qz8D01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9572 | 21 | 71 | 1.10.10.10 |
| 2p5vE01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9566 | 21 | 71 | 1.10.10.10 |
| 2p6sE01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9562 | 21 | 71 | 1.10.10.10 |
| 2p6sB01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9559 | 21 | 71 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1H5U0L5-F1-model_v4 | Lrp/AsnC family transcriptional regulator, leucine-responsive regulatory protein | 0.9679 | 17 | 163 |
GO:0005829
GO:0043200 GO:0043565 |
| AF-A0A3N7C0L3-F1-model_v4 | AsnC family transcriptional regulator | 0.964 | 17 | 169 |
GO:0005829
GO:0043200 GO:0043565 |
| AF-A0A5E8KUL6-F1-model_v4 | deleted | 0.9617 | 18 | 169 |
|
| AF-A0A1K1RDQ7-F1-model_v4 | Lrp/AsnC family transcriptional regulator, leucine-responsive regulatory protein | 0.9608 | 20 | 169 |
GO:0005829
GO:0043200 GO:0043565 |
| AF-A0A381VKJ2-F1-model_v4 | HTH asnC-type domain-containing protein | 0.9605 | 20 | 170 |
GO:0005829
GO:0043200 GO:0043565 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar