F484417

General Info

Members Datasets Scaffolds Average Seq Length
878 526 850 152

Family's Representative Sequence

Representative Sequence 3300006353|Ga0075370_10045539|Ga0075370_100455394
Length 158
Sequence MTTTGHPKTEAAHANKPSITRPQVVVYTDGACKGNPGPGGWGAWLSSGGHEKELFGGEALTTNNRMELTAVIEALASLKRTCDVILYTDSEYVRKGITEWIHGWKTRDKKPVKNADLWQRLDALRLLHRVEFRWVKGHAGDPGNERADALANRGCASV

Samples

Sample ID Description Type Environment
1 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
2 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
3 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
4 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
5 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
6 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
7 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
8 2738541297 Duganella sp. GV083 Isolate Unclassified
9 2738541357 Duganella sp. GV053 Isolate Unclassified
10 2738543003 Duganella sp. GV066 Isolate Unclassified
11 2738543026 Duganella sp. GV089 Isolate Unclassified
12 2738543029 Duganella sp. GV039 Isolate Unclassified
13 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
14 2818991436 Collimonas arenae 515 Isolate Unclassified
15 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
16 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
17 2842711865 Duganella sp. R-73148 Isolate Unclassified
18 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
19 2857553236 Duganella sp. R-74557 Isolate Unclassified
20 2857558681 Duganella sp. R-74565 Isolate Unclassified
21 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
22 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
23 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
24 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
25 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
26 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
27 2919476304 Duganella sp. 3397 Isolate Unclassified
28 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
29 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
30 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
31 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
32 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
33 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
34 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
35 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
36 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
37 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
38 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
39 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
40 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
41 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
42 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
43 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
44 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
45 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
46 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
47 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
48 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
49 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
50 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
51 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
52 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
53 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
54 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
55 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
56 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
57 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
58 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
59 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
60 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
61 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
62 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
63 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
64 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
65 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
66 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
67 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
68 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
69 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
70 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
71 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
72 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
73 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
74 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
75 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
76 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
77 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
78 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
79 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
80 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
81 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
82 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
83 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
84 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
85 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
86 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
87 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
88 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
89 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
90 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
91 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
92 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
93 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
94 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
95 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
96 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
97 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
98 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
99 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
100 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
101 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
102 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
103 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
104 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
105 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
106 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
107 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
108 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
109 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
110 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
111 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
112 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
113 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
114 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
115 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
116 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
117 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
118 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
119 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
120 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
121 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
122 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
123 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
124 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
125 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
126 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
127 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
128 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
129 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
130 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
131 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
132 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
133 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
134 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
135 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
136 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
137 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
138 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
139 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
140 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
141 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
142 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
143 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
144 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
145 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
146 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
147 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
148 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
149 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
150 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
151 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
152 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
153 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
154 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
155 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
156 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
157 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
158 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
159 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
160 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
161 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
162 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
163 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
164 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
165 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
166 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
167 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
168 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
169 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
170 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
171 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
172 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
173 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
174 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
175 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
176 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
177 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
178 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
185 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
186 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
188 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
189 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
190 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
192 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
193 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
194 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
195 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
196 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
198 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
199 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
200 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
201 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
202 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
203 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
204 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
205 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
206 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
260 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
261 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
262 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
263 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
264 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
265 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
266 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
267 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
268 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
269 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
270 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
271 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
272 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
273 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
274 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
275 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
276 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
277 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
278 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
279 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
280 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
284 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
285 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
286 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
287 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
288 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
289 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
290 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
291 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
292 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
293 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
294 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
295 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
296 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
297 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
298 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
299 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
300 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
301 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
302 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
303 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
304 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
305 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
306 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
307 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
308 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
309 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
310 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
311 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
312 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
313 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
314 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
315 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
316 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
317 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
318 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
319 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
320 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
321 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
322 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
323 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
324 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
325 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
326 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
327 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
328 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
329 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
330 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
331 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
332 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
333 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
334 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
335 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
336 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
337 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
338 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
339 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
340 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
341 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
342 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
343 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
344 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
345 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
346 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
347 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
348 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
349 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
350 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
351 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
352 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
353 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
354 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
355 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
356 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
357 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
358 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
359 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
360 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
361 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
362 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
363 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
364 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
365 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
366 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
367 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
368 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
369 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
370 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
371 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
372 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
373 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
374 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
375 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
376 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
377 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
378 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
379 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
380 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
381 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
382 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
383 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
384 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
385 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
386 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
387 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
388 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
389 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
390 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
391 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
392 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
393 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
394 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
395 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
396 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
397 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
398 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
399 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
400 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
401 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
402 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
403 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
404 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
405 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
406 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
407 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
408 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
409 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
410 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
411 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
412 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
413 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
414 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
415 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
416 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
417 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
418 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
419 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
420 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
421 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
422 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
423 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
424 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
425 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
426 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
427 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
428 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
429 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
430 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
431 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
432 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
433 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
434 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
435 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
436 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
437 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
438 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
439 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
440 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
441 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
442 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
443 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
444 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
445 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
446 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
447 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
448 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
449 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
450 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
451 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
452 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
453 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
454 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
455 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
456 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
457 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
458 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
459 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
460 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
461 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
462 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
463 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
464 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
465 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
466 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
467 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
468 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
469 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
470 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
471 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
472 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
473 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
474 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
475 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
476 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
477 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
478 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
479 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
480 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
481 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
482 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
483 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
484 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
485 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
486 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
487 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
488 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
489 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
490 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
491 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
492 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
493 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
494 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
495 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
496 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
497 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
498 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
499 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
500 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
501 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
502 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
503 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
504 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
505 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
506 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
507 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
508 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
509 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
510 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
511 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
512 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
513 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
514 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
515 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
516 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
517 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
518 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
519 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
520 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
521 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
522 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
523 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
524 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
525 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
526 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.58
Metatranscriptomes 0.23
Isolates 3.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.11
Nodule 0.68
Rhizoplane 1.71
Rhizosphere 70.84
Stem 0
Stem Tuber 0
Unclassified 8.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000132 3300002704 Bacteria 35559
2 JGI25155J39150_1000204 3300002704 Bacteria 24399
3 JGI25156J39149_1000154 3300002705 Bacteria 50528
4 JGI25162J39368_1000001 3300002737 Bacteria 740113
5 JGI25154J39366_1000401 3300002738 Bacteria 23593
6 JGI25154J39366_1000462 3300002738 Bacteria 21234
7 JGI25154J39366_1000584 3300002738 Bacteria 17690
8 JGI25158J39367_1012090 3300002739 Bacteria 1142
9 JGI25157J39369_1000169 3300002741 Bacteria 55047
10 JGI25163J39215_1002212 3300002771 Bacteria 2201
11 JGI25164J39214_1004383 3300002772 Bacteria 1635
12 JGI25150J39212_1001132 3300002774 Bacteria 8025
13 JGI25159J45721_1001688 3300002987 Bacteria 8942
14 JGI25165J46597_1000001 3300003214 Bacteria 1111887
15 JGI25153J46596_10037994 3300003215 Bacteria 1524
16 rootL2_10030503 3300003322 Bacteria 7631
17 rootL2_10034610 3300003322 Bacteria 6021
18 rootL2_10050963 3300003322 Bacteria 3280
19 rootL2_10105907 3300003322 Bacteria 1869
20 JGI26145J50221_1001623 3300003371 Bacteria 1776
21 Ga0055538_1000001 3300003751 Bacteria 1111887
22 Ga0055538_1000070 3300003751 Bacteria 93518
23 Ga0055539_1000001 3300003752 Bacteria 1111887
24 Ga0055539_1000105 3300003752 Bacteria 93518
25 Ga0055533_1000003 3300003756 Bacteria 1111887
26 Ga0055533_1000113 3300003756 Bacteria 93518
27 Ga0055532_1000017 3300003758 Bacteria 306880
28 Ga0055525_1000003 3300003759 Bacteria 962094
29 Ga0055525_1000153 3300003759 Bacteria 93518
30 Ga0055535_1007775 3300003761 Bacteria 2006
31 Ga0055529_1000836 3300003763 Bacteria 18140
32 Ga0055526_1000023 3300003771 Bacteria 163444
33 Ga0055526_1000341 3300003771 Bacteria 38207
34 Ga0055526_1010195 3300003771 Bacteria 4404
35 Ga0055537_1000129 3300003773 Bacteria 57643
36 Ga0055524_1000151 3300003775 Bacteria 82351
37 Ga0055524_1002022 3300003775 Bacteria 10819
38 Ga0055534_1000594 3300003784 Bacteria 18790
39 Ga0055534_1000965 3300003784 Bacteria 12758
40 Ga0055528_1000013 3300003790 Bacteria 176239
41 Ga0055540_1071329 3300003792 Bacteria 678
42 Ga0055531_10000044 3300003794 Bacteria 133446
43 Ga0055541_1000001 3300003841 Bacteria 1111887
44 Ga0055541_1000071 3300003841 Bacteria 93518
45 Ga0065165_1000005 3300005262 Bacteria 370361
46 Ga0065704_10108090 3300005289 Bacteria 2039
47 Ga0065704_10313445 3300005289 Bacteria 864
48 Ga0065712_10012574 3300005290 Unclassified 2501
49 Ga0065715_10042946 3300005293 Unclassified 1262
50 Ga0070676_10084340 3300005328 Bacteria 1934
51 Ga0070683_101637237 3300005329 Bacteria 619
52 Ga0070690_100190718 3300005330 Bacteria 1421
53 Ga0070670_100096244 3300005331 Bacteria 2547
54 Ga0070677_10043647 3300005333 Bacteria 1781
55 Ga0070677_10276683 3300005333 Bacteria 844
56 Ga0068869_100010984 3300005334 Bacteria 5929
57 Ga0070666_10050883 3300005335 Bacteria 2788
58 Ga0070666_10147195 3300005335 Bacteria 1642
59 Ga0070680_100069471 3300005336 Bacteria 2892
60 Ga0070682_100182320 3300005337 Bacteria 1468
61 Ga0068868_100015268 3300005338 Bacteria 5677
62 Ga0068868_100322227 3300005338 Bacteria 1317
63 Ga0070660_100060819 3300005339 Bacteria 2932
64 Ga0070660_100230977 3300005339 Bacteria 1505
65 Ga0070689_100003473 3300005340 Bacteria 10491
66 Ga0070691_10028707 3300005341 Bacteria 2601
67 Ga0070687_100007263 3300005343 Bacteria 4606
68 Ga0070661_100007428 3300005344 Bacteria 7556
69 Ga0070661_100157192 3300005344 Bacteria 1720
70 Ga0070692_10067874 3300005345 Bacteria 1894
71 Ga0070668_100024157 3300005347 Bacteria 4603
72 Ga0070669_100548603 3300005353 Bacteria 963
73 Ga0070669_101436298 3300005353 Bacteria 599
74 Ga0070675_100087418 3300005354 Bacteria 2606
75 Ga0070675_100105687 3300005354 Bacteria 2376
76 Ga0070671_100088620 3300005355 Bacteria 2590
77 Ga0070674_100014049 3300005356 Bacteria 4969
78 Ga0070674_100215730 3300005356 Bacteria 1490
79 Ga0070673_100002884 3300005364 Bacteria 10578
80 Ga0070688_100043383 3300005365 Bacteria 2771
81 Ga0070659_100003919 3300005366 Bacteria 10591
82 Ga0070659_100013137 3300005366 Bacteria 6157
83 Ga0070667_100116855 3300005367 Bacteria 2317
84 Ga0070667_101117695 3300005367 Bacteria 737
85 Ga0070709_10031572 3300005434 Bacteria 3187
86 Ga0070701_10036575 3300005438 Bacteria 2474
87 Ga0070711_100165441 3300005439 Bacteria 1681
88 Ga0070705_100042649 3300005440 Bacteria 2595
89 Ga0070700_100007514 3300005441 Bacteria 5892
90 Ga0070694_100071619 3300005444 Bacteria 2389
91 Ga0070708_100106236 3300005445 Bacteria 2577
92 Ga0070663_100802480 3300005455 Bacteria 807
93 Ga0070678_100014162 3300005456 Bacteria 5022
94 Ga0070662_100001274 3300005457 Bacteria 15485
95 Ga0070662_100015383 3300005457 Bacteria 5123
96 Ga0070662_100075388 3300005457 Bacteria 2498
97 Ga0070681_10025086 3300005458 Bacteria 6000
98 Ga0068867_100086893 3300005459 Bacteria 2367
99 Ga0068867_100228970 3300005459 Bacteria 1501
100 Ga0070685_10212160 3300005466 Bacteria 1264
101 Ga0070679_100054705 3300005530 Bacteria 3975
102 Ga0070679_100237334 3300005530 Bacteria 1782
103 Ga0070684_100160149 3300005535 Bacteria 2041
104 Ga0068853_100614700 3300005539 Bacteria 1033
105 Ga0070672_100008006 3300005543 Bacteria 7220
106 Ga0070672_100452748 3300005543 Bacteria 1106
107 Ga0070686_100015688 3300005544 Bacteria 4395
108 Ga0070695_100161462 3300005545 Bacteria 1573
109 Ga0070696_100080067 3300005546 Bacteria 2312
110 Ga0070693_100321217 3300005547 Bacteria 1050
111 Ga0070665_100438296 3300005548 Bacteria 1316
112 Ga0070665_101111966 3300005548 Bacteria 802
113 Ga0070665_101723604 3300005548 Bacteria 634
114 Ga0068855_100000645 3300005563 Bacteria 42677
115 Ga0068855_101184776 3300005563 Bacteria 795
116 Ga0070664_100075089 3300005564 Bacteria 2902
117 Ga0070664_100085441 3300005564 Bacteria 2725
118 Ga0068857_100119545 3300005577 Bacteria 2372
119 Ga0068857_100140107 3300005577 Bacteria 2186
120 Ga0068854_100081911 3300005578 Bacteria 2385
121 Ga0068854_100499274 3300005578 Bacteria 1024
122 Ga0068856_100299641 3300005614 Bacteria 1625
123 Ga0070702_100004200 3300005615 Bacteria 6552
124 Ga0068859_100003059 3300005617 Bacteria 16971
125 Ga0068859_100801284 3300005617 Bacteria 1030
126 Ga0068864_100083818 3300005618 Bacteria 2800
127 Ga0068866_10021224 3300005718 Bacteria 2990
128 Ga0068866_10122569 3300005718 Bacteria 1467
129 Ga0068861_100148175 3300005719 Bacteria 1923
130 Ga0068870_10327405 3300005840 Bacteria 975
131 Ga0068858_100868776 3300005842 Bacteria 881
132 Ga0068858_101624648 3300005842 Bacteria 638
133 Ga0068860_100091353 3300005843 Bacteria 2900
134 Ga0068862_100087801 3300005844 Bacteria 2705
135 Ga0070717_10503794 3300006028 Bacteria 1094
136 Ga0075365_10142883 3300006038 Bacteria 1662
137 Ga0075368_10021444 3300006042 Bacteria 2454
138 Ga0075368_10065499 3300006042 Bacteria 1460
139 Ga0075368_10146951 3300006042 Bacteria 984
140 Ga0075363_100005677 3300006048 Bacteria 5583
141 Ga0075364_10383477 3300006051 Bacteria 959
142 Ga0075432_10011257 3300006058 Bacteria 3041
143 Ga0070715_10125922 3300006163 Bacteria 1227
144 Ga0070712_100010843 3300006175 Bacteria 5764
145 Ga0070712_100021105 3300006175 Bacteria 4271
146 Ga0075362_10000768 3300006177 Bacteria 9563
147 Ga0075362_10014252 3300006177 Bacteria 3204
148 Ga0075362_10014530 3300006177 Bacteria 3179
149 Ga0075362_10108963 3300006177 Bacteria 1302
150 Ga0075367_10004491 3300006178 Bacteria 6819
151 Ga0075367_10006418 3300006178 Bacteria 5938
152 Ga0075369_10004486 3300006186 Bacteria 5161
153 Ga0075427_10017279 3300006194 Bacteria 1124
154 Ga0075366_10001662 3300006195 Bacteria 11166
155 Ga0075366_10021765 3300006195 Bacteria 3728
156 Ga0075366_10032423 3300006195 Bacteria 3075
157 Ga0075366_10308560 3300006195 Bacteria 968
158 Ga0075366_10428268 3300006195 Bacteria 815
159 Ga0097621_100001607 3300006237 Bacteria 15477
160 Ga0075370_10000340 3300006353 Bacteria 16849
161 Ga0075370_10003500 3300006353 Bacteria 7483
162 Ga0075370_10007532 3300006353 Bacteria 5548
163 Ga0075370_10045539 3300006353 Bacteria 2481
164 Ga0075370_10053180 3300006353 Bacteria 2298
165 Ga0075370_10074611 3300006353 Bacteria 1944
166 Ga0075370_10149660 3300006353 Bacteria 1368
167 Ga0068871_100013291 3300006358 Bacteria 6107
168 Ga0075428_100954627 3300006844 Bacteria 908
169 Ga0075430_100392893 3300006846 Bacteria 1145
170 Ga0075431_100022194 3300006847 Bacteria 6491
171 Ga0075434_100061167 3300006871 Bacteria 3746
172 Ga0075429_100341672 3300006880 Bacteria 1310
173 Ga0068865_100000749 3300006881 Bacteria 18204
174 Ga0075436_100081141 3300006914 Unclassified 2248
175 Ga0075436_100227179 3300006914 Bacteria 1325
176 Ga0097620_100003059 3300006931 Bacteria 16971
177 Ga0097620_100801295 3300006931 Bacteria 1030
178 Ga0099826_10000001 3300006948 Bacteria 1155201
179 Ga0075435_100063931 3300007076 Bacteria 2989
180 Ga0105240_10084689 3300009093 Bacteria 3887
181 Ga0105240_10143049 3300009093 Bacteria 2858
182 Ga0105240_11943960 3300009093 Bacteria 612
183 Ga0111539_11135623 3300009094 Bacteria 908
184 Ga0105245_10010244 3300009098 Bacteria 8163
185 Ga0105245_10035552 3300009098 Bacteria 4421
186 Ga0105245_10104106 3300009098 Bacteria 2631
187 Ga0105247_10002270 3300009101 Bacteria 13205
188 Ga0114129_10137856 3300009147 Bacteria 3347
189 Ga0114129_10328752 3300009147 Bacteria 2030
190 Ga0114129_11327033 3300009147 Bacteria 890
191 Ga0105243_10002966 3300009148 Bacteria 14026
192 Ga0105243_10045475 3300009148 Bacteria 3450
193 Ga0105243_10047246 3300009148 Bacteria 3388
194 Ga0105242_10003901 3300009176 Bacteria 11594
195 Ga0105248_10486994 3300009177 Bacteria 1390
196 Ga0105237_10017662 3300009545 Bacteria 7393
197 Ga0105237_10157015 3300009545 Bacteria 2272
198 Ga0105237_11514084 3300009545 Bacteria 678
199 Ga0105238_10000213 3300009551 Bacteria 64398
200 Ga0105238_10778280 3300009551 Bacteria 972
201 Ga0105239_10139319 3300010375 Bacteria 2703
202 Ga0105239_10260702 3300010375 Bacteria 1948
203 Ga0105239_10690031 3300010375 Bacteria 1167
204 Ga0105246_10010500 3300011119 Bacteria 5733
205 Ga0157371_10085802 3300013102 Bacteria 2230
206 Ga0157374_10016050 3300013296 Bacteria 6580
207 Ga0157374_10285472 3300013296 Bacteria 1630
208 Ga0157378_10194214 3300013297 Bacteria 1916
209 Ga0157372_10300490 3300013307 Bacteria 1867
210 Ga0157375_10110808 3300013308 Bacteria 2843
211 Ga0163163_12374153 3300014325 Bacteria 589
212 Ga0157380_10058979 3300014326 Bacteria 3061
213 Ga0157380_10161348 3300014326 Bacteria 1949
214 Ga0182008_10201802 3300014497 Bacteria 1012
215 Ga0157377_10095360 3300014745 Bacteria 1763
216 Ga0157377_10410938 3300014745 Bacteria 924
217 Ga0157376_10577375 3300014969 Bacteria 1116
218 Ga0157376_10760363 3300014969 Bacteria 979
219 Ga0182006_1000008 3300015261 Bacteria 449652
220 Ga0182006_1005802 3300015261 Bacteria 5819
221 Ga0182007_10012607 3300015262 Bacteria 3246
222 Ga0182005_1000008 3300015265 Bacteria 471394
223 Ga0182005_1000337 3300015265 Bacteria 27196
224 Ga0213872_10000148 3300021361 Bacteria 64199
225 Ga0213872_10010316 3300021361 Bacteria 4450
226 Ga0213872_10073827 3300021361 Bacteria 1536
227 Ga0213875_10014593 3300021388 Unclassified 3830
228 Ga0209435_100015 3300025206 Bacteria 321177
229 Ga0209435_100162 3300025206 Bacteria 21364
230 Ga0209760_101080 3300025207 Bacteria 3139
231 Ga0209784_100004 3300025224 Bacteria 1378156
232 Ga0209784_100009 3300025224 Bacteria 688031
233 Ga0209566_100004 3300025225 Bacteria 1531866
234 Ga0209566_100007 3300025225 Bacteria 688031
235 Ga0209674_100006 3300025226 Bacteria 1531866
236 Ga0209674_100018 3300025226 Bacteria 688031
237 Ga0209672_106477 3300025228 Bacteria 1895
238 Ga0209147_100004 3300025229 Bacteria 1371850
239 Ga0209563_100009 3300025230 Bacteria 1378156
240 Ga0209563_100020 3300025230 Bacteria 688031
241 Ga0207427_100514 3300025231 Bacteria 20525
242 Ga0209437_100004 3300025233 Bacteria 1378156
243 Ga0209437_100045 3300025233 Bacteria 429809
244 Ga0209437_101546 3300025233 Bacteria 5379
245 Ga0209258_100226 3300025242 Bacteria 106588
246 Ga0207425_1001395 3300025245 Bacteria 10198
247 Ga0207425_1001773 3300025245 Bacteria 8388
248 Ga0209646_1000020 3300025246 Bacteria 462204
249 Ga0209646_1000040 3300025246 Bacteria 347867
250 Ga0209646_1000252 3300025246 Bacteria 53546
251 Ga0209026_1000034 3300025250 Bacteria 306953
252 Ga0209677_100005 3300025253 Bacteria 1378156
253 Ga0209677_100010 3300025253 Bacteria 688031
254 Ga0209148_1025257 3300025254 Bacteria 931
255 Ga0209759_1000049 3300025256 Bacteria 221692
256 Ga0209759_1000809 3300025256 Bacteria 25105
257 Ga0209129_1000025 3300025258 Bacteria 413639
258 Ga0209233_1000005 3300025261 Bacteria 1531866
259 Ga0209565_1000003 3300025263 Bacteria 1099648
260 Ga0209565_1005211 3300025263 Bacteria 3813
261 Ga0209455_1000026 3300025272 Bacteria 653778
262 Ga0209455_1002265 3300025272 Bacteria 7569
263 Ga0209673_1000003 3300025273 Bacteria 980859
264 Ga0209673_1014092 3300025273 Bacteria 3114
265 Ga0209130_1000046 3300025284 Bacteria 236658
266 Ga0209675_1000003 3300025291 Bacteria 1003982
267 Ga0209564_1000002 3300025295 Bacteria 1636803
268 Ga0209564_1000012 3300025295 Bacteria 792078
269 Ga0209564_1000039 3300025295 Bacteria 413604
270 Ga0209758_1000196 3300025297 Bacteria 133816
271 Ga0209758_1000679 3300025297 Bacteria 50729
272 Ga0209050_1004618 3300025298 Bacteria 9193
273 Ga0209256_1000007 3300025299 Bacteria 1136599
274 Ga0209256_1000112 3300025299 Bacteria 178432
275 Ga0209256_1018225 3300025299 Bacteria 2294
276 Ga0209051_1012288 3300025303 Bacteria 4151
277 Ga0209051_1017173 3300025303 Bacteria 3242
278 Ga0209257_1000094 3300025304 Bacteria 262243
279 Ga0209257_1009045 3300025304 Bacteria 5456
280 Ga0207697_10056774 3300025315 Bacteria 1624
281 Ga0207653_10331764 3300025885 Bacteria 593
282 Ga0207682_10023671 3300025893 Bacteria 2428
283 Ga0207642_10137133 3300025899 Bacteria 1285
284 Ga0207642_10146883 3300025899 Bacteria 1250
285 Ga0207710_10001706 3300025900 Bacteria 10650
286 Ga0207688_10200881 3300025901 Bacteria 1195
287 Ga0207680_10398496 3300025903 Bacteria 972
288 Ga0207699_10037289 3300025906 Bacteria 2778
289 Ga0207645_10000134 3300025907 Bacteria 56602
290 Ga0207645_10383556 3300025907 Bacteria 944
291 Ga0207643_10256150 3300025908 Bacteria 1079
292 Ga0207707_10065503 3300025912 Bacteria 3165
293 Ga0207707_10390168 3300025912 Bacteria 1196
294 Ga0207695_10001039 3300025913 Bacteria 48767
295 Ga0207695_10116269 3300025913 Bacteria 2648
296 Ga0207671_10026866 3300025914 Bacteria 4306
297 Ga0207671_10086655 3300025914 Bacteria 2354
298 Ga0207693_10005621 3300025915 Bacteria 10426
299 Ga0207693_10072058 3300025915 Bacteria 2705
300 Ga0207663_10423632 3300025916 Bacteria 1022
301 Ga0207660_10020287 3300025917 Bacteria 4456
302 Ga0207662_10011397 3300025918 Bacteria 4931
303 Ga0207657_10026089 3300025919 Bacteria 5376
304 Ga0207657_10028740 3300025919 Bacteria 5067
305 Ga0207649_10019348 3300025920 Bacteria 3890
306 Ga0207649_10057169 3300025920 Bacteria 2438
307 Ga0207649_10332933 3300025920 Bacteria 1119
308 Ga0207652_10357425 3300025921 Bacteria 1318
309 Ga0207681_10031585 3300025923 Bacteria 3460
310 Ga0207681_10097888 3300025923 Bacteria 2109
311 Ga0207650_10187755 3300025925 Bacteria 1650
312 Ga0207659_10146090 3300025926 Bacteria 1841
313 Ga0207659_10261465 3300025926 Bacteria 1408
314 Ga0207687_10118563 3300025927 Bacteria 1976
315 Ga0207644_10285643 3300025931 Bacteria 1326
316 Ga0207644_10481033 3300025931 Bacteria 1023
317 Ga0207690_10089316 3300025932 Bacteria 2172
318 Ga0207690_10137951 3300025932 Bacteria 1793
319 Ga0207706_10000433 3300025933 Bacteria 44824
320 Ga0207706_10015176 3300025933 Bacteria 6971
321 Ga0207706_10096028 3300025933 Bacteria 2606
322 Ga0207706_10177454 3300025933 Bacteria 1871
323 Ga0207686_10268853 3300025934 Bacteria 1253
324 Ga0207709_10036278 3300025935 Bacteria 2921
325 Ga0207709_10092398 3300025935 Bacteria 1981
326 Ga0207670_10002879 3300025936 Bacteria 9078
327 Ga0207669_10481241 3300025937 Bacteria 989
328 Ga0207704_10222176 3300025938 Bacteria 1398
329 Ga0207665_10156836 3300025939 Bacteria 1634
330 Ga0207691_10002432 3300025940 Bacteria 18214
331 Ga0207691_10569018 3300025940 Bacteria 960
332 Ga0207711_10373407 3300025941 Bacteria 1323
333 Ga0207689_10056609 3300025942 Bacteria 3227
334 Ga0207689_10140401 3300025942 Bacteria 1990
335 Ga0207689_10287631 3300025942 Bacteria 1361
336 Ga0207689_10554411 3300025942 Bacteria 965
337 Ga0207661_11140707 3300025944 Bacteria 718
338 Ga0207679_10002243 3300025945 Bacteria 11939
339 Ga0207679_10083987 3300025945 Bacteria 2443
340 Ga0207667_10000191 3300025949 Bacteria 89641
341 Ga0207667_10030385 3300025949 Bacteria 5846
342 Ga0207667_11033363 3300025949 Bacteria 808
343 Ga0207651_10024042 3300025960 Bacteria 3760
344 Ga0207668_10116878 3300025972 Bacteria 2012
345 Ga0207668_10148139 3300025972 Bacteria 1814
346 Ga0207640_10056394 3300025981 Bacteria 2578
347 Ga0207640_10095662 3300025981 Bacteria 2069
348 Ga0207677_10047475 3300026023 Bacteria 2883
349 Ga0207677_10367241 3300026023 Bacteria 1211
350 Ga0207639_10346594 3300026041 Bacteria 1325
351 Ga0207639_10740501 3300026041 Bacteria 914
352 Ga0207678_10029766 3300026067 Bacteria 4767
353 Ga0207708_10063368 3300026075 Bacteria 2824
354 Ga0207702_10979350 3300026078 Bacteria 839
355 Ga0207648_10003400 3300026089 Bacteria 16699
356 Ga0207676_11277466 3300026095 Bacteria 728
357 Ga0207676_11328372 3300026095 Bacteria 714
358 Ga0207674_10117691 3300026116 Bacteria 2628
359 Ga0207674_10168123 3300026116 Bacteria 2146
360 Ga0207674_10439864 3300026116 Bacteria 1260
361 Ga0207674_10579583 3300026116 Bacteria 1084
362 Ga0207675_100214009 3300026118 Bacteria 1855
363 Ga0207675_100467947 3300026118 Bacteria 1251
364 Ga0207683_10000036 3300026121 Bacteria 101173
365 Ga0207683_10111179 3300026121 Bacteria 2453
366 Ga0207698_10017930 3300026142 Bacteria 4813
367 Ga0209281_1018100 3300027111 Bacteria 1416
368 Ga0209969_1000834 3300027360 Bacteria 4145
369 Ga0209967_1000395 3300027364 Bacteria 5757
370 Ga0209981_1001350 3300027378 Bacteria 3104
371 Ga0209996_1000010 3300027395 Bacteria 28392
372 Ga0209984_1000348 3300027424 Bacteria 5117
373 Ga0209984_1036081 3300027424 Bacteria 706
374 Ga0210000_1000006 3300027462 Bacteria 37930
375 Ga0209995_1000073 3300027471 Bacteria 16029
376 Ga0209968_1000047 3300027526 Bacteria 21860
377 Ga0209999_1000700 3300027543 Bacteria 5423
378 Ga0209982_1001009 3300027552 Bacteria 3733
379 Ga0209970_1010858 3300027614 Bacteria 1494
380 Ga0210002_1000143 3300027617 Bacteria 10813
381 Ga0209983_1018189 3300027665 Bacteria 1458
382 Ga0209282_1000001 3300027666 Bacteria 2450367
383 Ga0209971_1001389 3300027682 Bacteria 6017
384 Ga0209971_1007112 3300027682 Bacteria 2653
385 Ga0209966_1000182 3300027695 Bacteria 25722
386 Ga0209998_10000014 3300027717 Bacteria 91397
387 Ga0209813_10015447 3300027866 Bacteria 2069
388 Ga0209974_10000725 3300027876 Bacteria 11270
389 Ga0209974_10037638 3300027876 Bacteria 1606
390 Ga0207428_10006054 3300027907 Bacteria 11180
391 Ga0268266_10162728 3300028379 Bacteria 2020
392 Ga0268265_10208410 3300028380 Bacteria 1701
393 Ga0268264_10068360 3300028381 Bacteria 3002
394 Ga0268264_10235932 3300028381 Bacteria 1692
395 Ga0265334_10004043 3300028573 Bacteria 6577
396 Ga0265318_10006926 3300028577 Bacteria 5167
397 Ga0307517_10104341 3300028786 Bacteria 2209
398 Ga0307517_10132307 3300028786 Bacteria 1790
399 Ga0307515_10000416 3300028794 Bacteria 102535
400 Ga0307515_10021948 3300028794 Bacteria 11287
401 Ga0307515_10035905 3300028794 Bacteria 8043
402 Ga0307515_10084784 3300028794 Bacteria 4063
403 Ga0307515_10277025 3300028794 Bacteria 1390
404 Ga0265338_10165091 3300028800 Bacteria 1705
405 Ga0265330_10142497 3300031235 Bacteria 1019
406 Ga0265328_10031773 3300031239 Bacteria 1961
407 Ga0265328_10075933 3300031239 Bacteria 1237
408 Ga0265320_10028158 3300031240 Bacteria 2920
409 Ga0265325_10051280 3300031241 Bacteria 2122
410 Ga0265325_10054658 3300031241 Bacteria 2043
411 Ga0265329_10077120 3300031242 Bacteria 1055
412 Ga0265329_10094644 3300031242 Bacteria 949
413 Ga0265339_10310121 3300031249 Bacteria 751
414 Ga0265331_10007350 3300031250 Bacteria 6382
415 Ga0265331_10009455 3300031250 Bacteria 5471
416 Ga0265331_10058777 3300031250 Bacteria 1819
417 Ga0265327_10000043 3300031251 Bacteria 285108
418 Ga0265327_10000271 3300031251 Bacteria 102433
419 Ga0265327_10002604 3300031251 Bacteria 18671
420 Ga0265327_10093622 3300031251 Bacteria 1461
421 Ga0265316_10063161 3300031344 Bacteria 2872
422 Ga0307513_10189608 3300031456 Bacteria 1909
423 Ga0265313_10000626 3300031595 Bacteria 36567
424 Ga0265313_10008190 3300031595 Bacteria 6984
425 Ga0307508_10000017 3300031616 Bacteria 203567
426 Ga0307508_10048900 3300031616 Bacteria 3767
427 Ga0307514_10015317 3300031649 Bacteria 6332
428 Ga0265314_10032855 3300031711 Bacteria 3812
429 Ga0265342_10135376 3300031712 Bacteria 1377
430 Ga0307516_10000525 3300031730 Bacteria 51244
431 Ga0307516_10002317 3300031730 Bacteria 25638
432 Ga0307516_10085138 3300031730 Bacteria 2999
433 Ga0307516_10252822 3300031730 Bacteria 1456
434 Ga0307516_10606732 3300031730 Bacteria 749
435 Ga0307416_100434064 3300032002 Bacteria 1361
436 Ga0307416_100749548 3300032002 Unclassified 1069
437 Ga0307510_10003830 3300033180 Bacteria 17622
438 Ga0307510_10276015 3300033180 Bacteria 1154
439 Ga0373950_0049933 3300034818 Bacteria 820
440 Ga0373926_0008497 3300035083 Bacteria 3417
441 Ga0373934_0056179 3300035086 Bacteria 1565
442 Ga0373934_0116308 3300035086 Bacteria 1086
443 Ga0373951_0029924 3300035091 Bacteria 1280
444 Ga0373923_0007533 3300035111 Bacteria 3832
445 Ga0373932_0028610 3300035112 Bacteria 1533
446 Ga0373936_0005299 3300035113 Bacteria 4853
447 Ga0373939_0103885 3300035114 Bacteria 979
448 Ga0373941_0134973 3300035115 Bacteria 892
449 Ga0373945_0040048 3300035116 Bacteria 1691
450 Ga0373953_0005871 3300035117 Bacteria 4011
451 Ga0373954_0008316 3300035118 Bacteria 4552
452 Ga0373956_0397291 3300035119 Bacteria 657
453 Ga0373957_0062062 3300035120 Bacteria 1449
454 Ga0373946_0107196 3300035171 Bacteria 1260
455 Ga0373961_0033076 3300035241 Bacteria 1454
456 Ga0373962_0068642 3300035242 Bacteria 1055
457 Ga0373931_0035473 3300035691 Bacteria 2594
458 Ga0373931_0430578 3300035691 Bacteria 840
459 Ga0373935_0089927 3300035692 Bacteria 2008
460 Ga0373927_0009046 3300035695 Bacteria 6686
461 Ga0373933_0347978 3300035724 Bacteria 962
462 Ga0373933_0776497 3300035724 Bacteria 630
463 Ga0373937_0116818 3300036401 Bacteria 2484
464 Ga0316582_0325899 3300036647 Bacteria 1056
465 Ga0373925_0196552 3300037068 Bacteria 1602
466 Ga0373925_0466471 3300037068 Bacteria 1035
467 Ga0395899_0002847 3300037312 Bacteria 13928
468 Ga0395899_0037721 3300037312 Bacteria 3622
469 Ga0395899_0096847 3300037312 Bacteria 2133
470 Ga0395899_0782235 3300037312 Bacteria 591
471 Ga0395900_0022865 3300037418 Bacteria 6397
472 Ga0395900_0155446 3300037418 Bacteria 2336
473 Ga0395900_0171095 3300037418 Bacteria 2211
474 Ga0395900_1620362 3300037418 Bacteria 558
475 Ga0395898_0009320 3300037466 Bacteria 10318
476 Ga0395905_0000002 3300037471 Bacteria 1356358
477 Ga0395905_0000869 3300037471 Bacteria 39396
478 Ga0395905_0029166 3300037471 Bacteria 5200
479 Ga0395905_0040982 3300037471 Bacteria 4344
480 Ga0395905_0167165 3300037471 Bacteria 2067
481 Ga0395905_1093919 3300037471 Bacteria 700
482 Ga0395905_1300301 3300037471 Bacteria 631
483 Ga0436364_0372099 3300037853 Bacteria 8414
484 Ga0395901_0041924 3300038443 Bacteria 4744
485 Ga0395901_0172459 3300038443 Bacteria 2269
486 Ga0395901_0196471 3300038443 Bacteria 2115
487 Ga0395901_0517295 3300038443 Bacteria 1213
488 Ga0436361_0243249 3300039447 Bacteria 2160
489 Ga0436361_0249401 3300039447 Bacteria 41096
490 Ga0436361_0838192 3300039447 Bacteria 788
491 Ga0436361_1039366 3300039447 Bacteria 2368
492 Ga0436363_1301619 3300039450 Bacteria 1061
493 Ga0439465_0278065 3300041413 Bacteria 623
494 Ga0451791_1555694 3300041451 Bacteria 819
495 Ga0451802_0815355 3300041460 Bacteria 1727
496 Ga0451802_1186193 3300041460 Bacteria 1191
497 Ga0451807_0139676 3300041486 Bacteria 1435
498 Ga0451839_0386240 3300041496 Bacteria 909
499 Ga0451845_0164688 3300041501 Bacteria 936
500 Ga0451849_1555721 3300041505 Bacteria 958
501 Ga0439445_0097801 3300042004 Bacteria 831
502 Ga0439450_089257 3300042008 Unclassified 773
503 Ga0439455_0040202 3300042012 Bacteria 1195
504 Ga0450891_012751 3300042129 Bacteria 785
505 Ga0439446_0002656 3300042156 Bacteria 4319
506 Ga0439464_0084663 3300042439 Bacteria 950
507 Ga0466969_0002272 3300044656 Bacteria 10265
508 Ga0466969_0098779 3300044656 Bacteria 1376
509 Ga0466972_0000201 3300044658 Bacteria 43791
510 Ga0466977_0003980 3300044666 Bacteria 7341
511 Ga0453683_0132239 3300044673 Bacteria 1573
512 Ga0466965_0018249 3300044683 Bacteria 3361
513 Ga0466966_0011912 3300044684 Bacteria 5764
514 Ga0466961_0000346 3300044693 Bacteria 30296
515 Ga0466964_0300272 3300044706 Bacteria 809
516 Ga0453684_0006580 3300044712 Bacteria 21987
517 Ga0466970_0123792 3300044765 Bacteria 1417
518 Ga0466959_0010291 3300045049 Bacteria 6680
519 Ga0451576_0001125 3300045051 Bacteria 48618
520 Ga0451576_0067655 3300045051 Bacteria 3718
521 Ga0451576_0126051 3300045051 Bacteria 2668
522 Ga0451576_0420271 3300045051 Bacteria 1402
523 Ga0466958_0172756 3300045836 Bacteria 1369
524 Ga0466967_0352374 3300045976 Bacteria 1425
525 Ga0495617_000013 3300046452 Bacteria 290031
526 Ga0495617_005003 3300046452 Bacteria 4761
527 Ga0495627_000001 3300046453 Bacteria 1104709
528 Ga0495592_0001331 3300046454 Bacteria 17151
529 Ga0495592_0009127 3300046454 Bacteria 7461
530 Ga0495590_0000016 3300046457 Bacteria 225874
531 Ga0495590_0001068 3300046457 Bacteria 12077
532 Ga0495590_0061628 3300046457 Bacteria 1313
533 Ga0495629_0080697 3300046459 Bacteria 2271
534 Ga0495638_0000057 3300046460 Bacteria 193690
535 Ga0495638_0021068 3300046460 Bacteria 4300
536 Ga0495638_0048429 3300046460 Bacteria 2660
537 Ga0495638_0121115 3300046460 Bacteria 1546
538 Ga0495641_0017077 3300046461 Bacteria 3795
539 Ga0495651_0001603 3300046462 Bacteria 17498
540 Ga0495651_0071910 3300046462 Bacteria 2629
541 Ga0495651_0852830 3300046462 Bacteria 559
542 Ga0495653_0000025 3300046463 Bacteria 160471
543 Ga0495653_0006798 3300046463 Bacteria 9394
544 Ga0495653_0009105 3300046463 Bacteria 8118
545 Ga0495653_0031742 3300046463 Bacteria 4197
546 Ga0495650_0000024 3300046471 Bacteria 496674
547 Ga0495650_0000289 3300046471 Bacteria 93255
548 Ga0495650_0002136 3300046471 Bacteria 16820
549 Ga0495650_0031013 3300046471 Bacteria 2412
550 Ga0495580_0039205 3300046472 Bacteria 3389
551 Ga0495582_0115326 3300046473 Bacteria 1510
552 Ga0495605_0087347 3300046474 Bacteria 1450
553 Ga0495605_0121416 3300046474 Bacteria 1184
554 Ga0495639_0017786 3300046475 Bacteria 3089
555 Ga0495639_0037756 3300046475 Bacteria 2166
556 Ga0495664_0030191 3300046477 Bacteria 3174
557 Ga0495584_0204662 3300046491 Bacteria 1003
558 Ga0495585_0007022 3300046492 Bacteria 6933
559 Ga0495585_0019035 3300046492 Bacteria 3962
560 Ga0495594_0024049 3300046499 Bacteria 3269
561 Ga0495607_0014033 3300046501 Bacteria 5230
562 Ga0495607_0017745 3300046501 Bacteria 4556
563 Ga0495583_0000688 3300046506 Bacteria 43737
564 Ga0495583_0007041 3300046506 Bacteria 7189
565 Ga0495583_0049408 3300046506 Bacteria 1927
566 Ga0495606_0000087 3300046507 Bacteria 156407
567 Ga0495606_0000137 3300046507 Bacteria 124670
568 Ga0495606_0000197 3300046507 Bacteria 105038
569 Ga0495606_0000573 3300046507 Bacteria 58366
570 Ga0495606_0021465 3300046507 Bacteria 4729
571 Ga0495608_0008467 3300046511 Bacteria 7205
572 Ga0495608_0042836 3300046511 Bacteria 3026
573 Ga0495608_0177879 3300046511 Bacteria 1347
574 Ga0495608_0424356 3300046511 Bacteria 811
575 Ga0495610_0000008 3300046512 Bacteria 622732
576 Ga0495610_0000411 3300046512 Bacteria 43910
577 Ga0495610_0001341 3300046512 Bacteria 21846
578 Ga0495610_0003847 3300046512 Bacteria 11408
579 Ga0495610_0005455 3300046512 Bacteria 9030
580 Ga0495610_0074022 3300046512 Bacteria 1581
581 Ga0495610_0160319 3300046512 Bacteria 951
582 Ga0495616_0024731 3300046513 Bacteria 3217
583 Ga0495618_0039205 3300046514 Bacteria 2978
584 Ga0495618_0142683 3300046514 Bacteria 1531
585 Ga0495618_0180863 3300046514 Bacteria 1340
586 Ga0495620_0038664 3300046515 Bacteria 2116
587 Ga0495628_0003637 3300046516 Bacteria 13765
588 Ga0495628_0004029 3300046516 Bacteria 13083
589 Ga0495628_0023659 3300046516 Bacteria 5039
590 Ga0495628_0042761 3300046516 Bacteria 3612
591 Ga0495628_0117695 3300046516 Bacteria 2040
592 Ga0495628_0306639 3300046516 Bacteria 1174
593 Ga0495630_0215379 3300046517 Bacteria 1466
594 Ga0495630_0224436 3300046517 Bacteria 1434
595 Ga0495631_0005213 3300046518 Bacteria 6845
596 Ga0495631_0260269 3300046518 Bacteria 739
597 Ga0495632_0079055 3300046519 Bacteria 1570
598 Ga0495637_0027701 3300046520 Bacteria 2532
599 Ga0495637_0079617 3300046520 Bacteria 1308
600 Ga0495643_0000236 3300046522 Bacteria 83225
601 Ga0495643_0000289 3300046522 Bacteria 71822
602 Ga0495643_0038221 3300046522 Bacteria 2629
603 Ga0495644_0030618 3300046523 Bacteria 2032
604 Ga0495648_0000002 3300046524 Bacteria 593972
605 Ga0495648_0000029 3300046524 Bacteria 223499
606 Ga0495648_0011919 3300046524 Bacteria 6521
607 Ga0495648_0014417 3300046524 Bacteria 5788
608 Ga0495648_0103863 3300046524 Bacteria 1561
609 Ga0495666_0032341 3300046526 Bacteria 2560
610 Ga0495666_0520350 3300046526 Bacteria 531
611 Ga0495642_0003652 3300046528 Bacteria 6045
612 Ga0495642_0003770 3300046528 Bacteria 5935
613 Ga0495642_0318785 3300046528 Bacteria 682
614 Ga0495652_0004166 3300046529 Bacteria 13940
615 Ga0495652_0009851 3300046529 Bacteria 8661
616 Ga0495652_0167549 3300046529 Bacteria 1698
617 Ga0495652_0509591 3300046529 Bacteria 833
618 Ga0495654_0000226 3300046530 Bacteria 52630
619 Ga0495654_0031792 3300046530 Bacteria 2678
620 Ga0495665_0039110 3300046531 Bacteria 2527
621 Ga0495640_0006764 3300046533 Bacteria 9046
622 Ga0495586_0005800 3300046535 Bacteria 6603
623 Ga0495586_0096953 3300046535 Bacteria 1633
624 Ga0495598_0166461 3300046537 Bacteria 779
625 Ga0495609_0000142 3300046538 Bacteria 75002
626 Ga0495609_0022634 3300046538 Bacteria 2894
627 Ga0495609_0085568 3300046538 Bacteria 1375
628 Ga0495609_0087897 3300046538 Bacteria 1353
629 Ga0495621_0007826 3300046539 Bacteria 3177
630 Ga0495597_0000025 3300046542 Bacteria 142649
631 Ga0495597_0000848 3300046542 Bacteria 24046
632 Ga0495597_0002887 3300046542 Bacteria 10479
633 Ga0495597_0004543 3300046542 Bacteria 7594
634 Ga0495597_0085573 3300046542 Bacteria 1343
635 Ga0495597_0199453 3300046542 Bacteria 802
636 Ga0495645_0003192 3300046543 Bacteria 11110
637 Ga0495645_0118995 3300046543 Bacteria 1861
638 Ga0495645_0124023 3300046543 Bacteria 1816
639 Ga0495645_0593444 3300046543 Bacteria 682
640 Ga0495622_0000816 3300046557 Bacteria 17235
641 Ga0495633_0000073 3300046558 Bacteria 130286
642 Ga0495633_0000399 3300046558 Bacteria 45392
643 Ga0495667_0021617 3300046559 Bacteria 4341
644 Ga0495656_0160361 3300046615 Bacteria 1093
645 Ga0495668_0000020 3300046616 Bacteria 411641
646 Ga0495668_0000083 3300046616 Bacteria 153471
647 Ga0495668_0000132 3300046616 Bacteria 112674
648 Ga0495668_0002007 3300046616 Bacteria 17796
649 Ga0495668_0011331 3300046616 Bacteria 5347
650 Ga0495668_0101145 3300046616 Bacteria 1577
651 Ga0495634_0044238 3300046642 Bacteria 3014
652 Ga0495625_0000177 3300046660 Bacteria 98918
653 Ga0495625_0000398 3300046660 Bacteria 66474
654 Ga0495625_0002519 3300046660 Bacteria 19715
655 Ga0495625_0005727 3300046660 Bacteria 11236
656 Ga0495625_0006383 3300046660 Bacteria 10514
657 Ga0495625_0093220 3300046660 Bacteria 2079
658 Ga0495625_0093397 3300046660 Bacteria 2077
659 Ga0495625_0157726 3300046660 Bacteria 1522
660 Ga0495635_0028001 3300046663 Bacteria 3918
661 Ga0495659_0010327 3300046664 Bacteria 2992
662 Ga0495661_0001089 3300046665 Bacteria 23858
663 Ga0495661_0160929 3300046665 Bacteria 1205
664 Ga0495599_0013823 3300046678 Bacteria 4994
665 Ga0495599_0099917 3300046678 Bacteria 1808
666 Ga0495599_0141046 3300046678 Bacteria 1495
667 Ga0495623_0036186 3300046679 Bacteria 3164
668 Ga0495623_0130966 3300046679 Bacteria 1502
669 Ga0495623_0572068 3300046679 Bacteria 589
670 Ga0495646_0035836 3300046680 Bacteria 3075
671 Ga0495646_0133487 3300046680 Bacteria 1395
672 Ga0495647_0004559 3300046681 Bacteria 4510
673 Ga0495658_0065195 3300046683 Bacteria 2101
674 Ga0495658_0326515 3300046683 Bacteria 973
675 Ga0495669_0006738 3300046684 Bacteria 4808
676 Ga0495613_0051783 3300046689 Bacteria 3025
677 Ga0495613_0100713 3300046689 Bacteria 2086
678 Ga0495624_0010151 3300046690 Bacteria 6493
679 Ga0495624_0012877 3300046690 Bacteria 5708
680 Ga0495670_0046542 3300046691 Bacteria 2167
681 Ga0495671_0000002 3300046692 Bacteria 1136189
682 Ga0495671_0151936 3300046692 Bacteria 1127
683 Ga0495671_0172888 3300046692 Bacteria 1050
684 Ga0495649_0004026 3300046694 Bacteria 9679
685 Ga0495649_0011278 3300046694 Bacteria 5248
686 Ga0495649_0056866 3300046694 Bacteria 2110
687 Ga0495649_0112244 3300046694 Bacteria 1445
688 Ga0495600_0000478 3300046809 Bacteria 20729
689 Ga0495600_0003656 3300046809 Bacteria 9074
690 Ga0495600_0099784 3300046809 Bacteria 1893
691 Ga0495660_0000473 3300046810 Bacteria 33431
692 Ga0495660_0001536 3300046810 Bacteria 15558
693 Ga0495660_0042988 3300046810 Bacteria 2494
694 Ga0495660_0106062 3300046810 Bacteria 1440
695 Ga0495660_0300672 3300046810 Bacteria 727
696 Ga0495604_0033684 3300047317 Bacteria 4054
697 Ga0495604_0034831 3300047317 Bacteria 3980
698 Ga0495604_0051203 3300047317 Bacteria 3202
699 Ga0495672_0000291 3300047320 Bacteria 69062
700 Ga0495672_0041061 3300047320 Bacteria 2801
701 Ga0495680_0035304 3300047322 Bacteria 4028
702 Ga0495680_0073112 3300047322 Bacteria 2606
703 Ga0495687_000232 3300047443 Bacteria 77572
704 Ga0495687_002232 3300047443 Bacteria 15990
705 Ga0495687_003651 3300047443 Bacteria 10969
706 Ga0495687_005190 3300047443 Bacteria 8420
707 Ga0495687_012943 3300047443 Bacteria 4380
708 Ga0495687_029520 3300047443 Bacteria 2536
709 Ga0495675_0053079 3300047444 Bacteria 2573
710 Ga0495679_018373 3300047446 Bacteria 2483
711 Ga0495679_047697 3300047446 Bacteria 1298
712 Ga0495685_006052 3300047447 Bacteria 3955
713 Ga0495673_0000005 3300047469 Bacteria 943364
714 Ga0495673_0000015 3300047469 Bacteria 598766
715 Ga0495673_0000044 3300047469 Bacteria 283033
716 Ga0495673_0000342 3300047469 Bacteria 58945
717 Ga0495681_0021834 3300047470 Bacteria 3439
718 Ga0495681_0089671 3300047470 Bacteria 1360
719 Ga0495684_0025249 3300047471 Bacteria 4568
720 Ga0495684_0882939 3300047471 Bacteria 577
721 Ga0495686_0001836 3300047472 Bacteria 21329
722 Ga0495686_0002827 3300047472 Bacteria 15707
723 Ga0495686_0003434 3300047472 Bacteria 13744
724 Ga0495686_0145250 3300047472 Bacteria 1397
725 Ga0495593_0040204 3300047673 Bacteria 2518
726 Ga0495602_0029056 3300048088 Bacteria 5277
727 Ga0495602_0096376 3300048088 Bacteria 2440
728 Ga0495614_0013697 3300048089 Bacteria 3557
729 Ga0495614_0174881 3300048089 Bacteria 964
730 Ga0495615_0040844 3300048090 Bacteria 1157
731 Ga0495626_0073452 3300048091 Bacteria 1532
732 Ga0496100_0172163 3300048903 Bacteria 1560
733 Ga0496101_0158800 3300048904 Bacteria 1733
734 Ga0496102_0000059 3300048905 Bacteria 168633
735 Ga0496102_0643427 3300048905 Bacteria 983
736 Ga0496103_0000063 3300048906 Bacteria 128503
737 Ga0496104_1421106 3300048907 Bacteria 597
738 Ga0496107_0521430 3300048910 Bacteria 881
739 Ga0496109_1098920 3300048912 Bacteria 732
740 Ga0496113_0378531 3300048916 Bacteria 1136
741 Ga0496113_0455329 3300048916 Bacteria 1028
742 Ga0496114_0077477 3300048917 Bacteria 2803
743 Ga0496116_0206079 3300048919 Bacteria 1024
744 Ga0496116_0250253 3300048919 Bacteria 883
745 Ga0496117_0236371 3300048920 Bacteria 1006
746 Ga0496117_0328193 3300048920 Bacteria 799
747 Ga0496118_0066294 3300048921 Bacteria 2636
748 Ga0496119_0075172 3300048922 Bacteria 1964
749 Ga0496121_0015651 3300048924 Bacteria 7913
750 Ga0496121_0042446 3300048924 Bacteria 3956
751 Ga0496121_0360422 3300048924 Bacteria 965
752 Ga0496121_0452610 3300048924 Bacteria 827
753 Ga0496123_0023256 3300048926 Bacteria 4747
754 Ga0496124_0094251 3300048927 Bacteria 2435
755 Ga0496125_0000734 3300048928 Bacteria 54288
756 Ga0496125_0004104 3300048928 Bacteria 17027
757 Ga0496126_0156518 3300048929 Bacteria 1950
758 Ga0495678_000002 3300049459 Bacteria 999613
759 Ga0495678_000069 3300049459 Bacteria 131739
760 Ga0495678_004395 3300049459 Bacteria 8172
761 Ga0495678_067392 3300049459 Bacteria 1322
762 Ga0495678_135256 3300049459 Bacteria 812
763 Ga0495678_185638 3300049459 Bacteria 649
764 Ga0501300_019001 3300049523 Bacteria 1004
765 Ga0501209_000276 3300049656 Bacteria 6180
766 Ga0501222_001905 3300049662 Bacteria 2891
767 Ga0501222_016863 3300049662 Bacteria 967
768 Ga0501227_009261 3300049665 Bacteria 2119
769 Ga0501242_028684 3300049674 Bacteria 744
770 Ga0501080_0280723 3300049742 Bacteria 1514
771 Ga0501241_065884 3300049758 Bacteria 734
772 Ga0501267_004127 3300049764 Bacteria 1341
773 Ga0501279_001113 3300049775 Bacteria 3535
774 nmdc:mga03683_13913_c1 3300050489 Bacteria 2968
775 nmdc:mga03683_548786_c1 3300050489 Bacteria 562
776 nmdc:mga03683_58940_c1 3300050489 Bacteria 1619
777 nmdc:mga03683_8363_c1 3300050489 Bacteria 3636
778 nmdc:mga03n38_40701_c1 3300050490 Bacteria 2021
779 nmdc:mga00v17_19483_c1 3300050491 Bacteria 3874
780 nmdc:mga00v17_71067_c1 3300050491 Bacteria 2157
781 nmdc:mga0yw44_265632_c1 3300050492 Bacteria 1144
782 nmdc:mga0k408_1519_c1 3300050493 Bacteria 12529
783 nmdc:mga0k408_178250_c1 3300050493 Bacteria 1267
784 nmdc:mga0k408_213381_c1 3300050493 Bacteria 1153
785 nmdc:mga0k408_28421_c1 3300050493 Bacteria 3180
786 nmdc:mga0k408_4551_c1 3300050493 Bacteria 7363
787 nmdc:mga0k408_4876_c1 3300050493 Bacteria 7117
788 nmdc:mga0k408_52416_c1 3300050493 Bacteria 2365
789 nmdc:mga0k408_62704_c1 3300050493 Bacteria 2162
790 nmdc:mga0k408_95774_c1 3300050493 Bacteria 1747
791 nmdc:mga06z11_15377_c1 3300050494 Bacteria 3415
792 nmdc:mga06z11_62243_c1 3300050494 Bacteria 1949
793 nmdc:mga04h51_5040_c1 3300050495 Bacteria 3339
794 nmdc:mga07m45_164752_c1 3300050496 Bacteria 1288
795 nmdc:mga07m45_23515_c1 3300050496 Bacteria 3369
796 nmdc:mga07m45_474_c1 3300050496 Bacteria 16977
797 nmdc:mga07m45_73561_c1 3300050496 Bacteria 1945
798 nmdc:mga07m45_74368_c1 3300050496 Bacteria 1936
799 nmdc:mga07m45_880_c1 3300050496 Bacteria 13106
800 nmdc:mga07m45_9069_c1 3300050496 Bacteria 5140
801 nmdc:mga05p37_46673_c1 3300050507 Bacteria 5325
802 nmdc:mga05p37_581215_c1 3300050507 Bacteria 1269
803 nmdc:mga09592_512124_c1 3300050508 Bacteria 1033
804 nmdc:mga0qj67_901582_c1 3300050509 Bacteria 697
805 nmdc:mga06r32_125092_c1 3300050510 Bacteria 2539
806 nmdc:mga08y16_827742_c1 3300050511 Bacteria 917
807 nmdc:mga0n895_85688_c1 3300050512 Bacteria 3146
808 nmdc:mga0rr50_9567_c1 3300050513 Bacteria 6102
809 nmdc:mga08x19_177540_c1 3300050514 Bacteria 1453
810 nmdc:mga0a205_84522_c1 3300050515 Bacteria 3066
811 nmdc:mga0sz30_201547_c1 3300050516 Bacteria 884
812 nmdc:mga0sz30_37768_c1 3300050516 Bacteria 2022
813 Ga0495601_0000453 3300053077 Bacteria 21492
814 Ga0495601_0145738 3300053077 Bacteria 1545
815 Ga0495595_0006874 3300053084 Bacteria 4642
816 Ga0495619_0476348 3300053085 Bacteria 860
817 Ga0495619_0878273 3300053085 Bacteria 604
818 Ga0500578_0000102 3300053086 Bacteria 99108
819 Ga0500644_0000290 3300053088 Bacteria 27182
820 Ga0500644_0003902 3300053088 Bacteria 3714
821 Ga0500647_0083826 3300053091 Bacteria 1529
822 Ga0500566_0491563 3300053094 Bacteria 530
823 Ga0500641_0178453 3300053096 Bacteria 912
824 Ga0500556_0374510 3300053104 Bacteria 549
825 Ga0500562_003539 3300053108 Bacteria 3917
826 Ga0500572_012234 3300053111 Bacteria 2099
827 Ga0500594_0000540 3300053118 Bacteria 8211
828 Ga0500594_0024002 3300053118 Bacteria 1550
829 Ga0500595_003284 3300053119 Bacteria 7623
830 Ga0500618_001087 3300053125 Bacteria 13359
831 Ga0500618_001190 3300053125 Bacteria 12512
832 Ga0500658_0014067 3300053134 Bacteria 2960
833 Ga0500564_000289 3300053138 Bacteria 13960
834 Ga0500568_0048037 3300053139 Bacteria 1688
835 Ga0500573_0201861 3300053140 Bacteria 1055
836 Ga0500574_000188 3300053141 Bacteria 7253
837 Ga0500586_006749 3300053145 Bacteria 3007
838 Ga0500586_026623 3300053145 Bacteria 1874
839 Ga0500590_017522 3300053148 Bacteria 3702
840 Ga0500616_0012668 3300053153 Bacteria 4930
841 Ga0500619_000268 3300053154 Bacteria 10773
842 Ga0500622_0000674 3300053156 Bacteria 30184
843 Ga0500622_0073508 3300053156 Bacteria 1724
844 Ga0500627_0028183 3300053158 Bacteria 2330
845 Ga0590071_003614 3300059421 Bacteria 3796
846 Ga0590074_069989 3300059423 Bacteria 660
847 Ga0590075_072055 3300059424 Bacteria 893
848 Ga0587077_016128 3300059493 Bacteria 1254
849 Ga0587068_020103 3300059641 Bacteria 1088
850 Ga0466962_0333809 3300061719 Bacteria 753

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041501 Ga0451845_0164688 Ga0451845_0164688_182_619 136
2 3300006042 Ga0075368_10065499 Ga0075368_100654992 137
3 3300006195 Ga0075366_10308560 Ga0075366_103085602 137
4 3300028794 Ga0307515_10000416 Ga0307515_100004163 137
5 3300028794 Ga0307515_10021948 Ga0307515_100219486 137
6 3300031235 Ga0265330_10142497 Ga0265330_101424972 137
7 3300031241 Ga0265325_10051280 Ga0265325_100512802 137
8 3300031242 Ga0265329_10077120 Ga0265329_100771202 137
9 3300031595 Ga0265313_10000626 Ga0265313_1000062626 137
10 3300031711 Ga0265314_10032855 Ga0265314_100328552 137
11 3300041451 Ga0451791_1555694 Ga0451791_1555694_327_797 137
12 3300041460 Ga0451802_0815355 Ga0451802_0815355_133_612 137
13 3300041505 Ga0451849_1555721 Ga0451849_1555721_276_749 137
14 3300046512 Ga0495610_0074022 Ga0495610_0074022_62_532 137
15 3300046660 Ga0495625_0005727 Ga0495625_0005727_4928_5398 137
16 3300046683 Ga0495658_0065195 Ga0495658_0065195_390_857 137
17 3300053088 Ga0500644_0003902 Ga0500644_0003902_3067_3537 137
18 3300006353 Ga0075370_10045539 Ga0075370_100455394 138
19 3300050496 nmdc:mga07m45_23515_c1 nmdc:mga07m45_23515_c1_1880_2371 138
20 iso_pu_bacteria 2919704043 2919705477 138
21 3300003771 Ga0055526_1010195 Ga0055526_10101953 139
22 3300021361 Ga0213872_10073827 Ga0213872_100738272 139
23 3300025245 Ga0207425_1001773 Ga0207425_10017737 139
24 3300025258 Ga0209129_1000025 Ga0209129_1000025222 139
25 3300025273 Ga0209673_1014092 Ga0209673_10140923 139
26 3300025295 Ga0209564_1000039 Ga0209564_1000039222 139
27 3300025297 Ga0209758_1000196 Ga0209758_1000196102 139
28 3300025299 Ga0209256_1018225 Ga0209256_10182254 139
29 3300037471 Ga0395905_0000002 Ga0395905_0000002_72648_73073 139
30 3300039447 Ga0436361_1039366 Ga0436361_1039366_658_1098 139
31 iso_pu_bacteria 2511231026 2511383852 140
32 iso_pu_bacteria 2818991436 2819543986 140
33 iso_pu_bacteria 2842711865 2842716559 140
34 iso_pu_bacteria 2852618963 2852620291 140
35 iso_pu_bacteria 2857553236 2857557279 140
36 iso_pu_bacteria 2857558681 2857560156 140
37 iso_pu_bacteria 2904479285 2904482608 140
38 iso_pu_bacteria 2919046199 2919048018 140
39 iso_pu_bacteria 2919476304 2919477906 140
40 3300005434 Ga0070709_10031572 Ga0070709_100315723 141
41 3300006175 Ga0070712_100021105 Ga0070712_1000211056 141
42 3300009098 Ga0105245_10035552 Ga0105245_100355526 141
43 3300009101 Ga0105247_10002270 Ga0105247_1000227010 141
44 3300025906 Ga0207699_10037289 Ga0207699_100372894 141
45 3300025915 Ga0207693_10005621 Ga0207693_100056217 141
46 3300032002 Ga0307416_100749548 Ga0307416_1007495482 141
47 3300035724 Ga0373933_0776497 Ga0373933_0776497_190_618 141
48 3300039450 Ga0436363_1301619 Ga0436363_1301619_576_1025 141
49 3300048903 Ga0496100_0172163 Ga0496100_0172163_864_1298 141
50 3300048904 Ga0496101_0158800 Ga0496101_0158800_1184_1618 141
51 3300048905 Ga0496102_0000059 Ga0496102_0000059_136338_136772 141
52 3300048906 Ga0496103_0000063 Ga0496103_0000063_51442_51876 141
53 3300048910 Ga0496107_0521430 Ga0496107_0521430_143_577 141
54 3300048920 Ga0496117_0236371 Ga0496117_0236371_194_628 141
55 3300048921 Ga0496118_0066294 Ga0496118_0066294_1119_1553 141
56 3300048922 Ga0496119_0075172 Ga0496119_0075172_768_1202 141
57 iso_pu_bacteria 2582581279 2585148921 141
58 iso_pu_bacteria 2738541297 2738828141 141
59 iso_pu_bacteria 2738541357 2739151937 141
60 iso_pu_bacteria 2738543003 2739194042 141
61 iso_pu_bacteria 2738543026 2739320333 141
62 iso_pu_bacteria 2738543029 2739338759 141
63 3300003792 Ga0055540_1071329 Ga0055540_10713291 142
64 3300005445 Ga0070708_100106236 Ga0070708_1001062363 142
65 3300005457 Ga0070662_100075388 Ga0070662_1000753883 142
66 3300005459 Ga0068867_100086893 Ga0068867_1000868933 142
67 3300005617 Ga0068859_100003059 Ga0068859_10000305910 142
68 3300005842 Ga0068858_101624648 Ga0068858_1016246481 142
69 3300006042 Ga0075368_10021444 Ga0075368_100214443 142
70 3300006042 Ga0075368_10146951 Ga0075368_101469511 142
71 3300006048 Ga0075363_100005677 Ga0075363_1000056775 142
72 3300006051 Ga0075364_10383477 Ga0075364_103834772 142
73 3300006177 Ga0075362_10000768 Ga0075362_100007683 142
74 3300006177 Ga0075362_10014252 Ga0075362_100142523 142
75 3300006178 Ga0075367_10004491 Ga0075367_100044914 142
76 3300006186 Ga0075369_10004486 Ga0075369_100044866 142
77 3300006195 Ga0075366_10001662 Ga0075366_1000166210 142
78 3300006195 Ga0075366_10428268 Ga0075366_104282681 142
79 3300006353 Ga0075370_10000340 Ga0075370_1000034014 142
80 3300006353 Ga0075370_10053180 Ga0075370_100531802 142
81 3300006353 Ga0075370_10149660 Ga0075370_101496602 142
82 3300006931 Ga0097620_100003059 Ga0097620_10000305910 142
83 3300009148 Ga0105243_10045475 Ga0105243_100454753 142
84 3300014325 Ga0163163_12374153 Ga0163163_123741531 142
85 3300025303 Ga0209051_1012288 Ga0209051_10122883 142
86 3300025900 Ga0207710_10001706 Ga0207710_100017069 142
87 3300025931 Ga0207644_10481033 Ga0207644_104810331 142
88 3300025933 Ga0207706_10096028 Ga0207706_100960282 142
89 3300026041 Ga0207639_10740501 Ga0207639_107405012 142
90 3300026116 Ga0207674_10439864 Ga0207674_104398642 142
91 3300026118 Ga0207675_100467947 Ga0207675_1004679472 142
92 3300027866 Ga0209813_10015447 Ga0209813_100154472 142
93 3300028794 Ga0307515_10084784 Ga0307515_100847845 142
94 3300028794 Ga0307515_10277025 Ga0307515_102770252 142
95 3300031251 Ga0265327_10002604 Ga0265327_100026045 142
96 3300031616 Ga0307508_10000017 Ga0307508_1000001790 142
97 3300031649 Ga0307514_10015317 Ga0307514_100153174 142
98 3300031730 Ga0307516_10000525 Ga0307516_1000052548 142
99 3300031730 Ga0307516_10085138 Ga0307516_100851382 142
100 3300031730 Ga0307516_10252822 Ga0307516_102528222 142
101 3300031730 Ga0307516_10606732 Ga0307516_106067322 142
102 3300035691 Ga0373931_0430578 Ga0373931_0430578_175_645 142
103 3300037471 Ga0395905_0040982 Ga0395905_0040982_2550_3005 142
104 3300042129 Ga0450891_012751 Ga0450891_012751_298_759 142
105 3300044712 Ga0453684_0006580 Ga0453684_0006580_13814_14281 142
106 3300046492 Ga0495585_0007022 Ga0495585_0007022_4634_5095 142
107 3300046537 Ga0495598_0166461 Ga0495598_0166461_93_533 142
108 3300046542 Ga0495597_0004543 Ga0495597_0004543_6319_6831 142
109 3300046542 Ga0495597_0199453 Ga0495597_0199453_13_480 142
110 3300046616 Ga0495668_0101145 Ga0495668_0101145_901_1368 142
111 3300047443 Ga0495687_000232 Ga0495687_000232_20732_21244 142
112 3300047443 Ga0495687_029520 Ga0495687_029520_1709_2161 142
113 3300048091 Ga0495626_0073452 Ga0495626_0073452_407_919 142
114 3300048905 Ga0496102_0643427 Ga0496102_0643427_31_501 142
115 3300048907 Ga0496104_1421106 Ga0496104_1421106_43_507 142
116 3300048912 Ga0496109_1098920 Ga0496109_1098920_50_499 142
117 3300048916 Ga0496113_0455329 Ga0496113_0455329_170_625 142
118 3300049523 Ga0501300_019001 Ga0501300_019001_273_728 142
119 3300049662 Ga0501222_016863 Ga0501222_016863_377_850 142
120 3300049674 Ga0501242_028684 Ga0501242_028684_146_619 142
121 3300050489 nmdc:mga03683_13913_c1 nmdc:mga03683_13913_c1_728_1195 142
122 3300050489 nmdc:mga03683_8363_c1 nmdc:mga03683_8363_c1_2581_3042 142
123 3300050490 nmdc:mga03n38_40701_c1 nmdc:mga03n38_40701_c1_347_808 142
124 3300050491 nmdc:mga00v17_19483_c1 nmdc:mga00v17_19483_c1_3100_3561 142
125 3300050493 nmdc:mga0k408_1519_c1 nmdc:mga0k408_1519_c1_1541_2002 142
126 3300050493 nmdc:mga0k408_178250_c1 nmdc:mga0k408_178250_c1_147_602 142
127 3300050493 nmdc:mga0k408_4876_c1 nmdc:mga0k408_4876_c1_2701_3180 142
128 3300050493 nmdc:mga0k408_52416_c1 nmdc:mga0k408_52416_c1_650_1117 142
129 3300050494 nmdc:mga06z11_15377_c1 nmdc:mga06z11_15377_c1_2508_2969 142
130 3300050495 nmdc:mga04h51_5040_c1 nmdc:mga04h51_5040_c1_384_845 142
131 3300050496 nmdc:mga07m45_164752_c1 nmdc:mga07m45_164752_c1_305_772 142
132 3300050496 nmdc:mga07m45_9069_c1 nmdc:mga07m45_9069_c1_3718_4173 142
133 3300050516 nmdc:mga0sz30_201547_c1 nmdc:mga0sz30_201547_c1_24_485 142
134 3300053134 Ga0500658_0014067 Ga0500658_0014067_2058_2510 142
135 3300059424 Ga0590075_072055 Ga0590075_072055_133_588 142
136 iso_pu_bacteria 2585428057 2587726874 142
137 iso_pu_bacteria 2585428062 2587757396 142
138 iso_pu_bacteria 2765235838 2765570622 142
139 iso_pu_bacteria 2839094727 2839098168 142
140 3300005563 Ga0068855_100000645 Ga0068855_1000006455 143
141 3300006195 Ga0075366_10021765 Ga0075366_100217654 143
142 3300025949 Ga0207667_10000191 Ga0207667_1000019176 143
143 3300028573 Ga0265334_10004043 Ga0265334_100040435 143
144 3300028577 Ga0265318_10006926 Ga0265318_100069265 143
145 3300028800 Ga0265338_10165091 Ga0265338_101650912 143
146 3300031239 Ga0265328_10031773 Ga0265328_100317732 143
147 3300031240 Ga0265320_10028158 Ga0265320_100281583 143
148 3300031241 Ga0265325_10054658 Ga0265325_100546581 143
149 3300031242 Ga0265329_10094644 Ga0265329_100946441 143
150 3300031249 Ga0265339_10310121 Ga0265339_103101212 143
151 3300031250 Ga0265331_10058777 Ga0265331_100587771 143
152 3300031344 Ga0265316_10063161 Ga0265316_100631613 143
153 3300031595 Ga0265313_10008190 Ga0265313_100081907 143
154 3300031712 Ga0265342_10135376 Ga0265342_101353762 143
155 3300049742 Ga0501080_0280723 Ga0501080_0280723_329_769 143
156 3300050493 nmdc:mga0k408_4551_c1 nmdc:mga0k408_4551_c1_2046_2540 143
157 3300050493 nmdc:mga0k408_62704_c1 nmdc:mga0k408_62704_c1_971_1414 143
158 3300002737 JGI25162J39368_1000001 JGI25162J39368_1000001509 144
159 3300002738 JGI25154J39366_1000584 JGI25154J39366_10005845 144
160 3300002771 JGI25163J39215_1002212 JGI25163J39215_10022122 144
161 3300002772 JGI25164J39214_1004383 JGI25164J39214_10043832 144
162 3300002774 JGI25150J39212_1001132 JGI25150J39212_10011324 144
163 3300003214 JGI25165J46597_1000001 JGI25165J46597_1000001497 144
164 3300003215 JGI25153J46596_10037994 JGI25153J46596_100379942 144
165 3300003322 rootL2_10030503 rootL2_100305035 144
166 3300003322 rootL2_10050963 rootL2_100509632 144
167 3300003322 rootL2_10105907 rootL2_101059072 144
168 3300003371 JGI26145J50221_1001623 JGI26145J50221_10016233 144
169 3300003751 Ga0055538_1000001 Ga0055538_1000001535 144
170 3300003751 Ga0055538_1000070 Ga0055538_100007031 144
171 3300003752 Ga0055539_1000001 Ga0055539_1000001535 144
172 3300003752 Ga0055539_1000105 Ga0055539_100010531 144
173 3300003756 Ga0055533_1000003 Ga0055533_1000003497 144
174 3300003756 Ga0055533_1000113 Ga0055533_100011331 144
175 3300003759 Ga0055525_1000003 Ga0055525_1000003497 144
176 3300003759 Ga0055525_1000153 Ga0055525_100015331 144
177 3300003763 Ga0055529_1000836 Ga0055529_100083610 144
178 3300003771 Ga0055526_1000023 Ga0055526_100002352 144
179 3300003771 Ga0055526_1000341 Ga0055526_100034114 144
180 3300003773 Ga0055537_1000129 Ga0055537_100012911 144
181 3300003775 Ga0055524_1000151 Ga0055524_10001513 144
182 3300003775 Ga0055524_1002022 Ga0055524_100202212 144
183 3300003784 Ga0055534_1000594 Ga0055534_100059413 144
184 3300003784 Ga0055534_1000965 Ga0055534_100096513 144
185 3300003790 Ga0055528_1000013 Ga0055528_100001384 144
186 3300003794 Ga0055531_10000044 Ga0055531_1000004431 144
187 3300003841 Ga0055541_1000001 Ga0055541_1000001497 144
188 3300003841 Ga0055541_1000071 Ga0055541_100007131 144
189 3300005289 Ga0065704_10108090 Ga0065704_101080903 144
190 3300005289 Ga0065704_10313445 Ga0065704_103134452 144
191 3300005290 Ga0065712_10012574 Ga0065712_100125743 144
192 3300005293 Ga0065715_10042946 Ga0065715_100429462 144
193 3300005328 Ga0070676_10084340 Ga0070676_100843404 144
194 3300005329 Ga0070683_101637237 Ga0070683_1016372371 144
195 3300005330 Ga0070690_100190718 Ga0070690_1001907183 144
196 3300005331 Ga0070670_100096244 Ga0070670_1000962443 144
197 3300005333 Ga0070677_10043647 Ga0070677_100436472 144
198 3300005333 Ga0070677_10276683 Ga0070677_102766831 144
199 3300005334 Ga0068869_100010984 Ga0068869_1000109845 144
200 3300005335 Ga0070666_10050883 Ga0070666_100508833 144
201 3300005335 Ga0070666_10147195 Ga0070666_101471952 144
202 3300005336 Ga0070680_100069471 Ga0070680_1000694713 144
203 3300005337 Ga0070682_100182320 Ga0070682_1001823201 144
204 3300005338 Ga0068868_100015268 Ga0068868_1000152685 144
205 3300005338 Ga0068868_100322227 Ga0068868_1003222273 144
206 3300005339 Ga0070660_100060819 Ga0070660_1000608193 144
207 3300005339 Ga0070660_100230977 Ga0070660_1002309772 144
208 3300005340 Ga0070689_100003473 Ga0070689_10000347310 144
209 3300005341 Ga0070691_10028707 Ga0070691_100287072 144
210 3300005343 Ga0070687_100007263 Ga0070687_1000072632 144
211 3300005344 Ga0070661_100007428 Ga0070661_1000074285 144
212 3300005344 Ga0070661_100157192 Ga0070661_1001571921 144
213 3300005345 Ga0070692_10067874 Ga0070692_100678743 144
214 3300005347 Ga0070668_100024157 Ga0070668_1000241574 144
215 3300005353 Ga0070669_100548603 Ga0070669_1005486031 144
216 3300005353 Ga0070669_101436298 Ga0070669_1014362981 144
217 3300005354 Ga0070675_100087418 Ga0070675_1000874182 144
218 3300005354 Ga0070675_100105687 Ga0070675_1001056873 144
219 3300005355 Ga0070671_100088620 Ga0070671_1000886201 144
220 3300005356 Ga0070674_100014049 Ga0070674_1000140494 144
221 3300005356 Ga0070674_100215730 Ga0070674_1002157302 144
222 3300005364 Ga0070673_100002884 Ga0070673_1000028842 144
223 3300005365 Ga0070688_100043383 Ga0070688_1000433833 144
224 3300005366 Ga0070659_100003919 Ga0070659_1000039198 144
225 3300005366 Ga0070659_100013137 Ga0070659_1000131373 144
226 3300005367 Ga0070667_100116855 Ga0070667_1001168553 144
227 3300005367 Ga0070667_101117695 Ga0070667_1011176952 144
228 3300005438 Ga0070701_10036575 Ga0070701_100365752 144
229 3300005439 Ga0070711_100165441 Ga0070711_1001654413 144
230 3300005440 Ga0070705_100042649 Ga0070705_1000426493 144
231 3300005441 Ga0070700_100007514 Ga0070700_1000075142 144
232 3300005444 Ga0070694_100071619 Ga0070694_1000716193 144
233 3300005455 Ga0070663_100802480 Ga0070663_1008024801 144
234 3300005456 Ga0070678_100014162 Ga0070678_1000141624 144
235 3300005457 Ga0070662_100001274 Ga0070662_10000127415 144
236 3300005457 Ga0070662_100015383 Ga0070662_1000153833 144
237 3300005458 Ga0070681_10025086 Ga0070681_100250862 144
238 3300005459 Ga0068867_100228970 Ga0068867_1002289701 144
239 3300005466 Ga0070685_10212160 Ga0070685_102121601 144
240 3300005530 Ga0070679_100054705 Ga0070679_1000547052 144
241 3300005530 Ga0070679_100237334 Ga0070679_1002373342 144
242 3300005535 Ga0070684_100160149 Ga0070684_1001601493 144
243 3300005539 Ga0068853_100614700 Ga0068853_1006147002 144
244 3300005543 Ga0070672_100008006 Ga0070672_1000080062 144
245 3300005543 Ga0070672_100452748 Ga0070672_1004527482 144
246 3300005544 Ga0070686_100015688 Ga0070686_1000156882 144
247 3300005545 Ga0070695_100161462 Ga0070695_1001614621 144
248 3300005546 Ga0070696_100080067 Ga0070696_1000800673 144
249 3300005547 Ga0070693_100321217 Ga0070693_1003212171 144
250 3300005548 Ga0070665_100438296 Ga0070665_1004382963 144
251 3300005548 Ga0070665_101111966 Ga0070665_1011119661 144
252 3300005548 Ga0070665_101723604 Ga0070665_1017236042 144
253 3300005563 Ga0068855_101184776 Ga0068855_1011847761 144
254 3300005564 Ga0070664_100075089 Ga0070664_1000750892 144
255 3300005564 Ga0070664_100085441 Ga0070664_1000854413 144
256 3300005577 Ga0068857_100119545 Ga0068857_1001195452 144
257 3300005577 Ga0068857_100140107 Ga0068857_1001401072 144
258 3300005578 Ga0068854_100081911 Ga0068854_1000819113 144
259 3300005578 Ga0068854_100499274 Ga0068854_1004992741 144
260 3300005614 Ga0068856_100299641 Ga0068856_1002996412 144
261 3300005615 Ga0070702_100004200 Ga0070702_1000042002 144
262 3300005617 Ga0068859_100801284 Ga0068859_1008012842 144
263 3300005618 Ga0068864_100083818 Ga0068864_1000838183 144
264 3300005718 Ga0068866_10021224 Ga0068866_100212243 144
265 3300005718 Ga0068866_10122569 Ga0068866_101225692 144
266 3300005719 Ga0068861_100148175 Ga0068861_1001481753 144
267 3300005840 Ga0068870_10327405 Ga0068870_103274052 144
268 3300005842 Ga0068858_100868776 Ga0068858_1008687762 144
269 3300005843 Ga0068860_100091353 Ga0068860_1000913533 144
270 3300005844 Ga0068862_100087801 Ga0068862_1000878012 144
271 3300006028 Ga0070717_10503794 Ga0070717_105037942 144
272 3300006038 Ga0075365_10142883 Ga0075365_101428833 144
273 3300006058 Ga0075432_10011257 Ga0075432_100112574 144
274 3300006163 Ga0070715_10125922 Ga0070715_101259222 144
275 3300006177 Ga0075362_10014530 Ga0075362_100145303 144
276 3300006177 Ga0075362_10108963 Ga0075362_101089632 144
277 3300006178 Ga0075367_10006418 Ga0075367_100064185 144
278 3300006194 Ga0075427_10017279 Ga0075427_100172792 144
279 3300006195 Ga0075366_10032423 Ga0075366_100324234 144
280 3300006237 Ga0097621_100001607 Ga0097621_10000160711 144
281 3300006353 Ga0075370_10003500 Ga0075370_100035003 144
282 3300006353 Ga0075370_10074611 Ga0075370_100746113 144
283 3300006358 Ga0068871_100013291 Ga0068871_1000132917 144
284 3300006844 Ga0075428_100954627 Ga0075428_1009546271 144
285 3300006846 Ga0075430_100392893 Ga0075430_1003928931 144
286 3300006847 Ga0075431_100022194 Ga0075431_1000221946 144
287 3300006871 Ga0075434_100061167 Ga0075434_1000611674 144
288 3300006880 Ga0075429_100341672 Ga0075429_1003416723 144
289 3300006881 Ga0068865_100000749 Ga0068865_1000007499 144
290 3300006914 Ga0075436_100081141 Ga0075436_1000811411 144
291 3300006914 Ga0075436_100227179 Ga0075436_1002271792 144
292 3300006931 Ga0097620_100801295 Ga0097620_1008012952 144
293 3300006948 Ga0099826_10000001 Ga0099826_1000000170 144
294 3300007076 Ga0075435_100063931 Ga0075435_1000639313 144
295 3300009093 Ga0105240_10084689 Ga0105240_100846893 144
296 3300009093 Ga0105240_11943960 Ga0105240_119439601 144
297 3300009094 Ga0111539_11135623 Ga0111539_111356231 144
298 3300009098 Ga0105245_10010244 Ga0105245_100102444 144
299 3300009098 Ga0105245_10104106 Ga0105245_101041063 144
300 3300009147 Ga0114129_10137856 Ga0114129_101378562 144
301 3300009147 Ga0114129_10328752 Ga0114129_103287522 144
302 3300009147 Ga0114129_11327033 Ga0114129_113270332 144
303 3300009148 Ga0105243_10002966 Ga0105243_1000296613 144
304 3300009148 Ga0105243_10047246 Ga0105243_100472463 144
305 3300009176 Ga0105242_10003901 Ga0105242_100039019 144
306 3300009177 Ga0105248_10486994 Ga0105248_104869942 144
307 3300009545 Ga0105237_10017662 Ga0105237_100176623 144
308 3300009545 Ga0105237_11514084 Ga0105237_115140841 144
309 3300009551 Ga0105238_10778280 Ga0105238_107782802 144
310 3300010375 Ga0105239_10139319 Ga0105239_101393193 144
311 3300010375 Ga0105239_10260702 Ga0105239_102607021 144
312 3300011119 Ga0105246_10010500 Ga0105246_100105006 144
313 3300013102 Ga0157371_10085802 Ga0157371_100858022 144
314 3300013296 Ga0157374_10016050 Ga0157374_100160503 144
315 3300013296 Ga0157374_10285472 Ga0157374_102854722 144
316 3300013297 Ga0157378_10194214 Ga0157378_101942144 144
317 3300013307 Ga0157372_10300490 Ga0157372_103004902 144
318 3300013308 Ga0157375_10110808 Ga0157375_101108083 144
319 3300014326 Ga0157380_10058979 Ga0157380_100589792 144
320 3300014326 Ga0157380_10161348 Ga0157380_101613483 144
321 3300014497 Ga0182008_10201802 Ga0182008_102018022 144
322 3300014745 Ga0157377_10095360 Ga0157377_100953604 144
323 3300014745 Ga0157377_10410938 Ga0157377_104109382 144
324 3300014969 Ga0157376_10577375 Ga0157376_105773752 144
325 3300014969 Ga0157376_10760363 Ga0157376_107603632 144
326 3300015261 Ga0182006_1000008 Ga0182006_1000008367 144
327 3300015262 Ga0182007_10012607 Ga0182007_100126071 144
328 3300015265 Ga0182005_1000008 Ga0182005_1000008234 144
329 3300015265 Ga0182005_1000337 Ga0182005_100033720 144
330 3300021361 Ga0213872_10000148 Ga0213872_100001484 144
331 3300021361 Ga0213872_10010316 Ga0213872_100103164 144
332 3300021388 Ga0213875_10014593 Ga0213875_100145933 144
333 3300025207 Ga0209760_101080 Ga0209760_1010804 144
334 3300025224 Ga0209784_100004 Ga0209784_100004495 144
335 3300025224 Ga0209784_100009 Ga0209784_10000948 144
336 3300025225 Ga0209566_100004 Ga0209566_100004652 144
337 3300025225 Ga0209566_100007 Ga0209566_10000748 144
338 3300025226 Ga0209674_100006 Ga0209674_100006652 144
339 3300025226 Ga0209674_100018 Ga0209674_10001848 144
340 3300025228 Ga0209672_106477 Ga0209672_1064771 144
341 3300025230 Ga0209563_100009 Ga0209563_100009495 144
342 3300025230 Ga0209563_100020 Ga0209563_10002048 144
343 3300025231 Ga0207427_100514 Ga0207427_10051415 144
344 3300025233 Ga0209437_100004 Ga0209437_100004495 144
345 3300025233 Ga0209437_101546 Ga0209437_1015466 144
346 3300025245 Ga0207425_1001395 Ga0207425_10013959 144
347 3300025246 Ga0209646_1000252 Ga0209646_10002529 144
348 3300025253 Ga0209677_100005 Ga0209677_100005495 144
349 3300025253 Ga0209677_100010 Ga0209677_10001048 144
350 3300025261 Ga0209233_1000005 Ga0209233_1000005652 144
351 3300025263 Ga0209565_1000003 Ga0209565_1000003561 144
352 3300025263 Ga0209565_1005211 Ga0209565_10052112 144
353 3300025272 Ga0209455_1000026 Ga0209455_1000026208 144
354 3300025273 Ga0209673_1000003 Ga0209673_1000003447 144
355 3300025291 Ga0209675_1000003 Ga0209675_1000003477 144
356 3300025295 Ga0209564_1000002 Ga0209564_1000002664 144
357 3300025295 Ga0209564_1000012 Ga0209564_1000012285 144
358 3300025297 Ga0209758_1000679 Ga0209758_100067917 144
359 3300025298 Ga0209050_1004618 Ga0209050_10046182 144
360 3300025299 Ga0209256_1000007 Ga0209256_1000007898 144
361 3300025299 Ga0209256_1000112 Ga0209256_1000112102 144
362 3300025303 Ga0209051_1017173 Ga0209051_10171734 144
363 3300025304 Ga0209257_1000094 Ga0209257_1000094126 144
364 3300025304 Ga0209257_1009045 Ga0209257_10090452 144
365 3300025315 Ga0207697_10056774 Ga0207697_100567742 144
366 3300025885 Ga0207653_10331764 Ga0207653_103317641 144
367 3300025893 Ga0207682_10023671 Ga0207682_100236713 144
368 3300025899 Ga0207642_10137133 Ga0207642_101371332 144
369 3300025899 Ga0207642_10146883 Ga0207642_101468833 144
370 3300025901 Ga0207688_10200881 Ga0207688_102008812 144
371 3300025903 Ga0207680_10398496 Ga0207680_103984962 144
372 3300025907 Ga0207645_10000134 Ga0207645_1000013449 144
373 3300025907 Ga0207645_10383556 Ga0207645_103835562 144
374 3300025908 Ga0207643_10256150 Ga0207643_102561502 144
375 3300025912 Ga0207707_10065503 Ga0207707_100655033 144
376 3300025912 Ga0207707_10390168 Ga0207707_103901681 144
377 3300025914 Ga0207671_10026866 Ga0207671_100268663 144
378 3300025916 Ga0207663_10423632 Ga0207663_104236322 144
379 3300025917 Ga0207660_10020287 Ga0207660_100202873 144
380 3300025918 Ga0207662_10011397 Ga0207662_100113973 144
381 3300025919 Ga0207657_10026089 Ga0207657_100260893 144
382 3300025919 Ga0207657_10028740 Ga0207657_100287404 144
383 3300025920 Ga0207649_10019348 Ga0207649_100193484 144
384 3300025920 Ga0207649_10057169 Ga0207649_100571692 144
385 3300025921 Ga0207652_10357425 Ga0207652_103574251 144
386 3300025923 Ga0207681_10031585 Ga0207681_100315852 144
387 3300025923 Ga0207681_10097888 Ga0207681_100978884 144
388 3300025925 Ga0207650_10187755 Ga0207650_101877552 144
389 3300025926 Ga0207659_10146090 Ga0207659_101460903 144
390 3300025926 Ga0207659_10261465 Ga0207659_102614653 144
391 3300025927 Ga0207687_10118563 Ga0207687_101185633 144
392 3300025931 Ga0207644_10285643 Ga0207644_102856432 144
393 3300025932 Ga0207690_10089316 Ga0207690_100893162 144
394 3300025932 Ga0207690_10137951 Ga0207690_101379512 144
395 3300025933 Ga0207706_10000433 Ga0207706_100004333 144
396 3300025933 Ga0207706_10015176 Ga0207706_100151768 144
397 3300025933 Ga0207706_10177454 Ga0207706_101774544 144
398 3300025934 Ga0207686_10268853 Ga0207686_102688533 144
399 3300025935 Ga0207709_10036278 Ga0207709_100362785 144
400 3300025935 Ga0207709_10092398 Ga0207709_100923981 144
401 3300025936 Ga0207670_10002879 Ga0207670_100028798 144
402 3300025937 Ga0207669_10481241 Ga0207669_104812412 144
403 3300025938 Ga0207704_10222176 Ga0207704_102221762 144
404 3300025939 Ga0207665_10156836 Ga0207665_101568361 144
405 3300025940 Ga0207691_10002432 Ga0207691_1000243219 144
406 3300025940 Ga0207691_10569018 Ga0207691_105690182 144
407 3300025941 Ga0207711_10373407 Ga0207711_103734072 144
408 3300025942 Ga0207689_10056609 Ga0207689_100566095 144
409 3300025942 Ga0207689_10140401 Ga0207689_101404011 144
410 3300025942 Ga0207689_10287631 Ga0207689_102876312 144
411 3300025942 Ga0207689_10554411 Ga0207689_105544112 144
412 3300025944 Ga0207661_11140707 Ga0207661_111407071 144
413 3300025945 Ga0207679_10002243 Ga0207679_100022432 144
414 3300025945 Ga0207679_10083987 Ga0207679_100839873 144
415 3300025949 Ga0207667_11033363 Ga0207667_110333631 144
416 3300025960 Ga0207651_10024042 Ga0207651_100240422 144
417 3300025972 Ga0207668_10116878 Ga0207668_101168781 144
418 3300025972 Ga0207668_10148139 Ga0207668_101481391 144
419 3300025981 Ga0207640_10056394 Ga0207640_100563945 144
420 3300025981 Ga0207640_10095662 Ga0207640_100956623 144
421 3300026023 Ga0207677_10047475 Ga0207677_100474753 144
422 3300026023 Ga0207677_10367241 Ga0207677_103672412 144
423 3300026041 Ga0207639_10346594 Ga0207639_103465943 144
424 3300026067 Ga0207678_10029766 Ga0207678_100297663 144
425 3300026075 Ga0207708_10063368 Ga0207708_100633682 144
426 3300026078 Ga0207702_10979350 Ga0207702_109793502 144
427 3300026089 Ga0207648_10003400 Ga0207648_100034006 144
428 3300026095 Ga0207676_11277466 Ga0207676_112774662 144
429 3300026095 Ga0207676_11328372 Ga0207676_113283722 144
430 3300026116 Ga0207674_10117691 Ga0207674_101176912 144
431 3300026116 Ga0207674_10579583 Ga0207674_105795832 144
432 3300026118 Ga0207675_100214009 Ga0207675_1002140092 144
433 3300026121 Ga0207683_10000036 Ga0207683_10000036101 144
434 3300026121 Ga0207683_10111179 Ga0207683_101111792 144
435 3300026142 Ga0207698_10017930 Ga0207698_100179306 144
436 3300027111 Ga0209281_1018100 Ga0209281_10181002 144
437 3300027360 Ga0209969_1000834 Ga0209969_10008343 144
438 3300027364 Ga0209967_1000395 Ga0209967_10003955 144
439 3300027378 Ga0209981_1001350 Ga0209981_10013503 144
440 3300027395 Ga0209996_1000010 Ga0209996_100001023 144
441 3300027424 Ga0209984_1000348 Ga0209984_10003485 144
442 3300027424 Ga0209984_1036081 Ga0209984_10360811 144
443 3300027462 Ga0210000_1000006 Ga0210000_100000636 144
444 3300027471 Ga0209995_1000073 Ga0209995_10000732 144
445 3300027526 Ga0209968_1000047 Ga0209968_100004720 144
446 3300027543 Ga0209999_1000700 Ga0209999_10007004 144
447 3300027552 Ga0209982_1001009 Ga0209982_10010093 144
448 3300027614 Ga0209970_1010858 Ga0209970_10108583 144
449 3300027617 Ga0210002_1000143 Ga0210002_10001433 144
450 3300027665 Ga0209983_1018189 Ga0209983_10181891 144
451 3300027666 Ga0209282_1000001 Ga0209282_10000011210 144
452 3300027682 Ga0209971_1001389 Ga0209971_10013893 144
453 3300027682 Ga0209971_1007112 Ga0209971_10071122 144
454 3300027695 Ga0209966_1000182 Ga0209966_100018220 144
455 3300027717 Ga0209998_10000014 Ga0209998_1000001424 144
456 3300027876 Ga0209974_10000725 Ga0209974_100007253 144
457 3300027876 Ga0209974_10037638 Ga0209974_100376383 144
458 3300027907 Ga0207428_10006054 Ga0207428_100060542 144
459 3300028379 Ga0268266_10162728 Ga0268266_101627281 144
460 3300028380 Ga0268265_10208410 Ga0268265_102084102 144
461 3300028381 Ga0268264_10068360 Ga0268264_100683602 144
462 3300028381 Ga0268264_10235932 Ga0268264_102359322 144
463 3300028786 Ga0307517_10104341 Ga0307517_101043412 144
464 3300028794 Ga0307515_10035905 Ga0307515_100359056 144
465 3300031239 Ga0265328_10075933 Ga0265328_100759332 144
466 3300031250 Ga0265331_10007350 Ga0265331_100073508 144
467 3300031250 Ga0265331_10009455 Ga0265331_100094552 144
468 3300031251 Ga0265327_10000043 Ga0265327_10000043166 144
469 3300031251 Ga0265327_10000271 Ga0265327_1000027186 144
470 3300031616 Ga0307508_10048900 Ga0307508_100489004 144
471 3300031730 Ga0307516_10002317 Ga0307516_100023179 144
472 3300032002 Ga0307416_100434064 Ga0307416_1004340641 144
473 3300033180 Ga0307510_10003830 Ga0307510_100038307 144
474 3300033180 Ga0307510_10276015 Ga0307510_102760152 144
475 3300034818 Ga0373950_0049933 Ga0373950_0049933_191_643 144
476 3300035083 Ga0373926_0008497 Ga0373926_0008497_1868_2326 144
477 3300035086 Ga0373934_0056179 Ga0373934_0056179_98_556 144
478 3300035086 Ga0373934_0116308 Ga0373934_0116308_590_1048 144
479 3300035091 Ga0373951_0029924 Ga0373951_0029924_235_711 144
480 3300035111 Ga0373923_0007533 Ga0373923_0007533_111_569 144
481 3300035112 Ga0373932_0028610 Ga0373932_0028610_994_1470 144
482 3300035113 Ga0373936_0005299 Ga0373936_0005299_2935_3393 144
483 3300035114 Ga0373939_0103885 Ga0373939_0103885_102_590 144
484 3300035115 Ga0373941_0134973 Ga0373941_0134973_375_863 144
485 3300035116 Ga0373945_0040048 Ga0373945_0040048_93_551 144
486 3300035117 Ga0373953_0005871 Ga0373953_0005871_85_543 144
487 3300035118 Ga0373954_0008316 Ga0373954_0008316_3800_4258 144
488 3300035119 Ga0373956_0397291 Ga0373956_0397291_85_543 144
489 3300035120 Ga0373957_0062062 Ga0373957_0062062_904_1362 144
490 3300035171 Ga0373946_0107196 Ga0373946_0107196_482_940 144
491 3300035241 Ga0373961_0033076 Ga0373961_0033076_752_1240 144
492 3300035242 Ga0373962_0068642 Ga0373962_0068642_533_1021 144
493 3300035691 Ga0373931_0035473 Ga0373931_0035473_1741_2229 144
494 3300035692 Ga0373935_0089927 Ga0373935_0089927_840_1298 144
495 3300035695 Ga0373927_0009046 Ga0373927_0009046_888_1346 144
496 3300035724 Ga0373933_0347978 Ga0373933_0347978_176_634 144
497 3300036401 Ga0373937_0116818 Ga0373937_0116818_491_949 144
498 3300036647 Ga0316582_0325899 Ga0316582_0325899_51_491 144
499 3300037068 Ga0373925_0196552 Ga0373925_0196552_85_543 144
500 3300037068 Ga0373925_0466471 Ga0373925_0466471_72_548 144
501 3300037312 Ga0395899_0002847 Ga0395899_0002847_12137_12571 144
502 3300037312 Ga0395899_0037721 Ga0395899_0037721_2895_3329 144
503 3300037312 Ga0395899_0096847 Ga0395899_0096847_894_1328 144
504 3300037312 Ga0395899_0782235 Ga0395899_0782235_30_464 144
505 3300037418 Ga0395900_0022865 Ga0395900_0022865_1595_2029 144
506 3300037418 Ga0395900_0155446 Ga0395900_0155446_587_1021 144
507 3300037418 Ga0395900_0171095 Ga0395900_0171095_1384_1818 144
508 3300037418 Ga0395900_1620362 Ga0395900_1620362_113_547 144
509 3300037466 Ga0395898_0009320 Ga0395898_0009320_6062_6496 144
510 3300037471 Ga0395905_0000869 Ga0395905_0000869_5778_6263 144
511 3300037471 Ga0395905_0029166 Ga0395905_0029166_1131_1565 144
512 3300037471 Ga0395905_0167165 Ga0395905_0167165_1182_1616 144
513 3300037471 Ga0395905_1093919 Ga0395905_1093919_58_492 144
514 3300037471 Ga0395905_1300301 Ga0395905_1300301_157_591 144
515 3300037853 Ga0436364_0372099 Ga0436364_0372099_3156_3593 144
516 3300038443 Ga0395901_0041924 Ga0395901_0041924_3839_4273 144
517 3300038443 Ga0395901_0172459 Ga0395901_0172459_1588_2022 144
518 3300038443 Ga0395901_0196471 Ga0395901_0196471_1098_1532 144
519 3300038443 Ga0395901_0517295 Ga0395901_0517295_67_501 144
520 3300039447 Ga0436361_0243249 Ga0436361_0243249_1597_2031 144
521 3300039447 Ga0436361_0249401 Ga0436361_0249401_1302_1742 144
522 3300039447 Ga0436361_0838192 Ga0436361_0838192_81_563 144
523 3300041413 Ga0439465_0278065 Ga0439465_0278065_14_463 144
524 3300041460 Ga0451802_1186193 Ga0451802_1186193_274_735 144
525 3300041486 Ga0451807_0139676 Ga0451807_0139676_563_1024 144
526 3300041496 Ga0451839_0386240 Ga0451839_0386240_44_538 144
527 3300042004 Ga0439445_0097801 Ga0439445_0097801_15_464 144
528 3300042008 Ga0439450_089257 Ga0439450_089257_76_564 144
529 3300042156 Ga0439446_0002656 Ga0439446_0002656_3261_3710 144
530 3300042439 Ga0439464_0084663 Ga0439464_0084663_80_568 144
531 3300044656 Ga0466969_0002272 Ga0466969_0002272_5578_6027 144
532 3300044656 Ga0466969_0098779 Ga0466969_0098779_280_720 144
533 3300044658 Ga0466972_0000201 Ga0466972_0000201_32341_32781 144
534 3300044666 Ga0466977_0003980 Ga0466977_0003980_3972_4412 144
535 3300044673 Ga0453683_0132239 Ga0453683_0132239_967_1455 144
536 3300044683 Ga0466965_0018249 Ga0466965_0018249_2609_3058 144
537 3300044684 Ga0466966_0011912 Ga0466966_0011912_3482_3916 144
538 3300044693 Ga0466961_0000346 Ga0466961_0000346_2296_2745 144
539 3300044706 Ga0466964_0300272 Ga0466964_0300272_53_493 144
540 3300044765 Ga0466970_0123792 Ga0466970_0123792_344_784 144
541 3300045049 Ga0466959_0010291 Ga0466959_0010291_3671_4120 144
542 3300045051 Ga0451576_0001125 Ga0451576_0001125_34603_35046 144
543 3300045051 Ga0451576_0067655 Ga0451576_0067655_1090_1578 144
544 3300045051 Ga0451576_0126051 Ga0451576_0126051_1204_1695 144
545 3300045051 Ga0451576_0420271 Ga0451576_0420271_339_782 144
546 3300045836 Ga0466958_0172756 Ga0466958_0172756_583_1017 144
547 3300045976 Ga0466967_0352374 Ga0466967_0352374_568_1038 144
548 3300046452 Ga0495617_005003 Ga0495617_005003_2536_2979 144
549 3300046453 Ga0495627_000001 Ga0495627_000001_653151_653591 144
550 3300046454 Ga0495592_0001331 Ga0495592_0001331_916_1374 144
551 3300046454 Ga0495592_0009127 Ga0495592_0009127_3076_3510 144
552 3300046457 Ga0495590_0000016 Ga0495590_0000016_145492_145932 144
553 3300046457 Ga0495590_0001068 Ga0495590_0001068_3985_4425 144
554 3300046457 Ga0495590_0061628 Ga0495590_0061628_442_921 144
555 3300046459 Ga0495629_0080697 Ga0495629_0080697_1031_1489 144
556 3300046460 Ga0495638_0000057 Ga0495638_0000057_47263_47703 144
557 3300046460 Ga0495638_0021068 Ga0495638_0021068_1998_2438 144
558 3300046460 Ga0495638_0048429 Ga0495638_0048429_1383_1823 144
559 3300046461 Ga0495641_0017077 Ga0495641_0017077_1379_1837 144
560 3300046462 Ga0495651_0001603 Ga0495651_0001603_2102_2536 144
561 3300046462 Ga0495651_0071910 Ga0495651_0071910_580_1014 144
562 3300046462 Ga0495651_0852830 Ga0495651_0852830_87_545 144
563 3300046463 Ga0495653_0006798 Ga0495653_0006798_8265_8699 144
564 3300046463 Ga0495653_0009105 Ga0495653_0009105_2195_2653 144
565 3300046463 Ga0495653_0031742 Ga0495653_0031742_264_704 144
566 3300046471 Ga0495650_0000024 Ga0495650_0000024_253198_253647 144
567 3300046471 Ga0495650_0002136 Ga0495650_0002136_438_878 144
568 3300046471 Ga0495650_0031013 Ga0495650_0031013_1324_1764 144
569 3300046472 Ga0495580_0039205 Ga0495580_0039205_973_1431 144
570 3300046473 Ga0495582_0115326 Ga0495582_0115326_618_1076 144
571 3300046474 Ga0495605_0087347 Ga0495605_0087347_70_549 144
572 3300046474 Ga0495605_0121416 Ga0495605_0121416_206_640 144
573 3300046475 Ga0495639_0017786 Ga0495639_0017786_2159_2599 144
574 3300046475 Ga0495639_0037756 Ga0495639_0037756_1594_2052 144
575 3300046477 Ga0495664_0030191 Ga0495664_0030191_1742_2200 144
576 3300046491 Ga0495584_0204662 Ga0495584_0204662_320_754 144
577 3300046499 Ga0495594_0024049 Ga0495594_0024049_459_917 144
578 3300046501 Ga0495607_0014033 Ga0495607_0014033_888_1328 144
579 3300046501 Ga0495607_0017745 Ga0495607_0017745_2831_3271 144
580 3300046506 Ga0495583_0000688 Ga0495583_0000688_40474_40914 144
581 3300046506 Ga0495583_0007041 Ga0495583_0007041_2082_2522 144
582 3300046506 Ga0495583_0049408 Ga0495583_0049408_1209_1688 144
583 3300046507 Ga0495606_0000087 Ga0495606_0000087_14875_15312 144
584 3300046507 Ga0495606_0000197 Ga0495606_0000197_99980_100420 144
585 3300046507 Ga0495606_0000573 Ga0495606_0000573_2424_2864 144
586 3300046507 Ga0495606_0021465 Ga0495606_0021465_2462_2905 144
587 3300046511 Ga0495608_0008467 Ga0495608_0008467_4815_5249 144
588 3300046511 Ga0495608_0042836 Ga0495608_0042836_1022_1480 144
589 3300046511 Ga0495608_0177879 Ga0495608_0177879_453_905 144
590 3300046511 Ga0495608_0424356 Ga0495608_0424356_219_653 144
591 3300046512 Ga0495610_0000411 Ga0495610_0000411_43412_43855 144
592 3300046512 Ga0495610_0001341 Ga0495610_0001341_19057_19497 144
593 3300046512 Ga0495610_0003847 Ga0495610_0003847_10442_10885 144
594 3300046512 Ga0495610_0005455 Ga0495610_0005455_3858_4298 144
595 3300046512 Ga0495610_0160319 Ga0495610_0160319_450_902 144
596 3300046513 Ga0495616_0024731 Ga0495616_0024731_1660_2100 144
597 3300046514 Ga0495618_0039205 Ga0495618_0039205_2323_2757 144
598 3300046514 Ga0495618_0142683 Ga0495618_0142683_88_546 144
599 3300046514 Ga0495618_0180863 Ga0495618_0180863_603_1037 144
600 3300046515 Ga0495620_0038664 Ga0495620_0038664_1108_1557 144
601 3300046516 Ga0495628_0003637 Ga0495628_0003637_99_557 144
602 3300046516 Ga0495628_0004029 Ga0495628_0004029_1587_2021 144
603 3300046516 Ga0495628_0023659 Ga0495628_0023659_2784_3242 144
604 3300046516 Ga0495628_0042761 Ga0495628_0042761_979_1413 144
605 3300046516 Ga0495628_0117695 Ga0495628_0117695_798_1256 144
606 3300046516 Ga0495628_0306639 Ga0495628_0306639_51_485 144
607 3300046517 Ga0495630_0215379 Ga0495630_0215379_977_1429 144
608 3300046517 Ga0495630_0224436 Ga0495630_0224436_787_1245 144
609 3300046518 Ga0495631_0005213 Ga0495631_0005213_1500_1940 144
610 3300046518 Ga0495631_0260269 Ga0495631_0260269_178_657 144
611 3300046519 Ga0495632_0079055 Ga0495632_0079055_821_1300 144
612 3300046520 Ga0495637_0027701 Ga0495637_0027701_1960_2400 144
613 3300046520 Ga0495637_0079617 Ga0495637_0079617_777_1226 144
614 3300046522 Ga0495643_0000236 Ga0495643_0000236_78224_78676 144
615 3300046522 Ga0495643_0000289 Ga0495643_0000289_4814_5257 144
616 3300046522 Ga0495643_0038221 Ga0495643_0038221_962_1396 144
617 3300046523 Ga0495644_0030618 Ga0495644_0030618_48_488 144
618 3300046524 Ga0495648_0000002 Ga0495648_0000002_444402_444842 144
619 3300046524 Ga0495648_0000029 Ga0495648_0000029_210677_211117 144
620 3300046524 Ga0495648_0011919 Ga0495648_0011919_1787_2230 144
621 3300046524 Ga0495648_0014417 Ga0495648_0014417_88_537 144
622 3300046526 Ga0495666_0032341 Ga0495666_0032341_207_665 144
623 3300046526 Ga0495666_0520350 Ga0495666_0520350_35_475 144
624 3300046528 Ga0495642_0003652 Ga0495642_0003652_2384_2818 144
625 3300046528 Ga0495642_0003770 Ga0495642_0003770_3379_3819 144
626 3300046528 Ga0495642_0318785 Ga0495642_0318785_102_551 144
627 3300046529 Ga0495652_0004166 Ga0495652_0004166_1858_2292 144
628 3300046529 Ga0495652_0009851 Ga0495652_0009851_3899_4333 144
629 3300046529 Ga0495652_0167549 Ga0495652_0167549_1159_1593 144
630 3300046529 Ga0495652_0509591 Ga0495652_0509591_113_565 144
631 3300046530 Ga0495654_0000226 Ga0495654_0000226_20937_21386 144
632 3300046531 Ga0495665_0039110 Ga0495665_0039110_908_1366 144
633 3300046533 Ga0495640_0006764 Ga0495640_0006764_6339_6797 144
634 3300046535 Ga0495586_0005800 Ga0495586_0005800_4742_5182 144
635 3300046535 Ga0495586_0096953 Ga0495586_0096953_986_1444 144
636 3300046538 Ga0495609_0000142 Ga0495609_0000142_69686_70126 144
637 3300046538 Ga0495609_0022634 Ga0495609_0022634_2055_2495 144
638 3300046538 Ga0495609_0085568 Ga0495609_0085568_265_744 144
639 3300046538 Ga0495609_0087897 Ga0495609_0087897_789_1229 144
640 3300046539 Ga0495621_0007826 Ga0495621_0007826_348_800 144
641 3300046542 Ga0495597_0000025 Ga0495597_0000025_96937_97377 144
642 3300046542 Ga0495597_0000848 Ga0495597_0000848_20280_20732 144
643 3300046542 Ga0495597_0002887 Ga0495597_0002887_6362_6796 144
644 3300046542 Ga0495597_0085573 Ga0495597_0085573_289_729 144
645 3300046543 Ga0495645_0003192 Ga0495645_0003192_1595_2053 144
646 3300046543 Ga0495645_0118995 Ga0495645_0118995_1080_1514 144
647 3300046543 Ga0495645_0124023 Ga0495645_0124023_176_610 144
648 3300046543 Ga0495645_0593444 Ga0495645_0593444_209_661 144
649 3300046557 Ga0495622_0000816 Ga0495622_0000816_2462_2902 144
650 3300046558 Ga0495633_0000073 Ga0495633_0000073_125249_125689 144
651 3300046558 Ga0495633_0000399 Ga0495633_0000399_4658_5098 144
652 3300046559 Ga0495667_0021617 Ga0495667_0021617_470_928 144
653 3300046615 Ga0495656_0160361 Ga0495656_0160361_394_834 144
654 3300046616 Ga0495668_0000020 Ga0495668_0000020_364129_364569 144
655 3300046616 Ga0495668_0000083 Ga0495668_0000083_48251_48691 144
656 3300046616 Ga0495668_0000132 Ga0495668_0000132_88255_88695 144
657 3300046616 Ga0495668_0011331 Ga0495668_0011331_4118_4558 144
658 3300046642 Ga0495634_0044238 Ga0495634_0044238_1959_2417 144
659 3300046660 Ga0495625_0000177 Ga0495625_0000177_4594_5034 144
660 3300046660 Ga0495625_0000398 Ga0495625_0000398_51313_51762 144
661 3300046660 Ga0495625_0006383 Ga0495625_0006383_5591_6070 144
662 3300046660 Ga0495625_0093220 Ga0495625_0093220_935_1375 144
663 3300046660 Ga0495625_0093397 Ga0495625_0093397_726_1169 144
664 3300046660 Ga0495625_0157726 Ga0495625_0157726_283_723 144
665 3300046663 Ga0495635_0028001 Ga0495635_0028001_1727_2167 144
666 3300046664 Ga0495659_0010327 Ga0495659_0010327_2454_2894 144
667 3300046665 Ga0495661_0001089 Ga0495661_0001089_11447_11881 144
668 3300046678 Ga0495599_0013823 Ga0495599_0013823_3677_4111 144
669 3300046678 Ga0495599_0099917 Ga0495599_0099917_937_1395 144
670 3300046678 Ga0495599_0141046 Ga0495599_0141046_919_1377 144
671 3300046679 Ga0495623_0036186 Ga0495623_0036186_863_1297 144
672 3300046679 Ga0495623_0130966 Ga0495623_0130966_850_1302 144
673 3300046679 Ga0495623_0572068 Ga0495623_0572068_76_510 144
674 3300046680 Ga0495646_0035836 Ga0495646_0035836_223_657 144
675 3300046680 Ga0495646_0133487 Ga0495646_0133487_830_1264 144
676 3300046681 Ga0495647_0004559 Ga0495647_0004559_753_1211 144
677 3300046683 Ga0495658_0326515 Ga0495658_0326515_88_522 144
678 3300046684 Ga0495669_0006738 Ga0495669_0006738_3741_4181 144
679 3300046689 Ga0495613_0051783 Ga0495613_0051783_1878_2318 144
680 3300046689 Ga0495613_0100713 Ga0495613_0100713_865_1323 144
681 3300046690 Ga0495624_0010151 Ga0495624_0010151_5209_5667 144
682 3300046690 Ga0495624_0012877 Ga0495624_0012877_233_667 144
683 3300046691 Ga0495670_0046542 Ga0495670_0046542_1233_1688 144
684 3300046692 Ga0495671_0151936 Ga0495671_0151936_167_607 144
685 3300046692 Ga0495671_0172888 Ga0495671_0172888_397_840 144
686 3300046694 Ga0495649_0004026 Ga0495649_0004026_1705_2184 144
687 3300046694 Ga0495649_0011278 Ga0495649_0011278_2764_3207 144
688 3300046694 Ga0495649_0056866 Ga0495649_0056866_318_758 144
689 3300046694 Ga0495649_0112244 Ga0495649_0112244_227_670 144
690 3300046809 Ga0495600_0000478 Ga0495600_0000478_1617_2051 144
691 3300046809 Ga0495600_0003656 Ga0495600_0003656_6198_6656 144
692 3300046809 Ga0495600_0099784 Ga0495600_0099784_628_1068 144
693 3300046810 Ga0495660_0000473 Ga0495660_0000473_1568_2008 144
694 3300046810 Ga0495660_0001536 Ga0495660_0001536_10426_10872 144
695 3300046810 Ga0495660_0106062 Ga0495660_0106062_130_582 144
696 3300046810 Ga0495660_0300672 Ga0495660_0300672_180_659 144
697 3300047317 Ga0495604_0033684 Ga0495604_0033684_793_1233 144
698 3300047317 Ga0495604_0034831 Ga0495604_0034831_55_513 144
699 3300047317 Ga0495604_0051203 Ga0495604_0051203_2441_2875 144
700 3300047320 Ga0495672_0000291 Ga0495672_0000291_66530_66973 144
701 3300047320 Ga0495672_0041061 Ga0495672_0041061_2199_2648 144
702 3300047322 Ga0495680_0035304 Ga0495680_0035304_1134_1574 144
703 3300047322 Ga0495680_0073112 Ga0495680_0073112_190_648 144
704 3300047443 Ga0495687_002232 Ga0495687_002232_10552_10986 144
705 3300047443 Ga0495687_003651 Ga0495687_003651_10470_10922 144
706 3300047443 Ga0495687_005190 Ga0495687_005190_7921_8373 144
707 3300047443 Ga0495687_012943 Ga0495687_012943_3005_3445 144
708 3300047444 Ga0495675_0053079 Ga0495675_0053079_955_1395 144
709 3300047446 Ga0495679_018373 Ga0495679_018373_1853_2293 144
710 3300047447 Ga0495685_006052 Ga0495685_006052_2657_3097 144
711 3300047469 Ga0495673_0000015 Ga0495673_0000015_517976_518419 144
712 3300047469 Ga0495673_0000342 Ga0495673_0000342_25620_26060 144
713 3300047470 Ga0495681_0021834 Ga0495681_0021834_1881_2321 144
714 3300047470 Ga0495681_0089671 Ga0495681_0089671_32_472 144
715 3300047471 Ga0495684_0025249 Ga0495684_0025249_2574_3032 144
716 3300047471 Ga0495684_0882939 Ga0495684_0882939_109_561 144
717 3300047472 Ga0495686_0001836 Ga0495686_0001836_3343_3783 144
718 3300047472 Ga0495686_0002827 Ga0495686_0002827_6586_7026 144
719 3300047472 Ga0495686_0003434 Ga0495686_0003434_2792_3241 144
720 3300047472 Ga0495686_0145250 Ga0495686_0145250_204_644 144
721 3300047673 Ga0495593_0040204 Ga0495593_0040204_1943_2383 144
722 3300048088 Ga0495602_0029056 Ga0495602_0029056_3789_4223 144
723 3300048089 Ga0495614_0013697 Ga0495614_0013697_2841_3281 144
724 3300048089 Ga0495614_0174881 Ga0495614_0174881_75_533 144
725 3300048090 Ga0495615_0040844 Ga0495615_0040844_124_558 144
726 3300048916 Ga0496113_0378531 Ga0496113_0378531_466_906 144
727 3300048919 Ga0496116_0250253 Ga0496116_0250253_170_604 144
728 3300048924 Ga0496121_0015651 Ga0496121_0015651_2627_3064 144
729 3300048924 Ga0496121_0360422 Ga0496121_0360422_317_790 144
730 3300048924 Ga0496121_0452610 Ga0496121_0452610_294_767 144
731 3300048927 Ga0496124_0094251 Ga0496124_0094251_1221_1667 144
732 3300049459 Ga0495678_000002 Ga0495678_000002_562444_562890 144
733 3300049459 Ga0495678_000069 Ga0495678_000069_47823_48266 144
734 3300049459 Ga0495678_004395 Ga0495678_004395_608_1048 144
735 3300049459 Ga0495678_067392 Ga0495678_067392_259_711 144
736 3300049459 Ga0495678_135256 Ga0495678_135256_114_554 144
737 3300049459 Ga0495678_185638 Ga0495678_185638_135_575 144
738 3300049656 Ga0501209_000276 Ga0501209_000276_312_755 144
739 3300049662 Ga0501222_001905 Ga0501222_001905_1730_2170 144
740 3300049665 Ga0501227_009261 Ga0501227_009261_1246_1686 144
741 3300049758 Ga0501241_065884 Ga0501241_065884_147_590 144
742 3300049764 Ga0501267_004127 Ga0501267_004127_294_776 144
743 3300049775 Ga0501279_001113 Ga0501279_001113_2179_2619 144
744 3300050489 nmdc:mga03683_548786_c1 nmdc:mga03683_548786_c1_41_502 144
745 3300050489 nmdc:mga03683_58940_c1 nmdc:mga03683_58940_c1_116_595 144
746 3300050491 nmdc:mga00v17_71067_c1 nmdc:mga00v17_71067_c1_336_815 144
747 3300050492 nmdc:mga0yw44_265632_c1 nmdc:mga0yw44_265632_c1_197_676 144
748 3300050493 nmdc:mga0k408_213381_c1 nmdc:mga0k408_213381_c1_197_676 144
749 3300050493 nmdc:mga0k408_28421_c1 nmdc:mga0k408_28421_c1_1240_1719 144
750 3300050493 nmdc:mga0k408_95774_c1 nmdc:mga0k408_95774_c1_936_1415 144
751 3300050494 nmdc:mga06z11_62243_c1 nmdc:mga06z11_62243_c1_231_710 144
752 3300050496 nmdc:mga07m45_474_c1 nmdc:mga07m45_474_c1_8786_9265 144
753 3300050496 nmdc:mga07m45_73561_c1 nmdc:mga07m45_73561_c1_1447_1899 144
754 3300050496 nmdc:mga07m45_74368_c1 nmdc:mga07m45_74368_c1_678_1157 144
755 3300050496 nmdc:mga07m45_880_c1 nmdc:mga07m45_880_c1_8940_9419 144
756 3300050507 nmdc:mga05p37_46673_c1 nmdc:mga05p37_46673_c1_3986_4441 144
757 3300050507 nmdc:mga05p37_581215_c1 nmdc:mga05p37_581215_c1_405_893 144
758 3300050508 nmdc:mga09592_512124_c1 nmdc:mga09592_512124_c1_199_687 144
759 3300050509 nmdc:mga0qj67_901582_c1 nmdc:mga0qj67_901582_c1_100_588 144
760 3300050510 nmdc:mga06r32_125092_c1 nmdc:mga06r32_125092_c1_796_1284 144
761 3300050511 nmdc:mga08y16_827742_c1 nmdc:mga08y16_827742_c1_356_844 144
762 3300050512 nmdc:mga0n895_85688_c1 nmdc:mga0n895_85688_c1_1201_1689 144
763 3300050513 nmdc:mga0rr50_9567_c1 nmdc:mga0rr50_9567_c1_3456_3944 144
764 3300050514 nmdc:mga08x19_177540_c1 nmdc:mga08x19_177540_c1_446_934 144
765 3300050515 nmdc:mga0a205_84522_c1 nmdc:mga0a205_84522_c1_1240_1728 144
766 3300050516 nmdc:mga0sz30_37768_c1 nmdc:mga0sz30_37768_c1_525_1004 144
767 3300053077 Ga0495601_0000453 Ga0495601_0000453_17431_17889 144
768 3300053077 Ga0495601_0145738 Ga0495601_0145738_880_1314 144
769 3300053084 Ga0495595_0006874 Ga0495595_0006874_2521_2979 144
770 3300053085 Ga0495619_0476348 Ga0495619_0476348_168_602 144
771 3300053085 Ga0495619_0878273 Ga0495619_0878273_82_534 144
772 3300053086 Ga0500578_0000102 Ga0500578_0000102_67039_67479 144
773 3300053088 Ga0500644_0000290 Ga0500644_0000290_17591_18031 144
774 3300053091 Ga0500647_0083826 Ga0500647_0083826_516_995 144
775 3300053094 Ga0500566_0491563 Ga0500566_0491563_62_511 144
776 3300053096 Ga0500641_0178453 Ga0500641_0178453_28_468 144
777 3300053104 Ga0500556_0374510 Ga0500556_0374510_25_465 144
778 3300053108 Ga0500562_003539 Ga0500562_003539_1661_2101 144
779 3300053111 Ga0500572_012234 Ga0500572_012234_891_1325 144
780 3300053118 Ga0500594_0000540 Ga0500594_0000540_7239_7679 144
781 3300053118 Ga0500594_0024002 Ga0500594_0024002_41_484 144
782 3300053119 Ga0500595_003284 Ga0500595_003284_6997_7431 144
783 3300053125 Ga0500618_001087 Ga0500618_001087_10483_10917 144
784 3300053125 Ga0500618_001190 Ga0500618_001190_9775_10209 144
785 3300053138 Ga0500564_000289 Ga0500564_000289_12787_13227 144
786 3300053139 Ga0500568_0048037 Ga0500568_0048037_305_784 144
787 3300053140 Ga0500573_0201861 Ga0500573_0201861_171_605 144
788 3300053141 Ga0500574_000188 Ga0500574_000188_2383_2817 144
789 3300053145 Ga0500586_006749 Ga0500586_006749_397_849 144
790 3300053148 Ga0500590_017522 Ga0500590_017522_1324_1806 144
791 3300053153 Ga0500616_0012668 Ga0500616_0012668_425_874 144
792 3300053154 Ga0500619_000268 Ga0500619_000268_2378_2812 144
793 3300053156 Ga0500622_0000674 Ga0500622_0000674_13873_14313 144
794 3300053156 Ga0500622_0073508 Ga0500622_0073508_572_1021 144
795 3300053158 Ga0500627_0028183 Ga0500627_0028183_265_714 144
796 3300059421 Ga0590071_003614 Ga0590071_003614_2616_3080 144
797 3300059423 Ga0590074_069989 Ga0590074_069989_149_613 144
798 3300059493 Ga0587077_016128 Ga0587077_016128_361_795 144
799 3300059641 Ga0587068_020103 Ga0587068_020103_195_629 144
800 3300061719 Ga0466962_0333809 Ga0466962_0333809_78_512 144
801 3300006353 Ga0075370_10007532 Ga0075370_100075323 145
802 3300042012 Ga0439455_0040202 Ga0439455_0040202_261_737 145
803 3300046452 Ga0495617_000013 Ga0495617_000013_37907_38350 145
804 3300046460 Ga0495638_0121115 Ga0495638_0121115_855_1298 145
805 3300046463 Ga0495653_0000025 Ga0495653_0000025_122146_122589 145
806 3300046471 Ga0495650_0000289 Ga0495650_0000289_89404_89847 145
807 3300046492 Ga0495585_0019035 Ga0495585_0019035_649_1092 145
808 3300046507 Ga0495606_0000137 Ga0495606_0000137_4543_4986 145
809 3300046512 Ga0495610_0000008 Ga0495610_0000008_548645_549088 145
810 3300046524 Ga0495648_0103863 Ga0495648_0103863_33_476 145
811 3300046530 Ga0495654_0031792 Ga0495654_0031792_232_675 145
812 3300046616 Ga0495668_0002007 Ga0495668_0002007_12834_13277 145
813 3300046665 Ga0495661_0160929 Ga0495661_0160929_723_1166 145
814 3300046692 Ga0495671_0000002 Ga0495671_0000002_1063606_1064049 145
815 3300046810 Ga0495660_0042988 Ga0495660_0042988_2032_2475 145
816 3300047446 Ga0495679_047697 Ga0495679_047697_604_1047 145
817 3300047469 Ga0495673_0000005 Ga0495673_0000005_912672_913115 145
818 3300047469 Ga0495673_0000044 Ga0495673_0000044_244701_245144 145
819 3300048919 Ga0496116_0206079 Ga0496116_0206079_441_884 145
820 3300048926 Ga0496123_0023256 Ga0496123_0023256_3713_4156 145
821 3300053145 Ga0500586_026623 Ga0500586_026623_1114_1557 145
822 iso_pu_bacteria 2511231003 2511250096 145
823 iso_pu_bacteria 2548876994 2550693620 145
824 iso_pu_bacteria 2818991445 2819592075 145
825 iso_pu_bacteria 2884811622 2884816936 145
826 iso_pu_bacteria 2884836552 2884840507 145
827 iso_pu_bacteria 2884852848 2884855764 145
828 iso_pu_bacteria 2896154374 2896157311 145
829 3300003322 rootL2_10034610 rootL2_100346106 146
830 3300025920 Ga0207649_10332933 Ga0207649_103329331 146
831 3300048917 Ga0496114_0077477 Ga0496114_0077477_350_790 146
832 3300048928 Ga0496125_0000734 Ga0496125_0000734_41805_42245 146
833 3300048929 Ga0496126_0156518 Ga0496126_0156518_206_646 146
834 3300031251 Ga0265327_10093622 Ga0265327_100936222 147
835 3300002704 JGI25155J39150_1000204 JGI25155J39150_10002047 149
836 3300002705 JGI25156J39149_1000154 JGI25156J39149_100015429 149
837 3300002738 JGI25154J39366_1000462 JGI25154J39366_10004626 149
838 3300002741 JGI25157J39369_1000169 JGI25157J39369_100016920 149
839 3300003758 Ga0055532_1000017 Ga0055532_1000017187 149
840 3300003761 Ga0055535_1007775 Ga0055535_10077753 149
841 3300025206 Ga0209435_100015 Ga0209435_100015201 149
842 3300025229 Ga0209147_100004 Ga0209147_1000041025 149
843 3300025233 Ga0209437_100045 Ga0209437_100045344 149
844 3300025242 Ga0209258_100226 Ga0209258_10022614 149
845 3300025246 Ga0209646_1000040 Ga0209646_1000040231 149
846 3300025250 Ga0209026_1000034 Ga0209026_100003488 149
847 3300025254 Ga0209148_1025257 Ga0209148_10252572 149
848 3300025256 Ga0209759_1000049 Ga0209759_1000049115 149
849 3300025272 Ga0209455_1002265 Ga0209455_10022654 149
850 3300026116 Ga0207674_10168123 Ga0207674_101681233 149
851 3300046660 Ga0495625_0002519 Ga0495625_0002519_2557_3006 149
852 3300048928 Ga0496125_0004104 Ga0496125_0004104_201_650 149
853 iso_pu_bacteria 2521172590 2521559372 149
854 3300002739 JGI25158J39367_1012090 JGI25158J39367_10120902 150
855 3300002987 JGI25159J45721_1001688 JGI25159J45721_10016889 150
856 3300005262 Ga0065165_1000005 Ga0065165_100000514 150
857 3300025284 Ga0209130_1000046 Ga0209130_1000046139 150
858 3300028786 Ga0307517_10132307 Ga0307517_101323071 151
859 3300031456 Ga0307513_10189608 Ga0307513_101896082 151
860 3300048088 Ga0495602_0096376 Ga0495602_0096376_637_1092 151
861 3300002704 JGI25155J39150_1000132 JGI25155J39150_100013217 154
862 3300002738 JGI25154J39366_1000401 JGI25154J39366_100040120 154
863 3300006175 Ga0070712_100010843 Ga0070712_1000108435 154
864 3300009093 Ga0105240_10143049 Ga0105240_101430492 154
865 3300009545 Ga0105237_10157015 Ga0105237_101570153 154
866 3300009551 Ga0105238_10000213 Ga0105238_100002134 154
867 3300010375 Ga0105239_10690031 Ga0105239_106900312 154
868 3300015261 Ga0182006_1005802 Ga0182006_10058026 154
869 3300025206 Ga0209435_100162 Ga0209435_1001624 154
870 3300025246 Ga0209646_1000020 Ga0209646_1000020174 154
871 3300025256 Ga0209759_1000809 Ga0209759_100080921 154
872 3300025913 Ga0207695_10001039 Ga0207695_1000103916 154
873 3300025913 Ga0207695_10116269 Ga0207695_101162694 154
874 3300025914 Ga0207671_10086655 Ga0207671_100866553 154
875 3300025915 Ga0207693_10072058 Ga0207693_100720581 154
876 3300025949 Ga0207667_10030385 Ga0207667_100303852 154
877 3300048920 Ga0496117_0328193 Ga0496117_0328193_92_562 154
878 3300048924 Ga0496121_0042446 Ga0496121_0042446_2551_3021 154

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00075

RNase_H

RNase H

21

156

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wsj-assembly7.cif.gz_G crystal structure of e.coli rnase hi active site mutant (k87a/h124a) 0.9891 11 151
1wsh-assembly3.cif.gz_C crystal structure of e.coli rnase hi active site mutant (e48a/k87a) 0.9867 11 152
7vsa-assembly1.cif.gz_A e. coli ribonuclease hi in complex with two mg2+ 0.9859 11 151
1wsi-assembly2.cif.gz_B crystal structure of e.coli rnase hi active site mutant (e48a/k87a/d134n) 0.9859 11 151
1wsj-assembly3.cif.gz_C crystal structure of e.coli rnase hi active site mutant (k87a/h124a) 0.985 11 151
ID Description Score Start End Superfamily
1jl2C00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9738 13 151 3.30.420.10
2zqbB00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9714 11 154 3.30.420.10
2zqbB00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9199 11 154 3.30.420.10
af_Q86MG7_99_246_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9087 15 151 3.30.420.10
4ibnA01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8997 11 154 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A527HH28-F1-model_v4 deleted 1.004 11 82
AF-A0A2N3AU90-F1-model_v4 Ribonuclease HI 0.9984 11 93 GO:0003676
GO:0004523
AF-A0A3D0XTL9-F1-model_v4 Ribonuclease HI 0.9964 11 74 GO:0003676
GO:0004523
AF-A0A381ZS24-F1-model_v4 ribonuclease H (EC 3.1.26.4) 0.9962 11 94 GO:0003676
GO:0004523
GO:0043137
AF-A0A661FLC7-F1-model_v4 ribonuclease H (EC 3.1.26.4) 0.9958 26 153 GO:0003676
GO:0004523
GO:0043137

Feature Viewer

pLDDT pTM Quality
93.06 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map