F484417
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 878 | 526 | 850 | 152 |
Family's Representative Sequence
| Representative Sequence | 3300006353|Ga0075370_10045539|Ga0075370_100455394 |
| Length | 158 |
| Sequence | MTTTGHPKTEAAHANKPSITRPQVVVYTDGACKGNPGPGGWGAWLSSGGHEKELFGGEALTTNNRMELTAVIEALASLKRTCDVILYTDSEYVRKGITEWIHGWKTRDKKPVKNADLWQRLDALRLLHRVEFRWVKGHAGDPGNERADALANRGCASV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 2 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 3 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 4 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 5 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 6 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 7 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 8 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 9 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 10 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 11 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 12 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 13 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 14 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 15 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 16 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 17 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 18 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 19 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 20 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 21 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 22 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 23 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 24 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 25 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 26 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 27 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 28 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 29 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 30 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 31 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 32 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 33 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 34 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 35 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 36 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 37 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 38 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 39 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 40 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 41 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 42 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 43 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 44 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 45 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 46 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 47 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 48 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 49 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 50 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 51 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 52 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 53 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 54 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 55 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 56 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 57 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 58 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 59 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 60 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 61 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 62 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 65 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 68 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 70 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 72 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 74 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 76 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 85 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 98 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 99 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 100 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 101 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 102 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 103 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 105 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 106 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 110 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 112 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 113 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 114 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 116 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 117 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 118 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 119 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 120 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 121 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 122 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 123 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 125 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 126 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 127 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 128 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 129 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 130 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 131 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 132 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 133 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 134 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 135 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 136 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 138 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 139 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 140 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 141 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 142 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 143 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 144 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 145 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 146 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 148 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 149 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 160 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 161 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 169 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 172 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 173 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 174 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 175 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 176 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 177 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 188 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 189 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 190 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 193 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 194 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 196 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 197 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 198 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 200 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 201 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 202 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 204 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 205 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 206 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 260 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 274 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 278 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 280 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 284 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 285 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 286 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 287 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 288 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 289 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 290 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 291 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 292 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 293 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 294 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 295 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 296 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 297 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 298 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 299 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 300 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 301 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 302 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 303 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 304 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 305 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 306 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 307 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 308 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 309 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 310 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 311 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 312 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 313 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 314 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 315 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 316 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 317 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 318 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 319 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 320 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 321 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 322 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 323 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 324 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 325 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 326 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 327 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 328 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 329 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 330 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 331 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 332 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 333 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 334 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 335 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 336 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 337 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 338 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 339 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 340 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 341 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 342 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 343 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 344 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 345 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 346 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 347 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 348 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 349 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 350 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 351 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 352 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 353 | 3300044666 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E | Metagenome | Unclassified |
| 354 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 355 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 356 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 357 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 358 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 359 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 360 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 361 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 362 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 363 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 364 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 365 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 451 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 452 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 453 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 454 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 455 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 456 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 457 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 458 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 459 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 460 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 461 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 462 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 463 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 464 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 465 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 466 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 467 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 468 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 470 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 471 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 472 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 473 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 474 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 475 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 476 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 477 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 478 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 479 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 480 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 481 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 482 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 483 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 484 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 485 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 486 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 487 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 488 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 489 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 490 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 491 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 492 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 493 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 494 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 495 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 496 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 500 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 501 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 502 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 503 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 504 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 505 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 506 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 507 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 508 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 509 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 510 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 511 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 512 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 513 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 514 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 515 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 516 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 517 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 518 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 519 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 520 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 521 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 522 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 523 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 524 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 525 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 526 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.58 |
| Metatranscriptomes | 0.23 |
| Isolates | 3.19 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 18.11 |
| Nodule | 0.68 |
| Rhizoplane | 1.71 |
| Rhizosphere | 70.84 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.66 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25155J39150_1000132 | 3300002704 | Bacteria | 35559 |
| 2 | JGI25155J39150_1000204 | 3300002704 | Bacteria | 24399 |
| 3 | JGI25156J39149_1000154 | 3300002705 | Bacteria | 50528 |
| 4 | JGI25162J39368_1000001 | 3300002737 | Bacteria | 740113 |
| 5 | JGI25154J39366_1000401 | 3300002738 | Bacteria | 23593 |
| 6 | JGI25154J39366_1000462 | 3300002738 | Bacteria | 21234 |
| 7 | JGI25154J39366_1000584 | 3300002738 | Bacteria | 17690 |
| 8 | JGI25158J39367_1012090 | 3300002739 | Bacteria | 1142 |
| 9 | JGI25157J39369_1000169 | 3300002741 | Bacteria | 55047 |
| 10 | JGI25163J39215_1002212 | 3300002771 | Bacteria | 2201 |
| 11 | JGI25164J39214_1004383 | 3300002772 | Bacteria | 1635 |
| 12 | JGI25150J39212_1001132 | 3300002774 | Bacteria | 8025 |
| 13 | JGI25159J45721_1001688 | 3300002987 | Bacteria | 8942 |
| 14 | JGI25165J46597_1000001 | 3300003214 | Bacteria | 1111887 |
| 15 | JGI25153J46596_10037994 | 3300003215 | Bacteria | 1524 |
| 16 | rootL2_10030503 | 3300003322 | Bacteria | 7631 |
| 17 | rootL2_10034610 | 3300003322 | Bacteria | 6021 |
| 18 | rootL2_10050963 | 3300003322 | Bacteria | 3280 |
| 19 | rootL2_10105907 | 3300003322 | Bacteria | 1869 |
| 20 | JGI26145J50221_1001623 | 3300003371 | Bacteria | 1776 |
| 21 | Ga0055538_1000001 | 3300003751 | Bacteria | 1111887 |
| 22 | Ga0055538_1000070 | 3300003751 | Bacteria | 93518 |
| 23 | Ga0055539_1000001 | 3300003752 | Bacteria | 1111887 |
| 24 | Ga0055539_1000105 | 3300003752 | Bacteria | 93518 |
| 25 | Ga0055533_1000003 | 3300003756 | Bacteria | 1111887 |
| 26 | Ga0055533_1000113 | 3300003756 | Bacteria | 93518 |
| 27 | Ga0055532_1000017 | 3300003758 | Bacteria | 306880 |
| 28 | Ga0055525_1000003 | 3300003759 | Bacteria | 962094 |
| 29 | Ga0055525_1000153 | 3300003759 | Bacteria | 93518 |
| 30 | Ga0055535_1007775 | 3300003761 | Bacteria | 2006 |
| 31 | Ga0055529_1000836 | 3300003763 | Bacteria | 18140 |
| 32 | Ga0055526_1000023 | 3300003771 | Bacteria | 163444 |
| 33 | Ga0055526_1000341 | 3300003771 | Bacteria | 38207 |
| 34 | Ga0055526_1010195 | 3300003771 | Bacteria | 4404 |
| 35 | Ga0055537_1000129 | 3300003773 | Bacteria | 57643 |
| 36 | Ga0055524_1000151 | 3300003775 | Bacteria | 82351 |
| 37 | Ga0055524_1002022 | 3300003775 | Bacteria | 10819 |
| 38 | Ga0055534_1000594 | 3300003784 | Bacteria | 18790 |
| 39 | Ga0055534_1000965 | 3300003784 | Bacteria | 12758 |
| 40 | Ga0055528_1000013 | 3300003790 | Bacteria | 176239 |
| 41 | Ga0055540_1071329 | 3300003792 | Bacteria | 678 |
| 42 | Ga0055531_10000044 | 3300003794 | Bacteria | 133446 |
| 43 | Ga0055541_1000001 | 3300003841 | Bacteria | 1111887 |
| 44 | Ga0055541_1000071 | 3300003841 | Bacteria | 93518 |
| 45 | Ga0065165_1000005 | 3300005262 | Bacteria | 370361 |
| 46 | Ga0065704_10108090 | 3300005289 | Bacteria | 2039 |
| 47 | Ga0065704_10313445 | 3300005289 | Bacteria | 864 |
| 48 | Ga0065712_10012574 | 3300005290 | Unclassified | 2501 |
| 49 | Ga0065715_10042946 | 3300005293 | Unclassified | 1262 |
| 50 | Ga0070676_10084340 | 3300005328 | Bacteria | 1934 |
| 51 | Ga0070683_101637237 | 3300005329 | Bacteria | 619 |
| 52 | Ga0070690_100190718 | 3300005330 | Bacteria | 1421 |
| 53 | Ga0070670_100096244 | 3300005331 | Bacteria | 2547 |
| 54 | Ga0070677_10043647 | 3300005333 | Bacteria | 1781 |
| 55 | Ga0070677_10276683 | 3300005333 | Bacteria | 844 |
| 56 | Ga0068869_100010984 | 3300005334 | Bacteria | 5929 |
| 57 | Ga0070666_10050883 | 3300005335 | Bacteria | 2788 |
| 58 | Ga0070666_10147195 | 3300005335 | Bacteria | 1642 |
| 59 | Ga0070680_100069471 | 3300005336 | Bacteria | 2892 |
| 60 | Ga0070682_100182320 | 3300005337 | Bacteria | 1468 |
| 61 | Ga0068868_100015268 | 3300005338 | Bacteria | 5677 |
| 62 | Ga0068868_100322227 | 3300005338 | Bacteria | 1317 |
| 63 | Ga0070660_100060819 | 3300005339 | Bacteria | 2932 |
| 64 | Ga0070660_100230977 | 3300005339 | Bacteria | 1505 |
| 65 | Ga0070689_100003473 | 3300005340 | Bacteria | 10491 |
| 66 | Ga0070691_10028707 | 3300005341 | Bacteria | 2601 |
| 67 | Ga0070687_100007263 | 3300005343 | Bacteria | 4606 |
| 68 | Ga0070661_100007428 | 3300005344 | Bacteria | 7556 |
| 69 | Ga0070661_100157192 | 3300005344 | Bacteria | 1720 |
| 70 | Ga0070692_10067874 | 3300005345 | Bacteria | 1894 |
| 71 | Ga0070668_100024157 | 3300005347 | Bacteria | 4603 |
| 72 | Ga0070669_100548603 | 3300005353 | Bacteria | 963 |
| 73 | Ga0070669_101436298 | 3300005353 | Bacteria | 599 |
| 74 | Ga0070675_100087418 | 3300005354 | Bacteria | 2606 |
| 75 | Ga0070675_100105687 | 3300005354 | Bacteria | 2376 |
| 76 | Ga0070671_100088620 | 3300005355 | Bacteria | 2590 |
| 77 | Ga0070674_100014049 | 3300005356 | Bacteria | 4969 |
| 78 | Ga0070674_100215730 | 3300005356 | Bacteria | 1490 |
| 79 | Ga0070673_100002884 | 3300005364 | Bacteria | 10578 |
| 80 | Ga0070688_100043383 | 3300005365 | Bacteria | 2771 |
| 81 | Ga0070659_100003919 | 3300005366 | Bacteria | 10591 |
| 82 | Ga0070659_100013137 | 3300005366 | Bacteria | 6157 |
| 83 | Ga0070667_100116855 | 3300005367 | Bacteria | 2317 |
| 84 | Ga0070667_101117695 | 3300005367 | Bacteria | 737 |
| 85 | Ga0070709_10031572 | 3300005434 | Bacteria | 3187 |
| 86 | Ga0070701_10036575 | 3300005438 | Bacteria | 2474 |
| 87 | Ga0070711_100165441 | 3300005439 | Bacteria | 1681 |
| 88 | Ga0070705_100042649 | 3300005440 | Bacteria | 2595 |
| 89 | Ga0070700_100007514 | 3300005441 | Bacteria | 5892 |
| 90 | Ga0070694_100071619 | 3300005444 | Bacteria | 2389 |
| 91 | Ga0070708_100106236 | 3300005445 | Bacteria | 2577 |
| 92 | Ga0070663_100802480 | 3300005455 | Bacteria | 807 |
| 93 | Ga0070678_100014162 | 3300005456 | Bacteria | 5022 |
| 94 | Ga0070662_100001274 | 3300005457 | Bacteria | 15485 |
| 95 | Ga0070662_100015383 | 3300005457 | Bacteria | 5123 |
| 96 | Ga0070662_100075388 | 3300005457 | Bacteria | 2498 |
| 97 | Ga0070681_10025086 | 3300005458 | Bacteria | 6000 |
| 98 | Ga0068867_100086893 | 3300005459 | Bacteria | 2367 |
| 99 | Ga0068867_100228970 | 3300005459 | Bacteria | 1501 |
| 100 | Ga0070685_10212160 | 3300005466 | Bacteria | 1264 |
| 101 | Ga0070679_100054705 | 3300005530 | Bacteria | 3975 |
| 102 | Ga0070679_100237334 | 3300005530 | Bacteria | 1782 |
| 103 | Ga0070684_100160149 | 3300005535 | Bacteria | 2041 |
| 104 | Ga0068853_100614700 | 3300005539 | Bacteria | 1033 |
| 105 | Ga0070672_100008006 | 3300005543 | Bacteria | 7220 |
| 106 | Ga0070672_100452748 | 3300005543 | Bacteria | 1106 |
| 107 | Ga0070686_100015688 | 3300005544 | Bacteria | 4395 |
| 108 | Ga0070695_100161462 | 3300005545 | Bacteria | 1573 |
| 109 | Ga0070696_100080067 | 3300005546 | Bacteria | 2312 |
| 110 | Ga0070693_100321217 | 3300005547 | Bacteria | 1050 |
| 111 | Ga0070665_100438296 | 3300005548 | Bacteria | 1316 |
| 112 | Ga0070665_101111966 | 3300005548 | Bacteria | 802 |
| 113 | Ga0070665_101723604 | 3300005548 | Bacteria | 634 |
| 114 | Ga0068855_100000645 | 3300005563 | Bacteria | 42677 |
| 115 | Ga0068855_101184776 | 3300005563 | Bacteria | 795 |
| 116 | Ga0070664_100075089 | 3300005564 | Bacteria | 2902 |
| 117 | Ga0070664_100085441 | 3300005564 | Bacteria | 2725 |
| 118 | Ga0068857_100119545 | 3300005577 | Bacteria | 2372 |
| 119 | Ga0068857_100140107 | 3300005577 | Bacteria | 2186 |
| 120 | Ga0068854_100081911 | 3300005578 | Bacteria | 2385 |
| 121 | Ga0068854_100499274 | 3300005578 | Bacteria | 1024 |
| 122 | Ga0068856_100299641 | 3300005614 | Bacteria | 1625 |
| 123 | Ga0070702_100004200 | 3300005615 | Bacteria | 6552 |
| 124 | Ga0068859_100003059 | 3300005617 | Bacteria | 16971 |
| 125 | Ga0068859_100801284 | 3300005617 | Bacteria | 1030 |
| 126 | Ga0068864_100083818 | 3300005618 | Bacteria | 2800 |
| 127 | Ga0068866_10021224 | 3300005718 | Bacteria | 2990 |
| 128 | Ga0068866_10122569 | 3300005718 | Bacteria | 1467 |
| 129 | Ga0068861_100148175 | 3300005719 | Bacteria | 1923 |
| 130 | Ga0068870_10327405 | 3300005840 | Bacteria | 975 |
| 131 | Ga0068858_100868776 | 3300005842 | Bacteria | 881 |
| 132 | Ga0068858_101624648 | 3300005842 | Bacteria | 638 |
| 133 | Ga0068860_100091353 | 3300005843 | Bacteria | 2900 |
| 134 | Ga0068862_100087801 | 3300005844 | Bacteria | 2705 |
| 135 | Ga0070717_10503794 | 3300006028 | Bacteria | 1094 |
| 136 | Ga0075365_10142883 | 3300006038 | Bacteria | 1662 |
| 137 | Ga0075368_10021444 | 3300006042 | Bacteria | 2454 |
| 138 | Ga0075368_10065499 | 3300006042 | Bacteria | 1460 |
| 139 | Ga0075368_10146951 | 3300006042 | Bacteria | 984 |
| 140 | Ga0075363_100005677 | 3300006048 | Bacteria | 5583 |
| 141 | Ga0075364_10383477 | 3300006051 | Bacteria | 959 |
| 142 | Ga0075432_10011257 | 3300006058 | Bacteria | 3041 |
| 143 | Ga0070715_10125922 | 3300006163 | Bacteria | 1227 |
| 144 | Ga0070712_100010843 | 3300006175 | Bacteria | 5764 |
| 145 | Ga0070712_100021105 | 3300006175 | Bacteria | 4271 |
| 146 | Ga0075362_10000768 | 3300006177 | Bacteria | 9563 |
| 147 | Ga0075362_10014252 | 3300006177 | Bacteria | 3204 |
| 148 | Ga0075362_10014530 | 3300006177 | Bacteria | 3179 |
| 149 | Ga0075362_10108963 | 3300006177 | Bacteria | 1302 |
| 150 | Ga0075367_10004491 | 3300006178 | Bacteria | 6819 |
| 151 | Ga0075367_10006418 | 3300006178 | Bacteria | 5938 |
| 152 | Ga0075369_10004486 | 3300006186 | Bacteria | 5161 |
| 153 | Ga0075427_10017279 | 3300006194 | Bacteria | 1124 |
| 154 | Ga0075366_10001662 | 3300006195 | Bacteria | 11166 |
| 155 | Ga0075366_10021765 | 3300006195 | Bacteria | 3728 |
| 156 | Ga0075366_10032423 | 3300006195 | Bacteria | 3075 |
| 157 | Ga0075366_10308560 | 3300006195 | Bacteria | 968 |
| 158 | Ga0075366_10428268 | 3300006195 | Bacteria | 815 |
| 159 | Ga0097621_100001607 | 3300006237 | Bacteria | 15477 |
| 160 | Ga0075370_10000340 | 3300006353 | Bacteria | 16849 |
| 161 | Ga0075370_10003500 | 3300006353 | Bacteria | 7483 |
| 162 | Ga0075370_10007532 | 3300006353 | Bacteria | 5548 |
| 163 | Ga0075370_10045539 | 3300006353 | Bacteria | 2481 |
| 164 | Ga0075370_10053180 | 3300006353 | Bacteria | 2298 |
| 165 | Ga0075370_10074611 | 3300006353 | Bacteria | 1944 |
| 166 | Ga0075370_10149660 | 3300006353 | Bacteria | 1368 |
| 167 | Ga0068871_100013291 | 3300006358 | Bacteria | 6107 |
| 168 | Ga0075428_100954627 | 3300006844 | Bacteria | 908 |
| 169 | Ga0075430_100392893 | 3300006846 | Bacteria | 1145 |
| 170 | Ga0075431_100022194 | 3300006847 | Bacteria | 6491 |
| 171 | Ga0075434_100061167 | 3300006871 | Bacteria | 3746 |
| 172 | Ga0075429_100341672 | 3300006880 | Bacteria | 1310 |
| 173 | Ga0068865_100000749 | 3300006881 | Bacteria | 18204 |
| 174 | Ga0075436_100081141 | 3300006914 | Unclassified | 2248 |
| 175 | Ga0075436_100227179 | 3300006914 | Bacteria | 1325 |
| 176 | Ga0097620_100003059 | 3300006931 | Bacteria | 16971 |
| 177 | Ga0097620_100801295 | 3300006931 | Bacteria | 1030 |
| 178 | Ga0099826_10000001 | 3300006948 | Bacteria | 1155201 |
| 179 | Ga0075435_100063931 | 3300007076 | Bacteria | 2989 |
| 180 | Ga0105240_10084689 | 3300009093 | Bacteria | 3887 |
| 181 | Ga0105240_10143049 | 3300009093 | Bacteria | 2858 |
| 182 | Ga0105240_11943960 | 3300009093 | Bacteria | 612 |
| 183 | Ga0111539_11135623 | 3300009094 | Bacteria | 908 |
| 184 | Ga0105245_10010244 | 3300009098 | Bacteria | 8163 |
| 185 | Ga0105245_10035552 | 3300009098 | Bacteria | 4421 |
| 186 | Ga0105245_10104106 | 3300009098 | Bacteria | 2631 |
| 187 | Ga0105247_10002270 | 3300009101 | Bacteria | 13205 |
| 188 | Ga0114129_10137856 | 3300009147 | Bacteria | 3347 |
| 189 | Ga0114129_10328752 | 3300009147 | Bacteria | 2030 |
| 190 | Ga0114129_11327033 | 3300009147 | Bacteria | 890 |
| 191 | Ga0105243_10002966 | 3300009148 | Bacteria | 14026 |
| 192 | Ga0105243_10045475 | 3300009148 | Bacteria | 3450 |
| 193 | Ga0105243_10047246 | 3300009148 | Bacteria | 3388 |
| 194 | Ga0105242_10003901 | 3300009176 | Bacteria | 11594 |
| 195 | Ga0105248_10486994 | 3300009177 | Bacteria | 1390 |
| 196 | Ga0105237_10017662 | 3300009545 | Bacteria | 7393 |
| 197 | Ga0105237_10157015 | 3300009545 | Bacteria | 2272 |
| 198 | Ga0105237_11514084 | 3300009545 | Bacteria | 678 |
| 199 | Ga0105238_10000213 | 3300009551 | Bacteria | 64398 |
| 200 | Ga0105238_10778280 | 3300009551 | Bacteria | 972 |
| 201 | Ga0105239_10139319 | 3300010375 | Bacteria | 2703 |
| 202 | Ga0105239_10260702 | 3300010375 | Bacteria | 1948 |
| 203 | Ga0105239_10690031 | 3300010375 | Bacteria | 1167 |
| 204 | Ga0105246_10010500 | 3300011119 | Bacteria | 5733 |
| 205 | Ga0157371_10085802 | 3300013102 | Bacteria | 2230 |
| 206 | Ga0157374_10016050 | 3300013296 | Bacteria | 6580 |
| 207 | Ga0157374_10285472 | 3300013296 | Bacteria | 1630 |
| 208 | Ga0157378_10194214 | 3300013297 | Bacteria | 1916 |
| 209 | Ga0157372_10300490 | 3300013307 | Bacteria | 1867 |
| 210 | Ga0157375_10110808 | 3300013308 | Bacteria | 2843 |
| 211 | Ga0163163_12374153 | 3300014325 | Bacteria | 589 |
| 212 | Ga0157380_10058979 | 3300014326 | Bacteria | 3061 |
| 213 | Ga0157380_10161348 | 3300014326 | Bacteria | 1949 |
| 214 | Ga0182008_10201802 | 3300014497 | Bacteria | 1012 |
| 215 | Ga0157377_10095360 | 3300014745 | Bacteria | 1763 |
| 216 | Ga0157377_10410938 | 3300014745 | Bacteria | 924 |
| 217 | Ga0157376_10577375 | 3300014969 | Bacteria | 1116 |
| 218 | Ga0157376_10760363 | 3300014969 | Bacteria | 979 |
| 219 | Ga0182006_1000008 | 3300015261 | Bacteria | 449652 |
| 220 | Ga0182006_1005802 | 3300015261 | Bacteria | 5819 |
| 221 | Ga0182007_10012607 | 3300015262 | Bacteria | 3246 |
| 222 | Ga0182005_1000008 | 3300015265 | Bacteria | 471394 |
| 223 | Ga0182005_1000337 | 3300015265 | Bacteria | 27196 |
| 224 | Ga0213872_10000148 | 3300021361 | Bacteria | 64199 |
| 225 | Ga0213872_10010316 | 3300021361 | Bacteria | 4450 |
| 226 | Ga0213872_10073827 | 3300021361 | Bacteria | 1536 |
| 227 | Ga0213875_10014593 | 3300021388 | Unclassified | 3830 |
| 228 | Ga0209435_100015 | 3300025206 | Bacteria | 321177 |
| 229 | Ga0209435_100162 | 3300025206 | Bacteria | 21364 |
| 230 | Ga0209760_101080 | 3300025207 | Bacteria | 3139 |
| 231 | Ga0209784_100004 | 3300025224 | Bacteria | 1378156 |
| 232 | Ga0209784_100009 | 3300025224 | Bacteria | 688031 |
| 233 | Ga0209566_100004 | 3300025225 | Bacteria | 1531866 |
| 234 | Ga0209566_100007 | 3300025225 | Bacteria | 688031 |
| 235 | Ga0209674_100006 | 3300025226 | Bacteria | 1531866 |
| 236 | Ga0209674_100018 | 3300025226 | Bacteria | 688031 |
| 237 | Ga0209672_106477 | 3300025228 | Bacteria | 1895 |
| 238 | Ga0209147_100004 | 3300025229 | Bacteria | 1371850 |
| 239 | Ga0209563_100009 | 3300025230 | Bacteria | 1378156 |
| 240 | Ga0209563_100020 | 3300025230 | Bacteria | 688031 |
| 241 | Ga0207427_100514 | 3300025231 | Bacteria | 20525 |
| 242 | Ga0209437_100004 | 3300025233 | Bacteria | 1378156 |
| 243 | Ga0209437_100045 | 3300025233 | Bacteria | 429809 |
| 244 | Ga0209437_101546 | 3300025233 | Bacteria | 5379 |
| 245 | Ga0209258_100226 | 3300025242 | Bacteria | 106588 |
| 246 | Ga0207425_1001395 | 3300025245 | Bacteria | 10198 |
| 247 | Ga0207425_1001773 | 3300025245 | Bacteria | 8388 |
| 248 | Ga0209646_1000020 | 3300025246 | Bacteria | 462204 |
| 249 | Ga0209646_1000040 | 3300025246 | Bacteria | 347867 |
| 250 | Ga0209646_1000252 | 3300025246 | Bacteria | 53546 |
| 251 | Ga0209026_1000034 | 3300025250 | Bacteria | 306953 |
| 252 | Ga0209677_100005 | 3300025253 | Bacteria | 1378156 |
| 253 | Ga0209677_100010 | 3300025253 | Bacteria | 688031 |
| 254 | Ga0209148_1025257 | 3300025254 | Bacteria | 931 |
| 255 | Ga0209759_1000049 | 3300025256 | Bacteria | 221692 |
| 256 | Ga0209759_1000809 | 3300025256 | Bacteria | 25105 |
| 257 | Ga0209129_1000025 | 3300025258 | Bacteria | 413639 |
| 258 | Ga0209233_1000005 | 3300025261 | Bacteria | 1531866 |
| 259 | Ga0209565_1000003 | 3300025263 | Bacteria | 1099648 |
| 260 | Ga0209565_1005211 | 3300025263 | Bacteria | 3813 |
| 261 | Ga0209455_1000026 | 3300025272 | Bacteria | 653778 |
| 262 | Ga0209455_1002265 | 3300025272 | Bacteria | 7569 |
| 263 | Ga0209673_1000003 | 3300025273 | Bacteria | 980859 |
| 264 | Ga0209673_1014092 | 3300025273 | Bacteria | 3114 |
| 265 | Ga0209130_1000046 | 3300025284 | Bacteria | 236658 |
| 266 | Ga0209675_1000003 | 3300025291 | Bacteria | 1003982 |
| 267 | Ga0209564_1000002 | 3300025295 | Bacteria | 1636803 |
| 268 | Ga0209564_1000012 | 3300025295 | Bacteria | 792078 |
| 269 | Ga0209564_1000039 | 3300025295 | Bacteria | 413604 |
| 270 | Ga0209758_1000196 | 3300025297 | Bacteria | 133816 |
| 271 | Ga0209758_1000679 | 3300025297 | Bacteria | 50729 |
| 272 | Ga0209050_1004618 | 3300025298 | Bacteria | 9193 |
| 273 | Ga0209256_1000007 | 3300025299 | Bacteria | 1136599 |
| 274 | Ga0209256_1000112 | 3300025299 | Bacteria | 178432 |
| 275 | Ga0209256_1018225 | 3300025299 | Bacteria | 2294 |
| 276 | Ga0209051_1012288 | 3300025303 | Bacteria | 4151 |
| 277 | Ga0209051_1017173 | 3300025303 | Bacteria | 3242 |
| 278 | Ga0209257_1000094 | 3300025304 | Bacteria | 262243 |
| 279 | Ga0209257_1009045 | 3300025304 | Bacteria | 5456 |
| 280 | Ga0207697_10056774 | 3300025315 | Bacteria | 1624 |
| 281 | Ga0207653_10331764 | 3300025885 | Bacteria | 593 |
| 282 | Ga0207682_10023671 | 3300025893 | Bacteria | 2428 |
| 283 | Ga0207642_10137133 | 3300025899 | Bacteria | 1285 |
| 284 | Ga0207642_10146883 | 3300025899 | Bacteria | 1250 |
| 285 | Ga0207710_10001706 | 3300025900 | Bacteria | 10650 |
| 286 | Ga0207688_10200881 | 3300025901 | Bacteria | 1195 |
| 287 | Ga0207680_10398496 | 3300025903 | Bacteria | 972 |
| 288 | Ga0207699_10037289 | 3300025906 | Bacteria | 2778 |
| 289 | Ga0207645_10000134 | 3300025907 | Bacteria | 56602 |
| 290 | Ga0207645_10383556 | 3300025907 | Bacteria | 944 |
| 291 | Ga0207643_10256150 | 3300025908 | Bacteria | 1079 |
| 292 | Ga0207707_10065503 | 3300025912 | Bacteria | 3165 |
| 293 | Ga0207707_10390168 | 3300025912 | Bacteria | 1196 |
| 294 | Ga0207695_10001039 | 3300025913 | Bacteria | 48767 |
| 295 | Ga0207695_10116269 | 3300025913 | Bacteria | 2648 |
| 296 | Ga0207671_10026866 | 3300025914 | Bacteria | 4306 |
| 297 | Ga0207671_10086655 | 3300025914 | Bacteria | 2354 |
| 298 | Ga0207693_10005621 | 3300025915 | Bacteria | 10426 |
| 299 | Ga0207693_10072058 | 3300025915 | Bacteria | 2705 |
| 300 | Ga0207663_10423632 | 3300025916 | Bacteria | 1022 |
| 301 | Ga0207660_10020287 | 3300025917 | Bacteria | 4456 |
| 302 | Ga0207662_10011397 | 3300025918 | Bacteria | 4931 |
| 303 | Ga0207657_10026089 | 3300025919 | Bacteria | 5376 |
| 304 | Ga0207657_10028740 | 3300025919 | Bacteria | 5067 |
| 305 | Ga0207649_10019348 | 3300025920 | Bacteria | 3890 |
| 306 | Ga0207649_10057169 | 3300025920 | Bacteria | 2438 |
| 307 | Ga0207649_10332933 | 3300025920 | Bacteria | 1119 |
| 308 | Ga0207652_10357425 | 3300025921 | Bacteria | 1318 |
| 309 | Ga0207681_10031585 | 3300025923 | Bacteria | 3460 |
| 310 | Ga0207681_10097888 | 3300025923 | Bacteria | 2109 |
| 311 | Ga0207650_10187755 | 3300025925 | Bacteria | 1650 |
| 312 | Ga0207659_10146090 | 3300025926 | Bacteria | 1841 |
| 313 | Ga0207659_10261465 | 3300025926 | Bacteria | 1408 |
| 314 | Ga0207687_10118563 | 3300025927 | Bacteria | 1976 |
| 315 | Ga0207644_10285643 | 3300025931 | Bacteria | 1326 |
| 316 | Ga0207644_10481033 | 3300025931 | Bacteria | 1023 |
| 317 | Ga0207690_10089316 | 3300025932 | Bacteria | 2172 |
| 318 | Ga0207690_10137951 | 3300025932 | Bacteria | 1793 |
| 319 | Ga0207706_10000433 | 3300025933 | Bacteria | 44824 |
| 320 | Ga0207706_10015176 | 3300025933 | Bacteria | 6971 |
| 321 | Ga0207706_10096028 | 3300025933 | Bacteria | 2606 |
| 322 | Ga0207706_10177454 | 3300025933 | Bacteria | 1871 |
| 323 | Ga0207686_10268853 | 3300025934 | Bacteria | 1253 |
| 324 | Ga0207709_10036278 | 3300025935 | Bacteria | 2921 |
| 325 | Ga0207709_10092398 | 3300025935 | Bacteria | 1981 |
| 326 | Ga0207670_10002879 | 3300025936 | Bacteria | 9078 |
| 327 | Ga0207669_10481241 | 3300025937 | Bacteria | 989 |
| 328 | Ga0207704_10222176 | 3300025938 | Bacteria | 1398 |
| 329 | Ga0207665_10156836 | 3300025939 | Bacteria | 1634 |
| 330 | Ga0207691_10002432 | 3300025940 | Bacteria | 18214 |
| 331 | Ga0207691_10569018 | 3300025940 | Bacteria | 960 |
| 332 | Ga0207711_10373407 | 3300025941 | Bacteria | 1323 |
| 333 | Ga0207689_10056609 | 3300025942 | Bacteria | 3227 |
| 334 | Ga0207689_10140401 | 3300025942 | Bacteria | 1990 |
| 335 | Ga0207689_10287631 | 3300025942 | Bacteria | 1361 |
| 336 | Ga0207689_10554411 | 3300025942 | Bacteria | 965 |
| 337 | Ga0207661_11140707 | 3300025944 | Bacteria | 718 |
| 338 | Ga0207679_10002243 | 3300025945 | Bacteria | 11939 |
| 339 | Ga0207679_10083987 | 3300025945 | Bacteria | 2443 |
| 340 | Ga0207667_10000191 | 3300025949 | Bacteria | 89641 |
| 341 | Ga0207667_10030385 | 3300025949 | Bacteria | 5846 |
| 342 | Ga0207667_11033363 | 3300025949 | Bacteria | 808 |
| 343 | Ga0207651_10024042 | 3300025960 | Bacteria | 3760 |
| 344 | Ga0207668_10116878 | 3300025972 | Bacteria | 2012 |
| 345 | Ga0207668_10148139 | 3300025972 | Bacteria | 1814 |
| 346 | Ga0207640_10056394 | 3300025981 | Bacteria | 2578 |
| 347 | Ga0207640_10095662 | 3300025981 | Bacteria | 2069 |
| 348 | Ga0207677_10047475 | 3300026023 | Bacteria | 2883 |
| 349 | Ga0207677_10367241 | 3300026023 | Bacteria | 1211 |
| 350 | Ga0207639_10346594 | 3300026041 | Bacteria | 1325 |
| 351 | Ga0207639_10740501 | 3300026041 | Bacteria | 914 |
| 352 | Ga0207678_10029766 | 3300026067 | Bacteria | 4767 |
| 353 | Ga0207708_10063368 | 3300026075 | Bacteria | 2824 |
| 354 | Ga0207702_10979350 | 3300026078 | Bacteria | 839 |
| 355 | Ga0207648_10003400 | 3300026089 | Bacteria | 16699 |
| 356 | Ga0207676_11277466 | 3300026095 | Bacteria | 728 |
| 357 | Ga0207676_11328372 | 3300026095 | Bacteria | 714 |
| 358 | Ga0207674_10117691 | 3300026116 | Bacteria | 2628 |
| 359 | Ga0207674_10168123 | 3300026116 | Bacteria | 2146 |
| 360 | Ga0207674_10439864 | 3300026116 | Bacteria | 1260 |
| 361 | Ga0207674_10579583 | 3300026116 | Bacteria | 1084 |
| 362 | Ga0207675_100214009 | 3300026118 | Bacteria | 1855 |
| 363 | Ga0207675_100467947 | 3300026118 | Bacteria | 1251 |
| 364 | Ga0207683_10000036 | 3300026121 | Bacteria | 101173 |
| 365 | Ga0207683_10111179 | 3300026121 | Bacteria | 2453 |
| 366 | Ga0207698_10017930 | 3300026142 | Bacteria | 4813 |
| 367 | Ga0209281_1018100 | 3300027111 | Bacteria | 1416 |
| 368 | Ga0209969_1000834 | 3300027360 | Bacteria | 4145 |
| 369 | Ga0209967_1000395 | 3300027364 | Bacteria | 5757 |
| 370 | Ga0209981_1001350 | 3300027378 | Bacteria | 3104 |
| 371 | Ga0209996_1000010 | 3300027395 | Bacteria | 28392 |
| 372 | Ga0209984_1000348 | 3300027424 | Bacteria | 5117 |
| 373 | Ga0209984_1036081 | 3300027424 | Bacteria | 706 |
| 374 | Ga0210000_1000006 | 3300027462 | Bacteria | 37930 |
| 375 | Ga0209995_1000073 | 3300027471 | Bacteria | 16029 |
| 376 | Ga0209968_1000047 | 3300027526 | Bacteria | 21860 |
| 377 | Ga0209999_1000700 | 3300027543 | Bacteria | 5423 |
| 378 | Ga0209982_1001009 | 3300027552 | Bacteria | 3733 |
| 379 | Ga0209970_1010858 | 3300027614 | Bacteria | 1494 |
| 380 | Ga0210002_1000143 | 3300027617 | Bacteria | 10813 |
| 381 | Ga0209983_1018189 | 3300027665 | Bacteria | 1458 |
| 382 | Ga0209282_1000001 | 3300027666 | Bacteria | 2450367 |
| 383 | Ga0209971_1001389 | 3300027682 | Bacteria | 6017 |
| 384 | Ga0209971_1007112 | 3300027682 | Bacteria | 2653 |
| 385 | Ga0209966_1000182 | 3300027695 | Bacteria | 25722 |
| 386 | Ga0209998_10000014 | 3300027717 | Bacteria | 91397 |
| 387 | Ga0209813_10015447 | 3300027866 | Bacteria | 2069 |
| 388 | Ga0209974_10000725 | 3300027876 | Bacteria | 11270 |
| 389 | Ga0209974_10037638 | 3300027876 | Bacteria | 1606 |
| 390 | Ga0207428_10006054 | 3300027907 | Bacteria | 11180 |
| 391 | Ga0268266_10162728 | 3300028379 | Bacteria | 2020 |
| 392 | Ga0268265_10208410 | 3300028380 | Bacteria | 1701 |
| 393 | Ga0268264_10068360 | 3300028381 | Bacteria | 3002 |
| 394 | Ga0268264_10235932 | 3300028381 | Bacteria | 1692 |
| 395 | Ga0265334_10004043 | 3300028573 | Bacteria | 6577 |
| 396 | Ga0265318_10006926 | 3300028577 | Bacteria | 5167 |
| 397 | Ga0307517_10104341 | 3300028786 | Bacteria | 2209 |
| 398 | Ga0307517_10132307 | 3300028786 | Bacteria | 1790 |
| 399 | Ga0307515_10000416 | 3300028794 | Bacteria | 102535 |
| 400 | Ga0307515_10021948 | 3300028794 | Bacteria | 11287 |
| 401 | Ga0307515_10035905 | 3300028794 | Bacteria | 8043 |
| 402 | Ga0307515_10084784 | 3300028794 | Bacteria | 4063 |
| 403 | Ga0307515_10277025 | 3300028794 | Bacteria | 1390 |
| 404 | Ga0265338_10165091 | 3300028800 | Bacteria | 1705 |
| 405 | Ga0265330_10142497 | 3300031235 | Bacteria | 1019 |
| 406 | Ga0265328_10031773 | 3300031239 | Bacteria | 1961 |
| 407 | Ga0265328_10075933 | 3300031239 | Bacteria | 1237 |
| 408 | Ga0265320_10028158 | 3300031240 | Bacteria | 2920 |
| 409 | Ga0265325_10051280 | 3300031241 | Bacteria | 2122 |
| 410 | Ga0265325_10054658 | 3300031241 | Bacteria | 2043 |
| 411 | Ga0265329_10077120 | 3300031242 | Bacteria | 1055 |
| 412 | Ga0265329_10094644 | 3300031242 | Bacteria | 949 |
| 413 | Ga0265339_10310121 | 3300031249 | Bacteria | 751 |
| 414 | Ga0265331_10007350 | 3300031250 | Bacteria | 6382 |
| 415 | Ga0265331_10009455 | 3300031250 | Bacteria | 5471 |
| 416 | Ga0265331_10058777 | 3300031250 | Bacteria | 1819 |
| 417 | Ga0265327_10000043 | 3300031251 | Bacteria | 285108 |
| 418 | Ga0265327_10000271 | 3300031251 | Bacteria | 102433 |
| 419 | Ga0265327_10002604 | 3300031251 | Bacteria | 18671 |
| 420 | Ga0265327_10093622 | 3300031251 | Bacteria | 1461 |
| 421 | Ga0265316_10063161 | 3300031344 | Bacteria | 2872 |
| 422 | Ga0307513_10189608 | 3300031456 | Bacteria | 1909 |
| 423 | Ga0265313_10000626 | 3300031595 | Bacteria | 36567 |
| 424 | Ga0265313_10008190 | 3300031595 | Bacteria | 6984 |
| 425 | Ga0307508_10000017 | 3300031616 | Bacteria | 203567 |
| 426 | Ga0307508_10048900 | 3300031616 | Bacteria | 3767 |
| 427 | Ga0307514_10015317 | 3300031649 | Bacteria | 6332 |
| 428 | Ga0265314_10032855 | 3300031711 | Bacteria | 3812 |
| 429 | Ga0265342_10135376 | 3300031712 | Bacteria | 1377 |
| 430 | Ga0307516_10000525 | 3300031730 | Bacteria | 51244 |
| 431 | Ga0307516_10002317 | 3300031730 | Bacteria | 25638 |
| 432 | Ga0307516_10085138 | 3300031730 | Bacteria | 2999 |
| 433 | Ga0307516_10252822 | 3300031730 | Bacteria | 1456 |
| 434 | Ga0307516_10606732 | 3300031730 | Bacteria | 749 |
| 435 | Ga0307416_100434064 | 3300032002 | Bacteria | 1361 |
| 436 | Ga0307416_100749548 | 3300032002 | Unclassified | 1069 |
| 437 | Ga0307510_10003830 | 3300033180 | Bacteria | 17622 |
| 438 | Ga0307510_10276015 | 3300033180 | Bacteria | 1154 |
| 439 | Ga0373950_0049933 | 3300034818 | Bacteria | 820 |
| 440 | Ga0373926_0008497 | 3300035083 | Bacteria | 3417 |
| 441 | Ga0373934_0056179 | 3300035086 | Bacteria | 1565 |
| 442 | Ga0373934_0116308 | 3300035086 | Bacteria | 1086 |
| 443 | Ga0373951_0029924 | 3300035091 | Bacteria | 1280 |
| 444 | Ga0373923_0007533 | 3300035111 | Bacteria | 3832 |
| 445 | Ga0373932_0028610 | 3300035112 | Bacteria | 1533 |
| 446 | Ga0373936_0005299 | 3300035113 | Bacteria | 4853 |
| 447 | Ga0373939_0103885 | 3300035114 | Bacteria | 979 |
| 448 | Ga0373941_0134973 | 3300035115 | Bacteria | 892 |
| 449 | Ga0373945_0040048 | 3300035116 | Bacteria | 1691 |
| 450 | Ga0373953_0005871 | 3300035117 | Bacteria | 4011 |
| 451 | Ga0373954_0008316 | 3300035118 | Bacteria | 4552 |
| 452 | Ga0373956_0397291 | 3300035119 | Bacteria | 657 |
| 453 | Ga0373957_0062062 | 3300035120 | Bacteria | 1449 |
| 454 | Ga0373946_0107196 | 3300035171 | Bacteria | 1260 |
| 455 | Ga0373961_0033076 | 3300035241 | Bacteria | 1454 |
| 456 | Ga0373962_0068642 | 3300035242 | Bacteria | 1055 |
| 457 | Ga0373931_0035473 | 3300035691 | Bacteria | 2594 |
| 458 | Ga0373931_0430578 | 3300035691 | Bacteria | 840 |
| 459 | Ga0373935_0089927 | 3300035692 | Bacteria | 2008 |
| 460 | Ga0373927_0009046 | 3300035695 | Bacteria | 6686 |
| 461 | Ga0373933_0347978 | 3300035724 | Bacteria | 962 |
| 462 | Ga0373933_0776497 | 3300035724 | Bacteria | 630 |
| 463 | Ga0373937_0116818 | 3300036401 | Bacteria | 2484 |
| 464 | Ga0316582_0325899 | 3300036647 | Bacteria | 1056 |
| 465 | Ga0373925_0196552 | 3300037068 | Bacteria | 1602 |
| 466 | Ga0373925_0466471 | 3300037068 | Bacteria | 1035 |
| 467 | Ga0395899_0002847 | 3300037312 | Bacteria | 13928 |
| 468 | Ga0395899_0037721 | 3300037312 | Bacteria | 3622 |
| 469 | Ga0395899_0096847 | 3300037312 | Bacteria | 2133 |
| 470 | Ga0395899_0782235 | 3300037312 | Bacteria | 591 |
| 471 | Ga0395900_0022865 | 3300037418 | Bacteria | 6397 |
| 472 | Ga0395900_0155446 | 3300037418 | Bacteria | 2336 |
| 473 | Ga0395900_0171095 | 3300037418 | Bacteria | 2211 |
| 474 | Ga0395900_1620362 | 3300037418 | Bacteria | 558 |
| 475 | Ga0395898_0009320 | 3300037466 | Bacteria | 10318 |
| 476 | Ga0395905_0000002 | 3300037471 | Bacteria | 1356358 |
| 477 | Ga0395905_0000869 | 3300037471 | Bacteria | 39396 |
| 478 | Ga0395905_0029166 | 3300037471 | Bacteria | 5200 |
| 479 | Ga0395905_0040982 | 3300037471 | Bacteria | 4344 |
| 480 | Ga0395905_0167165 | 3300037471 | Bacteria | 2067 |
| 481 | Ga0395905_1093919 | 3300037471 | Bacteria | 700 |
| 482 | Ga0395905_1300301 | 3300037471 | Bacteria | 631 |
| 483 | Ga0436364_0372099 | 3300037853 | Bacteria | 8414 |
| 484 | Ga0395901_0041924 | 3300038443 | Bacteria | 4744 |
| 485 | Ga0395901_0172459 | 3300038443 | Bacteria | 2269 |
| 486 | Ga0395901_0196471 | 3300038443 | Bacteria | 2115 |
| 487 | Ga0395901_0517295 | 3300038443 | Bacteria | 1213 |
| 488 | Ga0436361_0243249 | 3300039447 | Bacteria | 2160 |
| 489 | Ga0436361_0249401 | 3300039447 | Bacteria | 41096 |
| 490 | Ga0436361_0838192 | 3300039447 | Bacteria | 788 |
| 491 | Ga0436361_1039366 | 3300039447 | Bacteria | 2368 |
| 492 | Ga0436363_1301619 | 3300039450 | Bacteria | 1061 |
| 493 | Ga0439465_0278065 | 3300041413 | Bacteria | 623 |
| 494 | Ga0451791_1555694 | 3300041451 | Bacteria | 819 |
| 495 | Ga0451802_0815355 | 3300041460 | Bacteria | 1727 |
| 496 | Ga0451802_1186193 | 3300041460 | Bacteria | 1191 |
| 497 | Ga0451807_0139676 | 3300041486 | Bacteria | 1435 |
| 498 | Ga0451839_0386240 | 3300041496 | Bacteria | 909 |
| 499 | Ga0451845_0164688 | 3300041501 | Bacteria | 936 |
| 500 | Ga0451849_1555721 | 3300041505 | Bacteria | 958 |
| 501 | Ga0439445_0097801 | 3300042004 | Bacteria | 831 |
| 502 | Ga0439450_089257 | 3300042008 | Unclassified | 773 |
| 503 | Ga0439455_0040202 | 3300042012 | Bacteria | 1195 |
| 504 | Ga0450891_012751 | 3300042129 | Bacteria | 785 |
| 505 | Ga0439446_0002656 | 3300042156 | Bacteria | 4319 |
| 506 | Ga0439464_0084663 | 3300042439 | Bacteria | 950 |
| 507 | Ga0466969_0002272 | 3300044656 | Bacteria | 10265 |
| 508 | Ga0466969_0098779 | 3300044656 | Bacteria | 1376 |
| 509 | Ga0466972_0000201 | 3300044658 | Bacteria | 43791 |
| 510 | Ga0466977_0003980 | 3300044666 | Bacteria | 7341 |
| 511 | Ga0453683_0132239 | 3300044673 | Bacteria | 1573 |
| 512 | Ga0466965_0018249 | 3300044683 | Bacteria | 3361 |
| 513 | Ga0466966_0011912 | 3300044684 | Bacteria | 5764 |
| 514 | Ga0466961_0000346 | 3300044693 | Bacteria | 30296 |
| 515 | Ga0466964_0300272 | 3300044706 | Bacteria | 809 |
| 516 | Ga0453684_0006580 | 3300044712 | Bacteria | 21987 |
| 517 | Ga0466970_0123792 | 3300044765 | Bacteria | 1417 |
| 518 | Ga0466959_0010291 | 3300045049 | Bacteria | 6680 |
| 519 | Ga0451576_0001125 | 3300045051 | Bacteria | 48618 |
| 520 | Ga0451576_0067655 | 3300045051 | Bacteria | 3718 |
| 521 | Ga0451576_0126051 | 3300045051 | Bacteria | 2668 |
| 522 | Ga0451576_0420271 | 3300045051 | Bacteria | 1402 |
| 523 | Ga0466958_0172756 | 3300045836 | Bacteria | 1369 |
| 524 | Ga0466967_0352374 | 3300045976 | Bacteria | 1425 |
| 525 | Ga0495617_000013 | 3300046452 | Bacteria | 290031 |
| 526 | Ga0495617_005003 | 3300046452 | Bacteria | 4761 |
| 527 | Ga0495627_000001 | 3300046453 | Bacteria | 1104709 |
| 528 | Ga0495592_0001331 | 3300046454 | Bacteria | 17151 |
| 529 | Ga0495592_0009127 | 3300046454 | Bacteria | 7461 |
| 530 | Ga0495590_0000016 | 3300046457 | Bacteria | 225874 |
| 531 | Ga0495590_0001068 | 3300046457 | Bacteria | 12077 |
| 532 | Ga0495590_0061628 | 3300046457 | Bacteria | 1313 |
| 533 | Ga0495629_0080697 | 3300046459 | Bacteria | 2271 |
| 534 | Ga0495638_0000057 | 3300046460 | Bacteria | 193690 |
| 535 | Ga0495638_0021068 | 3300046460 | Bacteria | 4300 |
| 536 | Ga0495638_0048429 | 3300046460 | Bacteria | 2660 |
| 537 | Ga0495638_0121115 | 3300046460 | Bacteria | 1546 |
| 538 | Ga0495641_0017077 | 3300046461 | Bacteria | 3795 |
| 539 | Ga0495651_0001603 | 3300046462 | Bacteria | 17498 |
| 540 | Ga0495651_0071910 | 3300046462 | Bacteria | 2629 |
| 541 | Ga0495651_0852830 | 3300046462 | Bacteria | 559 |
| 542 | Ga0495653_0000025 | 3300046463 | Bacteria | 160471 |
| 543 | Ga0495653_0006798 | 3300046463 | Bacteria | 9394 |
| 544 | Ga0495653_0009105 | 3300046463 | Bacteria | 8118 |
| 545 | Ga0495653_0031742 | 3300046463 | Bacteria | 4197 |
| 546 | Ga0495650_0000024 | 3300046471 | Bacteria | 496674 |
| 547 | Ga0495650_0000289 | 3300046471 | Bacteria | 93255 |
| 548 | Ga0495650_0002136 | 3300046471 | Bacteria | 16820 |
| 549 | Ga0495650_0031013 | 3300046471 | Bacteria | 2412 |
| 550 | Ga0495580_0039205 | 3300046472 | Bacteria | 3389 |
| 551 | Ga0495582_0115326 | 3300046473 | Bacteria | 1510 |
| 552 | Ga0495605_0087347 | 3300046474 | Bacteria | 1450 |
| 553 | Ga0495605_0121416 | 3300046474 | Bacteria | 1184 |
| 554 | Ga0495639_0017786 | 3300046475 | Bacteria | 3089 |
| 555 | Ga0495639_0037756 | 3300046475 | Bacteria | 2166 |
| 556 | Ga0495664_0030191 | 3300046477 | Bacteria | 3174 |
| 557 | Ga0495584_0204662 | 3300046491 | Bacteria | 1003 |
| 558 | Ga0495585_0007022 | 3300046492 | Bacteria | 6933 |
| 559 | Ga0495585_0019035 | 3300046492 | Bacteria | 3962 |
| 560 | Ga0495594_0024049 | 3300046499 | Bacteria | 3269 |
| 561 | Ga0495607_0014033 | 3300046501 | Bacteria | 5230 |
| 562 | Ga0495607_0017745 | 3300046501 | Bacteria | 4556 |
| 563 | Ga0495583_0000688 | 3300046506 | Bacteria | 43737 |
| 564 | Ga0495583_0007041 | 3300046506 | Bacteria | 7189 |
| 565 | Ga0495583_0049408 | 3300046506 | Bacteria | 1927 |
| 566 | Ga0495606_0000087 | 3300046507 | Bacteria | 156407 |
| 567 | Ga0495606_0000137 | 3300046507 | Bacteria | 124670 |
| 568 | Ga0495606_0000197 | 3300046507 | Bacteria | 105038 |
| 569 | Ga0495606_0000573 | 3300046507 | Bacteria | 58366 |
| 570 | Ga0495606_0021465 | 3300046507 | Bacteria | 4729 |
| 571 | Ga0495608_0008467 | 3300046511 | Bacteria | 7205 |
| 572 | Ga0495608_0042836 | 3300046511 | Bacteria | 3026 |
| 573 | Ga0495608_0177879 | 3300046511 | Bacteria | 1347 |
| 574 | Ga0495608_0424356 | 3300046511 | Bacteria | 811 |
| 575 | Ga0495610_0000008 | 3300046512 | Bacteria | 622732 |
| 576 | Ga0495610_0000411 | 3300046512 | Bacteria | 43910 |
| 577 | Ga0495610_0001341 | 3300046512 | Bacteria | 21846 |
| 578 | Ga0495610_0003847 | 3300046512 | Bacteria | 11408 |
| 579 | Ga0495610_0005455 | 3300046512 | Bacteria | 9030 |
| 580 | Ga0495610_0074022 | 3300046512 | Bacteria | 1581 |
| 581 | Ga0495610_0160319 | 3300046512 | Bacteria | 951 |
| 582 | Ga0495616_0024731 | 3300046513 | Bacteria | 3217 |
| 583 | Ga0495618_0039205 | 3300046514 | Bacteria | 2978 |
| 584 | Ga0495618_0142683 | 3300046514 | Bacteria | 1531 |
| 585 | Ga0495618_0180863 | 3300046514 | Bacteria | 1340 |
| 586 | Ga0495620_0038664 | 3300046515 | Bacteria | 2116 |
| 587 | Ga0495628_0003637 | 3300046516 | Bacteria | 13765 |
| 588 | Ga0495628_0004029 | 3300046516 | Bacteria | 13083 |
| 589 | Ga0495628_0023659 | 3300046516 | Bacteria | 5039 |
| 590 | Ga0495628_0042761 | 3300046516 | Bacteria | 3612 |
| 591 | Ga0495628_0117695 | 3300046516 | Bacteria | 2040 |
| 592 | Ga0495628_0306639 | 3300046516 | Bacteria | 1174 |
| 593 | Ga0495630_0215379 | 3300046517 | Bacteria | 1466 |
| 594 | Ga0495630_0224436 | 3300046517 | Bacteria | 1434 |
| 595 | Ga0495631_0005213 | 3300046518 | Bacteria | 6845 |
| 596 | Ga0495631_0260269 | 3300046518 | Bacteria | 739 |
| 597 | Ga0495632_0079055 | 3300046519 | Bacteria | 1570 |
| 598 | Ga0495637_0027701 | 3300046520 | Bacteria | 2532 |
| 599 | Ga0495637_0079617 | 3300046520 | Bacteria | 1308 |
| 600 | Ga0495643_0000236 | 3300046522 | Bacteria | 83225 |
| 601 | Ga0495643_0000289 | 3300046522 | Bacteria | 71822 |
| 602 | Ga0495643_0038221 | 3300046522 | Bacteria | 2629 |
| 603 | Ga0495644_0030618 | 3300046523 | Bacteria | 2032 |
| 604 | Ga0495648_0000002 | 3300046524 | Bacteria | 593972 |
| 605 | Ga0495648_0000029 | 3300046524 | Bacteria | 223499 |
| 606 | Ga0495648_0011919 | 3300046524 | Bacteria | 6521 |
| 607 | Ga0495648_0014417 | 3300046524 | Bacteria | 5788 |
| 608 | Ga0495648_0103863 | 3300046524 | Bacteria | 1561 |
| 609 | Ga0495666_0032341 | 3300046526 | Bacteria | 2560 |
| 610 | Ga0495666_0520350 | 3300046526 | Bacteria | 531 |
| 611 | Ga0495642_0003652 | 3300046528 | Bacteria | 6045 |
| 612 | Ga0495642_0003770 | 3300046528 | Bacteria | 5935 |
| 613 | Ga0495642_0318785 | 3300046528 | Bacteria | 682 |
| 614 | Ga0495652_0004166 | 3300046529 | Bacteria | 13940 |
| 615 | Ga0495652_0009851 | 3300046529 | Bacteria | 8661 |
| 616 | Ga0495652_0167549 | 3300046529 | Bacteria | 1698 |
| 617 | Ga0495652_0509591 | 3300046529 | Bacteria | 833 |
| 618 | Ga0495654_0000226 | 3300046530 | Bacteria | 52630 |
| 619 | Ga0495654_0031792 | 3300046530 | Bacteria | 2678 |
| 620 | Ga0495665_0039110 | 3300046531 | Bacteria | 2527 |
| 621 | Ga0495640_0006764 | 3300046533 | Bacteria | 9046 |
| 622 | Ga0495586_0005800 | 3300046535 | Bacteria | 6603 |
| 623 | Ga0495586_0096953 | 3300046535 | Bacteria | 1633 |
| 624 | Ga0495598_0166461 | 3300046537 | Bacteria | 779 |
| 625 | Ga0495609_0000142 | 3300046538 | Bacteria | 75002 |
| 626 | Ga0495609_0022634 | 3300046538 | Bacteria | 2894 |
| 627 | Ga0495609_0085568 | 3300046538 | Bacteria | 1375 |
| 628 | Ga0495609_0087897 | 3300046538 | Bacteria | 1353 |
| 629 | Ga0495621_0007826 | 3300046539 | Bacteria | 3177 |
| 630 | Ga0495597_0000025 | 3300046542 | Bacteria | 142649 |
| 631 | Ga0495597_0000848 | 3300046542 | Bacteria | 24046 |
| 632 | Ga0495597_0002887 | 3300046542 | Bacteria | 10479 |
| 633 | Ga0495597_0004543 | 3300046542 | Bacteria | 7594 |
| 634 | Ga0495597_0085573 | 3300046542 | Bacteria | 1343 |
| 635 | Ga0495597_0199453 | 3300046542 | Bacteria | 802 |
| 636 | Ga0495645_0003192 | 3300046543 | Bacteria | 11110 |
| 637 | Ga0495645_0118995 | 3300046543 | Bacteria | 1861 |
| 638 | Ga0495645_0124023 | 3300046543 | Bacteria | 1816 |
| 639 | Ga0495645_0593444 | 3300046543 | Bacteria | 682 |
| 640 | Ga0495622_0000816 | 3300046557 | Bacteria | 17235 |
| 641 | Ga0495633_0000073 | 3300046558 | Bacteria | 130286 |
| 642 | Ga0495633_0000399 | 3300046558 | Bacteria | 45392 |
| 643 | Ga0495667_0021617 | 3300046559 | Bacteria | 4341 |
| 644 | Ga0495656_0160361 | 3300046615 | Bacteria | 1093 |
| 645 | Ga0495668_0000020 | 3300046616 | Bacteria | 411641 |
| 646 | Ga0495668_0000083 | 3300046616 | Bacteria | 153471 |
| 647 | Ga0495668_0000132 | 3300046616 | Bacteria | 112674 |
| 648 | Ga0495668_0002007 | 3300046616 | Bacteria | 17796 |
| 649 | Ga0495668_0011331 | 3300046616 | Bacteria | 5347 |
| 650 | Ga0495668_0101145 | 3300046616 | Bacteria | 1577 |
| 651 | Ga0495634_0044238 | 3300046642 | Bacteria | 3014 |
| 652 | Ga0495625_0000177 | 3300046660 | Bacteria | 98918 |
| 653 | Ga0495625_0000398 | 3300046660 | Bacteria | 66474 |
| 654 | Ga0495625_0002519 | 3300046660 | Bacteria | 19715 |
| 655 | Ga0495625_0005727 | 3300046660 | Bacteria | 11236 |
| 656 | Ga0495625_0006383 | 3300046660 | Bacteria | 10514 |
| 657 | Ga0495625_0093220 | 3300046660 | Bacteria | 2079 |
| 658 | Ga0495625_0093397 | 3300046660 | Bacteria | 2077 |
| 659 | Ga0495625_0157726 | 3300046660 | Bacteria | 1522 |
| 660 | Ga0495635_0028001 | 3300046663 | Bacteria | 3918 |
| 661 | Ga0495659_0010327 | 3300046664 | Bacteria | 2992 |
| 662 | Ga0495661_0001089 | 3300046665 | Bacteria | 23858 |
| 663 | Ga0495661_0160929 | 3300046665 | Bacteria | 1205 |
| 664 | Ga0495599_0013823 | 3300046678 | Bacteria | 4994 |
| 665 | Ga0495599_0099917 | 3300046678 | Bacteria | 1808 |
| 666 | Ga0495599_0141046 | 3300046678 | Bacteria | 1495 |
| 667 | Ga0495623_0036186 | 3300046679 | Bacteria | 3164 |
| 668 | Ga0495623_0130966 | 3300046679 | Bacteria | 1502 |
| 669 | Ga0495623_0572068 | 3300046679 | Bacteria | 589 |
| 670 | Ga0495646_0035836 | 3300046680 | Bacteria | 3075 |
| 671 | Ga0495646_0133487 | 3300046680 | Bacteria | 1395 |
| 672 | Ga0495647_0004559 | 3300046681 | Bacteria | 4510 |
| 673 | Ga0495658_0065195 | 3300046683 | Bacteria | 2101 |
| 674 | Ga0495658_0326515 | 3300046683 | Bacteria | 973 |
| 675 | Ga0495669_0006738 | 3300046684 | Bacteria | 4808 |
| 676 | Ga0495613_0051783 | 3300046689 | Bacteria | 3025 |
| 677 | Ga0495613_0100713 | 3300046689 | Bacteria | 2086 |
| 678 | Ga0495624_0010151 | 3300046690 | Bacteria | 6493 |
| 679 | Ga0495624_0012877 | 3300046690 | Bacteria | 5708 |
| 680 | Ga0495670_0046542 | 3300046691 | Bacteria | 2167 |
| 681 | Ga0495671_0000002 | 3300046692 | Bacteria | 1136189 |
| 682 | Ga0495671_0151936 | 3300046692 | Bacteria | 1127 |
| 683 | Ga0495671_0172888 | 3300046692 | Bacteria | 1050 |
| 684 | Ga0495649_0004026 | 3300046694 | Bacteria | 9679 |
| 685 | Ga0495649_0011278 | 3300046694 | Bacteria | 5248 |
| 686 | Ga0495649_0056866 | 3300046694 | Bacteria | 2110 |
| 687 | Ga0495649_0112244 | 3300046694 | Bacteria | 1445 |
| 688 | Ga0495600_0000478 | 3300046809 | Bacteria | 20729 |
| 689 | Ga0495600_0003656 | 3300046809 | Bacteria | 9074 |
| 690 | Ga0495600_0099784 | 3300046809 | Bacteria | 1893 |
| 691 | Ga0495660_0000473 | 3300046810 | Bacteria | 33431 |
| 692 | Ga0495660_0001536 | 3300046810 | Bacteria | 15558 |
| 693 | Ga0495660_0042988 | 3300046810 | Bacteria | 2494 |
| 694 | Ga0495660_0106062 | 3300046810 | Bacteria | 1440 |
| 695 | Ga0495660_0300672 | 3300046810 | Bacteria | 727 |
| 696 | Ga0495604_0033684 | 3300047317 | Bacteria | 4054 |
| 697 | Ga0495604_0034831 | 3300047317 | Bacteria | 3980 |
| 698 | Ga0495604_0051203 | 3300047317 | Bacteria | 3202 |
| 699 | Ga0495672_0000291 | 3300047320 | Bacteria | 69062 |
| 700 | Ga0495672_0041061 | 3300047320 | Bacteria | 2801 |
| 701 | Ga0495680_0035304 | 3300047322 | Bacteria | 4028 |
| 702 | Ga0495680_0073112 | 3300047322 | Bacteria | 2606 |
| 703 | Ga0495687_000232 | 3300047443 | Bacteria | 77572 |
| 704 | Ga0495687_002232 | 3300047443 | Bacteria | 15990 |
| 705 | Ga0495687_003651 | 3300047443 | Bacteria | 10969 |
| 706 | Ga0495687_005190 | 3300047443 | Bacteria | 8420 |
| 707 | Ga0495687_012943 | 3300047443 | Bacteria | 4380 |
| 708 | Ga0495687_029520 | 3300047443 | Bacteria | 2536 |
| 709 | Ga0495675_0053079 | 3300047444 | Bacteria | 2573 |
| 710 | Ga0495679_018373 | 3300047446 | Bacteria | 2483 |
| 711 | Ga0495679_047697 | 3300047446 | Bacteria | 1298 |
| 712 | Ga0495685_006052 | 3300047447 | Bacteria | 3955 |
| 713 | Ga0495673_0000005 | 3300047469 | Bacteria | 943364 |
| 714 | Ga0495673_0000015 | 3300047469 | Bacteria | 598766 |
| 715 | Ga0495673_0000044 | 3300047469 | Bacteria | 283033 |
| 716 | Ga0495673_0000342 | 3300047469 | Bacteria | 58945 |
| 717 | Ga0495681_0021834 | 3300047470 | Bacteria | 3439 |
| 718 | Ga0495681_0089671 | 3300047470 | Bacteria | 1360 |
| 719 | Ga0495684_0025249 | 3300047471 | Bacteria | 4568 |
| 720 | Ga0495684_0882939 | 3300047471 | Bacteria | 577 |
| 721 | Ga0495686_0001836 | 3300047472 | Bacteria | 21329 |
| 722 | Ga0495686_0002827 | 3300047472 | Bacteria | 15707 |
| 723 | Ga0495686_0003434 | 3300047472 | Bacteria | 13744 |
| 724 | Ga0495686_0145250 | 3300047472 | Bacteria | 1397 |
| 725 | Ga0495593_0040204 | 3300047673 | Bacteria | 2518 |
| 726 | Ga0495602_0029056 | 3300048088 | Bacteria | 5277 |
| 727 | Ga0495602_0096376 | 3300048088 | Bacteria | 2440 |
| 728 | Ga0495614_0013697 | 3300048089 | Bacteria | 3557 |
| 729 | Ga0495614_0174881 | 3300048089 | Bacteria | 964 |
| 730 | Ga0495615_0040844 | 3300048090 | Bacteria | 1157 |
| 731 | Ga0495626_0073452 | 3300048091 | Bacteria | 1532 |
| 732 | Ga0496100_0172163 | 3300048903 | Bacteria | 1560 |
| 733 | Ga0496101_0158800 | 3300048904 | Bacteria | 1733 |
| 734 | Ga0496102_0000059 | 3300048905 | Bacteria | 168633 |
| 735 | Ga0496102_0643427 | 3300048905 | Bacteria | 983 |
| 736 | Ga0496103_0000063 | 3300048906 | Bacteria | 128503 |
| 737 | Ga0496104_1421106 | 3300048907 | Bacteria | 597 |
| 738 | Ga0496107_0521430 | 3300048910 | Bacteria | 881 |
| 739 | Ga0496109_1098920 | 3300048912 | Bacteria | 732 |
| 740 | Ga0496113_0378531 | 3300048916 | Bacteria | 1136 |
| 741 | Ga0496113_0455329 | 3300048916 | Bacteria | 1028 |
| 742 | Ga0496114_0077477 | 3300048917 | Bacteria | 2803 |
| 743 | Ga0496116_0206079 | 3300048919 | Bacteria | 1024 |
| 744 | Ga0496116_0250253 | 3300048919 | Bacteria | 883 |
| 745 | Ga0496117_0236371 | 3300048920 | Bacteria | 1006 |
| 746 | Ga0496117_0328193 | 3300048920 | Bacteria | 799 |
| 747 | Ga0496118_0066294 | 3300048921 | Bacteria | 2636 |
| 748 | Ga0496119_0075172 | 3300048922 | Bacteria | 1964 |
| 749 | Ga0496121_0015651 | 3300048924 | Bacteria | 7913 |
| 750 | Ga0496121_0042446 | 3300048924 | Bacteria | 3956 |
| 751 | Ga0496121_0360422 | 3300048924 | Bacteria | 965 |
| 752 | Ga0496121_0452610 | 3300048924 | Bacteria | 827 |
| 753 | Ga0496123_0023256 | 3300048926 | Bacteria | 4747 |
| 754 | Ga0496124_0094251 | 3300048927 | Bacteria | 2435 |
| 755 | Ga0496125_0000734 | 3300048928 | Bacteria | 54288 |
| 756 | Ga0496125_0004104 | 3300048928 | Bacteria | 17027 |
| 757 | Ga0496126_0156518 | 3300048929 | Bacteria | 1950 |
| 758 | Ga0495678_000002 | 3300049459 | Bacteria | 999613 |
| 759 | Ga0495678_000069 | 3300049459 | Bacteria | 131739 |
| 760 | Ga0495678_004395 | 3300049459 | Bacteria | 8172 |
| 761 | Ga0495678_067392 | 3300049459 | Bacteria | 1322 |
| 762 | Ga0495678_135256 | 3300049459 | Bacteria | 812 |
| 763 | Ga0495678_185638 | 3300049459 | Bacteria | 649 |
| 764 | Ga0501300_019001 | 3300049523 | Bacteria | 1004 |
| 765 | Ga0501209_000276 | 3300049656 | Bacteria | 6180 |
| 766 | Ga0501222_001905 | 3300049662 | Bacteria | 2891 |
| 767 | Ga0501222_016863 | 3300049662 | Bacteria | 967 |
| 768 | Ga0501227_009261 | 3300049665 | Bacteria | 2119 |
| 769 | Ga0501242_028684 | 3300049674 | Bacteria | 744 |
| 770 | Ga0501080_0280723 | 3300049742 | Bacteria | 1514 |
| 771 | Ga0501241_065884 | 3300049758 | Bacteria | 734 |
| 772 | Ga0501267_004127 | 3300049764 | Bacteria | 1341 |
| 773 | Ga0501279_001113 | 3300049775 | Bacteria | 3535 |
| 774 | nmdc:mga03683_13913_c1 | 3300050489 | Bacteria | 2968 |
| 775 | nmdc:mga03683_548786_c1 | 3300050489 | Bacteria | 562 |
| 776 | nmdc:mga03683_58940_c1 | 3300050489 | Bacteria | 1619 |
| 777 | nmdc:mga03683_8363_c1 | 3300050489 | Bacteria | 3636 |
| 778 | nmdc:mga03n38_40701_c1 | 3300050490 | Bacteria | 2021 |
| 779 | nmdc:mga00v17_19483_c1 | 3300050491 | Bacteria | 3874 |
| 780 | nmdc:mga00v17_71067_c1 | 3300050491 | Bacteria | 2157 |
| 781 | nmdc:mga0yw44_265632_c1 | 3300050492 | Bacteria | 1144 |
| 782 | nmdc:mga0k408_1519_c1 | 3300050493 | Bacteria | 12529 |
| 783 | nmdc:mga0k408_178250_c1 | 3300050493 | Bacteria | 1267 |
| 784 | nmdc:mga0k408_213381_c1 | 3300050493 | Bacteria | 1153 |
| 785 | nmdc:mga0k408_28421_c1 | 3300050493 | Bacteria | 3180 |
| 786 | nmdc:mga0k408_4551_c1 | 3300050493 | Bacteria | 7363 |
| 787 | nmdc:mga0k408_4876_c1 | 3300050493 | Bacteria | 7117 |
| 788 | nmdc:mga0k408_52416_c1 | 3300050493 | Bacteria | 2365 |
| 789 | nmdc:mga0k408_62704_c1 | 3300050493 | Bacteria | 2162 |
| 790 | nmdc:mga0k408_95774_c1 | 3300050493 | Bacteria | 1747 |
| 791 | nmdc:mga06z11_15377_c1 | 3300050494 | Bacteria | 3415 |
| 792 | nmdc:mga06z11_62243_c1 | 3300050494 | Bacteria | 1949 |
| 793 | nmdc:mga04h51_5040_c1 | 3300050495 | Bacteria | 3339 |
| 794 | nmdc:mga07m45_164752_c1 | 3300050496 | Bacteria | 1288 |
| 795 | nmdc:mga07m45_23515_c1 | 3300050496 | Bacteria | 3369 |
| 796 | nmdc:mga07m45_474_c1 | 3300050496 | Bacteria | 16977 |
| 797 | nmdc:mga07m45_73561_c1 | 3300050496 | Bacteria | 1945 |
| 798 | nmdc:mga07m45_74368_c1 | 3300050496 | Bacteria | 1936 |
| 799 | nmdc:mga07m45_880_c1 | 3300050496 | Bacteria | 13106 |
| 800 | nmdc:mga07m45_9069_c1 | 3300050496 | Bacteria | 5140 |
| 801 | nmdc:mga05p37_46673_c1 | 3300050507 | Bacteria | 5325 |
| 802 | nmdc:mga05p37_581215_c1 | 3300050507 | Bacteria | 1269 |
| 803 | nmdc:mga09592_512124_c1 | 3300050508 | Bacteria | 1033 |
| 804 | nmdc:mga0qj67_901582_c1 | 3300050509 | Bacteria | 697 |
| 805 | nmdc:mga06r32_125092_c1 | 3300050510 | Bacteria | 2539 |
| 806 | nmdc:mga08y16_827742_c1 | 3300050511 | Bacteria | 917 |
| 807 | nmdc:mga0n895_85688_c1 | 3300050512 | Bacteria | 3146 |
| 808 | nmdc:mga0rr50_9567_c1 | 3300050513 | Bacteria | 6102 |
| 809 | nmdc:mga08x19_177540_c1 | 3300050514 | Bacteria | 1453 |
| 810 | nmdc:mga0a205_84522_c1 | 3300050515 | Bacteria | 3066 |
| 811 | nmdc:mga0sz30_201547_c1 | 3300050516 | Bacteria | 884 |
| 812 | nmdc:mga0sz30_37768_c1 | 3300050516 | Bacteria | 2022 |
| 813 | Ga0495601_0000453 | 3300053077 | Bacteria | 21492 |
| 814 | Ga0495601_0145738 | 3300053077 | Bacteria | 1545 |
| 815 | Ga0495595_0006874 | 3300053084 | Bacteria | 4642 |
| 816 | Ga0495619_0476348 | 3300053085 | Bacteria | 860 |
| 817 | Ga0495619_0878273 | 3300053085 | Bacteria | 604 |
| 818 | Ga0500578_0000102 | 3300053086 | Bacteria | 99108 |
| 819 | Ga0500644_0000290 | 3300053088 | Bacteria | 27182 |
| 820 | Ga0500644_0003902 | 3300053088 | Bacteria | 3714 |
| 821 | Ga0500647_0083826 | 3300053091 | Bacteria | 1529 |
| 822 | Ga0500566_0491563 | 3300053094 | Bacteria | 530 |
| 823 | Ga0500641_0178453 | 3300053096 | Bacteria | 912 |
| 824 | Ga0500556_0374510 | 3300053104 | Bacteria | 549 |
| 825 | Ga0500562_003539 | 3300053108 | Bacteria | 3917 |
| 826 | Ga0500572_012234 | 3300053111 | Bacteria | 2099 |
| 827 | Ga0500594_0000540 | 3300053118 | Bacteria | 8211 |
| 828 | Ga0500594_0024002 | 3300053118 | Bacteria | 1550 |
| 829 | Ga0500595_003284 | 3300053119 | Bacteria | 7623 |
| 830 | Ga0500618_001087 | 3300053125 | Bacteria | 13359 |
| 831 | Ga0500618_001190 | 3300053125 | Bacteria | 12512 |
| 832 | Ga0500658_0014067 | 3300053134 | Bacteria | 2960 |
| 833 | Ga0500564_000289 | 3300053138 | Bacteria | 13960 |
| 834 | Ga0500568_0048037 | 3300053139 | Bacteria | 1688 |
| 835 | Ga0500573_0201861 | 3300053140 | Bacteria | 1055 |
| 836 | Ga0500574_000188 | 3300053141 | Bacteria | 7253 |
| 837 | Ga0500586_006749 | 3300053145 | Bacteria | 3007 |
| 838 | Ga0500586_026623 | 3300053145 | Bacteria | 1874 |
| 839 | Ga0500590_017522 | 3300053148 | Bacteria | 3702 |
| 840 | Ga0500616_0012668 | 3300053153 | Bacteria | 4930 |
| 841 | Ga0500619_000268 | 3300053154 | Bacteria | 10773 |
| 842 | Ga0500622_0000674 | 3300053156 | Bacteria | 30184 |
| 843 | Ga0500622_0073508 | 3300053156 | Bacteria | 1724 |
| 844 | Ga0500627_0028183 | 3300053158 | Bacteria | 2330 |
| 845 | Ga0590071_003614 | 3300059421 | Bacteria | 3796 |
| 846 | Ga0590074_069989 | 3300059423 | Bacteria | 660 |
| 847 | Ga0590075_072055 | 3300059424 | Bacteria | 893 |
| 848 | Ga0587077_016128 | 3300059493 | Bacteria | 1254 |
| 849 | Ga0587068_020103 | 3300059641 | Bacteria | 1088 |
| 850 | Ga0466962_0333809 | 3300061719 | Bacteria | 753 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041501 | Ga0451845_0164688 | Ga0451845_0164688_182_619 | 136 |
| 2 | 3300006042 | Ga0075368_10065499 | Ga0075368_100654992 | 137 |
| 3 | 3300006195 | Ga0075366_10308560 | Ga0075366_103085602 | 137 |
| 4 | 3300028794 | Ga0307515_10000416 | Ga0307515_100004163 | 137 |
| 5 | 3300028794 | Ga0307515_10021948 | Ga0307515_100219486 | 137 |
| 6 | 3300031235 | Ga0265330_10142497 | Ga0265330_101424972 | 137 |
| 7 | 3300031241 | Ga0265325_10051280 | Ga0265325_100512802 | 137 |
| 8 | 3300031242 | Ga0265329_10077120 | Ga0265329_100771202 | 137 |
| 9 | 3300031595 | Ga0265313_10000626 | Ga0265313_1000062626 | 137 |
| 10 | 3300031711 | Ga0265314_10032855 | Ga0265314_100328552 | 137 |
| 11 | 3300041451 | Ga0451791_1555694 | Ga0451791_1555694_327_797 | 137 |
| 12 | 3300041460 | Ga0451802_0815355 | Ga0451802_0815355_133_612 | 137 |
| 13 | 3300041505 | Ga0451849_1555721 | Ga0451849_1555721_276_749 | 137 |
| 14 | 3300046512 | Ga0495610_0074022 | Ga0495610_0074022_62_532 | 137 |
| 15 | 3300046660 | Ga0495625_0005727 | Ga0495625_0005727_4928_5398 | 137 |
| 16 | 3300046683 | Ga0495658_0065195 | Ga0495658_0065195_390_857 | 137 |
| 17 | 3300053088 | Ga0500644_0003902 | Ga0500644_0003902_3067_3537 | 137 |
| 18 | 3300006353 | Ga0075370_10045539 | Ga0075370_100455394 | 138 |
| 19 | 3300050496 | nmdc:mga07m45_23515_c1 | nmdc:mga07m45_23515_c1_1880_2371 | 138 |
| 20 | iso_pu_bacteria | 2919704043 | 2919705477 | 138 |
| 21 | 3300003771 | Ga0055526_1010195 | Ga0055526_10101953 | 139 |
| 22 | 3300021361 | Ga0213872_10073827 | Ga0213872_100738272 | 139 |
| 23 | 3300025245 | Ga0207425_1001773 | Ga0207425_10017737 | 139 |
| 24 | 3300025258 | Ga0209129_1000025 | Ga0209129_1000025222 | 139 |
| 25 | 3300025273 | Ga0209673_1014092 | Ga0209673_10140923 | 139 |
| 26 | 3300025295 | Ga0209564_1000039 | Ga0209564_1000039222 | 139 |
| 27 | 3300025297 | Ga0209758_1000196 | Ga0209758_1000196102 | 139 |
| 28 | 3300025299 | Ga0209256_1018225 | Ga0209256_10182254 | 139 |
| 29 | 3300037471 | Ga0395905_0000002 | Ga0395905_0000002_72648_73073 | 139 |
| 30 | 3300039447 | Ga0436361_1039366 | Ga0436361_1039366_658_1098 | 139 |
| 31 | iso_pu_bacteria | 2511231026 | 2511383852 | 140 |
| 32 | iso_pu_bacteria | 2818991436 | 2819543986 | 140 |
| 33 | iso_pu_bacteria | 2842711865 | 2842716559 | 140 |
| 34 | iso_pu_bacteria | 2852618963 | 2852620291 | 140 |
| 35 | iso_pu_bacteria | 2857553236 | 2857557279 | 140 |
| 36 | iso_pu_bacteria | 2857558681 | 2857560156 | 140 |
| 37 | iso_pu_bacteria | 2904479285 | 2904482608 | 140 |
| 38 | iso_pu_bacteria | 2919046199 | 2919048018 | 140 |
| 39 | iso_pu_bacteria | 2919476304 | 2919477906 | 140 |
| 40 | 3300005434 | Ga0070709_10031572 | Ga0070709_100315723 | 141 |
| 41 | 3300006175 | Ga0070712_100021105 | Ga0070712_1000211056 | 141 |
| 42 | 3300009098 | Ga0105245_10035552 | Ga0105245_100355526 | 141 |
| 43 | 3300009101 | Ga0105247_10002270 | Ga0105247_1000227010 | 141 |
| 44 | 3300025906 | Ga0207699_10037289 | Ga0207699_100372894 | 141 |
| 45 | 3300025915 | Ga0207693_10005621 | Ga0207693_100056217 | 141 |
| 46 | 3300032002 | Ga0307416_100749548 | Ga0307416_1007495482 | 141 |
| 47 | 3300035724 | Ga0373933_0776497 | Ga0373933_0776497_190_618 | 141 |
| 48 | 3300039450 | Ga0436363_1301619 | Ga0436363_1301619_576_1025 | 141 |
| 49 | 3300048903 | Ga0496100_0172163 | Ga0496100_0172163_864_1298 | 141 |
| 50 | 3300048904 | Ga0496101_0158800 | Ga0496101_0158800_1184_1618 | 141 |
| 51 | 3300048905 | Ga0496102_0000059 | Ga0496102_0000059_136338_136772 | 141 |
| 52 | 3300048906 | Ga0496103_0000063 | Ga0496103_0000063_51442_51876 | 141 |
| 53 | 3300048910 | Ga0496107_0521430 | Ga0496107_0521430_143_577 | 141 |
| 54 | 3300048920 | Ga0496117_0236371 | Ga0496117_0236371_194_628 | 141 |
| 55 | 3300048921 | Ga0496118_0066294 | Ga0496118_0066294_1119_1553 | 141 |
| 56 | 3300048922 | Ga0496119_0075172 | Ga0496119_0075172_768_1202 | 141 |
| 57 | iso_pu_bacteria | 2582581279 | 2585148921 | 141 |
| 58 | iso_pu_bacteria | 2738541297 | 2738828141 | 141 |
| 59 | iso_pu_bacteria | 2738541357 | 2739151937 | 141 |
| 60 | iso_pu_bacteria | 2738543003 | 2739194042 | 141 |
| 61 | iso_pu_bacteria | 2738543026 | 2739320333 | 141 |
| 62 | iso_pu_bacteria | 2738543029 | 2739338759 | 141 |
| 63 | 3300003792 | Ga0055540_1071329 | Ga0055540_10713291 | 142 |
| 64 | 3300005445 | Ga0070708_100106236 | Ga0070708_1001062363 | 142 |
| 65 | 3300005457 | Ga0070662_100075388 | Ga0070662_1000753883 | 142 |
| 66 | 3300005459 | Ga0068867_100086893 | Ga0068867_1000868933 | 142 |
| 67 | 3300005617 | Ga0068859_100003059 | Ga0068859_10000305910 | 142 |
| 68 | 3300005842 | Ga0068858_101624648 | Ga0068858_1016246481 | 142 |
| 69 | 3300006042 | Ga0075368_10021444 | Ga0075368_100214443 | 142 |
| 70 | 3300006042 | Ga0075368_10146951 | Ga0075368_101469511 | 142 |
| 71 | 3300006048 | Ga0075363_100005677 | Ga0075363_1000056775 | 142 |
| 72 | 3300006051 | Ga0075364_10383477 | Ga0075364_103834772 | 142 |
| 73 | 3300006177 | Ga0075362_10000768 | Ga0075362_100007683 | 142 |
| 74 | 3300006177 | Ga0075362_10014252 | Ga0075362_100142523 | 142 |
| 75 | 3300006178 | Ga0075367_10004491 | Ga0075367_100044914 | 142 |
| 76 | 3300006186 | Ga0075369_10004486 | Ga0075369_100044866 | 142 |
| 77 | 3300006195 | Ga0075366_10001662 | Ga0075366_1000166210 | 142 |
| 78 | 3300006195 | Ga0075366_10428268 | Ga0075366_104282681 | 142 |
| 79 | 3300006353 | Ga0075370_10000340 | Ga0075370_1000034014 | 142 |
| 80 | 3300006353 | Ga0075370_10053180 | Ga0075370_100531802 | 142 |
| 81 | 3300006353 | Ga0075370_10149660 | Ga0075370_101496602 | 142 |
| 82 | 3300006931 | Ga0097620_100003059 | Ga0097620_10000305910 | 142 |
| 83 | 3300009148 | Ga0105243_10045475 | Ga0105243_100454753 | 142 |
| 84 | 3300014325 | Ga0163163_12374153 | Ga0163163_123741531 | 142 |
| 85 | 3300025303 | Ga0209051_1012288 | Ga0209051_10122883 | 142 |
| 86 | 3300025900 | Ga0207710_10001706 | Ga0207710_100017069 | 142 |
| 87 | 3300025931 | Ga0207644_10481033 | Ga0207644_104810331 | 142 |
| 88 | 3300025933 | Ga0207706_10096028 | Ga0207706_100960282 | 142 |
| 89 | 3300026041 | Ga0207639_10740501 | Ga0207639_107405012 | 142 |
| 90 | 3300026116 | Ga0207674_10439864 | Ga0207674_104398642 | 142 |
| 91 | 3300026118 | Ga0207675_100467947 | Ga0207675_1004679472 | 142 |
| 92 | 3300027866 | Ga0209813_10015447 | Ga0209813_100154472 | 142 |
| 93 | 3300028794 | Ga0307515_10084784 | Ga0307515_100847845 | 142 |
| 94 | 3300028794 | Ga0307515_10277025 | Ga0307515_102770252 | 142 |
| 95 | 3300031251 | Ga0265327_10002604 | Ga0265327_100026045 | 142 |
| 96 | 3300031616 | Ga0307508_10000017 | Ga0307508_1000001790 | 142 |
| 97 | 3300031649 | Ga0307514_10015317 | Ga0307514_100153174 | 142 |
| 98 | 3300031730 | Ga0307516_10000525 | Ga0307516_1000052548 | 142 |
| 99 | 3300031730 | Ga0307516_10085138 | Ga0307516_100851382 | 142 |
| 100 | 3300031730 | Ga0307516_10252822 | Ga0307516_102528222 | 142 |
| 101 | 3300031730 | Ga0307516_10606732 | Ga0307516_106067322 | 142 |
| 102 | 3300035691 | Ga0373931_0430578 | Ga0373931_0430578_175_645 | 142 |
| 103 | 3300037471 | Ga0395905_0040982 | Ga0395905_0040982_2550_3005 | 142 |
| 104 | 3300042129 | Ga0450891_012751 | Ga0450891_012751_298_759 | 142 |
| 105 | 3300044712 | Ga0453684_0006580 | Ga0453684_0006580_13814_14281 | 142 |
| 106 | 3300046492 | Ga0495585_0007022 | Ga0495585_0007022_4634_5095 | 142 |
| 107 | 3300046537 | Ga0495598_0166461 | Ga0495598_0166461_93_533 | 142 |
| 108 | 3300046542 | Ga0495597_0004543 | Ga0495597_0004543_6319_6831 | 142 |
| 109 | 3300046542 | Ga0495597_0199453 | Ga0495597_0199453_13_480 | 142 |
| 110 | 3300046616 | Ga0495668_0101145 | Ga0495668_0101145_901_1368 | 142 |
| 111 | 3300047443 | Ga0495687_000232 | Ga0495687_000232_20732_21244 | 142 |
| 112 | 3300047443 | Ga0495687_029520 | Ga0495687_029520_1709_2161 | 142 |
| 113 | 3300048091 | Ga0495626_0073452 | Ga0495626_0073452_407_919 | 142 |
| 114 | 3300048905 | Ga0496102_0643427 | Ga0496102_0643427_31_501 | 142 |
| 115 | 3300048907 | Ga0496104_1421106 | Ga0496104_1421106_43_507 | 142 |
| 116 | 3300048912 | Ga0496109_1098920 | Ga0496109_1098920_50_499 | 142 |
| 117 | 3300048916 | Ga0496113_0455329 | Ga0496113_0455329_170_625 | 142 |
| 118 | 3300049523 | Ga0501300_019001 | Ga0501300_019001_273_728 | 142 |
| 119 | 3300049662 | Ga0501222_016863 | Ga0501222_016863_377_850 | 142 |
| 120 | 3300049674 | Ga0501242_028684 | Ga0501242_028684_146_619 | 142 |
| 121 | 3300050489 | nmdc:mga03683_13913_c1 | nmdc:mga03683_13913_c1_728_1195 | 142 |
| 122 | 3300050489 | nmdc:mga03683_8363_c1 | nmdc:mga03683_8363_c1_2581_3042 | 142 |
| 123 | 3300050490 | nmdc:mga03n38_40701_c1 | nmdc:mga03n38_40701_c1_347_808 | 142 |
| 124 | 3300050491 | nmdc:mga00v17_19483_c1 | nmdc:mga00v17_19483_c1_3100_3561 | 142 |
| 125 | 3300050493 | nmdc:mga0k408_1519_c1 | nmdc:mga0k408_1519_c1_1541_2002 | 142 |
| 126 | 3300050493 | nmdc:mga0k408_178250_c1 | nmdc:mga0k408_178250_c1_147_602 | 142 |
| 127 | 3300050493 | nmdc:mga0k408_4876_c1 | nmdc:mga0k408_4876_c1_2701_3180 | 142 |
| 128 | 3300050493 | nmdc:mga0k408_52416_c1 | nmdc:mga0k408_52416_c1_650_1117 | 142 |
| 129 | 3300050494 | nmdc:mga06z11_15377_c1 | nmdc:mga06z11_15377_c1_2508_2969 | 142 |
| 130 | 3300050495 | nmdc:mga04h51_5040_c1 | nmdc:mga04h51_5040_c1_384_845 | 142 |
| 131 | 3300050496 | nmdc:mga07m45_164752_c1 | nmdc:mga07m45_164752_c1_305_772 | 142 |
| 132 | 3300050496 | nmdc:mga07m45_9069_c1 | nmdc:mga07m45_9069_c1_3718_4173 | 142 |
| 133 | 3300050516 | nmdc:mga0sz30_201547_c1 | nmdc:mga0sz30_201547_c1_24_485 | 142 |
| 134 | 3300053134 | Ga0500658_0014067 | Ga0500658_0014067_2058_2510 | 142 |
| 135 | 3300059424 | Ga0590075_072055 | Ga0590075_072055_133_588 | 142 |
| 136 | iso_pu_bacteria | 2585428057 | 2587726874 | 142 |
| 137 | iso_pu_bacteria | 2585428062 | 2587757396 | 142 |
| 138 | iso_pu_bacteria | 2765235838 | 2765570622 | 142 |
| 139 | iso_pu_bacteria | 2839094727 | 2839098168 | 142 |
| 140 | 3300005563 | Ga0068855_100000645 | Ga0068855_1000006455 | 143 |
| 141 | 3300006195 | Ga0075366_10021765 | Ga0075366_100217654 | 143 |
| 142 | 3300025949 | Ga0207667_10000191 | Ga0207667_1000019176 | 143 |
| 143 | 3300028573 | Ga0265334_10004043 | Ga0265334_100040435 | 143 |
| 144 | 3300028577 | Ga0265318_10006926 | Ga0265318_100069265 | 143 |
| 145 | 3300028800 | Ga0265338_10165091 | Ga0265338_101650912 | 143 |
| 146 | 3300031239 | Ga0265328_10031773 | Ga0265328_100317732 | 143 |
| 147 | 3300031240 | Ga0265320_10028158 | Ga0265320_100281583 | 143 |
| 148 | 3300031241 | Ga0265325_10054658 | Ga0265325_100546581 | 143 |
| 149 | 3300031242 | Ga0265329_10094644 | Ga0265329_100946441 | 143 |
| 150 | 3300031249 | Ga0265339_10310121 | Ga0265339_103101212 | 143 |
| 151 | 3300031250 | Ga0265331_10058777 | Ga0265331_100587771 | 143 |
| 152 | 3300031344 | Ga0265316_10063161 | Ga0265316_100631613 | 143 |
| 153 | 3300031595 | Ga0265313_10008190 | Ga0265313_100081907 | 143 |
| 154 | 3300031712 | Ga0265342_10135376 | Ga0265342_101353762 | 143 |
| 155 | 3300049742 | Ga0501080_0280723 | Ga0501080_0280723_329_769 | 143 |
| 156 | 3300050493 | nmdc:mga0k408_4551_c1 | nmdc:mga0k408_4551_c1_2046_2540 | 143 |
| 157 | 3300050493 | nmdc:mga0k408_62704_c1 | nmdc:mga0k408_62704_c1_971_1414 | 143 |
| 158 | 3300002737 | JGI25162J39368_1000001 | JGI25162J39368_1000001509 | 144 |
| 159 | 3300002738 | JGI25154J39366_1000584 | JGI25154J39366_10005845 | 144 |
| 160 | 3300002771 | JGI25163J39215_1002212 | JGI25163J39215_10022122 | 144 |
| 161 | 3300002772 | JGI25164J39214_1004383 | JGI25164J39214_10043832 | 144 |
| 162 | 3300002774 | JGI25150J39212_1001132 | JGI25150J39212_10011324 | 144 |
| 163 | 3300003214 | JGI25165J46597_1000001 | JGI25165J46597_1000001497 | 144 |
| 164 | 3300003215 | JGI25153J46596_10037994 | JGI25153J46596_100379942 | 144 |
| 165 | 3300003322 | rootL2_10030503 | rootL2_100305035 | 144 |
| 166 | 3300003322 | rootL2_10050963 | rootL2_100509632 | 144 |
| 167 | 3300003322 | rootL2_10105907 | rootL2_101059072 | 144 |
| 168 | 3300003371 | JGI26145J50221_1001623 | JGI26145J50221_10016233 | 144 |
| 169 | 3300003751 | Ga0055538_1000001 | Ga0055538_1000001535 | 144 |
| 170 | 3300003751 | Ga0055538_1000070 | Ga0055538_100007031 | 144 |
| 171 | 3300003752 | Ga0055539_1000001 | Ga0055539_1000001535 | 144 |
| 172 | 3300003752 | Ga0055539_1000105 | Ga0055539_100010531 | 144 |
| 173 | 3300003756 | Ga0055533_1000003 | Ga0055533_1000003497 | 144 |
| 174 | 3300003756 | Ga0055533_1000113 | Ga0055533_100011331 | 144 |
| 175 | 3300003759 | Ga0055525_1000003 | Ga0055525_1000003497 | 144 |
| 176 | 3300003759 | Ga0055525_1000153 | Ga0055525_100015331 | 144 |
| 177 | 3300003763 | Ga0055529_1000836 | Ga0055529_100083610 | 144 |
| 178 | 3300003771 | Ga0055526_1000023 | Ga0055526_100002352 | 144 |
| 179 | 3300003771 | Ga0055526_1000341 | Ga0055526_100034114 | 144 |
| 180 | 3300003773 | Ga0055537_1000129 | Ga0055537_100012911 | 144 |
| 181 | 3300003775 | Ga0055524_1000151 | Ga0055524_10001513 | 144 |
| 182 | 3300003775 | Ga0055524_1002022 | Ga0055524_100202212 | 144 |
| 183 | 3300003784 | Ga0055534_1000594 | Ga0055534_100059413 | 144 |
| 184 | 3300003784 | Ga0055534_1000965 | Ga0055534_100096513 | 144 |
| 185 | 3300003790 | Ga0055528_1000013 | Ga0055528_100001384 | 144 |
| 186 | 3300003794 | Ga0055531_10000044 | Ga0055531_1000004431 | 144 |
| 187 | 3300003841 | Ga0055541_1000001 | Ga0055541_1000001497 | 144 |
| 188 | 3300003841 | Ga0055541_1000071 | Ga0055541_100007131 | 144 |
| 189 | 3300005289 | Ga0065704_10108090 | Ga0065704_101080903 | 144 |
| 190 | 3300005289 | Ga0065704_10313445 | Ga0065704_103134452 | 144 |
| 191 | 3300005290 | Ga0065712_10012574 | Ga0065712_100125743 | 144 |
| 192 | 3300005293 | Ga0065715_10042946 | Ga0065715_100429462 | 144 |
| 193 | 3300005328 | Ga0070676_10084340 | Ga0070676_100843404 | 144 |
| 194 | 3300005329 | Ga0070683_101637237 | Ga0070683_1016372371 | 144 |
| 195 | 3300005330 | Ga0070690_100190718 | Ga0070690_1001907183 | 144 |
| 196 | 3300005331 | Ga0070670_100096244 | Ga0070670_1000962443 | 144 |
| 197 | 3300005333 | Ga0070677_10043647 | Ga0070677_100436472 | 144 |
| 198 | 3300005333 | Ga0070677_10276683 | Ga0070677_102766831 | 144 |
| 199 | 3300005334 | Ga0068869_100010984 | Ga0068869_1000109845 | 144 |
| 200 | 3300005335 | Ga0070666_10050883 | Ga0070666_100508833 | 144 |
| 201 | 3300005335 | Ga0070666_10147195 | Ga0070666_101471952 | 144 |
| 202 | 3300005336 | Ga0070680_100069471 | Ga0070680_1000694713 | 144 |
| 203 | 3300005337 | Ga0070682_100182320 | Ga0070682_1001823201 | 144 |
| 204 | 3300005338 | Ga0068868_100015268 | Ga0068868_1000152685 | 144 |
| 205 | 3300005338 | Ga0068868_100322227 | Ga0068868_1003222273 | 144 |
| 206 | 3300005339 | Ga0070660_100060819 | Ga0070660_1000608193 | 144 |
| 207 | 3300005339 | Ga0070660_100230977 | Ga0070660_1002309772 | 144 |
| 208 | 3300005340 | Ga0070689_100003473 | Ga0070689_10000347310 | 144 |
| 209 | 3300005341 | Ga0070691_10028707 | Ga0070691_100287072 | 144 |
| 210 | 3300005343 | Ga0070687_100007263 | Ga0070687_1000072632 | 144 |
| 211 | 3300005344 | Ga0070661_100007428 | Ga0070661_1000074285 | 144 |
| 212 | 3300005344 | Ga0070661_100157192 | Ga0070661_1001571921 | 144 |
| 213 | 3300005345 | Ga0070692_10067874 | Ga0070692_100678743 | 144 |
| 214 | 3300005347 | Ga0070668_100024157 | Ga0070668_1000241574 | 144 |
| 215 | 3300005353 | Ga0070669_100548603 | Ga0070669_1005486031 | 144 |
| 216 | 3300005353 | Ga0070669_101436298 | Ga0070669_1014362981 | 144 |
| 217 | 3300005354 | Ga0070675_100087418 | Ga0070675_1000874182 | 144 |
| 218 | 3300005354 | Ga0070675_100105687 | Ga0070675_1001056873 | 144 |
| 219 | 3300005355 | Ga0070671_100088620 | Ga0070671_1000886201 | 144 |
| 220 | 3300005356 | Ga0070674_100014049 | Ga0070674_1000140494 | 144 |
| 221 | 3300005356 | Ga0070674_100215730 | Ga0070674_1002157302 | 144 |
| 222 | 3300005364 | Ga0070673_100002884 | Ga0070673_1000028842 | 144 |
| 223 | 3300005365 | Ga0070688_100043383 | Ga0070688_1000433833 | 144 |
| 224 | 3300005366 | Ga0070659_100003919 | Ga0070659_1000039198 | 144 |
| 225 | 3300005366 | Ga0070659_100013137 | Ga0070659_1000131373 | 144 |
| 226 | 3300005367 | Ga0070667_100116855 | Ga0070667_1001168553 | 144 |
| 227 | 3300005367 | Ga0070667_101117695 | Ga0070667_1011176952 | 144 |
| 228 | 3300005438 | Ga0070701_10036575 | Ga0070701_100365752 | 144 |
| 229 | 3300005439 | Ga0070711_100165441 | Ga0070711_1001654413 | 144 |
| 230 | 3300005440 | Ga0070705_100042649 | Ga0070705_1000426493 | 144 |
| 231 | 3300005441 | Ga0070700_100007514 | Ga0070700_1000075142 | 144 |
| 232 | 3300005444 | Ga0070694_100071619 | Ga0070694_1000716193 | 144 |
| 233 | 3300005455 | Ga0070663_100802480 | Ga0070663_1008024801 | 144 |
| 234 | 3300005456 | Ga0070678_100014162 | Ga0070678_1000141624 | 144 |
| 235 | 3300005457 | Ga0070662_100001274 | Ga0070662_10000127415 | 144 |
| 236 | 3300005457 | Ga0070662_100015383 | Ga0070662_1000153833 | 144 |
| 237 | 3300005458 | Ga0070681_10025086 | Ga0070681_100250862 | 144 |
| 238 | 3300005459 | Ga0068867_100228970 | Ga0068867_1002289701 | 144 |
| 239 | 3300005466 | Ga0070685_10212160 | Ga0070685_102121601 | 144 |
| 240 | 3300005530 | Ga0070679_100054705 | Ga0070679_1000547052 | 144 |
| 241 | 3300005530 | Ga0070679_100237334 | Ga0070679_1002373342 | 144 |
| 242 | 3300005535 | Ga0070684_100160149 | Ga0070684_1001601493 | 144 |
| 243 | 3300005539 | Ga0068853_100614700 | Ga0068853_1006147002 | 144 |
| 244 | 3300005543 | Ga0070672_100008006 | Ga0070672_1000080062 | 144 |
| 245 | 3300005543 | Ga0070672_100452748 | Ga0070672_1004527482 | 144 |
| 246 | 3300005544 | Ga0070686_100015688 | Ga0070686_1000156882 | 144 |
| 247 | 3300005545 | Ga0070695_100161462 | Ga0070695_1001614621 | 144 |
| 248 | 3300005546 | Ga0070696_100080067 | Ga0070696_1000800673 | 144 |
| 249 | 3300005547 | Ga0070693_100321217 | Ga0070693_1003212171 | 144 |
| 250 | 3300005548 | Ga0070665_100438296 | Ga0070665_1004382963 | 144 |
| 251 | 3300005548 | Ga0070665_101111966 | Ga0070665_1011119661 | 144 |
| 252 | 3300005548 | Ga0070665_101723604 | Ga0070665_1017236042 | 144 |
| 253 | 3300005563 | Ga0068855_101184776 | Ga0068855_1011847761 | 144 |
| 254 | 3300005564 | Ga0070664_100075089 | Ga0070664_1000750892 | 144 |
| 255 | 3300005564 | Ga0070664_100085441 | Ga0070664_1000854413 | 144 |
| 256 | 3300005577 | Ga0068857_100119545 | Ga0068857_1001195452 | 144 |
| 257 | 3300005577 | Ga0068857_100140107 | Ga0068857_1001401072 | 144 |
| 258 | 3300005578 | Ga0068854_100081911 | Ga0068854_1000819113 | 144 |
| 259 | 3300005578 | Ga0068854_100499274 | Ga0068854_1004992741 | 144 |
| 260 | 3300005614 | Ga0068856_100299641 | Ga0068856_1002996412 | 144 |
| 261 | 3300005615 | Ga0070702_100004200 | Ga0070702_1000042002 | 144 |
| 262 | 3300005617 | Ga0068859_100801284 | Ga0068859_1008012842 | 144 |
| 263 | 3300005618 | Ga0068864_100083818 | Ga0068864_1000838183 | 144 |
| 264 | 3300005718 | Ga0068866_10021224 | Ga0068866_100212243 | 144 |
| 265 | 3300005718 | Ga0068866_10122569 | Ga0068866_101225692 | 144 |
| 266 | 3300005719 | Ga0068861_100148175 | Ga0068861_1001481753 | 144 |
| 267 | 3300005840 | Ga0068870_10327405 | Ga0068870_103274052 | 144 |
| 268 | 3300005842 | Ga0068858_100868776 | Ga0068858_1008687762 | 144 |
| 269 | 3300005843 | Ga0068860_100091353 | Ga0068860_1000913533 | 144 |
| 270 | 3300005844 | Ga0068862_100087801 | Ga0068862_1000878012 | 144 |
| 271 | 3300006028 | Ga0070717_10503794 | Ga0070717_105037942 | 144 |
| 272 | 3300006038 | Ga0075365_10142883 | Ga0075365_101428833 | 144 |
| 273 | 3300006058 | Ga0075432_10011257 | Ga0075432_100112574 | 144 |
| 274 | 3300006163 | Ga0070715_10125922 | Ga0070715_101259222 | 144 |
| 275 | 3300006177 | Ga0075362_10014530 | Ga0075362_100145303 | 144 |
| 276 | 3300006177 | Ga0075362_10108963 | Ga0075362_101089632 | 144 |
| 277 | 3300006178 | Ga0075367_10006418 | Ga0075367_100064185 | 144 |
| 278 | 3300006194 | Ga0075427_10017279 | Ga0075427_100172792 | 144 |
| 279 | 3300006195 | Ga0075366_10032423 | Ga0075366_100324234 | 144 |
| 280 | 3300006237 | Ga0097621_100001607 | Ga0097621_10000160711 | 144 |
| 281 | 3300006353 | Ga0075370_10003500 | Ga0075370_100035003 | 144 |
| 282 | 3300006353 | Ga0075370_10074611 | Ga0075370_100746113 | 144 |
| 283 | 3300006358 | Ga0068871_100013291 | Ga0068871_1000132917 | 144 |
| 284 | 3300006844 | Ga0075428_100954627 | Ga0075428_1009546271 | 144 |
| 285 | 3300006846 | Ga0075430_100392893 | Ga0075430_1003928931 | 144 |
| 286 | 3300006847 | Ga0075431_100022194 | Ga0075431_1000221946 | 144 |
| 287 | 3300006871 | Ga0075434_100061167 | Ga0075434_1000611674 | 144 |
| 288 | 3300006880 | Ga0075429_100341672 | Ga0075429_1003416723 | 144 |
| 289 | 3300006881 | Ga0068865_100000749 | Ga0068865_1000007499 | 144 |
| 290 | 3300006914 | Ga0075436_100081141 | Ga0075436_1000811411 | 144 |
| 291 | 3300006914 | Ga0075436_100227179 | Ga0075436_1002271792 | 144 |
| 292 | 3300006931 | Ga0097620_100801295 | Ga0097620_1008012952 | 144 |
| 293 | 3300006948 | Ga0099826_10000001 | Ga0099826_1000000170 | 144 |
| 294 | 3300007076 | Ga0075435_100063931 | Ga0075435_1000639313 | 144 |
| 295 | 3300009093 | Ga0105240_10084689 | Ga0105240_100846893 | 144 |
| 296 | 3300009093 | Ga0105240_11943960 | Ga0105240_119439601 | 144 |
| 297 | 3300009094 | Ga0111539_11135623 | Ga0111539_111356231 | 144 |
| 298 | 3300009098 | Ga0105245_10010244 | Ga0105245_100102444 | 144 |
| 299 | 3300009098 | Ga0105245_10104106 | Ga0105245_101041063 | 144 |
| 300 | 3300009147 | Ga0114129_10137856 | Ga0114129_101378562 | 144 |
| 301 | 3300009147 | Ga0114129_10328752 | Ga0114129_103287522 | 144 |
| 302 | 3300009147 | Ga0114129_11327033 | Ga0114129_113270332 | 144 |
| 303 | 3300009148 | Ga0105243_10002966 | Ga0105243_1000296613 | 144 |
| 304 | 3300009148 | Ga0105243_10047246 | Ga0105243_100472463 | 144 |
| 305 | 3300009176 | Ga0105242_10003901 | Ga0105242_100039019 | 144 |
| 306 | 3300009177 | Ga0105248_10486994 | Ga0105248_104869942 | 144 |
| 307 | 3300009545 | Ga0105237_10017662 | Ga0105237_100176623 | 144 |
| 308 | 3300009545 | Ga0105237_11514084 | Ga0105237_115140841 | 144 |
| 309 | 3300009551 | Ga0105238_10778280 | Ga0105238_107782802 | 144 |
| 310 | 3300010375 | Ga0105239_10139319 | Ga0105239_101393193 | 144 |
| 311 | 3300010375 | Ga0105239_10260702 | Ga0105239_102607021 | 144 |
| 312 | 3300011119 | Ga0105246_10010500 | Ga0105246_100105006 | 144 |
| 313 | 3300013102 | Ga0157371_10085802 | Ga0157371_100858022 | 144 |
| 314 | 3300013296 | Ga0157374_10016050 | Ga0157374_100160503 | 144 |
| 315 | 3300013296 | Ga0157374_10285472 | Ga0157374_102854722 | 144 |
| 316 | 3300013297 | Ga0157378_10194214 | Ga0157378_101942144 | 144 |
| 317 | 3300013307 | Ga0157372_10300490 | Ga0157372_103004902 | 144 |
| 318 | 3300013308 | Ga0157375_10110808 | Ga0157375_101108083 | 144 |
| 319 | 3300014326 | Ga0157380_10058979 | Ga0157380_100589792 | 144 |
| 320 | 3300014326 | Ga0157380_10161348 | Ga0157380_101613483 | 144 |
| 321 | 3300014497 | Ga0182008_10201802 | Ga0182008_102018022 | 144 |
| 322 | 3300014745 | Ga0157377_10095360 | Ga0157377_100953604 | 144 |
| 323 | 3300014745 | Ga0157377_10410938 | Ga0157377_104109382 | 144 |
| 324 | 3300014969 | Ga0157376_10577375 | Ga0157376_105773752 | 144 |
| 325 | 3300014969 | Ga0157376_10760363 | Ga0157376_107603632 | 144 |
| 326 | 3300015261 | Ga0182006_1000008 | Ga0182006_1000008367 | 144 |
| 327 | 3300015262 | Ga0182007_10012607 | Ga0182007_100126071 | 144 |
| 328 | 3300015265 | Ga0182005_1000008 | Ga0182005_1000008234 | 144 |
| 329 | 3300015265 | Ga0182005_1000337 | Ga0182005_100033720 | 144 |
| 330 | 3300021361 | Ga0213872_10000148 | Ga0213872_100001484 | 144 |
| 331 | 3300021361 | Ga0213872_10010316 | Ga0213872_100103164 | 144 |
| 332 | 3300021388 | Ga0213875_10014593 | Ga0213875_100145933 | 144 |
| 333 | 3300025207 | Ga0209760_101080 | Ga0209760_1010804 | 144 |
| 334 | 3300025224 | Ga0209784_100004 | Ga0209784_100004495 | 144 |
| 335 | 3300025224 | Ga0209784_100009 | Ga0209784_10000948 | 144 |
| 336 | 3300025225 | Ga0209566_100004 | Ga0209566_100004652 | 144 |
| 337 | 3300025225 | Ga0209566_100007 | Ga0209566_10000748 | 144 |
| 338 | 3300025226 | Ga0209674_100006 | Ga0209674_100006652 | 144 |
| 339 | 3300025226 | Ga0209674_100018 | Ga0209674_10001848 | 144 |
| 340 | 3300025228 | Ga0209672_106477 | Ga0209672_1064771 | 144 |
| 341 | 3300025230 | Ga0209563_100009 | Ga0209563_100009495 | 144 |
| 342 | 3300025230 | Ga0209563_100020 | Ga0209563_10002048 | 144 |
| 343 | 3300025231 | Ga0207427_100514 | Ga0207427_10051415 | 144 |
| 344 | 3300025233 | Ga0209437_100004 | Ga0209437_100004495 | 144 |
| 345 | 3300025233 | Ga0209437_101546 | Ga0209437_1015466 | 144 |
| 346 | 3300025245 | Ga0207425_1001395 | Ga0207425_10013959 | 144 |
| 347 | 3300025246 | Ga0209646_1000252 | Ga0209646_10002529 | 144 |
| 348 | 3300025253 | Ga0209677_100005 | Ga0209677_100005495 | 144 |
| 349 | 3300025253 | Ga0209677_100010 | Ga0209677_10001048 | 144 |
| 350 | 3300025261 | Ga0209233_1000005 | Ga0209233_1000005652 | 144 |
| 351 | 3300025263 | Ga0209565_1000003 | Ga0209565_1000003561 | 144 |
| 352 | 3300025263 | Ga0209565_1005211 | Ga0209565_10052112 | 144 |
| 353 | 3300025272 | Ga0209455_1000026 | Ga0209455_1000026208 | 144 |
| 354 | 3300025273 | Ga0209673_1000003 | Ga0209673_1000003447 | 144 |
| 355 | 3300025291 | Ga0209675_1000003 | Ga0209675_1000003477 | 144 |
| 356 | 3300025295 | Ga0209564_1000002 | Ga0209564_1000002664 | 144 |
| 357 | 3300025295 | Ga0209564_1000012 | Ga0209564_1000012285 | 144 |
| 358 | 3300025297 | Ga0209758_1000679 | Ga0209758_100067917 | 144 |
| 359 | 3300025298 | Ga0209050_1004618 | Ga0209050_10046182 | 144 |
| 360 | 3300025299 | Ga0209256_1000007 | Ga0209256_1000007898 | 144 |
| 361 | 3300025299 | Ga0209256_1000112 | Ga0209256_1000112102 | 144 |
| 362 | 3300025303 | Ga0209051_1017173 | Ga0209051_10171734 | 144 |
| 363 | 3300025304 | Ga0209257_1000094 | Ga0209257_1000094126 | 144 |
| 364 | 3300025304 | Ga0209257_1009045 | Ga0209257_10090452 | 144 |
| 365 | 3300025315 | Ga0207697_10056774 | Ga0207697_100567742 | 144 |
| 366 | 3300025885 | Ga0207653_10331764 | Ga0207653_103317641 | 144 |
| 367 | 3300025893 | Ga0207682_10023671 | Ga0207682_100236713 | 144 |
| 368 | 3300025899 | Ga0207642_10137133 | Ga0207642_101371332 | 144 |
| 369 | 3300025899 | Ga0207642_10146883 | Ga0207642_101468833 | 144 |
| 370 | 3300025901 | Ga0207688_10200881 | Ga0207688_102008812 | 144 |
| 371 | 3300025903 | Ga0207680_10398496 | Ga0207680_103984962 | 144 |
| 372 | 3300025907 | Ga0207645_10000134 | Ga0207645_1000013449 | 144 |
| 373 | 3300025907 | Ga0207645_10383556 | Ga0207645_103835562 | 144 |
| 374 | 3300025908 | Ga0207643_10256150 | Ga0207643_102561502 | 144 |
| 375 | 3300025912 | Ga0207707_10065503 | Ga0207707_100655033 | 144 |
| 376 | 3300025912 | Ga0207707_10390168 | Ga0207707_103901681 | 144 |
| 377 | 3300025914 | Ga0207671_10026866 | Ga0207671_100268663 | 144 |
| 378 | 3300025916 | Ga0207663_10423632 | Ga0207663_104236322 | 144 |
| 379 | 3300025917 | Ga0207660_10020287 | Ga0207660_100202873 | 144 |
| 380 | 3300025918 | Ga0207662_10011397 | Ga0207662_100113973 | 144 |
| 381 | 3300025919 | Ga0207657_10026089 | Ga0207657_100260893 | 144 |
| 382 | 3300025919 | Ga0207657_10028740 | Ga0207657_100287404 | 144 |
| 383 | 3300025920 | Ga0207649_10019348 | Ga0207649_100193484 | 144 |
| 384 | 3300025920 | Ga0207649_10057169 | Ga0207649_100571692 | 144 |
| 385 | 3300025921 | Ga0207652_10357425 | Ga0207652_103574251 | 144 |
| 386 | 3300025923 | Ga0207681_10031585 | Ga0207681_100315852 | 144 |
| 387 | 3300025923 | Ga0207681_10097888 | Ga0207681_100978884 | 144 |
| 388 | 3300025925 | Ga0207650_10187755 | Ga0207650_101877552 | 144 |
| 389 | 3300025926 | Ga0207659_10146090 | Ga0207659_101460903 | 144 |
| 390 | 3300025926 | Ga0207659_10261465 | Ga0207659_102614653 | 144 |
| 391 | 3300025927 | Ga0207687_10118563 | Ga0207687_101185633 | 144 |
| 392 | 3300025931 | Ga0207644_10285643 | Ga0207644_102856432 | 144 |
| 393 | 3300025932 | Ga0207690_10089316 | Ga0207690_100893162 | 144 |
| 394 | 3300025932 | Ga0207690_10137951 | Ga0207690_101379512 | 144 |
| 395 | 3300025933 | Ga0207706_10000433 | Ga0207706_100004333 | 144 |
| 396 | 3300025933 | Ga0207706_10015176 | Ga0207706_100151768 | 144 |
| 397 | 3300025933 | Ga0207706_10177454 | Ga0207706_101774544 | 144 |
| 398 | 3300025934 | Ga0207686_10268853 | Ga0207686_102688533 | 144 |
| 399 | 3300025935 | Ga0207709_10036278 | Ga0207709_100362785 | 144 |
| 400 | 3300025935 | Ga0207709_10092398 | Ga0207709_100923981 | 144 |
| 401 | 3300025936 | Ga0207670_10002879 | Ga0207670_100028798 | 144 |
| 402 | 3300025937 | Ga0207669_10481241 | Ga0207669_104812412 | 144 |
| 403 | 3300025938 | Ga0207704_10222176 | Ga0207704_102221762 | 144 |
| 404 | 3300025939 | Ga0207665_10156836 | Ga0207665_101568361 | 144 |
| 405 | 3300025940 | Ga0207691_10002432 | Ga0207691_1000243219 | 144 |
| 406 | 3300025940 | Ga0207691_10569018 | Ga0207691_105690182 | 144 |
| 407 | 3300025941 | Ga0207711_10373407 | Ga0207711_103734072 | 144 |
| 408 | 3300025942 | Ga0207689_10056609 | Ga0207689_100566095 | 144 |
| 409 | 3300025942 | Ga0207689_10140401 | Ga0207689_101404011 | 144 |
| 410 | 3300025942 | Ga0207689_10287631 | Ga0207689_102876312 | 144 |
| 411 | 3300025942 | Ga0207689_10554411 | Ga0207689_105544112 | 144 |
| 412 | 3300025944 | Ga0207661_11140707 | Ga0207661_111407071 | 144 |
| 413 | 3300025945 | Ga0207679_10002243 | Ga0207679_100022432 | 144 |
| 414 | 3300025945 | Ga0207679_10083987 | Ga0207679_100839873 | 144 |
| 415 | 3300025949 | Ga0207667_11033363 | Ga0207667_110333631 | 144 |
| 416 | 3300025960 | Ga0207651_10024042 | Ga0207651_100240422 | 144 |
| 417 | 3300025972 | Ga0207668_10116878 | Ga0207668_101168781 | 144 |
| 418 | 3300025972 | Ga0207668_10148139 | Ga0207668_101481391 | 144 |
| 419 | 3300025981 | Ga0207640_10056394 | Ga0207640_100563945 | 144 |
| 420 | 3300025981 | Ga0207640_10095662 | Ga0207640_100956623 | 144 |
| 421 | 3300026023 | Ga0207677_10047475 | Ga0207677_100474753 | 144 |
| 422 | 3300026023 | Ga0207677_10367241 | Ga0207677_103672412 | 144 |
| 423 | 3300026041 | Ga0207639_10346594 | Ga0207639_103465943 | 144 |
| 424 | 3300026067 | Ga0207678_10029766 | Ga0207678_100297663 | 144 |
| 425 | 3300026075 | Ga0207708_10063368 | Ga0207708_100633682 | 144 |
| 426 | 3300026078 | Ga0207702_10979350 | Ga0207702_109793502 | 144 |
| 427 | 3300026089 | Ga0207648_10003400 | Ga0207648_100034006 | 144 |
| 428 | 3300026095 | Ga0207676_11277466 | Ga0207676_112774662 | 144 |
| 429 | 3300026095 | Ga0207676_11328372 | Ga0207676_113283722 | 144 |
| 430 | 3300026116 | Ga0207674_10117691 | Ga0207674_101176912 | 144 |
| 431 | 3300026116 | Ga0207674_10579583 | Ga0207674_105795832 | 144 |
| 432 | 3300026118 | Ga0207675_100214009 | Ga0207675_1002140092 | 144 |
| 433 | 3300026121 | Ga0207683_10000036 | Ga0207683_10000036101 | 144 |
| 434 | 3300026121 | Ga0207683_10111179 | Ga0207683_101111792 | 144 |
| 435 | 3300026142 | Ga0207698_10017930 | Ga0207698_100179306 | 144 |
| 436 | 3300027111 | Ga0209281_1018100 | Ga0209281_10181002 | 144 |
| 437 | 3300027360 | Ga0209969_1000834 | Ga0209969_10008343 | 144 |
| 438 | 3300027364 | Ga0209967_1000395 | Ga0209967_10003955 | 144 |
| 439 | 3300027378 | Ga0209981_1001350 | Ga0209981_10013503 | 144 |
| 440 | 3300027395 | Ga0209996_1000010 | Ga0209996_100001023 | 144 |
| 441 | 3300027424 | Ga0209984_1000348 | Ga0209984_10003485 | 144 |
| 442 | 3300027424 | Ga0209984_1036081 | Ga0209984_10360811 | 144 |
| 443 | 3300027462 | Ga0210000_1000006 | Ga0210000_100000636 | 144 |
| 444 | 3300027471 | Ga0209995_1000073 | Ga0209995_10000732 | 144 |
| 445 | 3300027526 | Ga0209968_1000047 | Ga0209968_100004720 | 144 |
| 446 | 3300027543 | Ga0209999_1000700 | Ga0209999_10007004 | 144 |
| 447 | 3300027552 | Ga0209982_1001009 | Ga0209982_10010093 | 144 |
| 448 | 3300027614 | Ga0209970_1010858 | Ga0209970_10108583 | 144 |
| 449 | 3300027617 | Ga0210002_1000143 | Ga0210002_10001433 | 144 |
| 450 | 3300027665 | Ga0209983_1018189 | Ga0209983_10181891 | 144 |
| 451 | 3300027666 | Ga0209282_1000001 | Ga0209282_10000011210 | 144 |
| 452 | 3300027682 | Ga0209971_1001389 | Ga0209971_10013893 | 144 |
| 453 | 3300027682 | Ga0209971_1007112 | Ga0209971_10071122 | 144 |
| 454 | 3300027695 | Ga0209966_1000182 | Ga0209966_100018220 | 144 |
| 455 | 3300027717 | Ga0209998_10000014 | Ga0209998_1000001424 | 144 |
| 456 | 3300027876 | Ga0209974_10000725 | Ga0209974_100007253 | 144 |
| 457 | 3300027876 | Ga0209974_10037638 | Ga0209974_100376383 | 144 |
| 458 | 3300027907 | Ga0207428_10006054 | Ga0207428_100060542 | 144 |
| 459 | 3300028379 | Ga0268266_10162728 | Ga0268266_101627281 | 144 |
| 460 | 3300028380 | Ga0268265_10208410 | Ga0268265_102084102 | 144 |
| 461 | 3300028381 | Ga0268264_10068360 | Ga0268264_100683602 | 144 |
| 462 | 3300028381 | Ga0268264_10235932 | Ga0268264_102359322 | 144 |
| 463 | 3300028786 | Ga0307517_10104341 | Ga0307517_101043412 | 144 |
| 464 | 3300028794 | Ga0307515_10035905 | Ga0307515_100359056 | 144 |
| 465 | 3300031239 | Ga0265328_10075933 | Ga0265328_100759332 | 144 |
| 466 | 3300031250 | Ga0265331_10007350 | Ga0265331_100073508 | 144 |
| 467 | 3300031250 | Ga0265331_10009455 | Ga0265331_100094552 | 144 |
| 468 | 3300031251 | Ga0265327_10000043 | Ga0265327_10000043166 | 144 |
| 469 | 3300031251 | Ga0265327_10000271 | Ga0265327_1000027186 | 144 |
| 470 | 3300031616 | Ga0307508_10048900 | Ga0307508_100489004 | 144 |
| 471 | 3300031730 | Ga0307516_10002317 | Ga0307516_100023179 | 144 |
| 472 | 3300032002 | Ga0307416_100434064 | Ga0307416_1004340641 | 144 |
| 473 | 3300033180 | Ga0307510_10003830 | Ga0307510_100038307 | 144 |
| 474 | 3300033180 | Ga0307510_10276015 | Ga0307510_102760152 | 144 |
| 475 | 3300034818 | Ga0373950_0049933 | Ga0373950_0049933_191_643 | 144 |
| 476 | 3300035083 | Ga0373926_0008497 | Ga0373926_0008497_1868_2326 | 144 |
| 477 | 3300035086 | Ga0373934_0056179 | Ga0373934_0056179_98_556 | 144 |
| 478 | 3300035086 | Ga0373934_0116308 | Ga0373934_0116308_590_1048 | 144 |
| 479 | 3300035091 | Ga0373951_0029924 | Ga0373951_0029924_235_711 | 144 |
| 480 | 3300035111 | Ga0373923_0007533 | Ga0373923_0007533_111_569 | 144 |
| 481 | 3300035112 | Ga0373932_0028610 | Ga0373932_0028610_994_1470 | 144 |
| 482 | 3300035113 | Ga0373936_0005299 | Ga0373936_0005299_2935_3393 | 144 |
| 483 | 3300035114 | Ga0373939_0103885 | Ga0373939_0103885_102_590 | 144 |
| 484 | 3300035115 | Ga0373941_0134973 | Ga0373941_0134973_375_863 | 144 |
| 485 | 3300035116 | Ga0373945_0040048 | Ga0373945_0040048_93_551 | 144 |
| 486 | 3300035117 | Ga0373953_0005871 | Ga0373953_0005871_85_543 | 144 |
| 487 | 3300035118 | Ga0373954_0008316 | Ga0373954_0008316_3800_4258 | 144 |
| 488 | 3300035119 | Ga0373956_0397291 | Ga0373956_0397291_85_543 | 144 |
| 489 | 3300035120 | Ga0373957_0062062 | Ga0373957_0062062_904_1362 | 144 |
| 490 | 3300035171 | Ga0373946_0107196 | Ga0373946_0107196_482_940 | 144 |
| 491 | 3300035241 | Ga0373961_0033076 | Ga0373961_0033076_752_1240 | 144 |
| 492 | 3300035242 | Ga0373962_0068642 | Ga0373962_0068642_533_1021 | 144 |
| 493 | 3300035691 | Ga0373931_0035473 | Ga0373931_0035473_1741_2229 | 144 |
| 494 | 3300035692 | Ga0373935_0089927 | Ga0373935_0089927_840_1298 | 144 |
| 495 | 3300035695 | Ga0373927_0009046 | Ga0373927_0009046_888_1346 | 144 |
| 496 | 3300035724 | Ga0373933_0347978 | Ga0373933_0347978_176_634 | 144 |
| 497 | 3300036401 | Ga0373937_0116818 | Ga0373937_0116818_491_949 | 144 |
| 498 | 3300036647 | Ga0316582_0325899 | Ga0316582_0325899_51_491 | 144 |
| 499 | 3300037068 | Ga0373925_0196552 | Ga0373925_0196552_85_543 | 144 |
| 500 | 3300037068 | Ga0373925_0466471 | Ga0373925_0466471_72_548 | 144 |
| 501 | 3300037312 | Ga0395899_0002847 | Ga0395899_0002847_12137_12571 | 144 |
| 502 | 3300037312 | Ga0395899_0037721 | Ga0395899_0037721_2895_3329 | 144 |
| 503 | 3300037312 | Ga0395899_0096847 | Ga0395899_0096847_894_1328 | 144 |
| 504 | 3300037312 | Ga0395899_0782235 | Ga0395899_0782235_30_464 | 144 |
| 505 | 3300037418 | Ga0395900_0022865 | Ga0395900_0022865_1595_2029 | 144 |
| 506 | 3300037418 | Ga0395900_0155446 | Ga0395900_0155446_587_1021 | 144 |
| 507 | 3300037418 | Ga0395900_0171095 | Ga0395900_0171095_1384_1818 | 144 |
| 508 | 3300037418 | Ga0395900_1620362 | Ga0395900_1620362_113_547 | 144 |
| 509 | 3300037466 | Ga0395898_0009320 | Ga0395898_0009320_6062_6496 | 144 |
| 510 | 3300037471 | Ga0395905_0000869 | Ga0395905_0000869_5778_6263 | 144 |
| 511 | 3300037471 | Ga0395905_0029166 | Ga0395905_0029166_1131_1565 | 144 |
| 512 | 3300037471 | Ga0395905_0167165 | Ga0395905_0167165_1182_1616 | 144 |
| 513 | 3300037471 | Ga0395905_1093919 | Ga0395905_1093919_58_492 | 144 |
| 514 | 3300037471 | Ga0395905_1300301 | Ga0395905_1300301_157_591 | 144 |
| 515 | 3300037853 | Ga0436364_0372099 | Ga0436364_0372099_3156_3593 | 144 |
| 516 | 3300038443 | Ga0395901_0041924 | Ga0395901_0041924_3839_4273 | 144 |
| 517 | 3300038443 | Ga0395901_0172459 | Ga0395901_0172459_1588_2022 | 144 |
| 518 | 3300038443 | Ga0395901_0196471 | Ga0395901_0196471_1098_1532 | 144 |
| 519 | 3300038443 | Ga0395901_0517295 | Ga0395901_0517295_67_501 | 144 |
| 520 | 3300039447 | Ga0436361_0243249 | Ga0436361_0243249_1597_2031 | 144 |
| 521 | 3300039447 | Ga0436361_0249401 | Ga0436361_0249401_1302_1742 | 144 |
| 522 | 3300039447 | Ga0436361_0838192 | Ga0436361_0838192_81_563 | 144 |
| 523 | 3300041413 | Ga0439465_0278065 | Ga0439465_0278065_14_463 | 144 |
| 524 | 3300041460 | Ga0451802_1186193 | Ga0451802_1186193_274_735 | 144 |
| 525 | 3300041486 | Ga0451807_0139676 | Ga0451807_0139676_563_1024 | 144 |
| 526 | 3300041496 | Ga0451839_0386240 | Ga0451839_0386240_44_538 | 144 |
| 527 | 3300042004 | Ga0439445_0097801 | Ga0439445_0097801_15_464 | 144 |
| 528 | 3300042008 | Ga0439450_089257 | Ga0439450_089257_76_564 | 144 |
| 529 | 3300042156 | Ga0439446_0002656 | Ga0439446_0002656_3261_3710 | 144 |
| 530 | 3300042439 | Ga0439464_0084663 | Ga0439464_0084663_80_568 | 144 |
| 531 | 3300044656 | Ga0466969_0002272 | Ga0466969_0002272_5578_6027 | 144 |
| 532 | 3300044656 | Ga0466969_0098779 | Ga0466969_0098779_280_720 | 144 |
| 533 | 3300044658 | Ga0466972_0000201 | Ga0466972_0000201_32341_32781 | 144 |
| 534 | 3300044666 | Ga0466977_0003980 | Ga0466977_0003980_3972_4412 | 144 |
| 535 | 3300044673 | Ga0453683_0132239 | Ga0453683_0132239_967_1455 | 144 |
| 536 | 3300044683 | Ga0466965_0018249 | Ga0466965_0018249_2609_3058 | 144 |
| 537 | 3300044684 | Ga0466966_0011912 | Ga0466966_0011912_3482_3916 | 144 |
| 538 | 3300044693 | Ga0466961_0000346 | Ga0466961_0000346_2296_2745 | 144 |
| 539 | 3300044706 | Ga0466964_0300272 | Ga0466964_0300272_53_493 | 144 |
| 540 | 3300044765 | Ga0466970_0123792 | Ga0466970_0123792_344_784 | 144 |
| 541 | 3300045049 | Ga0466959_0010291 | Ga0466959_0010291_3671_4120 | 144 |
| 542 | 3300045051 | Ga0451576_0001125 | Ga0451576_0001125_34603_35046 | 144 |
| 543 | 3300045051 | Ga0451576_0067655 | Ga0451576_0067655_1090_1578 | 144 |
| 544 | 3300045051 | Ga0451576_0126051 | Ga0451576_0126051_1204_1695 | 144 |
| 545 | 3300045051 | Ga0451576_0420271 | Ga0451576_0420271_339_782 | 144 |
| 546 | 3300045836 | Ga0466958_0172756 | Ga0466958_0172756_583_1017 | 144 |
| 547 | 3300045976 | Ga0466967_0352374 | Ga0466967_0352374_568_1038 | 144 |
| 548 | 3300046452 | Ga0495617_005003 | Ga0495617_005003_2536_2979 | 144 |
| 549 | 3300046453 | Ga0495627_000001 | Ga0495627_000001_653151_653591 | 144 |
| 550 | 3300046454 | Ga0495592_0001331 | Ga0495592_0001331_916_1374 | 144 |
| 551 | 3300046454 | Ga0495592_0009127 | Ga0495592_0009127_3076_3510 | 144 |
| 552 | 3300046457 | Ga0495590_0000016 | Ga0495590_0000016_145492_145932 | 144 |
| 553 | 3300046457 | Ga0495590_0001068 | Ga0495590_0001068_3985_4425 | 144 |
| 554 | 3300046457 | Ga0495590_0061628 | Ga0495590_0061628_442_921 | 144 |
| 555 | 3300046459 | Ga0495629_0080697 | Ga0495629_0080697_1031_1489 | 144 |
| 556 | 3300046460 | Ga0495638_0000057 | Ga0495638_0000057_47263_47703 | 144 |
| 557 | 3300046460 | Ga0495638_0021068 | Ga0495638_0021068_1998_2438 | 144 |
| 558 | 3300046460 | Ga0495638_0048429 | Ga0495638_0048429_1383_1823 | 144 |
| 559 | 3300046461 | Ga0495641_0017077 | Ga0495641_0017077_1379_1837 | 144 |
| 560 | 3300046462 | Ga0495651_0001603 | Ga0495651_0001603_2102_2536 | 144 |
| 561 | 3300046462 | Ga0495651_0071910 | Ga0495651_0071910_580_1014 | 144 |
| 562 | 3300046462 | Ga0495651_0852830 | Ga0495651_0852830_87_545 | 144 |
| 563 | 3300046463 | Ga0495653_0006798 | Ga0495653_0006798_8265_8699 | 144 |
| 564 | 3300046463 | Ga0495653_0009105 | Ga0495653_0009105_2195_2653 | 144 |
| 565 | 3300046463 | Ga0495653_0031742 | Ga0495653_0031742_264_704 | 144 |
| 566 | 3300046471 | Ga0495650_0000024 | Ga0495650_0000024_253198_253647 | 144 |
| 567 | 3300046471 | Ga0495650_0002136 | Ga0495650_0002136_438_878 | 144 |
| 568 | 3300046471 | Ga0495650_0031013 | Ga0495650_0031013_1324_1764 | 144 |
| 569 | 3300046472 | Ga0495580_0039205 | Ga0495580_0039205_973_1431 | 144 |
| 570 | 3300046473 | Ga0495582_0115326 | Ga0495582_0115326_618_1076 | 144 |
| 571 | 3300046474 | Ga0495605_0087347 | Ga0495605_0087347_70_549 | 144 |
| 572 | 3300046474 | Ga0495605_0121416 | Ga0495605_0121416_206_640 | 144 |
| 573 | 3300046475 | Ga0495639_0017786 | Ga0495639_0017786_2159_2599 | 144 |
| 574 | 3300046475 | Ga0495639_0037756 | Ga0495639_0037756_1594_2052 | 144 |
| 575 | 3300046477 | Ga0495664_0030191 | Ga0495664_0030191_1742_2200 | 144 |
| 576 | 3300046491 | Ga0495584_0204662 | Ga0495584_0204662_320_754 | 144 |
| 577 | 3300046499 | Ga0495594_0024049 | Ga0495594_0024049_459_917 | 144 |
| 578 | 3300046501 | Ga0495607_0014033 | Ga0495607_0014033_888_1328 | 144 |
| 579 | 3300046501 | Ga0495607_0017745 | Ga0495607_0017745_2831_3271 | 144 |
| 580 | 3300046506 | Ga0495583_0000688 | Ga0495583_0000688_40474_40914 | 144 |
| 581 | 3300046506 | Ga0495583_0007041 | Ga0495583_0007041_2082_2522 | 144 |
| 582 | 3300046506 | Ga0495583_0049408 | Ga0495583_0049408_1209_1688 | 144 |
| 583 | 3300046507 | Ga0495606_0000087 | Ga0495606_0000087_14875_15312 | 144 |
| 584 | 3300046507 | Ga0495606_0000197 | Ga0495606_0000197_99980_100420 | 144 |
| 585 | 3300046507 | Ga0495606_0000573 | Ga0495606_0000573_2424_2864 | 144 |
| 586 | 3300046507 | Ga0495606_0021465 | Ga0495606_0021465_2462_2905 | 144 |
| 587 | 3300046511 | Ga0495608_0008467 | Ga0495608_0008467_4815_5249 | 144 |
| 588 | 3300046511 | Ga0495608_0042836 | Ga0495608_0042836_1022_1480 | 144 |
| 589 | 3300046511 | Ga0495608_0177879 | Ga0495608_0177879_453_905 | 144 |
| 590 | 3300046511 | Ga0495608_0424356 | Ga0495608_0424356_219_653 | 144 |
| 591 | 3300046512 | Ga0495610_0000411 | Ga0495610_0000411_43412_43855 | 144 |
| 592 | 3300046512 | Ga0495610_0001341 | Ga0495610_0001341_19057_19497 | 144 |
| 593 | 3300046512 | Ga0495610_0003847 | Ga0495610_0003847_10442_10885 | 144 |
| 594 | 3300046512 | Ga0495610_0005455 | Ga0495610_0005455_3858_4298 | 144 |
| 595 | 3300046512 | Ga0495610_0160319 | Ga0495610_0160319_450_902 | 144 |
| 596 | 3300046513 | Ga0495616_0024731 | Ga0495616_0024731_1660_2100 | 144 |
| 597 | 3300046514 | Ga0495618_0039205 | Ga0495618_0039205_2323_2757 | 144 |
| 598 | 3300046514 | Ga0495618_0142683 | Ga0495618_0142683_88_546 | 144 |
| 599 | 3300046514 | Ga0495618_0180863 | Ga0495618_0180863_603_1037 | 144 |
| 600 | 3300046515 | Ga0495620_0038664 | Ga0495620_0038664_1108_1557 | 144 |
| 601 | 3300046516 | Ga0495628_0003637 | Ga0495628_0003637_99_557 | 144 |
| 602 | 3300046516 | Ga0495628_0004029 | Ga0495628_0004029_1587_2021 | 144 |
| 603 | 3300046516 | Ga0495628_0023659 | Ga0495628_0023659_2784_3242 | 144 |
| 604 | 3300046516 | Ga0495628_0042761 | Ga0495628_0042761_979_1413 | 144 |
| 605 | 3300046516 | Ga0495628_0117695 | Ga0495628_0117695_798_1256 | 144 |
| 606 | 3300046516 | Ga0495628_0306639 | Ga0495628_0306639_51_485 | 144 |
| 607 | 3300046517 | Ga0495630_0215379 | Ga0495630_0215379_977_1429 | 144 |
| 608 | 3300046517 | Ga0495630_0224436 | Ga0495630_0224436_787_1245 | 144 |
| 609 | 3300046518 | Ga0495631_0005213 | Ga0495631_0005213_1500_1940 | 144 |
| 610 | 3300046518 | Ga0495631_0260269 | Ga0495631_0260269_178_657 | 144 |
| 611 | 3300046519 | Ga0495632_0079055 | Ga0495632_0079055_821_1300 | 144 |
| 612 | 3300046520 | Ga0495637_0027701 | Ga0495637_0027701_1960_2400 | 144 |
| 613 | 3300046520 | Ga0495637_0079617 | Ga0495637_0079617_777_1226 | 144 |
| 614 | 3300046522 | Ga0495643_0000236 | Ga0495643_0000236_78224_78676 | 144 |
| 615 | 3300046522 | Ga0495643_0000289 | Ga0495643_0000289_4814_5257 | 144 |
| 616 | 3300046522 | Ga0495643_0038221 | Ga0495643_0038221_962_1396 | 144 |
| 617 | 3300046523 | Ga0495644_0030618 | Ga0495644_0030618_48_488 | 144 |
| 618 | 3300046524 | Ga0495648_0000002 | Ga0495648_0000002_444402_444842 | 144 |
| 619 | 3300046524 | Ga0495648_0000029 | Ga0495648_0000029_210677_211117 | 144 |
| 620 | 3300046524 | Ga0495648_0011919 | Ga0495648_0011919_1787_2230 | 144 |
| 621 | 3300046524 | Ga0495648_0014417 | Ga0495648_0014417_88_537 | 144 |
| 622 | 3300046526 | Ga0495666_0032341 | Ga0495666_0032341_207_665 | 144 |
| 623 | 3300046526 | Ga0495666_0520350 | Ga0495666_0520350_35_475 | 144 |
| 624 | 3300046528 | Ga0495642_0003652 | Ga0495642_0003652_2384_2818 | 144 |
| 625 | 3300046528 | Ga0495642_0003770 | Ga0495642_0003770_3379_3819 | 144 |
| 626 | 3300046528 | Ga0495642_0318785 | Ga0495642_0318785_102_551 | 144 |
| 627 | 3300046529 | Ga0495652_0004166 | Ga0495652_0004166_1858_2292 | 144 |
| 628 | 3300046529 | Ga0495652_0009851 | Ga0495652_0009851_3899_4333 | 144 |
| 629 | 3300046529 | Ga0495652_0167549 | Ga0495652_0167549_1159_1593 | 144 |
| 630 | 3300046529 | Ga0495652_0509591 | Ga0495652_0509591_113_565 | 144 |
| 631 | 3300046530 | Ga0495654_0000226 | Ga0495654_0000226_20937_21386 | 144 |
| 632 | 3300046531 | Ga0495665_0039110 | Ga0495665_0039110_908_1366 | 144 |
| 633 | 3300046533 | Ga0495640_0006764 | Ga0495640_0006764_6339_6797 | 144 |
| 634 | 3300046535 | Ga0495586_0005800 | Ga0495586_0005800_4742_5182 | 144 |
| 635 | 3300046535 | Ga0495586_0096953 | Ga0495586_0096953_986_1444 | 144 |
| 636 | 3300046538 | Ga0495609_0000142 | Ga0495609_0000142_69686_70126 | 144 |
| 637 | 3300046538 | Ga0495609_0022634 | Ga0495609_0022634_2055_2495 | 144 |
| 638 | 3300046538 | Ga0495609_0085568 | Ga0495609_0085568_265_744 | 144 |
| 639 | 3300046538 | Ga0495609_0087897 | Ga0495609_0087897_789_1229 | 144 |
| 640 | 3300046539 | Ga0495621_0007826 | Ga0495621_0007826_348_800 | 144 |
| 641 | 3300046542 | Ga0495597_0000025 | Ga0495597_0000025_96937_97377 | 144 |
| 642 | 3300046542 | Ga0495597_0000848 | Ga0495597_0000848_20280_20732 | 144 |
| 643 | 3300046542 | Ga0495597_0002887 | Ga0495597_0002887_6362_6796 | 144 |
| 644 | 3300046542 | Ga0495597_0085573 | Ga0495597_0085573_289_729 | 144 |
| 645 | 3300046543 | Ga0495645_0003192 | Ga0495645_0003192_1595_2053 | 144 |
| 646 | 3300046543 | Ga0495645_0118995 | Ga0495645_0118995_1080_1514 | 144 |
| 647 | 3300046543 | Ga0495645_0124023 | Ga0495645_0124023_176_610 | 144 |
| 648 | 3300046543 | Ga0495645_0593444 | Ga0495645_0593444_209_661 | 144 |
| 649 | 3300046557 | Ga0495622_0000816 | Ga0495622_0000816_2462_2902 | 144 |
| 650 | 3300046558 | Ga0495633_0000073 | Ga0495633_0000073_125249_125689 | 144 |
| 651 | 3300046558 | Ga0495633_0000399 | Ga0495633_0000399_4658_5098 | 144 |
| 652 | 3300046559 | Ga0495667_0021617 | Ga0495667_0021617_470_928 | 144 |
| 653 | 3300046615 | Ga0495656_0160361 | Ga0495656_0160361_394_834 | 144 |
| 654 | 3300046616 | Ga0495668_0000020 | Ga0495668_0000020_364129_364569 | 144 |
| 655 | 3300046616 | Ga0495668_0000083 | Ga0495668_0000083_48251_48691 | 144 |
| 656 | 3300046616 | Ga0495668_0000132 | Ga0495668_0000132_88255_88695 | 144 |
| 657 | 3300046616 | Ga0495668_0011331 | Ga0495668_0011331_4118_4558 | 144 |
| 658 | 3300046642 | Ga0495634_0044238 | Ga0495634_0044238_1959_2417 | 144 |
| 659 | 3300046660 | Ga0495625_0000177 | Ga0495625_0000177_4594_5034 | 144 |
| 660 | 3300046660 | Ga0495625_0000398 | Ga0495625_0000398_51313_51762 | 144 |
| 661 | 3300046660 | Ga0495625_0006383 | Ga0495625_0006383_5591_6070 | 144 |
| 662 | 3300046660 | Ga0495625_0093220 | Ga0495625_0093220_935_1375 | 144 |
| 663 | 3300046660 | Ga0495625_0093397 | Ga0495625_0093397_726_1169 | 144 |
| 664 | 3300046660 | Ga0495625_0157726 | Ga0495625_0157726_283_723 | 144 |
| 665 | 3300046663 | Ga0495635_0028001 | Ga0495635_0028001_1727_2167 | 144 |
| 666 | 3300046664 | Ga0495659_0010327 | Ga0495659_0010327_2454_2894 | 144 |
| 667 | 3300046665 | Ga0495661_0001089 | Ga0495661_0001089_11447_11881 | 144 |
| 668 | 3300046678 | Ga0495599_0013823 | Ga0495599_0013823_3677_4111 | 144 |
| 669 | 3300046678 | Ga0495599_0099917 | Ga0495599_0099917_937_1395 | 144 |
| 670 | 3300046678 | Ga0495599_0141046 | Ga0495599_0141046_919_1377 | 144 |
| 671 | 3300046679 | Ga0495623_0036186 | Ga0495623_0036186_863_1297 | 144 |
| 672 | 3300046679 | Ga0495623_0130966 | Ga0495623_0130966_850_1302 | 144 |
| 673 | 3300046679 | Ga0495623_0572068 | Ga0495623_0572068_76_510 | 144 |
| 674 | 3300046680 | Ga0495646_0035836 | Ga0495646_0035836_223_657 | 144 |
| 675 | 3300046680 | Ga0495646_0133487 | Ga0495646_0133487_830_1264 | 144 |
| 676 | 3300046681 | Ga0495647_0004559 | Ga0495647_0004559_753_1211 | 144 |
| 677 | 3300046683 | Ga0495658_0326515 | Ga0495658_0326515_88_522 | 144 |
| 678 | 3300046684 | Ga0495669_0006738 | Ga0495669_0006738_3741_4181 | 144 |
| 679 | 3300046689 | Ga0495613_0051783 | Ga0495613_0051783_1878_2318 | 144 |
| 680 | 3300046689 | Ga0495613_0100713 | Ga0495613_0100713_865_1323 | 144 |
| 681 | 3300046690 | Ga0495624_0010151 | Ga0495624_0010151_5209_5667 | 144 |
| 682 | 3300046690 | Ga0495624_0012877 | Ga0495624_0012877_233_667 | 144 |
| 683 | 3300046691 | Ga0495670_0046542 | Ga0495670_0046542_1233_1688 | 144 |
| 684 | 3300046692 | Ga0495671_0151936 | Ga0495671_0151936_167_607 | 144 |
| 685 | 3300046692 | Ga0495671_0172888 | Ga0495671_0172888_397_840 | 144 |
| 686 | 3300046694 | Ga0495649_0004026 | Ga0495649_0004026_1705_2184 | 144 |
| 687 | 3300046694 | Ga0495649_0011278 | Ga0495649_0011278_2764_3207 | 144 |
| 688 | 3300046694 | Ga0495649_0056866 | Ga0495649_0056866_318_758 | 144 |
| 689 | 3300046694 | Ga0495649_0112244 | Ga0495649_0112244_227_670 | 144 |
| 690 | 3300046809 | Ga0495600_0000478 | Ga0495600_0000478_1617_2051 | 144 |
| 691 | 3300046809 | Ga0495600_0003656 | Ga0495600_0003656_6198_6656 | 144 |
| 692 | 3300046809 | Ga0495600_0099784 | Ga0495600_0099784_628_1068 | 144 |
| 693 | 3300046810 | Ga0495660_0000473 | Ga0495660_0000473_1568_2008 | 144 |
| 694 | 3300046810 | Ga0495660_0001536 | Ga0495660_0001536_10426_10872 | 144 |
| 695 | 3300046810 | Ga0495660_0106062 | Ga0495660_0106062_130_582 | 144 |
| 696 | 3300046810 | Ga0495660_0300672 | Ga0495660_0300672_180_659 | 144 |
| 697 | 3300047317 | Ga0495604_0033684 | Ga0495604_0033684_793_1233 | 144 |
| 698 | 3300047317 | Ga0495604_0034831 | Ga0495604_0034831_55_513 | 144 |
| 699 | 3300047317 | Ga0495604_0051203 | Ga0495604_0051203_2441_2875 | 144 |
| 700 | 3300047320 | Ga0495672_0000291 | Ga0495672_0000291_66530_66973 | 144 |
| 701 | 3300047320 | Ga0495672_0041061 | Ga0495672_0041061_2199_2648 | 144 |
| 702 | 3300047322 | Ga0495680_0035304 | Ga0495680_0035304_1134_1574 | 144 |
| 703 | 3300047322 | Ga0495680_0073112 | Ga0495680_0073112_190_648 | 144 |
| 704 | 3300047443 | Ga0495687_002232 | Ga0495687_002232_10552_10986 | 144 |
| 705 | 3300047443 | Ga0495687_003651 | Ga0495687_003651_10470_10922 | 144 |
| 706 | 3300047443 | Ga0495687_005190 | Ga0495687_005190_7921_8373 | 144 |
| 707 | 3300047443 | Ga0495687_012943 | Ga0495687_012943_3005_3445 | 144 |
| 708 | 3300047444 | Ga0495675_0053079 | Ga0495675_0053079_955_1395 | 144 |
| 709 | 3300047446 | Ga0495679_018373 | Ga0495679_018373_1853_2293 | 144 |
| 710 | 3300047447 | Ga0495685_006052 | Ga0495685_006052_2657_3097 | 144 |
| 711 | 3300047469 | Ga0495673_0000015 | Ga0495673_0000015_517976_518419 | 144 |
| 712 | 3300047469 | Ga0495673_0000342 | Ga0495673_0000342_25620_26060 | 144 |
| 713 | 3300047470 | Ga0495681_0021834 | Ga0495681_0021834_1881_2321 | 144 |
| 714 | 3300047470 | Ga0495681_0089671 | Ga0495681_0089671_32_472 | 144 |
| 715 | 3300047471 | Ga0495684_0025249 | Ga0495684_0025249_2574_3032 | 144 |
| 716 | 3300047471 | Ga0495684_0882939 | Ga0495684_0882939_109_561 | 144 |
| 717 | 3300047472 | Ga0495686_0001836 | Ga0495686_0001836_3343_3783 | 144 |
| 718 | 3300047472 | Ga0495686_0002827 | Ga0495686_0002827_6586_7026 | 144 |
| 719 | 3300047472 | Ga0495686_0003434 | Ga0495686_0003434_2792_3241 | 144 |
| 720 | 3300047472 | Ga0495686_0145250 | Ga0495686_0145250_204_644 | 144 |
| 721 | 3300047673 | Ga0495593_0040204 | Ga0495593_0040204_1943_2383 | 144 |
| 722 | 3300048088 | Ga0495602_0029056 | Ga0495602_0029056_3789_4223 | 144 |
| 723 | 3300048089 | Ga0495614_0013697 | Ga0495614_0013697_2841_3281 | 144 |
| 724 | 3300048089 | Ga0495614_0174881 | Ga0495614_0174881_75_533 | 144 |
| 725 | 3300048090 | Ga0495615_0040844 | Ga0495615_0040844_124_558 | 144 |
| 726 | 3300048916 | Ga0496113_0378531 | Ga0496113_0378531_466_906 | 144 |
| 727 | 3300048919 | Ga0496116_0250253 | Ga0496116_0250253_170_604 | 144 |
| 728 | 3300048924 | Ga0496121_0015651 | Ga0496121_0015651_2627_3064 | 144 |
| 729 | 3300048924 | Ga0496121_0360422 | Ga0496121_0360422_317_790 | 144 |
| 730 | 3300048924 | Ga0496121_0452610 | Ga0496121_0452610_294_767 | 144 |
| 731 | 3300048927 | Ga0496124_0094251 | Ga0496124_0094251_1221_1667 | 144 |
| 732 | 3300049459 | Ga0495678_000002 | Ga0495678_000002_562444_562890 | 144 |
| 733 | 3300049459 | Ga0495678_000069 | Ga0495678_000069_47823_48266 | 144 |
| 734 | 3300049459 | Ga0495678_004395 | Ga0495678_004395_608_1048 | 144 |
| 735 | 3300049459 | Ga0495678_067392 | Ga0495678_067392_259_711 | 144 |
| 736 | 3300049459 | Ga0495678_135256 | Ga0495678_135256_114_554 | 144 |
| 737 | 3300049459 | Ga0495678_185638 | Ga0495678_185638_135_575 | 144 |
| 738 | 3300049656 | Ga0501209_000276 | Ga0501209_000276_312_755 | 144 |
| 739 | 3300049662 | Ga0501222_001905 | Ga0501222_001905_1730_2170 | 144 |
| 740 | 3300049665 | Ga0501227_009261 | Ga0501227_009261_1246_1686 | 144 |
| 741 | 3300049758 | Ga0501241_065884 | Ga0501241_065884_147_590 | 144 |
| 742 | 3300049764 | Ga0501267_004127 | Ga0501267_004127_294_776 | 144 |
| 743 | 3300049775 | Ga0501279_001113 | Ga0501279_001113_2179_2619 | 144 |
| 744 | 3300050489 | nmdc:mga03683_548786_c1 | nmdc:mga03683_548786_c1_41_502 | 144 |
| 745 | 3300050489 | nmdc:mga03683_58940_c1 | nmdc:mga03683_58940_c1_116_595 | 144 |
| 746 | 3300050491 | nmdc:mga00v17_71067_c1 | nmdc:mga00v17_71067_c1_336_815 | 144 |
| 747 | 3300050492 | nmdc:mga0yw44_265632_c1 | nmdc:mga0yw44_265632_c1_197_676 | 144 |
| 748 | 3300050493 | nmdc:mga0k408_213381_c1 | nmdc:mga0k408_213381_c1_197_676 | 144 |
| 749 | 3300050493 | nmdc:mga0k408_28421_c1 | nmdc:mga0k408_28421_c1_1240_1719 | 144 |
| 750 | 3300050493 | nmdc:mga0k408_95774_c1 | nmdc:mga0k408_95774_c1_936_1415 | 144 |
| 751 | 3300050494 | nmdc:mga06z11_62243_c1 | nmdc:mga06z11_62243_c1_231_710 | 144 |
| 752 | 3300050496 | nmdc:mga07m45_474_c1 | nmdc:mga07m45_474_c1_8786_9265 | 144 |
| 753 | 3300050496 | nmdc:mga07m45_73561_c1 | nmdc:mga07m45_73561_c1_1447_1899 | 144 |
| 754 | 3300050496 | nmdc:mga07m45_74368_c1 | nmdc:mga07m45_74368_c1_678_1157 | 144 |
| 755 | 3300050496 | nmdc:mga07m45_880_c1 | nmdc:mga07m45_880_c1_8940_9419 | 144 |
| 756 | 3300050507 | nmdc:mga05p37_46673_c1 | nmdc:mga05p37_46673_c1_3986_4441 | 144 |
| 757 | 3300050507 | nmdc:mga05p37_581215_c1 | nmdc:mga05p37_581215_c1_405_893 | 144 |
| 758 | 3300050508 | nmdc:mga09592_512124_c1 | nmdc:mga09592_512124_c1_199_687 | 144 |
| 759 | 3300050509 | nmdc:mga0qj67_901582_c1 | nmdc:mga0qj67_901582_c1_100_588 | 144 |
| 760 | 3300050510 | nmdc:mga06r32_125092_c1 | nmdc:mga06r32_125092_c1_796_1284 | 144 |
| 761 | 3300050511 | nmdc:mga08y16_827742_c1 | nmdc:mga08y16_827742_c1_356_844 | 144 |
| 762 | 3300050512 | nmdc:mga0n895_85688_c1 | nmdc:mga0n895_85688_c1_1201_1689 | 144 |
| 763 | 3300050513 | nmdc:mga0rr50_9567_c1 | nmdc:mga0rr50_9567_c1_3456_3944 | 144 |
| 764 | 3300050514 | nmdc:mga08x19_177540_c1 | nmdc:mga08x19_177540_c1_446_934 | 144 |
| 765 | 3300050515 | nmdc:mga0a205_84522_c1 | nmdc:mga0a205_84522_c1_1240_1728 | 144 |
| 766 | 3300050516 | nmdc:mga0sz30_37768_c1 | nmdc:mga0sz30_37768_c1_525_1004 | 144 |
| 767 | 3300053077 | Ga0495601_0000453 | Ga0495601_0000453_17431_17889 | 144 |
| 768 | 3300053077 | Ga0495601_0145738 | Ga0495601_0145738_880_1314 | 144 |
| 769 | 3300053084 | Ga0495595_0006874 | Ga0495595_0006874_2521_2979 | 144 |
| 770 | 3300053085 | Ga0495619_0476348 | Ga0495619_0476348_168_602 | 144 |
| 771 | 3300053085 | Ga0495619_0878273 | Ga0495619_0878273_82_534 | 144 |
| 772 | 3300053086 | Ga0500578_0000102 | Ga0500578_0000102_67039_67479 | 144 |
| 773 | 3300053088 | Ga0500644_0000290 | Ga0500644_0000290_17591_18031 | 144 |
| 774 | 3300053091 | Ga0500647_0083826 | Ga0500647_0083826_516_995 | 144 |
| 775 | 3300053094 | Ga0500566_0491563 | Ga0500566_0491563_62_511 | 144 |
| 776 | 3300053096 | Ga0500641_0178453 | Ga0500641_0178453_28_468 | 144 |
| 777 | 3300053104 | Ga0500556_0374510 | Ga0500556_0374510_25_465 | 144 |
| 778 | 3300053108 | Ga0500562_003539 | Ga0500562_003539_1661_2101 | 144 |
| 779 | 3300053111 | Ga0500572_012234 | Ga0500572_012234_891_1325 | 144 |
| 780 | 3300053118 | Ga0500594_0000540 | Ga0500594_0000540_7239_7679 | 144 |
| 781 | 3300053118 | Ga0500594_0024002 | Ga0500594_0024002_41_484 | 144 |
| 782 | 3300053119 | Ga0500595_003284 | Ga0500595_003284_6997_7431 | 144 |
| 783 | 3300053125 | Ga0500618_001087 | Ga0500618_001087_10483_10917 | 144 |
| 784 | 3300053125 | Ga0500618_001190 | Ga0500618_001190_9775_10209 | 144 |
| 785 | 3300053138 | Ga0500564_000289 | Ga0500564_000289_12787_13227 | 144 |
| 786 | 3300053139 | Ga0500568_0048037 | Ga0500568_0048037_305_784 | 144 |
| 787 | 3300053140 | Ga0500573_0201861 | Ga0500573_0201861_171_605 | 144 |
| 788 | 3300053141 | Ga0500574_000188 | Ga0500574_000188_2383_2817 | 144 |
| 789 | 3300053145 | Ga0500586_006749 | Ga0500586_006749_397_849 | 144 |
| 790 | 3300053148 | Ga0500590_017522 | Ga0500590_017522_1324_1806 | 144 |
| 791 | 3300053153 | Ga0500616_0012668 | Ga0500616_0012668_425_874 | 144 |
| 792 | 3300053154 | Ga0500619_000268 | Ga0500619_000268_2378_2812 | 144 |
| 793 | 3300053156 | Ga0500622_0000674 | Ga0500622_0000674_13873_14313 | 144 |
| 794 | 3300053156 | Ga0500622_0073508 | Ga0500622_0073508_572_1021 | 144 |
| 795 | 3300053158 | Ga0500627_0028183 | Ga0500627_0028183_265_714 | 144 |
| 796 | 3300059421 | Ga0590071_003614 | Ga0590071_003614_2616_3080 | 144 |
| 797 | 3300059423 | Ga0590074_069989 | Ga0590074_069989_149_613 | 144 |
| 798 | 3300059493 | Ga0587077_016128 | Ga0587077_016128_361_795 | 144 |
| 799 | 3300059641 | Ga0587068_020103 | Ga0587068_020103_195_629 | 144 |
| 800 | 3300061719 | Ga0466962_0333809 | Ga0466962_0333809_78_512 | 144 |
| 801 | 3300006353 | Ga0075370_10007532 | Ga0075370_100075323 | 145 |
| 802 | 3300042012 | Ga0439455_0040202 | Ga0439455_0040202_261_737 | 145 |
| 803 | 3300046452 | Ga0495617_000013 | Ga0495617_000013_37907_38350 | 145 |
| 804 | 3300046460 | Ga0495638_0121115 | Ga0495638_0121115_855_1298 | 145 |
| 805 | 3300046463 | Ga0495653_0000025 | Ga0495653_0000025_122146_122589 | 145 |
| 806 | 3300046471 | Ga0495650_0000289 | Ga0495650_0000289_89404_89847 | 145 |
| 807 | 3300046492 | Ga0495585_0019035 | Ga0495585_0019035_649_1092 | 145 |
| 808 | 3300046507 | Ga0495606_0000137 | Ga0495606_0000137_4543_4986 | 145 |
| 809 | 3300046512 | Ga0495610_0000008 | Ga0495610_0000008_548645_549088 | 145 |
| 810 | 3300046524 | Ga0495648_0103863 | Ga0495648_0103863_33_476 | 145 |
| 811 | 3300046530 | Ga0495654_0031792 | Ga0495654_0031792_232_675 | 145 |
| 812 | 3300046616 | Ga0495668_0002007 | Ga0495668_0002007_12834_13277 | 145 |
| 813 | 3300046665 | Ga0495661_0160929 | Ga0495661_0160929_723_1166 | 145 |
| 814 | 3300046692 | Ga0495671_0000002 | Ga0495671_0000002_1063606_1064049 | 145 |
| 815 | 3300046810 | Ga0495660_0042988 | Ga0495660_0042988_2032_2475 | 145 |
| 816 | 3300047446 | Ga0495679_047697 | Ga0495679_047697_604_1047 | 145 |
| 817 | 3300047469 | Ga0495673_0000005 | Ga0495673_0000005_912672_913115 | 145 |
| 818 | 3300047469 | Ga0495673_0000044 | Ga0495673_0000044_244701_245144 | 145 |
| 819 | 3300048919 | Ga0496116_0206079 | Ga0496116_0206079_441_884 | 145 |
| 820 | 3300048926 | Ga0496123_0023256 | Ga0496123_0023256_3713_4156 | 145 |
| 821 | 3300053145 | Ga0500586_026623 | Ga0500586_026623_1114_1557 | 145 |
| 822 | iso_pu_bacteria | 2511231003 | 2511250096 | 145 |
| 823 | iso_pu_bacteria | 2548876994 | 2550693620 | 145 |
| 824 | iso_pu_bacteria | 2818991445 | 2819592075 | 145 |
| 825 | iso_pu_bacteria | 2884811622 | 2884816936 | 145 |
| 826 | iso_pu_bacteria | 2884836552 | 2884840507 | 145 |
| 827 | iso_pu_bacteria | 2884852848 | 2884855764 | 145 |
| 828 | iso_pu_bacteria | 2896154374 | 2896157311 | 145 |
| 829 | 3300003322 | rootL2_10034610 | rootL2_100346106 | 146 |
| 830 | 3300025920 | Ga0207649_10332933 | Ga0207649_103329331 | 146 |
| 831 | 3300048917 | Ga0496114_0077477 | Ga0496114_0077477_350_790 | 146 |
| 832 | 3300048928 | Ga0496125_0000734 | Ga0496125_0000734_41805_42245 | 146 |
| 833 | 3300048929 | Ga0496126_0156518 | Ga0496126_0156518_206_646 | 146 |
| 834 | 3300031251 | Ga0265327_10093622 | Ga0265327_100936222 | 147 |
| 835 | 3300002704 | JGI25155J39150_1000204 | JGI25155J39150_10002047 | 149 |
| 836 | 3300002705 | JGI25156J39149_1000154 | JGI25156J39149_100015429 | 149 |
| 837 | 3300002738 | JGI25154J39366_1000462 | JGI25154J39366_10004626 | 149 |
| 838 | 3300002741 | JGI25157J39369_1000169 | JGI25157J39369_100016920 | 149 |
| 839 | 3300003758 | Ga0055532_1000017 | Ga0055532_1000017187 | 149 |
| 840 | 3300003761 | Ga0055535_1007775 | Ga0055535_10077753 | 149 |
| 841 | 3300025206 | Ga0209435_100015 | Ga0209435_100015201 | 149 |
| 842 | 3300025229 | Ga0209147_100004 | Ga0209147_1000041025 | 149 |
| 843 | 3300025233 | Ga0209437_100045 | Ga0209437_100045344 | 149 |
| 844 | 3300025242 | Ga0209258_100226 | Ga0209258_10022614 | 149 |
| 845 | 3300025246 | Ga0209646_1000040 | Ga0209646_1000040231 | 149 |
| 846 | 3300025250 | Ga0209026_1000034 | Ga0209026_100003488 | 149 |
| 847 | 3300025254 | Ga0209148_1025257 | Ga0209148_10252572 | 149 |
| 848 | 3300025256 | Ga0209759_1000049 | Ga0209759_1000049115 | 149 |
| 849 | 3300025272 | Ga0209455_1002265 | Ga0209455_10022654 | 149 |
| 850 | 3300026116 | Ga0207674_10168123 | Ga0207674_101681233 | 149 |
| 851 | 3300046660 | Ga0495625_0002519 | Ga0495625_0002519_2557_3006 | 149 |
| 852 | 3300048928 | Ga0496125_0004104 | Ga0496125_0004104_201_650 | 149 |
| 853 | iso_pu_bacteria | 2521172590 | 2521559372 | 149 |
| 854 | 3300002739 | JGI25158J39367_1012090 | JGI25158J39367_10120902 | 150 |
| 855 | 3300002987 | JGI25159J45721_1001688 | JGI25159J45721_10016889 | 150 |
| 856 | 3300005262 | Ga0065165_1000005 | Ga0065165_100000514 | 150 |
| 857 | 3300025284 | Ga0209130_1000046 | Ga0209130_1000046139 | 150 |
| 858 | 3300028786 | Ga0307517_10132307 | Ga0307517_101323071 | 151 |
| 859 | 3300031456 | Ga0307513_10189608 | Ga0307513_101896082 | 151 |
| 860 | 3300048088 | Ga0495602_0096376 | Ga0495602_0096376_637_1092 | 151 |
| 861 | 3300002704 | JGI25155J39150_1000132 | JGI25155J39150_100013217 | 154 |
| 862 | 3300002738 | JGI25154J39366_1000401 | JGI25154J39366_100040120 | 154 |
| 863 | 3300006175 | Ga0070712_100010843 | Ga0070712_1000108435 | 154 |
| 864 | 3300009093 | Ga0105240_10143049 | Ga0105240_101430492 | 154 |
| 865 | 3300009545 | Ga0105237_10157015 | Ga0105237_101570153 | 154 |
| 866 | 3300009551 | Ga0105238_10000213 | Ga0105238_100002134 | 154 |
| 867 | 3300010375 | Ga0105239_10690031 | Ga0105239_106900312 | 154 |
| 868 | 3300015261 | Ga0182006_1005802 | Ga0182006_10058026 | 154 |
| 869 | 3300025206 | Ga0209435_100162 | Ga0209435_1001624 | 154 |
| 870 | 3300025246 | Ga0209646_1000020 | Ga0209646_1000020174 | 154 |
| 871 | 3300025256 | Ga0209759_1000809 | Ga0209759_100080921 | 154 |
| 872 | 3300025913 | Ga0207695_10001039 | Ga0207695_1000103916 | 154 |
| 873 | 3300025913 | Ga0207695_10116269 | Ga0207695_101162694 | 154 |
| 874 | 3300025914 | Ga0207671_10086655 | Ga0207671_100866553 | 154 |
| 875 | 3300025915 | Ga0207693_10072058 | Ga0207693_100720581 | 154 |
| 876 | 3300025949 | Ga0207667_10030385 | Ga0207667_100303852 | 154 |
| 877 | 3300048920 | Ga0496117_0328193 | Ga0496117_0328193_92_562 | 154 |
| 878 | 3300048924 | Ga0496121_0042446 | Ga0496121_0042446_2551_3021 | 154 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1wsj-assembly7.cif.gz_G | crystal structure of e.coli rnase hi active site mutant (k87a/h124a) | 0.9891 | 11 | 151 |
| 1wsh-assembly3.cif.gz_C | crystal structure of e.coli rnase hi active site mutant (e48a/k87a) | 0.9867 | 11 | 152 |
| 7vsa-assembly1.cif.gz_A | e. coli ribonuclease hi in complex with two mg2+ | 0.9859 | 11 | 151 |
| 1wsi-assembly2.cif.gz_B | crystal structure of e.coli rnase hi active site mutant (e48a/k87a/d134n) | 0.9859 | 11 | 151 |
| 1wsj-assembly3.cif.gz_C | crystal structure of e.coli rnase hi active site mutant (k87a/h124a) | 0.985 | 11 | 151 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1jl2C00 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.9738 | 13 | 151 | 3.30.420.10 |
| 2zqbB00 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.9714 | 11 | 154 | 3.30.420.10 |
| 2zqbB00 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.9199 | 11 | 154 | 3.30.420.10 |
| af_Q86MG7_99_246_3.30.420.10 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.9087 | 15 | 151 | 3.30.420.10 |
| 4ibnA01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.8997 | 11 | 154 | 3.30.420.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A527HH28-F1-model_v4 | deleted | 1.004 | 11 | 82 |
|
| AF-A0A2N3AU90-F1-model_v4 | Ribonuclease HI | 0.9984 | 11 | 93 |
GO:0003676
GO:0004523 |
| AF-A0A3D0XTL9-F1-model_v4 | Ribonuclease HI | 0.9964 | 11 | 74 |
GO:0003676
GO:0004523 |
| AF-A0A381ZS24-F1-model_v4 | ribonuclease H (EC 3.1.26.4) | 0.9962 | 11 | 94 |
GO:0003676
GO:0004523 GO:0043137 |
| AF-A0A661FLC7-F1-model_v4 | ribonuclease H (EC 3.1.26.4) | 0.9958 | 26 | 153 |
GO:0003676
GO:0004523 GO:0043137 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar