F484370
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 876 | 379 | 1752 | 206 |
Family's Representative Sequence
| Representative Sequence | 3300049584|Ga0501068_0016213|Ga0501068_0016213_2978_3673 |
| Length | 231 |
| Sequence | VAQRGGQAKPSDGVAERGEEVRVHMAHEKHRLVAVGNLQEFFRDALHSAMSHQKLAVHDHTEHYVVNLLTLFSRADALYERTAHGVRLKPLVVMLAEALEAPSASERNRALQRLGDVSLFIAGFFAGSFARKLIDIDYHIAMGGRAYGSLADFMSRGRGQALAGVFEELAQKFQRLVDALNEVSEMAHTHTDRDILRLYEIWMKTGSRRAQALLRKLDVEPALAARTPFRH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 2 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 76 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 77 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 83 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 90 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 91 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 105 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 125 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 126 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 189 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 193 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 194 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 195 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 196 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 197 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 198 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 199 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 200 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 201 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 202 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 203 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 204 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 205 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 206 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 207 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 208 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 209 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 210 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 211 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 212 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 213 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 214 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 215 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 216 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 217 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 218 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 219 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 220 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 221 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 222 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 223 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 224 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 225 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 226 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 227 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 228 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 229 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 230 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 231 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 232 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 233 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 234 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 235 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 236 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 237 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 238 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 239 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 240 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 241 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 242 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 243 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 244 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 245 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 246 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 247 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 248 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 249 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 250 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 251 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 252 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 253 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 254 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 255 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 256 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 257 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 258 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 259 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 260 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 261 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 262 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 263 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 264 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 265 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 266 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 267 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 268 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 269 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 270 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 271 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 272 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 273 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 274 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 275 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 276 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 301 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 303 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 304 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 305 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 306 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 307 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 308 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 309 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 310 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 311 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 312 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 313 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 314 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 315 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 316 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 317 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 318 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 319 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 320 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 321 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 322 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 323 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 324 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 362 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 363 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 364 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 365 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 366 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 367 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 368 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 369 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 370 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 371 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 372 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 373 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 374 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 375 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 376 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 379 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.54 |
| Metatranscriptomes | 0.46 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.42 |
| Nodule | 0 |
| Rhizoplane | 3.08 |
| Rhizosphere | 88.36 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 26.03 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501068_0016213 | 3300049584 | Bacteria | 4294 |
| 2 | JGI24744J21845_10014774 | 3300002077 | Bacteria | 1565 |
| 3 | JGI25406J46586_10038756 | 3300003203 | Bacteria | 1705 |
| 4 | rootH2_10010996 | 3300003320 | Bacteria | 4100 |
| 5 | rootL2_10336540 | 3300003322 | Bacteria | 2110 |
| 6 | rootH1_10317689 | 3300003323 | Bacteria | 1673 |
| 7 | Ga0065712_10074314 | 3300005290 | Unclassified | 4126 |
| 8 | Ga0065715_10113859 | 3300005293 | Bacteria | 2472 |
| 9 | Ga0065707_10082386 | 3300005295 | Bacteria | 15797 |
| 10 | Ga0065707_10083134 | 3300005295 | Bacteria | 10277 |
| 11 | Ga0070683_100053089 | 3300005329 | Bacteria | 3756 |
| 12 | Ga0070683_100089296 | 3300005329 | Bacteria | 2892 |
| 13 | Ga0070683_100408406 | 3300005329 | Bacteria | 1295 |
| 14 | Ga0070690_100006941 | 3300005330 | Bacteria | 6444 |
| 15 | Ga0070670_100008276 | 3300005331 | Bacteria | 8855 |
| 16 | Ga0070670_100502870 | 3300005331 | Bacteria | 1078 |
| 17 | Ga0070677_10427100 | 3300005333 | Unclassified | 704 |
| 18 | Ga0068869_100025118 | 3300005334 | Bacteria | 4134 |
| 19 | Ga0068869_100079555 | 3300005334 | Unclassified | 2443 |
| 20 | Ga0068869_100220572 | 3300005334 | Unclassified | 1503 |
| 21 | Ga0070666_10011857 | 3300005335 | Bacteria | 5482 |
| 22 | Ga0070666_10775257 | 3300005335 | Unclassified | 705 |
| 23 | Ga0070680_100002053 | 3300005336 | Bacteria | 14852 |
| 24 | Ga0070680_100004832 | 3300005336 | Bacteria | 10144 |
| 25 | Ga0070680_100188638 | 3300005336 | Unclassified | 1737 |
| 26 | Ga0070680_100312177 | 3300005336 | Bacteria | 1334 |
| 27 | Ga0070680_100336173 | 3300005336 | Unclassified | 1283 |
| 28 | Ga0070682_100046755 | 3300005337 | Unclassified | 2687 |
| 29 | Ga0068868_100023884 | 3300005338 | Bacteria | 4632 |
| 30 | Ga0070660_100277047 | 3300005339 | Bacteria | 1372 |
| 31 | Ga0070660_100717047 | 3300005339 | Unclassified | 839 |
| 32 | Ga0070689_100003722 | 3300005340 | Bacteria | 10206 |
| 33 | Ga0070687_100001064 | 3300005343 | Bacteria | 9391 |
| 34 | Ga0070661_100004428 | 3300005344 | Bacteria | 9681 |
| 35 | Ga0070661_100240763 | 3300005344 | Bacteria | 1393 |
| 36 | Ga0070661_100375907 | 3300005344 | Bacteria | 1119 |
| 37 | Ga0070661_100637126 | 3300005344 | Unclassified | 864 |
| 38 | Ga0070692_10281632 | 3300005345 | Bacteria | 1008 |
| 39 | Ga0070668_100121305 | 3300005347 | Unclassified | 2090 |
| 40 | Ga0070669_100008029 | 3300005353 | Bacteria | 7535 |
| 41 | Ga0070669_100026375 | 3300005353 | Bacteria | 4181 |
| 42 | Ga0070669_100567582 | 3300005353 | Bacteria | 948 |
| 43 | Ga0070675_100006841 | 3300005354 | Bacteria | 8757 |
| 44 | Ga0070675_100010323 | 3300005354 | Bacteria | 7291 |
| 45 | Ga0070671_100001079 | 3300005355 | Bacteria | 20179 |
| 46 | Ga0070671_100006515 | 3300005355 | Bacteria | 9333 |
| 47 | Ga0070671_100067611 | 3300005355 | Bacteria | 2979 |
| 48 | Ga0070674_100696294 | 3300005356 | Unclassified | 868 |
| 49 | Ga0070673_100000998 | 3300005364 | Bacteria | 16053 |
| 50 | Ga0070673_100011800 | 3300005364 | Bacteria | 5979 |
| 51 | Ga0070688_100076614 | 3300005365 | Bacteria | 2153 |
| 52 | Ga0070667_100000395 | 3300005367 | Bacteria | 47219 |
| 53 | Ga0070667_100005556 | 3300005367 | Bacteria | 10521 |
| 54 | Ga0070667_100202092 | 3300005367 | Unclassified | 1763 |
| 55 | Ga0070667_100290889 | 3300005367 | Bacteria | 1469 |
| 56 | Ga0070709_10523334 | 3300005434 | Unclassified | 904 |
| 57 | Ga0070714_100086100 | 3300005435 | Bacteria | 2746 |
| 58 | Ga0070713_100006106 | 3300005436 | Bacteria | 8309 |
| 59 | Ga0070713_100059934 | 3300005436 | Bacteria | 3181 |
| 60 | Ga0070713_100727075 | 3300005436 | Bacteria | 949 |
| 61 | Ga0070710_10093733 | 3300005437 | Bacteria | 1776 |
| 62 | Ga0070701_10170737 | 3300005438 | Bacteria | 1266 |
| 63 | Ga0070711_100015495 | 3300005439 | Bacteria | 4827 |
| 64 | Ga0070711_100081000 | 3300005439 | Bacteria | 2313 |
| 65 | Ga0070705_100005687 | 3300005440 | Bacteria | 6091 |
| 66 | Ga0070705_100011210 | 3300005440 | Bacteria | 4516 |
| 67 | Ga0070700_100058990 | 3300005441 | Unclassified | 2414 |
| 68 | Ga0070694_100082059 | 3300005444 | Bacteria | 2244 |
| 69 | Ga0070694_100134656 | 3300005444 | Bacteria | 1789 |
| 70 | Ga0070663_100160988 | 3300005455 | Unclassified | 1727 |
| 71 | Ga0070663_101026373 | 3300005455 | Unclassified | 718 |
| 72 | Ga0070678_100001136 | 3300005456 | Bacteria | 14048 |
| 73 | Ga0070662_100027548 | 3300005457 | Bacteria | 3946 |
| 74 | Ga0070662_100034320 | 3300005457 | Bacteria | 3576 |
| 75 | Ga0070681_10011856 | 3300005458 | Bacteria | 8642 |
| 76 | Ga0070681_10029764 | 3300005458 | Bacteria | 5482 |
| 77 | Ga0070681_10032836 | 3300005458 | Bacteria | 5211 |
| 78 | Ga0070681_10086130 | 3300005458 | Bacteria | 3095 |
| 79 | Ga0070681_10099002 | 3300005458 | Bacteria | 2862 |
| 80 | Ga0070681_10254460 | 3300005458 | Bacteria | 1668 |
| 81 | Ga0070681_10694639 | 3300005458 | Bacteria | 933 |
| 82 | Ga0070681_10714980 | 3300005458 | Bacteria | 918 |
| 83 | Ga0070681_10876639 | 3300005458 | Unclassified | 816 |
| 84 | Ga0068867_100147781 | 3300005459 | Bacteria | 1844 |
| 85 | Ga0070685_10004822 | 3300005466 | Bacteria | 6825 |
| 86 | Ga0070685_10709578 | 3300005466 | Unclassified | 734 |
| 87 | Ga0070707_100556277 | 3300005468 | Unclassified | 1109 |
| 88 | Ga0070679_100004061 | 3300005530 | Bacteria | 13485 |
| 89 | Ga0070679_100018028 | 3300005530 | Bacteria | 6843 |
| 90 | Ga0070679_100024463 | 3300005530 | Bacteria | 5917 |
| 91 | Ga0070679_100057560 | 3300005530 | Unclassified | 3874 |
| 92 | Ga0070679_100094419 | 3300005530 | Bacteria | 2978 |
| 93 | Ga0070679_100177972 | 3300005530 | Unclassified | 2100 |
| 94 | Ga0070684_100001445 | 3300005535 | Bacteria | 17131 |
| 95 | Ga0070684_100051422 | 3300005535 | Bacteria | 3580 |
| 96 | Ga0070697_100137297 | 3300005536 | Bacteria | 2054 |
| 97 | Ga0068853_100107434 | 3300005539 | Bacteria | 2474 |
| 98 | Ga0068853_100311244 | 3300005539 | Bacteria | 1458 |
| 99 | Ga0070672_100046021 | 3300005543 | Bacteria | 3379 |
| 100 | Ga0070672_100076759 | 3300005543 | Bacteria | 2670 |
| 101 | Ga0070686_100001945 | 3300005544 | Bacteria | 11458 |
| 102 | Ga0070686_100064886 | 3300005544 | Bacteria | 2370 |
| 103 | Ga0070686_100571594 | 3300005544 | Unclassified | 887 |
| 104 | Ga0070696_100164196 | 3300005546 | Unclassified | 1638 |
| 105 | Ga0070693_100080946 | 3300005547 | Unclassified | 1936 |
| 106 | Ga0070665_100005098 | 3300005548 | Bacteria | 13627 |
| 107 | Ga0070665_100008171 | 3300005548 | Bacteria | 10595 |
| 108 | Ga0070665_100009641 | 3300005548 | Bacteria | 9765 |
| 109 | Ga0070665_100016687 | 3300005548 | Bacteria | 7358 |
| 110 | Ga0070665_100071031 | 3300005548 | Bacteria | 3488 |
| 111 | Ga0070665_100080522 | 3300005548 | Bacteria | 3262 |
| 112 | Ga0070665_100417086 | 3300005548 | Unclassified | 1351 |
| 113 | Ga0070704_100061263 | 3300005549 | Bacteria | 2692 |
| 114 | Ga0070704_100304578 | 3300005549 | Unclassified | 1329 |
| 115 | Ga0068855_100001126 | 3300005563 | Bacteria | 33184 |
| 116 | Ga0068855_100005841 | 3300005563 | Bacteria | 15022 |
| 117 | Ga0068855_100008548 | 3300005563 | Bacteria | 12374 |
| 118 | Ga0068855_100044345 | 3300005563 | Bacteria | 5263 |
| 119 | Ga0068855_100400283 | 3300005563 | Bacteria | 1505 |
| 120 | Ga0070664_100038093 | 3300005564 | Bacteria | 4046 |
| 121 | Ga0070664_100780018 | 3300005564 | Unclassified | 893 |
| 122 | Ga0068857_100051245 | 3300005577 | Bacteria | 3661 |
| 123 | Ga0068857_100867664 | 3300005577 | Unclassified | 864 |
| 124 | Ga0068854_100082218 | 3300005578 | Bacteria | 2380 |
| 125 | Ga0068854_100309236 | 3300005578 | Unclassified | 1281 |
| 126 | Ga0068854_100569313 | 3300005578 | Unclassified | 963 |
| 127 | Ga0068856_100053850 | 3300005614 | Bacteria | 3968 |
| 128 | Ga0068856_100350267 | 3300005614 | Unclassified | 1495 |
| 129 | Ga0070702_100010262 | 3300005615 | Bacteria | 4609 |
| 130 | Ga0068852_100886466 | 3300005616 | Unclassified | 909 |
| 131 | Ga0068859_100000351 | 3300005617 | Bacteria | 45794 |
| 132 | Ga0068859_100001971 | 3300005617 | Bacteria | 20954 |
| 133 | Ga0068859_100099996 | 3300005617 | Bacteria | 2956 |
| 134 | Ga0068864_100006023 | 3300005618 | Bacteria | 9955 |
| 135 | Ga0068864_100132739 | 3300005618 | Unclassified | 2239 |
| 136 | Ga0068864_100179156 | 3300005618 | Bacteria | 1937 |
| 137 | Ga0068864_100931122 | 3300005618 | Bacteria | 859 |
| 138 | Ga0068864_101155363 | 3300005618 | Unclassified | 772 |
| 139 | Ga0068866_10038137 | 3300005718 | Unclassified | 2364 |
| 140 | Ga0068866_10248680 | 3300005718 | Bacteria | 1087 |
| 141 | Ga0068861_100001164 | 3300005719 | Bacteria | 16384 |
| 142 | Ga0068861_100001318 | 3300005719 | Bacteria | 15568 |
| 143 | Ga0068861_100031712 | 3300005719 | Bacteria | 3884 |
| 144 | Ga0068861_100735349 | 3300005719 | Bacteria | 920 |
| 145 | Ga0068861_100950339 | 3300005719 | Bacteria | 817 |
| 146 | Ga0068851_10071989 | 3300005834 | Unclassified | 1790 |
| 147 | Ga0068870_10096872 | 3300005840 | Bacteria | 1660 |
| 148 | Ga0068863_100001670 | 3300005841 | Bacteria | 21939 |
| 149 | Ga0068863_100012408 | 3300005841 | Bacteria | 8228 |
| 150 | Ga0068863_100025514 | 3300005841 | Bacteria | 5635 |
| 151 | Ga0068863_100033124 | 3300005841 | Bacteria | 4922 |
| 152 | Ga0068858_100006174 | 3300005842 | Bacteria | 11687 |
| 153 | Ga0068858_100006466 | 3300005842 | Bacteria | 11409 |
| 154 | Ga0068858_100010999 | 3300005842 | Bacteria | 8553 |
| 155 | Ga0068858_100040805 | 3300005842 | Bacteria | 4305 |
| 156 | Ga0068858_100210525 | 3300005842 | Bacteria | 1840 |
| 157 | Ga0068858_100432068 | 3300005842 | Bacteria | 1267 |
| 158 | Ga0068860_100000293 | 3300005843 | Bacteria | 70629 |
| 159 | Ga0068860_100006090 | 3300005843 | Bacteria | 12137 |
| 160 | Ga0068860_100009097 | 3300005843 | Bacteria | 9884 |
| 161 | Ga0068860_100040768 | 3300005843 | Bacteria | 4436 |
| 162 | Ga0068860_100189016 | 3300005843 | Bacteria | 1993 |
| 163 | Ga0068860_100324251 | 3300005843 | Bacteria | 1512 |
| 164 | Ga0068862_100005680 | 3300005844 | Bacteria | 10409 |
| 165 | Ga0068862_100041083 | 3300005844 | Unclassified | 3934 |
| 166 | Ga0068862_100058576 | 3300005844 | Unclassified | 3304 |
| 167 | Ga0068862_100084811 | 3300005844 | Bacteria | 2752 |
| 168 | Ga0068862_100096304 | 3300005844 | Unclassified | 2583 |
| 169 | Ga0068862_100341994 | 3300005844 | Bacteria | 1386 |
| 170 | Ga0081455_10000039 | 3300005937 | Bacteria | 135506 |
| 171 | Ga0081455_10115556 | 3300005937 | Unclassified | 2124 |
| 172 | Ga0081539_10000006 | 3300005985 | Bacteria | 534555 |
| 173 | Ga0070715_10000168 | 3300006163 | Bacteria | 15210 |
| 174 | Ga0070712_100001910 | 3300006175 | Bacteria | 12744 |
| 175 | Ga0070712_100385877 | 3300006175 | Unclassified | 1154 |
| 176 | Ga0097621_100044192 | 3300006237 | Bacteria | 3594 |
| 177 | Ga0097621_100075626 | 3300006237 | Bacteria | 2792 |
| 178 | Ga0097621_100144729 | 3300006237 | Bacteria | 2034 |
| 179 | Ga0068871_100017714 | 3300006358 | Bacteria | 5397 |
| 180 | Ga0068871_100080411 | 3300006358 | Unclassified | 2698 |
| 181 | Ga0068871_100118151 | 3300006358 | Bacteria | 2237 |
| 182 | Ga0075428_100002157 | 3300006844 | Bacteria | 21269 |
| 183 | Ga0075428_100009058 | 3300006844 | Bacteria | 11044 |
| 184 | Ga0075428_100020190 | 3300006844 | Bacteria | 7379 |
| 185 | Ga0075428_100116927 | 3300006844 | Bacteria | 2904 |
| 186 | Ga0075428_100241951 | 3300006844 | Bacteria | 1946 |
| 187 | Ga0075430_100028458 | 3300006846 | Bacteria | 4748 |
| 188 | Ga0075430_100036930 | 3300006846 | Bacteria | 4141 |
| 189 | Ga0075430_100153970 | 3300006846 | Unclassified | 1914 |
| 190 | Ga0075431_100000064 | 3300006847 | Bacteria | 61023 |
| 191 | Ga0075431_100087200 | 3300006847 | Bacteria | 3221 |
| 192 | Ga0075433_10016693 | 3300006852 | Bacteria | 6060 |
| 193 | Ga0075434_100044029 | 3300006871 | Bacteria | 4428 |
| 194 | Ga0075434_100264926 | 3300006871 | Bacteria | 1738 |
| 195 | Ga0075429_100005986 | 3300006880 | Bacteria | 10512 |
| 196 | Ga0075429_100442020 | 3300006880 | Bacteria | 1140 |
| 197 | Ga0068865_100030682 | 3300006881 | Bacteria | 3578 |
| 198 | Ga0068865_100117641 | 3300006881 | Bacteria | 1971 |
| 199 | Ga0068865_100188643 | 3300006881 | Bacteria | 1592 |
| 200 | Ga0097620_100000351 | 3300006931 | Bacteria | 45794 |
| 201 | Ga0097620_100001971 | 3300006931 | Bacteria | 20954 |
| 202 | Ga0097620_100099995 | 3300006931 | Bacteria | 2956 |
| 203 | Ga0075435_100009973 | 3300007076 | Bacteria | 6922 |
| 204 | Ga0075435_100905600 | 3300007076 | Unclassified | 769 |
| 205 | Ga0099794_10100567 | 3300007265 | Unclassified | 1443 |
| 206 | Ga0105250_10046869 | 3300009092 | Bacteria | 1733 |
| 207 | Ga0105250_10055914 | 3300009092 | Bacteria | 1584 |
| 208 | Ga0105240_10000995 | 3300009093 | Bacteria | 50634 |
| 209 | Ga0105240_10009806 | 3300009093 | Bacteria | 13518 |
| 210 | Ga0105240_10011322 | 3300009093 | Bacteria | 12427 |
| 211 | Ga0105240_10013816 | 3300009093 | Bacteria | 11060 |
| 212 | Ga0105240_10030471 | 3300009093 | Bacteria | 7012 |
| 213 | Ga0105240_10030890 | 3300009093 | Bacteria | 6958 |
| 214 | Ga0105240_10063423 | 3300009093 | Bacteria | 4597 |
| 215 | Ga0105240_10089814 | 3300009093 | Bacteria | 3757 |
| 216 | Ga0105240_10098363 | 3300009093 | Bacteria | 3563 |
| 217 | Ga0105240_10359029 | 3300009093 | Bacteria | 1651 |
| 218 | Ga0105240_10927195 | 3300009093 | Unclassified | 935 |
| 219 | Ga0105240_11307194 | 3300009093 | Unclassified | 765 |
| 220 | Ga0111539_10000362 | 3300009094 | Bacteria | 55860 |
| 221 | Ga0111539_10003977 | 3300009094 | Bacteria | 19420 |
| 222 | Ga0111539_10072714 | 3300009094 | Bacteria | 4055 |
| 223 | Ga0111539_10153493 | 3300009094 | Unclassified | 2695 |
| 224 | Ga0111539_10676907 | 3300009094 | Bacteria | 1201 |
| 225 | Ga0105245_10018862 | 3300009098 | Bacteria | 6037 |
| 226 | Ga0105245_10158987 | 3300009098 | Bacteria | 2143 |
| 227 | Ga0105245_11100649 | 3300009098 | Unclassified | 841 |
| 228 | Ga0105245_11161069 | 3300009098 | Unclassified | 819 |
| 229 | Ga0105247_10000150 | 3300009101 | Bacteria | 68542 |
| 230 | Ga0105247_10001687 | 3300009101 | Bacteria | 15585 |
| 231 | Ga0105247_10007631 | 3300009101 | Bacteria | 6624 |
| 232 | Ga0105247_10245818 | 3300009101 | Bacteria | 1221 |
| 233 | Ga0114129_10023151 | 3300009147 | Bacteria | 8811 |
| 234 | Ga0114129_10042119 | 3300009147 | Bacteria | 6430 |
| 235 | Ga0114129_10061504 | 3300009147 | Bacteria | 5247 |
| 236 | Ga0114129_10769779 | 3300009147 | Unclassified | 1231 |
| 237 | Ga0105243_10425224 | 3300009148 | Bacteria | 1240 |
| 238 | Ga0105241_10103622 | 3300009174 | Unclassified | 2266 |
| 239 | Ga0105241_10204824 | 3300009174 | Bacteria | 1650 |
| 240 | Ga0105242_10000384 | 3300009176 | Bacteria | 35144 |
| 241 | Ga0105242_10329256 | 3300009176 | Bacteria | 1404 |
| 242 | Ga0105248_10007148 | 3300009177 | Bacteria | 12243 |
| 243 | Ga0105248_10021309 | 3300009177 | Bacteria | 7183 |
| 244 | Ga0105248_10096736 | 3300009177 | Bacteria | 3326 |
| 245 | Ga0105248_10188751 | 3300009177 | Bacteria | 2322 |
| 246 | Ga0105248_10326551 | 3300009177 | Unclassified | 1728 |
| 247 | Ga0105237_10027347 | 3300009545 | Bacteria | 5823 |
| 248 | Ga0105237_10107967 | 3300009545 | Unclassified | 2775 |
| 249 | Ga0105237_10127285 | 3300009545 | Bacteria | 2541 |
| 250 | Ga0105237_10160141 | 3300009545 | Unclassified | 2249 |
| 251 | Ga0105237_10162471 | 3300009545 | Unclassified | 2232 |
| 252 | Ga0105238_10010575 | 3300009551 | Bacteria | 9266 |
| 253 | Ga0105238_10011421 | 3300009551 | Bacteria | 8945 |
| 254 | Ga0105238_10131265 | 3300009551 | Archaea | 2483 |
| 255 | Ga0105238_10160181 | 3300009551 | Unclassified | 2226 |
| 256 | Ga0105238_10840158 | 3300009551 | Unclassified | 935 |
| 257 | Ga0105238_11184974 | 3300009551 | Bacteria | 788 |
| 258 | Ga0105249_10014095 | 3300009553 | Bacteria | 7067 |
| 259 | Ga0105249_10030956 | 3300009553 | Unclassified | 4838 |
| 260 | Ga0105249_10050436 | 3300009553 | Bacteria | 3794 |
| 261 | Ga0105249_10055747 | 3300009553 | Bacteria | 3617 |
| 262 | Ga0105249_10163684 | 3300009553 | Bacteria | 2152 |
| 263 | Ga0105249_10261799 | 3300009553 | Bacteria | 1719 |
| 264 | Ga0105249_10282795 | 3300009553 | Bacteria | 1657 |
| 265 | Ga0105249_11247577 | 3300009553 | Unclassified | 815 |
| 266 | Ga0105030_100029 | 3300009987 | Bacteria | 11182 |
| 267 | Ga0099796_10000823 | 3300010159 | Bacteria | 5653 |
| 268 | Ga0105239_10045275 | 3300010375 | Unclassified | 4822 |
| 269 | Ga0105239_10122966 | 3300010375 | Unclassified | 2884 |
| 270 | Ga0105239_10349662 | 3300010375 | Unclassified | 1669 |
| 271 | Ga0105239_10521211 | 3300010375 | Unclassified | 1352 |
| 272 | Ga0105239_10673930 | 3300010375 | Unclassified | 1182 |
| 273 | Ga0105239_10866892 | 3300010375 | Unclassified | 1036 |
| 274 | Ga0105246_10032866 | 3300011119 | Bacteria | 3444 |
| 275 | Ga0105246_10035157 | 3300011119 | Bacteria | 3347 |
| 276 | Ga0157370_10005646 | 3300013104 | Bacteria | 13990 |
| 277 | Ga0157370_10391954 | 3300013104 | Bacteria | 1279 |
| 278 | Ga0157370_10682611 | 3300013104 | Unclassified | 938 |
| 279 | Ga0157369_10004805 | 3300013105 | Bacteria | 15873 |
| 280 | Ga0157369_10024343 | 3300013105 | Bacteria | 6738 |
| 281 | Ga0157369_10075516 | 3300013105 | Unclassified | 3613 |
| 282 | Ga0157369_10269406 | 3300013105 | Unclassified | 1775 |
| 283 | Ga0157374_10015813 | 3300013296 | Bacteria | 6629 |
| 284 | Ga0157374_10162726 | 3300013296 | Unclassified | 2174 |
| 285 | Ga0157374_10344351 | 3300013296 | Bacteria | 1480 |
| 286 | Ga0157374_10371910 | 3300013296 | Unclassified | 1423 |
| 287 | Ga0157378_10002033 | 3300013297 | Bacteria | 18118 |
| 288 | Ga0163162_10100619 | 3300013306 | Bacteria | 2982 |
| 289 | Ga0163162_10288032 | 3300013306 | Unclassified | 1774 |
| 290 | Ga0157372_10555822 | 3300013307 | Unclassified | 1338 |
| 291 | Ga0157372_10735691 | 3300013307 | Unclassified | 1147 |
| 292 | Ga0157375_10008766 | 3300013308 | Bacteria | 8861 |
| 293 | Ga0157375_10018374 | 3300013308 | Bacteria | 6339 |
| 294 | Ga0157375_10042556 | 3300013308 | Bacteria | 4397 |
| 295 | Ga0157375_10488179 | 3300013308 | Bacteria | 1396 |
| 296 | Ga0163163_10004798 | 3300014325 | Bacteria | 11605 |
| 297 | Ga0163163_10063626 | 3300014325 | Bacteria | 3658 |
| 298 | Ga0163163_10201399 | 3300014325 | Unclassified | 2039 |
| 299 | Ga0163163_10218572 | 3300014325 | Bacteria | 1954 |
| 300 | Ga0163163_10248391 | 3300014325 | Bacteria | 1830 |
| 301 | Ga0157380_10000775 | 3300014326 | Bacteria | 20002 |
| 302 | Ga0157380_10004057 | 3300014326 | Bacteria | 10101 |
| 303 | Ga0157380_10060466 | 3300014326 | Bacteria | 3028 |
| 304 | Ga0157380_10132310 | 3300014326 | Unclassified | 2130 |
| 305 | Ga0157380_10291928 | 3300014326 | Bacteria | 1498 |
| 306 | Ga0157380_11297854 | 3300014326 | Unclassified | 775 |
| 307 | Ga0157377_10158217 | 3300014745 | Bacteria | 1406 |
| 308 | Ga0157379_10082843 | 3300014968 | Bacteria | 2874 |
| 309 | Ga0157379_10093522 | 3300014968 | Bacteria | 2697 |
| 310 | Ga0157379_10226572 | 3300014968 | Bacteria | 1694 |
| 311 | Ga0157376_10097033 | 3300014969 | Bacteria | 2567 |
| 312 | Ga0157376_10241086 | 3300014969 | Unclassified | 1684 |
| 313 | Ga0163161_10129925 | 3300017792 | Bacteria | 1899 |
| 314 | Ga0206356_11883884 | 3300020070 | Bacteria | 888 |
| 315 | Ga0206350_10008138 | 3300020080 | Bacteria | 1013 |
| 316 | Ga0206354_11029202 | 3300020081 | Unclassified | 772 |
| 317 | Ga0213874_10032867 | 3300021377 | Bacteria | 1509 |
| 318 | Ga0213876_10061474 | 3300021384 | Bacteria | 1982 |
| 319 | Ga0224712_10191359 | 3300022467 | Bacteria | 926 |
| 320 | Ga0207656_10045027 | 3300025321 | Bacteria | 1887 |
| 321 | Ga0207692_10267350 | 3300025898 | Unclassified | 1030 |
| 322 | Ga0207642_10037095 | 3300025899 | Unclassified | 2098 |
| 323 | Ga0207642_10121390 | 3300025899 | Unclassified | 1348 |
| 324 | Ga0207710_10000181 | 3300025900 | Bacteria | 63816 |
| 325 | Ga0207710_10019776 | 3300025900 | Bacteria | 2875 |
| 326 | Ga0207710_10140778 | 3300025900 | Bacteria | 1164 |
| 327 | Ga0207688_10016011 | 3300025901 | Bacteria | 4065 |
| 328 | Ga0207680_10009065 | 3300025903 | Bacteria | 4918 |
| 329 | Ga0207680_10099639 | 3300025903 | Unclassified | 1864 |
| 330 | Ga0207647_10037693 | 3300025904 | Bacteria | 3063 |
| 331 | Ga0207685_10000708 | 3300025905 | Bacteria | 6027 |
| 332 | Ga0207699_10327934 | 3300025906 | Unclassified | 1075 |
| 333 | Ga0207699_10396449 | 3300025906 | Unclassified | 982 |
| 334 | Ga0207643_10072929 | 3300025908 | Bacteria | 1978 |
| 335 | Ga0207643_10166561 | 3300025908 | Bacteria | 1328 |
| 336 | Ga0207684_11094292 | 3300025910 | Unclassified | 663 |
| 337 | Ga0207654_10174662 | 3300025911 | Unclassified | 1398 |
| 338 | Ga0207707_10003382 | 3300025912 | Bacteria | 14157 |
| 339 | Ga0207707_10009212 | 3300025912 | Bacteria | 8569 |
| 340 | Ga0207707_10046009 | 3300025912 | Bacteria | 3800 |
| 341 | Ga0207707_10058009 | 3300025912 | Bacteria | 3369 |
| 342 | Ga0207707_10099759 | 3300025912 | Bacteria | 2538 |
| 343 | Ga0207707_10321510 | 3300025912 | Bacteria | 1336 |
| 344 | Ga0207707_10678188 | 3300025912 | Unclassified | 867 |
| 345 | Ga0207695_10011497 | 3300025913 | Bacteria | 10714 |
| 346 | Ga0207695_10020399 | 3300025913 | Bacteria | 7593 |
| 347 | Ga0207695_10022926 | 3300025913 | Bacteria | 7071 |
| 348 | Ga0207695_10027837 | 3300025913 | Bacteria | 6284 |
| 349 | Ga0207695_10057929 | 3300025913 | Archaea | 4023 |
| 350 | Ga0207695_10066015 | 3300025913 | Bacteria | 3718 |
| 351 | Ga0207695_10080228 | 3300025913 | Unclassified | 3305 |
| 352 | Ga0207695_10081333 | 3300025913 | Unclassified | 3278 |
| 353 | Ga0207695_10127643 | 3300025913 | Bacteria | 2504 |
| 354 | Ga0207695_10355851 | 3300025913 | Bacteria | 1351 |
| 355 | Ga0207695_10421396 | 3300025913 | Unclassified | 1219 |
| 356 | Ga0207695_10889981 | 3300025913 | Unclassified | 770 |
| 357 | Ga0207671_10039138 | 3300025914 | Bacteria | 3512 |
| 358 | Ga0207671_10046891 | 3300025914 | Unclassified | 3197 |
| 359 | Ga0207671_10052570 | 3300025914 | Unclassified | 3019 |
| 360 | Ga0207671_10244624 | 3300025914 | Unclassified | 1410 |
| 361 | Ga0207693_10000385 | 3300025915 | Bacteria | 40463 |
| 362 | Ga0207663_10055592 | 3300025916 | Unclassified | 2484 |
| 363 | Ga0207660_10047569 | 3300025917 | Unclassified | 3033 |
| 364 | Ga0207662_10001650 | 3300025918 | Bacteria | 10908 |
| 365 | Ga0207662_10117928 | 3300025918 | Bacteria | 1661 |
| 366 | Ga0207657_10163056 | 3300025919 | Bacteria | 1810 |
| 367 | Ga0207649_10022125 | 3300025920 | Bacteria | 3671 |
| 368 | Ga0207652_10025697 | 3300025921 | Bacteria | 4898 |
| 369 | Ga0207652_10300268 | 3300025921 | Unclassified | 1449 |
| 370 | Ga0207652_10303778 | 3300025921 | Bacteria | 1440 |
| 371 | Ga0207652_10571067 | 3300025921 | Bacteria | 1015 |
| 372 | Ga0207652_10898614 | 3300025921 | Unclassified | 782 |
| 373 | Ga0207646_10351657 | 3300025922 | Bacteria | 1332 |
| 374 | Ga0207681_10035262 | 3300025923 | Bacteria | 3295 |
| 375 | Ga0207681_10131100 | 3300025923 | Bacteria | 1854 |
| 376 | Ga0207681_10454781 | 3300025923 | Bacteria | 1042 |
| 377 | Ga0207694_10151341 | 3300025924 | Unclassified | 1869 |
| 378 | Ga0207694_10287996 | 3300025924 | Bacteria | 1350 |
| 379 | Ga0207694_10758948 | 3300025924 | Bacteria | 819 |
| 380 | Ga0207650_10007807 | 3300025925 | Bacteria | 7291 |
| 381 | Ga0207659_10016096 | 3300025926 | Bacteria | 4862 |
| 382 | Ga0207659_10054743 | 3300025926 | Bacteria | 2850 |
| 383 | Ga0207687_10772380 | 3300025927 | Unclassified | 818 |
| 384 | Ga0207700_10000880 | 3300025928 | Bacteria | 17286 |
| 385 | Ga0207700_10042352 | 3300025928 | Bacteria | 3338 |
| 386 | Ga0207644_10004581 | 3300025931 | Bacteria | 8989 |
| 387 | Ga0207644_10011875 | 3300025931 | Bacteria | 5772 |
| 388 | Ga0207706_10032463 | 3300025933 | Bacteria | 4650 |
| 389 | Ga0207706_10068180 | 3300025933 | Bacteria | 3130 |
| 390 | Ga0207686_10011705 | 3300025934 | Bacteria | 4811 |
| 391 | Ga0207709_10085085 | 3300025935 | Bacteria | 2049 |
| 392 | Ga0207670_10987720 | 3300025936 | Bacteria | 708 |
| 393 | Ga0207669_10117292 | 3300025937 | Bacteria | 1799 |
| 394 | Ga0207669_11016811 | 3300025937 | Bacteria | 697 |
| 395 | Ga0207704_10025561 | 3300025938 | Bacteria | 3223 |
| 396 | Ga0207704_10305144 | 3300025938 | Bacteria | 1221 |
| 397 | Ga0207691_10010045 | 3300025940 | Bacteria | 9083 |
| 398 | Ga0207691_10053791 | 3300025940 | Bacteria | 3674 |
| 399 | Ga0207711_10164231 | 3300025941 | Bacteria | 2012 |
| 400 | Ga0207711_10166529 | 3300025941 | Unclassified | 1998 |
| 401 | Ga0207711_10223692 | 3300025941 | Bacteria | 1722 |
| 402 | Ga0207711_10334314 | 3300025941 | Bacteria | 1401 |
| 403 | Ga0207689_10003796 | 3300025942 | Bacteria | 13771 |
| 404 | Ga0207689_10067888 | 3300025942 | Unclassified | 2930 |
| 405 | Ga0207689_10108074 | 3300025942 | Bacteria | 2286 |
| 406 | Ga0207661_10126741 | 3300025944 | Bacteria | 2181 |
| 407 | Ga0207679_10014827 | 3300025945 | Bacteria | 5135 |
| 408 | Ga0207679_10904506 | 3300025945 | Unclassified | 807 |
| 409 | Ga0207679_11043643 | 3300025945 | Unclassified | 750 |
| 410 | Ga0207667_10001075 | 3300025949 | Bacteria | 34658 |
| 411 | Ga0207667_10008172 | 3300025949 | Bacteria | 12451 |
| 412 | Ga0207667_10017290 | 3300025949 | Bacteria | 8122 |
| 413 | Ga0207667_10120503 | 3300025949 | Bacteria | 2703 |
| 414 | Ga0207667_10660119 | 3300025949 | Unclassified | 1051 |
| 415 | Ga0207667_10816668 | 3300025949 | Unclassified | 928 |
| 416 | Ga0207651_10124585 | 3300025960 | Unclassified | 1961 |
| 417 | Ga0207712_10005709 | 3300025961 | Bacteria | 7841 |
| 418 | Ga0207712_10016495 | 3300025961 | Bacteria | 4785 |
| 419 | Ga0207712_10018767 | 3300025961 | Bacteria | 4509 |
| 420 | Ga0207712_10087646 | 3300025961 | Bacteria | 2283 |
| 421 | Ga0207712_10176320 | 3300025961 | Bacteria | 1675 |
| 422 | Ga0207712_10182428 | 3300025961 | Unclassified | 1650 |
| 423 | Ga0207668_10176346 | 3300025972 | Unclassified | 1681 |
| 424 | Ga0207640_10192578 | 3300025981 | Bacteria | 1538 |
| 425 | Ga0207640_10287937 | 3300025981 | Unclassified | 1294 |
| 426 | Ga0207658_10000097 | 3300025986 | Bacteria | 97223 |
| 427 | Ga0207658_10018140 | 3300025986 | Bacteria | 4854 |
| 428 | Ga0207658_10129646 | 3300025986 | Unclassified | 2024 |
| 429 | Ga0207658_10392754 | 3300025986 | Bacteria | 1217 |
| 430 | Ga0207677_10576394 | 3300026023 | Bacteria | 984 |
| 431 | Ga0207703_10001369 | 3300026035 | Bacteria | 22262 |
| 432 | Ga0207703_10002198 | 3300026035 | Bacteria | 17122 |
| 433 | Ga0207703_10030580 | 3300026035 | Bacteria | 4257 |
| 434 | Ga0207703_10220507 | 3300026035 | Unclassified | 1695 |
| 435 | Ga0207703_10507940 | 3300026035 | Bacteria | 1132 |
| 436 | Ga0207639_10328444 | 3300026041 | Bacteria | 1360 |
| 437 | Ga0207678_10195602 | 3300026067 | Bacteria | 1728 |
| 438 | Ga0207678_10806741 | 3300026067 | Unclassified | 829 |
| 439 | Ga0207708_10022002 | 3300026075 | Bacteria | 4812 |
| 440 | Ga0207641_10003386 | 3300026088 | Bacteria | 14152 |
| 441 | Ga0207641_10005080 | 3300026088 | Bacteria | 11280 |
| 442 | Ga0207641_10020132 | 3300026088 | Bacteria | 5477 |
| 443 | Ga0207641_10126905 | 3300026088 | Unclassified | 2285 |
| 444 | Ga0207648_10185172 | 3300026089 | Bacteria | 1844 |
| 445 | Ga0207648_10914548 | 3300026089 | Bacteria | 820 |
| 446 | Ga0207676_10003378 | 3300026095 | Bacteria | 11285 |
| 447 | Ga0207676_10191022 | 3300026095 | Unclassified | 1802 |
| 448 | Ga0207676_10471538 | 3300026095 | Unclassified | 1187 |
| 449 | Ga0207676_10519013 | 3300026095 | Unclassified | 1134 |
| 450 | Ga0207674_10103219 | 3300026116 | Unclassified | 2831 |
| 451 | Ga0207674_10189014 | 3300026116 | Bacteria | 2009 |
| 452 | Ga0207675_100040136 | 3300026118 | Bacteria | 4369 |
| 453 | Ga0207675_100064580 | 3300026118 | Bacteria | 3421 |
| 454 | Ga0207675_100166373 | 3300026118 | Bacteria | 2106 |
| 455 | Ga0207675_100262226 | 3300026118 | Bacteria | 1675 |
| 456 | Ga0207675_100359573 | 3300026118 | Unclassified | 1428 |
| 457 | Ga0207675_101139561 | 3300026118 | Unclassified | 800 |
| 458 | Ga0207683_10005289 | 3300026121 | Bacteria | 11074 |
| 459 | Ga0207698_10697936 | 3300026142 | Unclassified | 1009 |
| 460 | Ga0209999_1028823 | 3300027543 | Bacteria | 1030 |
| 461 | Ga0209974_10010109 | 3300027876 | Bacteria | 3190 |
| 462 | Ga0207428_10001201 | 3300027907 | Bacteria | 27753 |
| 463 | Ga0207428_10009885 | 3300027907 | Bacteria | 8544 |
| 464 | Ga0207428_10055379 | 3300027907 | Bacteria | 3154 |
| 465 | Ga0268266_10004397 | 3300028379 | Bacteria | 13505 |
| 466 | Ga0268266_10019389 | 3300028379 | Bacteria | 5791 |
| 467 | Ga0268266_10023855 | 3300028379 | Bacteria | 5206 |
| 468 | Ga0268266_10035411 | 3300028379 | Bacteria | 4246 |
| 469 | Ga0268266_10035791 | 3300028379 | Unclassified | 4222 |
| 470 | Ga0268266_10040539 | 3300028379 | Bacteria | 3969 |
| 471 | Ga0268266_10042488 | 3300028379 | Bacteria | 3883 |
| 472 | Ga0268266_10118106 | 3300028379 | Unclassified | 2357 |
| 473 | Ga0268265_10006756 | 3300028380 | Bacteria | 7762 |
| 474 | Ga0268265_10011774 | 3300028380 | Bacteria | 5914 |
| 475 | Ga0268265_10069686 | 3300028380 | Bacteria | 2732 |
| 476 | Ga0268265_10229394 | 3300028380 | Bacteria | 1631 |
| 477 | Ga0268264_10000293 | 3300028381 | Bacteria | 83870 |
| 478 | Ga0268264_10024832 | 3300028381 | Bacteria | 4896 |
| 479 | Ga0268264_10051426 | 3300028381 | Bacteria | 3433 |
| 480 | Ga0268264_10349427 | 3300028381 | Bacteria | 1407 |
| 481 | Ga0268264_10532619 | 3300028381 | Unclassified | 1150 |
| 482 | Ga0307517_10321120 | 3300028786 | Unclassified | 857 |
| 483 | Ga0307515_10006519 | 3300028794 | Bacteria | 23340 |
| 484 | Ga0307515_10376706 | 3300028794 | Bacteria | 1053 |
| 485 | Ga0307511_10000310 | 3300030521 | Bacteria | 51837 |
| 486 | Ga0307511_10060950 | 3300030521 | Bacteria | 2880 |
| 487 | Ga0307511_10279603 | 3300030521 | Unclassified | 773 |
| 488 | Ga0265332_10039245 | 3300031238 | Bacteria | 2051 |
| 489 | Ga0265328_10005167 | 3300031239 | Bacteria | 5612 |
| 490 | Ga0265331_10002531 | 3300031250 | Bacteria | 12310 |
| 491 | Ga0265316_10047959 | 3300031344 | Bacteria | 3376 |
| 492 | Ga0307513_10146920 | 3300031456 | Unclassified | 2274 |
| 493 | Ga0307513_10212496 | 3300031456 | Bacteria | 1764 |
| 494 | Ga0307509_10000017 | 3300031507 | Bacteria | 265012 |
| 495 | Ga0307509_10001255 | 3300031507 | Bacteria | 43009 |
| 496 | Ga0307408_100074084 | 3300031548 | Bacteria | 2525 |
| 497 | Ga0307508_10501129 | 3300031616 | Unclassified | 809 |
| 498 | Ga0316576_10006449 | 3300031727 | Bacteria | 7305 |
| 499 | Ga0316576_10141673 | 3300031727 | Bacteria | 1810 |
| 500 | Ga0316578_10058385 | 3300031728 | Bacteria | 2268 |
| 501 | Ga0316578_10093112 | 3300031728 | Bacteria | 1802 |
| 502 | Ga0316578_10192999 | 3300031728 | Bacteria | 1227 |
| 503 | Ga0316577_10002556 | 3300031733 | Bacteria | 9051 |
| 504 | Ga0307413_10114027 | 3300031824 | Bacteria | 1816 |
| 505 | Ga0307413_10218690 | 3300031824 | Bacteria | 1390 |
| 506 | Ga0307413_10508336 | 3300031824 | Unclassified | 969 |
| 507 | Ga0307410_10016028 | 3300031852 | Bacteria | 4457 |
| 508 | Ga0307410_11048769 | 3300031852 | Bacteria | 705 |
| 509 | Ga0307406_10213238 | 3300031901 | Unclassified | 1430 |
| 510 | Ga0307406_10374355 | 3300031901 | Bacteria | 1121 |
| 511 | Ga0307406_10912967 | 3300031901 | Bacteria | 748 |
| 512 | Ga0307412_10013079 | 3300031911 | Bacteria | 4855 |
| 513 | Ga0307412_10341174 | 3300031911 | Bacteria | 1199 |
| 514 | Ga0307409_100249694 | 3300031995 | Unclassified | 1621 |
| 515 | Ga0307416_100007092 | 3300032002 | Bacteria | 7081 |
| 516 | Ga0307416_100251233 | 3300032002 | Bacteria | 1721 |
| 517 | Ga0307414_10798170 | 3300032004 | Bacteria | 861 |
| 518 | Ga0307411_10069975 | 3300032005 | Unclassified | 2372 |
| 519 | Ga0307411_10462575 | 3300032005 | Bacteria | 1064 |
| 520 | Ga0307411_10475022 | 3300032005 | Bacteria | 1051 |
| 521 | Ga0307411_10759668 | 3300032005 | Unclassified | 850 |
| 522 | Ga0307415_100696666 | 3300032126 | Unclassified | 916 |
| 523 | Ga0307510_10000002 | 3300033180 | Bacteria | 801565 |
| 524 | Ga0316215_1003399 | 3300033544 | Unclassified | 1516 |
| 525 | Ga0373958_0004528 | 3300034819 | Bacteria | 2063 |
| 526 | Ga0373923_0140294 | 3300035111 | Bacteria | 1092 |
| 527 | Ga0373932_0093713 | 3300035112 | Unclassified | 968 |
| 528 | Ga0373936_0012241 | 3300035113 | Bacteria | 3261 |
| 529 | Ga0373936_0211384 | 3300035113 | Unclassified | 858 |
| 530 | Ga0373953_0141225 | 3300035117 | Bacteria | 1030 |
| 531 | Ga0373954_0071239 | 3300035118 | Unclassified | 1652 |
| 532 | Ga0373956_0020807 | 3300035119 | Unclassified | 2796 |
| 533 | Ga0373946_0239747 | 3300035171 | Unclassified | 881 |
| 534 | Ga0373955_0026482 | 3300035172 | Bacteria | 2988 |
| 535 | Ga0373955_0038212 | 3300035172 | Unclassified | 2557 |
| 536 | Ga0316574_0001389 | 3300035398 | Bacteria | 11438 |
| 537 | Ga0316574_0065927 | 3300035398 | Bacteria | 2280 |
| 538 | Ga0316574_0316885 | 3300035398 | Bacteria | 990 |
| 539 | Ga0373935_0161898 | 3300035692 | Bacteria | 1526 |
| 540 | Ga0373935_0799322 | 3300035692 | Bacteria | 696 |
| 541 | Ga0373927_0006569 | 3300035695 | Bacteria | 7921 |
| 542 | Ga0373947_0068608 | 3300035725 | Bacteria | 2169 |
| 543 | Ga0373937_0191021 | 3300036401 | Bacteria | 1924 |
| 544 | Ga0316584_0001547 | 3300036712 | Bacteria | 13923 |
| 545 | Ga0316584_0236392 | 3300036712 | Bacteria | 1338 |
| 546 | Ga0316584_0396362 | 3300036712 | Bacteria | 984 |
| 547 | Ga0373925_0112683 | 3300037068 | Unclassified | 2103 |
| 548 | Ga0395898_0001671 | 3300037466 | Bacteria | 29733 |
| 549 | Ga0395898_0031186 | 3300037466 | Bacteria | 5329 |
| 550 | Ga0395901_0354148 | 3300038443 | Bacteria | 1515 |
| 551 | Ga0436365_0361199 | 3300039437 | Unclassified | 1062 |
| 552 | Ga0436365_0968703 | 3300039437 | Unclassified | 1421 |
| 553 | Ga0436365_1262329 | 3300039437 | Bacteria | 3698 |
| 554 | Ga0436360_0636129 | 3300039438 | Bacteria | 1183 |
| 555 | Ga0436360_0761517 | 3300039438 | Bacteria | 4024 |
| 556 | Ga0436360_0903621 | 3300039438 | Bacteria | 1004 |
| 557 | Ga0436360_1218347 | 3300039438 | Unclassified | 779 |
| 558 | Ga0436363_0242732 | 3300039450 | Bacteria | 10557 |
| 559 | Ga0436363_0408341 | 3300039450 | Bacteria | 4182 |
| 560 | Ga0436363_1328907 | 3300039450 | Unclassified | 929 |
| 561 | Ga0436363_1562350 | 3300039450 | Bacteria | 3938 |
| 562 | Ga0436362_0066625 | 3300039453 | Unclassified | 881 |
| 563 | Ga0436362_0683596 | 3300039453 | Bacteria | 1239 |
| 564 | Ga0439439_0007547 | 3300041406 | Bacteria | 2548 |
| 565 | Ga0439461_0052441 | 3300041410 | Bacteria | 908 |
| 566 | Ga0439461_0072390 | 3300041410 | Bacteria | 801 |
| 567 | Ga0451787_275374 | 3300041441 | Bacteria | 761 |
| 568 | Ga0439431_0016311 | 3300041997 | Unclassified | 1737 |
| 569 | Ga0439433_0057551 | 3300041999 | Unclassified | 924 |
| 570 | Ga0439443_001283 | 3300042003 | Bacteria | 2707 |
| 571 | Ga0439455_0048461 | 3300042012 | Bacteria | 1105 |
| 572 | Ga0450920_015104 | 3300042122 | Bacteria | 1466 |
| 573 | Ga0450920_055342 | 3300042122 | Bacteria | 798 |
| 574 | Ga0450922_004663 | 3300042124 | Bacteria | 1262 |
| 575 | Ga0450923_005519 | 3300042125 | Bacteria | 2047 |
| 576 | Ga0450923_012011 | 3300042125 | Unclassified | 1569 |
| 577 | Ga0450895_004324 | 3300042132 | Bacteria | 1118 |
| 578 | Ga0450896_000043 | 3300042133 | Bacteria | 7684 |
| 579 | Ga0450898_008132 | 3300042134 | Bacteria | 1647 |
| 580 | Ga0450906_005321 | 3300042145 | Bacteria | 2652 |
| 581 | Ga0450910_002669 | 3300042147 | Unclassified | 2343 |
| 582 | Ga0439446_0000625 | 3300042156 | Bacteria | 7320 |
| 583 | Ga0439446_0005284 | 3300042156 | Bacteria | 3316 |
| 584 | Ga0450908_000158 | 3300042184 | Bacteria | 14125 |
| 585 | Ga0439434_0000161 | 3300042435 | Bacteria | 18066 |
| 586 | Ga0439434_0121465 | 3300042435 | Unclassified | 852 |
| 587 | Ga0439435_0000638 | 3300042436 | Bacteria | 5748 |
| 588 | Ga0439464_0031830 | 3300042439 | Unclassified | 1481 |
| 589 | Ga0439464_0100179 | 3300042439 | Unclassified | 880 |
| 590 | Ga0450916_029259 | 3300042530 | Bacteria | 795 |
| 591 | Ga0450918_025111 | 3300042531 | Unclassified | 1043 |
| 592 | Ga0451577_0111990 | 3300042876 | Unclassified | 2442 |
| 593 | Ga0466969_0001004 | 3300044656 | Bacteria | 15261 |
| 594 | Ga0466969_0001145 | 3300044656 | Bacteria | 14285 |
| 595 | Ga0466969_0055883 | 3300044656 | Bacteria | 1929 |
| 596 | Ga0466972_0015610 | 3300044658 | Unclassified | 3798 |
| 597 | Ga0466965_0021037 | 3300044683 | Unclassified | 3139 |
| 598 | Ga0466966_0000115 | 3300044684 | Bacteria | 49898 |
| 599 | Ga0466966_0095424 | 3300044684 | Bacteria | 1843 |
| 600 | Ga0466966_0173503 | 3300044684 | Unclassified | 1310 |
| 601 | Ga0466961_0000137 | 3300044693 | Bacteria | 49031 |
| 602 | Ga0466964_0000061 | 3300044706 | Bacteria | 23354 |
| 603 | Ga0453684_0706975 | 3300044712 | Bacteria | 1095 |
| 604 | Ga0466971_0000102 | 3300044719 | Bacteria | 31582 |
| 605 | Ga0466968_0072545 | 3300044735 | Bacteria | 1501 |
| 606 | Ga0466970_0000553 | 3300044765 | Bacteria | 18250 |
| 607 | Ga0466957_0006358 | 3300044842 | Bacteria | 6666 |
| 608 | Ga0466959_0001065 | 3300045049 | Bacteria | 16419 |
| 609 | Ga0466959_0010240 | 3300045049 | Bacteria | 6695 |
| 610 | Ga0466959_0036423 | 3300045049 | Unclassified | 3635 |
| 611 | Ga0466959_0052252 | 3300045049 | Bacteria | 2994 |
| 612 | Ga0466959_0099012 | 3300045049 | Unclassified | 2088 |
| 613 | Ga0451576_0143341 | 3300045051 | Unclassified | 2491 |
| 614 | Ga0466958_0081788 | 3300045836 | Unclassified | 1988 |
| 615 | Ga0466958_0087949 | 3300045836 | Bacteria | 1919 |
| 616 | Ga0495603_0293472 | 3300046455 | Unclassified | 934 |
| 617 | Ga0495629_0251213 | 3300046459 | Bacteria | 1217 |
| 618 | Ga0495638_0007774 | 3300046460 | Bacteria | 7656 |
| 619 | Ga0495638_0077538 | 3300046460 | Bacteria | 2023 |
| 620 | Ga0495650_0056464 | 3300046471 | Bacteria | 1593 |
| 621 | Ga0495580_0004499 | 3300046472 | Bacteria | 11707 |
| 622 | Ga0495580_0004701 | 3300046472 | Bacteria | 11447 |
| 623 | Ga0495580_0102354 | 3300046472 | Unclassified | 1991 |
| 624 | Ga0495582_0213906 | 3300046473 | Unclassified | 1102 |
| 625 | Ga0495639_0291648 | 3300046475 | Bacteria | 812 |
| 626 | Ga0495594_0421571 | 3300046499 | Bacteria | 759 |
| 627 | Ga0495606_0146447 | 3300046507 | Bacteria | 1390 |
| 628 | Ga0495630_0029743 | 3300046517 | Unclassified | 4061 |
| 629 | Ga0495632_0058846 | 3300046519 | Unclassified | 1871 |
| 630 | Ga0495632_0075526 | 3300046519 | Unclassified | 1613 |
| 631 | Ga0495632_0281869 | 3300046519 | Bacteria | 740 |
| 632 | Ga0495586_0007092 | 3300046535 | Bacteria | 5972 |
| 633 | Ga0495587_0240066 | 3300046536 | Bacteria | 1020 |
| 634 | Ga0495611_0121128 | 3300046648 | Bacteria | 1220 |
| 635 | Ga0495625_0034546 | 3300046660 | Bacteria | 3730 |
| 636 | Ga0495625_0106672 | 3300046660 | Unclassified | 1918 |
| 637 | Ga0495625_0207423 | 3300046660 | Bacteria | 1290 |
| 638 | Ga0495635_0516421 | 3300046663 | Bacteria | 785 |
| 639 | Ga0495646_0319036 | 3300046680 | Unclassified | 819 |
| 640 | Ga0495613_0501652 | 3300046689 | Bacteria | 817 |
| 641 | Ga0495671_0091841 | 3300046692 | Bacteria | 1486 |
| 642 | Ga0495674_0206606 | 3300047319 | Bacteria | 1628 |
| 643 | Ga0495674_0319647 | 3300047319 | Bacteria | 1265 |
| 644 | Ga0495672_0025433 | 3300047320 | Bacteria | 3789 |
| 645 | Ga0495683_0337586 | 3300047323 | Bacteria | 639 |
| 646 | Ga0495686_0089440 | 3300047472 | Unclassified | 1871 |
| 647 | Ga0495626_0280968 | 3300048091 | Unclassified | 661 |
| 648 | Ga0496100_0064832 | 3300048903 | Bacteria | 2419 |
| 649 | Ga0496100_0120810 | 3300048903 | Unclassified | 1832 |
| 650 | Ga0496101_0002467 | 3300048904 | Bacteria | 11361 |
| 651 | Ga0496102_0010382 | 3300048905 | Bacteria | 8013 |
| 652 | Ga0496102_0120199 | 3300048905 | Unclassified | 2453 |
| 653 | Ga0496102_0395477 | 3300048905 | Bacteria | 1300 |
| 654 | Ga0496103_0059820 | 3300048906 | Unclassified | 2367 |
| 655 | Ga0496103_0114242 | 3300048906 | Bacteria | 1716 |
| 656 | Ga0496106_0004490 | 3300048909 | Bacteria | 10347 |
| 657 | Ga0496107_0045942 | 3300048910 | Unclassified | 3142 |
| 658 | Ga0496107_0212796 | 3300048910 | Unclassified | 1438 |
| 659 | Ga0496107_0730535 | 3300048910 | Unclassified | 727 |
| 660 | Ga0496108_0025584 | 3300048911 | Bacteria | 4865 |
| 661 | Ga0496108_0036334 | 3300048911 | Bacteria | 4099 |
| 662 | Ga0496109_0012647 | 3300048912 | Bacteria | 7290 |
| 663 | Ga0496109_0434732 | 3300048912 | Unclassified | 1240 |
| 664 | Ga0496110_0023555 | 3300048913 | Bacteria | 5238 |
| 665 | Ga0496110_0060976 | 3300048913 | Bacteria | 3328 |
| 666 | Ga0496111_0001145 | 3300048914 | Bacteria | 14715 |
| 667 | Ga0496112_0009020 | 3300048915 | Bacteria | 8956 |
| 668 | Ga0496112_0058535 | 3300048915 | Bacteria | 3795 |
| 669 | Ga0496112_0156130 | 3300048915 | Bacteria | 2249 |
| 670 | Ga0496113_0069692 | 3300048916 | Bacteria | 2671 |
| 671 | Ga0496114_0147715 | 3300048917 | Unclassified | 2038 |
| 672 | Ga0496115_0049582 | 3300048918 | Unclassified | 3361 |
| 673 | Ga0496115_0166668 | 3300048918 | Bacteria | 1822 |
| 674 | Ga0496116_0002908 | 3300048919 | Bacteria | 17496 |
| 675 | Ga0496117_0000140 | 3300048920 | Bacteria | 158390 |
| 676 | Ga0496118_0000102 | 3300048921 | Bacteria | 158228 |
| 677 | Ga0496118_0093711 | 3300048921 | Bacteria | 2056 |
| 678 | Ga0496119_0032426 | 3300048922 | Unclassified | 3481 |
| 679 | Ga0496120_0002491 | 3300048923 | Bacteria | 18506 |
| 680 | Ga0496120_0041201 | 3300048923 | Unclassified | 2707 |
| 681 | Ga0496121_0014518 | 3300048924 | Bacteria | 8350 |
| 682 | Ga0496121_0027937 | 3300048924 | Bacteria | 5268 |
| 683 | Ga0496121_0136736 | 3300048924 | Bacteria | 1824 |
| 684 | Ga0496121_0249043 | 3300048924 | Unclassified | 1233 |
| 685 | Ga0496124_0090228 | 3300048927 | Bacteria | 2500 |
| 686 | Ga0496125_0000690 | 3300048928 | Bacteria | 55954 |
| 687 | Ga0496125_0035666 | 3300048928 | Bacteria | 4357 |
| 688 | Ga0496125_0146311 | 3300048928 | Unclassified | 1632 |
| 689 | Ga0496125_0196877 | 3300048928 | Unclassified | 1324 |
| 690 | Ga0496126_0044577 | 3300048929 | Bacteria | 4083 |
| 691 | Ga0496126_0048097 | 3300048929 | Bacteria | 3901 |
| 692 | Ga0496126_0086690 | 3300048929 | Unclassified | 2759 |
| 693 | Ga0496126_0142243 | 3300048929 | Bacteria | 2064 |
| 694 | Ga0501299_009438 | 3300049522 | Bacteria | 1608 |
| 695 | Ga0501031_0120188 | 3300049568 | Bacteria | 1716 |
| 696 | Ga0501032_0027305 | 3300049569 | Bacteria | 3923 |
| 697 | Ga0501033_0247248 | 3300049570 | Unclassified | 1265 |
| 698 | Ga0501033_0379978 | 3300049570 | Bacteria | 987 |
| 699 | Ga0501034_0440423 | 3300049571 | Bacteria | 1222 |
| 700 | Ga0501036_0001259 | 3300049572 | Bacteria | 19410 |
| 701 | Ga0501036_0151731 | 3300049572 | Bacteria | 1954 |
| 702 | Ga0501036_0415632 | 3300049572 | Bacteria | 1122 |
| 703 | Ga0501037_0023306 | 3300049573 | Bacteria | 4578 |
| 704 | Ga0501037_0046548 | 3300049573 | Bacteria | 3181 |
| 705 | Ga0501038_0303108 | 3300049574 | Unclassified | 1253 |
| 706 | Ga0501039_0000810 | 3300049575 | Bacteria | 22551 |
| 707 | Ga0501039_0080485 | 3300049575 | Bacteria | 2535 |
| 708 | Ga0501039_0086988 | 3300049575 | Bacteria | 2434 |
| 709 | Ga0501039_0128277 | 3300049575 | Bacteria | 1990 |
| 710 | Ga0501039_0412657 | 3300049575 | Unclassified | 1061 |
| 711 | Ga0501040_0004684 | 3300049576 | Bacteria | 8875 |
| 712 | Ga0501040_0004869 | 3300049576 | Bacteria | 8693 |
| 713 | Ga0501040_0010830 | 3300049576 | Bacteria | 5961 |
| 714 | Ga0501040_0015857 | 3300049576 | Bacteria | 4980 |
| 715 | Ga0501040_0020786 | 3300049576 | Bacteria | 4377 |
| 716 | Ga0501040_0258797 | 3300049576 | Bacteria | 1242 |
| 717 | Ga0501041_0000218 | 3300049577 | Bacteria | 26770 |
| 718 | Ga0501041_0011756 | 3300049577 | Bacteria | 5181 |
| 719 | Ga0501041_0044475 | 3300049577 | Bacteria | 2699 |
| 720 | Ga0501041_0079418 | 3300049577 | Bacteria | 2019 |
| 721 | Ga0501041_0095658 | 3300049577 | Unclassified | 1836 |
| 722 | Ga0501041_0607226 | 3300049577 | Bacteria | 698 |
| 723 | Ga0501042_0009188 | 3300049578 | Bacteria | 6575 |
| 724 | Ga0501042_0029488 | 3300049578 | Bacteria | 3869 |
| 725 | Ga0501042_0075884 | 3300049578 | Bacteria | 2405 |
| 726 | Ga0501042_0106922 | 3300049578 | Bacteria | 2014 |
| 727 | Ga0501042_0156392 | 3300049578 | Bacteria | 1644 |
| 728 | Ga0501043_0323091 | 3300049579 | Unclassified | 1176 |
| 729 | Ga0501043_0361887 | 3300049579 | Unclassified | 1101 |
| 730 | Ga0501046_0032270 | 3300049580 | Bacteria | 4241 |
| 731 | Ga0501046_0055562 | 3300049580 | Bacteria | 3110 |
| 732 | Ga0501046_0079959 | 3300049580 | Bacteria | 2527 |
| 733 | Ga0501048_0053820 | 3300049582 | Bacteria | 2860 |
| 734 | Ga0501048_0064137 | 3300049582 | Bacteria | 2598 |
| 735 | Ga0501048_0080804 | 3300049582 | Bacteria | 2293 |
| 736 | Ga0501067_0002110 | 3300049583 | Bacteria | 10958 |
| 737 | Ga0501068_0030587 | 3300049584 | Unclassified | 3195 |
| 738 | Ga0501068_0235702 | 3300049584 | Unclassified | 1164 |
| 739 | Ga0501069_0017735 | 3300049585 | Bacteria | 3837 |
| 740 | Ga0501069_0487742 | 3300049585 | Unclassified | 735 |
| 741 | Ga0501071_0011560 | 3300049587 | Bacteria | 5955 |
| 742 | Ga0501071_0017929 | 3300049587 | Bacteria | 4895 |
| 743 | Ga0501071_0183110 | 3300049587 | Bacteria | 1570 |
| 744 | Ga0501071_0303900 | 3300049587 | Bacteria | 1210 |
| 745 | Ga0501071_0456693 | 3300049587 | Bacteria | 978 |
| 746 | Ga0501071_0613746 | 3300049587 | Unclassified | 836 |
| 747 | Ga0501072_0000330 | 3300049588 | Bacteria | 33764 |
| 748 | Ga0501072_0005171 | 3300049588 | Bacteria | 9924 |
| 749 | Ga0501072_0005396 | 3300049588 | Bacteria | 9733 |
| 750 | Ga0501072_0112542 | 3300049588 | Bacteria | 2167 |
| 751 | Ga0501072_0190544 | 3300049588 | Bacteria | 1635 |
| 752 | Ga0501072_0461765 | 3300049588 | Bacteria | 1005 |
| 753 | Ga0501072_0641228 | 3300049588 | Unclassified | 836 |
| 754 | Ga0501073_0018358 | 3300049589 | Bacteria | 5055 |
| 755 | Ga0501073_0038211 | 3300049589 | Bacteria | 3407 |
| 756 | Ga0501073_0394134 | 3300049589 | Unclassified | 957 |
| 757 | Ga0501073_0442783 | 3300049589 | Unclassified | 898 |
| 758 | Ga0501074_0007873 | 3300049590 | Bacteria | 7719 |
| 759 | Ga0501074_0099180 | 3300049590 | Unclassified | 2085 |
| 760 | Ga0501075_0045992 | 3300049591 | Bacteria | 3278 |
| 761 | Ga0501075_0056710 | 3300049591 | Bacteria | 2949 |
| 762 | Ga0501075_0201350 | 3300049591 | Bacteria | 1518 |
| 763 | Ga0501075_0206353 | 3300049591 | Unclassified | 1499 |
| 764 | Ga0501076_0009540 | 3300049592 | Bacteria | 7164 |
| 765 | Ga0501076_0013454 | 3300049592 | Bacteria | 6138 |
| 766 | Ga0501076_0025566 | 3300049592 | Bacteria | 4570 |
| 767 | Ga0501076_0058390 | 3300049592 | Bacteria | 3066 |
| 768 | Ga0501076_0073896 | 3300049592 | Bacteria | 2730 |
| 769 | Ga0501076_0179508 | 3300049592 | Bacteria | 1726 |
| 770 | Ga0501076_0384844 | 3300049592 | Unclassified | 1153 |
| 771 | Ga0501076_0455384 | 3300049592 | Bacteria | 1053 |
| 772 | Ga0501077_0015063 | 3300049593 | Bacteria | 4862 |
| 773 | Ga0501077_0035113 | 3300049593 | Bacteria | 3192 |
| 774 | Ga0501077_0106075 | 3300049593 | Unclassified | 1781 |
| 775 | Ga0501077_0117545 | 3300049593 | Bacteria | 1685 |
| 776 | Ga0501079_0000621 | 3300049741 | Bacteria | 23559 |
| 777 | Ga0501079_0027098 | 3300049741 | Bacteria | 4392 |
| 778 | Ga0501079_0032462 | 3300049741 | Bacteria | 4014 |
| 779 | Ga0501079_0055880 | 3300049741 | Bacteria | 3046 |
| 780 | Ga0501079_0092501 | 3300049741 | Bacteria | 2343 |
| 781 | Ga0501079_0279873 | 3300049741 | Bacteria | 1304 |
| 782 | Ga0501080_0001908 | 3300049742 | Bacteria | 17967 |
| 783 | Ga0501080_0014235 | 3300049742 | Bacteria | 7323 |
| 784 | Ga0501080_0015672 | 3300049742 | Bacteria | 6989 |
| 785 | Ga0501080_0044736 | 3300049742 | Bacteria | 4121 |
| 786 | Ga0501080_0251503 | 3300049742 | Bacteria | 1611 |
| 787 | Ga0501081_0003178 | 3300049743 | Bacteria | 10446 |
| 788 | Ga0501081_0015558 | 3300049743 | Bacteria | 5022 |
| 789 | Ga0501081_0017496 | 3300049743 | Bacteria | 4746 |
| 790 | Ga0501081_0029299 | 3300049743 | Bacteria | 3720 |
| 791 | Ga0501081_0078372 | 3300049743 | Bacteria | 2309 |
| 792 | Ga0501081_0659446 | 3300049743 | Unclassified | 784 |
| 793 | Ga0501083_0031993 | 3300049744 | Bacteria | 3609 |
| 794 | Ga0501083_0145997 | 3300049744 | Bacteria | 1549 |
| 795 | Ga0501083_0277981 | 3300049744 | Unclassified | 1089 |
| 796 | Ga0501083_0306475 | 3300049744 | Bacteria | 1033 |
| 797 | Ga0501083_0598511 | 3300049744 | Unclassified | 717 |
| 798 | Ga0501035_0006537 | 3300049822 | Bacteria | 10941 |
| 799 | Ga0501035_0017291 | 3300049822 | Bacteria | 6649 |
| 800 | Ga0501035_0267905 | 3300049822 | Bacteria | 1446 |
| 801 | Ga0501035_0597947 | 3300049822 | Unclassified | 899 |
| 802 | Ga0501044_0061457 | 3300049823 | Bacteria | 3843 |
| 803 | Ga0501045_0000097 | 3300049824 | Bacteria | 42924 |
| 804 | Ga0501045_0019438 | 3300049824 | Bacteria | 4843 |
| 805 | Ga0501045_0057703 | 3300049824 | Bacteria | 2841 |
| 806 | nmdc:mga05p37_21733_c1 | 3300050507 | Bacteria | 7773 |
| 807 | nmdc:mga05p37_691449_c1 | 3300050507 | Unclassified | 1135 |
| 808 | nmdc:mga05p37_75240_c1 | 3300050507 | Bacteria | 4156 |
| 809 | nmdc:mga05p37_83523_c1 | 3300050507 | Bacteria | 3935 |
| 810 | nmdc:mga09592_1167_c1 | 3300050508 | Bacteria | 20982 |
| 811 | nmdc:mga09592_20418_c1 | 3300050508 | Bacteria | 5447 |
| 812 | nmdc:mga09592_76662_c1 | 3300050508 | Bacteria | 2843 |
| 813 | nmdc:mga0qj67_155512_c1 | 3300050509 | Bacteria | 1856 |
| 814 | nmdc:mga0qj67_220180_c1 | 3300050509 | Unclassified | 1541 |
| 815 | nmdc:mga0qj67_251269_c1 | 3300050509 | Bacteria | 1435 |
| 816 | nmdc:mga0qj67_319477_c1 | 3300050509 | Bacteria | 1257 |
| 817 | nmdc:mga06r32_75_c1 | 3300050510 | Bacteria | 65273 |
| 818 | nmdc:mga06r32_77956_c1 | 3300050510 | Bacteria | 3220 |
| 819 | nmdc:mga08y16_1433_c1 | 3300050511 | Bacteria | 23931 |
| 820 | nmdc:mga08y16_201_c1 | 3300050511 | Bacteria | 53812 |
| 821 | nmdc:mga08y16_369877_c1 | 3300050511 | Bacteria | 1471 |
| 822 | nmdc:mga08y16_461818_c1 | 3300050511 | Bacteria | 1294 |
| 823 | nmdc:mga08y16_63856_c1 | 3300050511 | Bacteria | 3846 |
| 824 | nmdc:mga0n895_1704_c1 | 3300050512 | Bacteria | 16618 |
| 825 | nmdc:mga0a205_1481_c1 | 3300050515 | Bacteria | 20039 |
| 826 | Ga0500583_0049792 | 3300053092 | Bacteria | 1940 |
| 827 | Ga0500583_0053543 | 3300053092 | Unclassified | 1881 |
| 828 | Ga0500583_0057774 | 3300053092 | Bacteria | 1823 |
| 829 | Ga0500583_0131716 | 3300053092 | Bacteria | 1241 |
| 830 | Ga0500583_0179866 | 3300053092 | Bacteria | 1053 |
| 831 | Ga0500651_0213590 | 3300053093 | Unclassified | 1134 |
| 832 | Ga0500641_0022160 | 3300053096 | Bacteria | 2430 |
| 833 | Ga0500641_0086975 | 3300053096 | Unclassified | 1331 |
| 834 | Ga0500650_0120515 | 3300053098 | Bacteria | 1223 |
| 835 | Ga0500556_0000806 | 3300053104 | Bacteria | 18285 |
| 836 | Ga0500556_0066435 | 3300053104 | Unclassified | 1339 |
| 837 | Ga0500617_017315 | 3300053124 | Unclassified | 3122 |
| 838 | Ga0500642_0213871 | 3300053130 | Bacteria | 894 |
| 839 | Ga0500642_0267615 | 3300053130 | Unclassified | 780 |
| 840 | Ga0500658_0055866 | 3300053134 | Unclassified | 1627 |
| 841 | Ga0500568_0066733 | 3300053139 | Bacteria | 1383 |
| 842 | Ga0500568_0108478 | 3300053139 | Bacteria | 1038 |
| 843 | Ga0500588_0001169 | 3300053146 | Bacteria | 4841 |
| 844 | Ga0500588_0084362 | 3300053146 | Bacteria | 1069 |
| 845 | Ga0500588_0094053 | 3300053146 | Bacteria | 1023 |
| 846 | Ga0500616_0007166 | 3300053153 | Bacteria | 7131 |
| 847 | Ga0500622_0067142 | 3300053156 | Unclassified | 1819 |
| 848 | Ga0500622_0090055 | 3300053156 | Unclassified | 1523 |
| 849 | Ga0500622_0091027 | 3300053156 | Bacteria | 1513 |
| 850 | Ga0500630_022217 | 3300053159 | Unclassified | 3134 |
| 851 | Ga0500636_0041079 | 3300053177 | Archaea | 2736 |
| 852 | Ga0500637_0001461 | 3300053178 | Bacteria | 10067 |
| 853 | Ga0500637_0021113 | 3300053178 | Bacteria | 3534 |
| 854 | Ga0500637_0115310 | 3300053178 | Unclassified | 1558 |
| 855 | Ga0500637_0131368 | 3300053178 | Unclassified | 1452 |
| 856 | Ga0501084_0017200 | 3300054114 | Bacteria | 6007 |
| 857 | Ga0501084_0072488 | 3300054114 | Bacteria | 2884 |
| 858 | Ga0501084_0097724 | 3300054114 | Bacteria | 2465 |
| 859 | Ga0501084_0127555 | 3300054114 | Bacteria | 2141 |
| 860 | Ga0501084_0440304 | 3300054114 | Bacteria | 1102 |
| 861 | Ga0501084_0804981 | 3300054114 | Bacteria | 791 |
| 862 | Ga0501082_0000238 | 3300060353 | Bacteria | 48210 |
| 863 | Ga0501082_0006893 | 3300060353 | Bacteria | 9829 |
| 864 | Ga0501082_0068455 | 3300060353 | Bacteria | 3056 |
| 865 | Ga0501082_0167849 | 3300060353 | Bacteria | 1907 |
| 866 | Ga0501082_0417516 | 3300060353 | Bacteria | 1171 |
| 867 | Ga0501082_0646141 | 3300060353 | Bacteria | 926 |
| 868 | Ga0501082_1276945 | 3300060353 | Unclassified | 641 |
| 869 | Ga0466962_0000766 | 3300061719 | Bacteria | 14407 |
| 870 | Ga0530510_0010796 | 3300061734 | Bacteria | 6408 |
| 871 | Ga0530510_0038580 | 3300061734 | Bacteria | 3449 |
| 872 | Ga0530510_0043942 | 3300061734 | Bacteria | 3228 |
| 873 | Ga0530510_0056289 | 3300061734 | Bacteria | 2841 |
| 874 | Ga0530510_0071389 | 3300061734 | Bacteria | 2520 |
| 875 | Ga0530510_0385098 | 3300061734 | Unclassified | 1056 |
| 876 | Ga0530510_0566113 | 3300061734 | Unclassified | 863 |
| 877 | Ga0501068_0016213 | |||
| 878 | JGI24744J21845_10014774 | |||
| 879 | JGI25406J46586_10038756 | |||
| 880 | rootH2_10010996 | |||
| 881 | rootL2_10336540 | |||
| 882 | rootH1_10317689 | |||
| 883 | Ga0065712_10074314 | |||
| 884 | Ga0065715_10113859 | |||
| 885 | Ga0065707_10082386 | |||
| 886 | Ga0065707_10083134 | |||
| 887 | Ga0070683_100053089 | |||
| 888 | Ga0070683_100089296 | |||
| 889 | Ga0070683_100408406 | |||
| 890 | Ga0070690_100006941 | |||
| 891 | Ga0070670_100008276 | |||
| 892 | Ga0070670_100502870 | |||
| 893 | Ga0070677_10427100 | |||
| 894 | Ga0068869_100025118 | |||
| 895 | Ga0068869_100079555 | |||
| 896 | Ga0068869_100220572 | |||
| 897 | Ga0070666_10011857 | |||
| 898 | Ga0070666_10775257 | |||
| 899 | Ga0070680_100002053 | |||
| 900 | Ga0070680_100004832 | |||
| 901 | Ga0070680_100188638 | |||
| 902 | Ga0070680_100312177 | |||
| 903 | Ga0070680_100336173 | |||
| 904 | Ga0070682_100046755 | |||
| 905 | Ga0068868_100023884 | |||
| 906 | Ga0070660_100277047 | |||
| 907 | Ga0070660_100717047 | |||
| 908 | Ga0070689_100003722 | |||
| 909 | Ga0070687_100001064 | |||
| 910 | Ga0070661_100004428 | |||
| 911 | Ga0070661_100240763 | |||
| 912 | Ga0070661_100375907 | |||
| 913 | Ga0070661_100637126 | |||
| 914 | Ga0070692_10281632 | |||
| 915 | Ga0070668_100121305 | |||
| 916 | Ga0070669_100008029 | |||
| 917 | Ga0070669_100026375 | |||
| 918 | Ga0070669_100567582 | |||
| 919 | Ga0070675_100006841 | |||
| 920 | Ga0070675_100010323 | |||
| 921 | Ga0070671_100001079 | |||
| 922 | Ga0070671_100006515 | |||
| 923 | Ga0070671_100067611 | |||
| 924 | Ga0070674_100696294 | |||
| 925 | Ga0070673_100000998 | |||
| 926 | Ga0070673_100011800 | |||
| 927 | Ga0070688_100076614 | |||
| 928 | Ga0070667_100000395 | |||
| 929 | Ga0070667_100005556 | |||
| 930 | Ga0070667_100202092 | |||
| 931 | Ga0070667_100290889 | |||
| 932 | Ga0070709_10523334 | |||
| 933 | Ga0070714_100086100 | |||
| 934 | Ga0070713_100006106 | |||
| 935 | Ga0070713_100059934 | |||
| 936 | Ga0070713_100727075 | |||
| 937 | Ga0070710_10093733 | |||
| 938 | Ga0070701_10170737 | |||
| 939 | Ga0070711_100015495 | |||
| 940 | Ga0070711_100081000 | |||
| 941 | Ga0070705_100005687 | |||
| 942 | Ga0070705_100011210 | |||
| 943 | Ga0070700_100058990 | |||
| 944 | Ga0070694_100082059 | |||
| 945 | Ga0070694_100134656 | |||
| 946 | Ga0070663_100160988 | |||
| 947 | Ga0070663_101026373 | |||
| 948 | Ga0070678_100001136 | |||
| 949 | Ga0070662_100027548 | |||
| 950 | Ga0070662_100034320 | |||
| 951 | Ga0070681_10011856 | |||
| 952 | Ga0070681_10029764 | |||
| 953 | Ga0070681_10032836 | |||
| 954 | Ga0070681_10086130 | |||
| 955 | Ga0070681_10099002 | |||
| 956 | Ga0070681_10254460 | |||
| 957 | Ga0070681_10694639 | |||
| 958 | Ga0070681_10714980 | |||
| 959 | Ga0070681_10876639 | |||
| 960 | Ga0068867_100147781 | |||
| 961 | Ga0070685_10004822 | |||
| 962 | Ga0070685_10709578 | |||
| 963 | Ga0070707_100556277 | |||
| 964 | Ga0070679_100004061 | |||
| 965 | Ga0070679_100018028 | |||
| 966 | Ga0070679_100024463 | |||
| 967 | Ga0070679_100057560 | |||
| 968 | Ga0070679_100094419 | |||
| 969 | Ga0070679_100177972 | |||
| 970 | Ga0070684_100001445 | |||
| 971 | Ga0070684_100051422 | |||
| 972 | Ga0070697_100137297 | |||
| 973 | Ga0068853_100107434 | |||
| 974 | Ga0068853_100311244 | |||
| 975 | Ga0070672_100046021 | |||
| 976 | Ga0070672_100076759 | |||
| 977 | Ga0070686_100001945 | |||
| 978 | Ga0070686_100064886 | |||
| 979 | Ga0070686_100571594 | |||
| 980 | Ga0070696_100164196 | |||
| 981 | Ga0070693_100080946 | |||
| 982 | Ga0070665_100005098 | |||
| 983 | Ga0070665_100008171 | |||
| 984 | Ga0070665_100009641 | |||
| 985 | Ga0070665_100016687 | |||
| 986 | Ga0070665_100071031 | |||
| 987 | Ga0070665_100080522 | |||
| 988 | Ga0070665_100417086 | |||
| 989 | Ga0070704_100061263 | |||
| 990 | Ga0070704_100304578 | |||
| 991 | Ga0068855_100001126 | |||
| 992 | Ga0068855_100005841 | |||
| 993 | Ga0068855_100008548 | |||
| 994 | Ga0068855_100044345 | |||
| 995 | Ga0068855_100400283 | |||
| 996 | Ga0070664_100038093 | |||
| 997 | Ga0070664_100780018 | |||
| 998 | Ga0068857_100051245 | |||
| 999 | Ga0068857_100867664 | |||
| 1000 | Ga0068854_100082218 | |||
| 1001 | Ga0068854_100309236 | |||
| 1002 | Ga0068854_100569313 | |||
| 1003 | Ga0068856_100053850 | |||
| 1004 | Ga0068856_100350267 | |||
| 1005 | Ga0070702_100010262 | |||
| 1006 | Ga0068852_100886466 | |||
| 1007 | Ga0068859_100000351 | |||
| 1008 | Ga0068859_100001971 | |||
| 1009 | Ga0068859_100099996 | |||
| 1010 | Ga0068864_100006023 | |||
| 1011 | Ga0068864_100132739 | |||
| 1012 | Ga0068864_100179156 | |||
| 1013 | Ga0068864_100931122 | |||
| 1014 | Ga0068864_101155363 | |||
| 1015 | Ga0068866_10038137 | |||
| 1016 | Ga0068866_10248680 | |||
| 1017 | Ga0068861_100001164 | |||
| 1018 | Ga0068861_100001318 | |||
| 1019 | Ga0068861_100031712 | |||
| 1020 | Ga0068861_100735349 | |||
| 1021 | Ga0068861_100950339 | |||
| 1022 | Ga0068851_10071989 | |||
| 1023 | Ga0068870_10096872 | |||
| 1024 | Ga0068863_100001670 | |||
| 1025 | Ga0068863_100012408 | |||
| 1026 | Ga0068863_100025514 | |||
| 1027 | Ga0068863_100033124 | |||
| 1028 | Ga0068858_100006174 | |||
| 1029 | Ga0068858_100006466 | |||
| 1030 | Ga0068858_100010999 | |||
| 1031 | Ga0068858_100040805 | |||
| 1032 | Ga0068858_100210525 | |||
| 1033 | Ga0068858_100432068 | |||
| 1034 | Ga0068860_100000293 | |||
| 1035 | Ga0068860_100006090 | |||
| 1036 | Ga0068860_100009097 | |||
| 1037 | Ga0068860_100040768 | |||
| 1038 | Ga0068860_100189016 | |||
| 1039 | Ga0068860_100324251 | |||
| 1040 | Ga0068862_100005680 | |||
| 1041 | Ga0068862_100041083 | |||
| 1042 | Ga0068862_100058576 | |||
| 1043 | Ga0068862_100084811 | |||
| 1044 | Ga0068862_100096304 | |||
| 1045 | Ga0068862_100341994 | |||
| 1046 | Ga0081455_10000039 | |||
| 1047 | Ga0081455_10115556 | |||
| 1048 | Ga0081539_10000006 | |||
| 1049 | Ga0070715_10000168 | |||
| 1050 | Ga0070712_100001910 | |||
| 1051 | Ga0070712_100385877 | |||
| 1052 | Ga0097621_100044192 | |||
| 1053 | Ga0097621_100075626 | |||
| 1054 | Ga0097621_100144729 | |||
| 1055 | Ga0068871_100017714 | |||
| 1056 | Ga0068871_100080411 | |||
| 1057 | Ga0068871_100118151 | |||
| 1058 | Ga0075428_100002157 | |||
| 1059 | Ga0075428_100009058 | |||
| 1060 | Ga0075428_100020190 | |||
| 1061 | Ga0075428_100116927 | |||
| 1062 | Ga0075428_100241951 | |||
| 1063 | Ga0075430_100028458 | |||
| 1064 | Ga0075430_100036930 | |||
| 1065 | Ga0075430_100153970 | |||
| 1066 | Ga0075431_100000064 | |||
| 1067 | Ga0075431_100087200 | |||
| 1068 | Ga0075433_10016693 | |||
| 1069 | Ga0075434_100044029 | |||
| 1070 | Ga0075434_100264926 | |||
| 1071 | Ga0075429_100005986 | |||
| 1072 | Ga0075429_100442020 | |||
| 1073 | Ga0068865_100030682 | |||
| 1074 | Ga0068865_100117641 | |||
| 1075 | Ga0068865_100188643 | |||
| 1076 | Ga0097620_100000351 | |||
| 1077 | Ga0097620_100001971 | |||
| 1078 | Ga0097620_100099995 | |||
| 1079 | Ga0075435_100009973 | |||
| 1080 | Ga0075435_100905600 | |||
| 1081 | Ga0099794_10100567 | |||
| 1082 | Ga0105250_10046869 | |||
| 1083 | Ga0105250_10055914 | |||
| 1084 | Ga0105240_10000995 | |||
| 1085 | Ga0105240_10009806 | |||
| 1086 | Ga0105240_10011322 | |||
| 1087 | Ga0105240_10013816 | |||
| 1088 | Ga0105240_10030471 | |||
| 1089 | Ga0105240_10030890 | |||
| 1090 | Ga0105240_10063423 | |||
| 1091 | Ga0105240_10089814 | |||
| 1092 | Ga0105240_10098363 | |||
| 1093 | Ga0105240_10359029 | |||
| 1094 | Ga0105240_10927195 | |||
| 1095 | Ga0105240_11307194 | |||
| 1096 | Ga0111539_10000362 | |||
| 1097 | Ga0111539_10003977 | |||
| 1098 | Ga0111539_10072714 | |||
| 1099 | Ga0111539_10153493 | |||
| 1100 | Ga0111539_10676907 | |||
| 1101 | Ga0105245_10018862 | |||
| 1102 | Ga0105245_10158987 | |||
| 1103 | Ga0105245_11100649 | |||
| 1104 | Ga0105245_11161069 | |||
| 1105 | Ga0105247_10000150 | |||
| 1106 | Ga0105247_10001687 | |||
| 1107 | Ga0105247_10007631 | |||
| 1108 | Ga0105247_10245818 | |||
| 1109 | Ga0114129_10023151 | |||
| 1110 | Ga0114129_10042119 | |||
| 1111 | Ga0114129_10061504 | |||
| 1112 | Ga0114129_10769779 | |||
| 1113 | Ga0105243_10425224 | |||
| 1114 | Ga0105241_10103622 | |||
| 1115 | Ga0105241_10204824 | |||
| 1116 | Ga0105242_10000384 | |||
| 1117 | Ga0105242_10329256 | |||
| 1118 | Ga0105248_10007148 | |||
| 1119 | Ga0105248_10021309 | |||
| 1120 | Ga0105248_10096736 | |||
| 1121 | Ga0105248_10188751 | |||
| 1122 | Ga0105248_10326551 | |||
| 1123 | Ga0105237_10027347 | |||
| 1124 | Ga0105237_10107967 | |||
| 1125 | Ga0105237_10127285 | |||
| 1126 | Ga0105237_10160141 | |||
| 1127 | Ga0105237_10162471 | |||
| 1128 | Ga0105238_10010575 | |||
| 1129 | Ga0105238_10011421 | |||
| 1130 | Ga0105238_10131265 | |||
| 1131 | Ga0105238_10160181 | |||
| 1132 | Ga0105238_10840158 | |||
| 1133 | Ga0105238_11184974 | |||
| 1134 | Ga0105249_10014095 | |||
| 1135 | Ga0105249_10030956 | |||
| 1136 | Ga0105249_10050436 | |||
| 1137 | Ga0105249_10055747 | |||
| 1138 | Ga0105249_10163684 | |||
| 1139 | Ga0105249_10261799 | |||
| 1140 | Ga0105249_10282795 | |||
| 1141 | Ga0105249_11247577 | |||
| 1142 | Ga0105030_100029 | |||
| 1143 | Ga0099796_10000823 | |||
| 1144 | Ga0105239_10045275 | |||
| 1145 | Ga0105239_10122966 | |||
| 1146 | Ga0105239_10349662 | |||
| 1147 | Ga0105239_10521211 | |||
| 1148 | Ga0105239_10673930 | |||
| 1149 | Ga0105239_10866892 | |||
| 1150 | Ga0105246_10032866 | |||
| 1151 | Ga0105246_10035157 | |||
| 1152 | Ga0157370_10005646 | |||
| 1153 | Ga0157370_10391954 | |||
| 1154 | Ga0157370_10682611 | |||
| 1155 | Ga0157369_10004805 | |||
| 1156 | Ga0157369_10024343 | |||
| 1157 | Ga0157369_10075516 | |||
| 1158 | Ga0157369_10269406 | |||
| 1159 | Ga0157374_10015813 | |||
| 1160 | Ga0157374_10162726 | |||
| 1161 | Ga0157374_10344351 | |||
| 1162 | Ga0157374_10371910 | |||
| 1163 | Ga0157378_10002033 | |||
| 1164 | Ga0163162_10100619 | |||
| 1165 | Ga0163162_10288032 | |||
| 1166 | Ga0157372_10555822 | |||
| 1167 | Ga0157372_10735691 | |||
| 1168 | Ga0157375_10008766 | |||
| 1169 | Ga0157375_10018374 | |||
| 1170 | Ga0157375_10042556 | |||
| 1171 | Ga0157375_10488179 | |||
| 1172 | Ga0163163_10004798 | |||
| 1173 | Ga0163163_10063626 | |||
| 1174 | Ga0163163_10201399 | |||
| 1175 | Ga0163163_10218572 | |||
| 1176 | Ga0163163_10248391 | |||
| 1177 | Ga0157380_10000775 | |||
| 1178 | Ga0157380_10004057 | |||
| 1179 | Ga0157380_10060466 | |||
| 1180 | Ga0157380_10132310 | |||
| 1181 | Ga0157380_10291928 | |||
| 1182 | Ga0157380_11297854 | |||
| 1183 | Ga0157377_10158217 | |||
| 1184 | Ga0157379_10082843 | |||
| 1185 | Ga0157379_10093522 | |||
| 1186 | Ga0157379_10226572 | |||
| 1187 | Ga0157376_10097033 | |||
| 1188 | Ga0157376_10241086 | |||
| 1189 | Ga0163161_10129925 | |||
| 1190 | Ga0206356_11883884 | |||
| 1191 | Ga0206350_10008138 | |||
| 1192 | Ga0206354_11029202 | |||
| 1193 | Ga0213874_10032867 | |||
| 1194 | Ga0213876_10061474 | |||
| 1195 | Ga0224712_10191359 | |||
| 1196 | Ga0207656_10045027 | |||
| 1197 | Ga0207692_10267350 | |||
| 1198 | Ga0207642_10037095 | |||
| 1199 | Ga0207642_10121390 | |||
| 1200 | Ga0207710_10000181 | |||
| 1201 | Ga0207710_10019776 | |||
| 1202 | Ga0207710_10140778 | |||
| 1203 | Ga0207688_10016011 | |||
| 1204 | Ga0207680_10009065 | |||
| 1205 | Ga0207680_10099639 | |||
| 1206 | Ga0207647_10037693 | |||
| 1207 | Ga0207685_10000708 | |||
| 1208 | Ga0207699_10327934 | |||
| 1209 | Ga0207699_10396449 | |||
| 1210 | Ga0207643_10072929 | |||
| 1211 | Ga0207643_10166561 | |||
| 1212 | Ga0207684_11094292 | |||
| 1213 | Ga0207654_10174662 | |||
| 1214 | Ga0207707_10003382 | |||
| 1215 | Ga0207707_10009212 | |||
| 1216 | Ga0207707_10046009 | |||
| 1217 | Ga0207707_10058009 | |||
| 1218 | Ga0207707_10099759 | |||
| 1219 | Ga0207707_10321510 | |||
| 1220 | Ga0207707_10678188 | |||
| 1221 | Ga0207695_10011497 | |||
| 1222 | Ga0207695_10020399 | |||
| 1223 | Ga0207695_10022926 | |||
| 1224 | Ga0207695_10027837 | |||
| 1225 | Ga0207695_10057929 | |||
| 1226 | Ga0207695_10066015 | |||
| 1227 | Ga0207695_10080228 | |||
| 1228 | Ga0207695_10081333 | |||
| 1229 | Ga0207695_10127643 | |||
| 1230 | Ga0207695_10355851 | |||
| 1231 | Ga0207695_10421396 | |||
| 1232 | Ga0207695_10889981 | |||
| 1233 | Ga0207671_10039138 | |||
| 1234 | Ga0207671_10046891 | |||
| 1235 | Ga0207671_10052570 | |||
| 1236 | Ga0207671_10244624 | |||
| 1237 | Ga0207693_10000385 | |||
| 1238 | Ga0207663_10055592 | |||
| 1239 | Ga0207660_10047569 | |||
| 1240 | Ga0207662_10001650 | |||
| 1241 | Ga0207662_10117928 | |||
| 1242 | Ga0207657_10163056 | |||
| 1243 | Ga0207649_10022125 | |||
| 1244 | Ga0207652_10025697 | |||
| 1245 | Ga0207652_10300268 | |||
| 1246 | Ga0207652_10303778 | |||
| 1247 | Ga0207652_10571067 | |||
| 1248 | Ga0207652_10898614 | |||
| 1249 | Ga0207646_10351657 | |||
| 1250 | Ga0207681_10035262 | |||
| 1251 | Ga0207681_10131100 | |||
| 1252 | Ga0207681_10454781 | |||
| 1253 | Ga0207694_10151341 | |||
| 1254 | Ga0207694_10287996 | |||
| 1255 | Ga0207694_10758948 | |||
| 1256 | Ga0207650_10007807 | |||
| 1257 | Ga0207659_10016096 | |||
| 1258 | Ga0207659_10054743 | |||
| 1259 | Ga0207687_10772380 | |||
| 1260 | Ga0207700_10000880 | |||
| 1261 | Ga0207700_10042352 | |||
| 1262 | Ga0207644_10004581 | |||
| 1263 | Ga0207644_10011875 | |||
| 1264 | Ga0207706_10032463 | |||
| 1265 | Ga0207706_10068180 | |||
| 1266 | Ga0207686_10011705 | |||
| 1267 | Ga0207709_10085085 | |||
| 1268 | Ga0207670_10987720 | |||
| 1269 | Ga0207669_10117292 | |||
| 1270 | Ga0207669_11016811 | |||
| 1271 | Ga0207704_10025561 | |||
| 1272 | Ga0207704_10305144 | |||
| 1273 | Ga0207691_10010045 | |||
| 1274 | Ga0207691_10053791 | |||
| 1275 | Ga0207711_10164231 | |||
| 1276 | Ga0207711_10166529 | |||
| 1277 | Ga0207711_10223692 | |||
| 1278 | Ga0207711_10334314 | |||
| 1279 | Ga0207689_10003796 | |||
| 1280 | Ga0207689_10067888 | |||
| 1281 | Ga0207689_10108074 | |||
| 1282 | Ga0207661_10126741 | |||
| 1283 | Ga0207679_10014827 | |||
| 1284 | Ga0207679_10904506 | |||
| 1285 | Ga0207679_11043643 | |||
| 1286 | Ga0207667_10001075 | |||
| 1287 | Ga0207667_10008172 | |||
| 1288 | Ga0207667_10017290 | |||
| 1289 | Ga0207667_10120503 | |||
| 1290 | Ga0207667_10660119 | |||
| 1291 | Ga0207667_10816668 | |||
| 1292 | Ga0207651_10124585 | |||
| 1293 | Ga0207712_10005709 | |||
| 1294 | Ga0207712_10016495 | |||
| 1295 | Ga0207712_10018767 | |||
| 1296 | Ga0207712_10087646 | |||
| 1297 | Ga0207712_10176320 | |||
| 1298 | Ga0207712_10182428 | |||
| 1299 | Ga0207668_10176346 | |||
| 1300 | Ga0207640_10192578 | |||
| 1301 | Ga0207640_10287937 | |||
| 1302 | Ga0207658_10000097 | |||
| 1303 | Ga0207658_10018140 | |||
| 1304 | Ga0207658_10129646 | |||
| 1305 | Ga0207658_10392754 | |||
| 1306 | Ga0207677_10576394 | |||
| 1307 | Ga0207703_10001369 | |||
| 1308 | Ga0207703_10002198 | |||
| 1309 | Ga0207703_10030580 | |||
| 1310 | Ga0207703_10220507 | |||
| 1311 | Ga0207703_10507940 | |||
| 1312 | Ga0207639_10328444 | |||
| 1313 | Ga0207678_10195602 | |||
| 1314 | Ga0207678_10806741 | |||
| 1315 | Ga0207708_10022002 | |||
| 1316 | Ga0207641_10003386 | |||
| 1317 | Ga0207641_10005080 | |||
| 1318 | Ga0207641_10020132 | |||
| 1319 | Ga0207641_10126905 | |||
| 1320 | Ga0207648_10185172 | |||
| 1321 | Ga0207648_10914548 | |||
| 1322 | Ga0207676_10003378 | |||
| 1323 | Ga0207676_10191022 | |||
| 1324 | Ga0207676_10471538 | |||
| 1325 | Ga0207676_10519013 | |||
| 1326 | Ga0207674_10103219 | |||
| 1327 | Ga0207674_10189014 | |||
| 1328 | Ga0207675_100040136 | |||
| 1329 | Ga0207675_100064580 | |||
| 1330 | Ga0207675_100166373 | |||
| 1331 | Ga0207675_100262226 | |||
| 1332 | Ga0207675_100359573 | |||
| 1333 | Ga0207675_101139561 | |||
| 1334 | Ga0207683_10005289 | |||
| 1335 | Ga0207698_10697936 | |||
| 1336 | Ga0209999_1028823 | |||
| 1337 | Ga0209974_10010109 | |||
| 1338 | Ga0207428_10001201 | |||
| 1339 | Ga0207428_10009885 | |||
| 1340 | Ga0207428_10055379 | |||
| 1341 | Ga0268266_10004397 | |||
| 1342 | Ga0268266_10019389 | |||
| 1343 | Ga0268266_10023855 | |||
| 1344 | Ga0268266_10035411 | |||
| 1345 | Ga0268266_10035791 | |||
| 1346 | Ga0268266_10040539 | |||
| 1347 | Ga0268266_10042488 | |||
| 1348 | Ga0268266_10118106 | |||
| 1349 | Ga0268265_10006756 | |||
| 1350 | Ga0268265_10011774 | |||
| 1351 | Ga0268265_10069686 | |||
| 1352 | Ga0268265_10229394 | |||
| 1353 | Ga0268264_10000293 | |||
| 1354 | Ga0268264_10024832 | |||
| 1355 | Ga0268264_10051426 | |||
| 1356 | Ga0268264_10349427 | |||
| 1357 | Ga0268264_10532619 | |||
| 1358 | Ga0307517_10321120 | |||
| 1359 | Ga0307515_10006519 | |||
| 1360 | Ga0307515_10376706 | |||
| 1361 | Ga0307511_10000310 | |||
| 1362 | Ga0307511_10060950 | |||
| 1363 | Ga0307511_10279603 | |||
| 1364 | Ga0265332_10039245 | |||
| 1365 | Ga0265328_10005167 | |||
| 1366 | Ga0265331_10002531 | |||
| 1367 | Ga0265316_10047959 | |||
| 1368 | Ga0307513_10146920 | |||
| 1369 | Ga0307513_10212496 | |||
| 1370 | Ga0307509_10000017 | |||
| 1371 | Ga0307509_10001255 | |||
| 1372 | Ga0307408_100074084 | |||
| 1373 | Ga0307508_10501129 | |||
| 1374 | Ga0316576_10006449 | |||
| 1375 | Ga0316576_10141673 | |||
| 1376 | Ga0316578_10058385 | |||
| 1377 | Ga0316578_10093112 | |||
| 1378 | Ga0316578_10192999 | |||
| 1379 | Ga0316577_10002556 | |||
| 1380 | Ga0307413_10114027 | |||
| 1381 | Ga0307413_10218690 | |||
| 1382 | Ga0307413_10508336 | |||
| 1383 | Ga0307410_10016028 | |||
| 1384 | Ga0307410_11048769 | |||
| 1385 | Ga0307406_10213238 | |||
| 1386 | Ga0307406_10374355 | |||
| 1387 | Ga0307406_10912967 | |||
| 1388 | Ga0307412_10013079 | |||
| 1389 | Ga0307412_10341174 | |||
| 1390 | Ga0307409_100249694 | |||
| 1391 | Ga0307416_100007092 | |||
| 1392 | Ga0307416_100251233 | |||
| 1393 | Ga0307414_10798170 | |||
| 1394 | Ga0307411_10069975 | |||
| 1395 | Ga0307411_10462575 | |||
| 1396 | Ga0307411_10475022 | |||
| 1397 | Ga0307411_10759668 | |||
| 1398 | Ga0307415_100696666 | |||
| 1399 | Ga0307510_10000002 | |||
| 1400 | Ga0316215_1003399 | |||
| 1401 | Ga0373958_0004528 | |||
| 1402 | Ga0373923_0140294 | |||
| 1403 | Ga0373932_0093713 | |||
| 1404 | Ga0373936_0012241 | |||
| 1405 | Ga0373936_0211384 | |||
| 1406 | Ga0373953_0141225 | |||
| 1407 | Ga0373954_0071239 | |||
| 1408 | Ga0373956_0020807 | |||
| 1409 | Ga0373946_0239747 | |||
| 1410 | Ga0373955_0026482 | |||
| 1411 | Ga0373955_0038212 | |||
| 1412 | Ga0316574_0001389 | |||
| 1413 | Ga0316574_0065927 | |||
| 1414 | Ga0316574_0316885 | |||
| 1415 | Ga0373935_0161898 | |||
| 1416 | Ga0373935_0799322 | |||
| 1417 | Ga0373927_0006569 | |||
| 1418 | Ga0373947_0068608 | |||
| 1419 | Ga0373937_0191021 | |||
| 1420 | Ga0316584_0001547 | |||
| 1421 | Ga0316584_0236392 | |||
| 1422 | Ga0316584_0396362 | |||
| 1423 | Ga0373925_0112683 | |||
| 1424 | Ga0395898_0001671 | |||
| 1425 | Ga0395898_0031186 | |||
| 1426 | Ga0395901_0354148 | |||
| 1427 | Ga0436365_0361199 | |||
| 1428 | Ga0436365_0968703 | |||
| 1429 | Ga0436365_1262329 | |||
| 1430 | Ga0436360_0636129 | |||
| 1431 | Ga0436360_0761517 | |||
| 1432 | Ga0436360_0903621 | |||
| 1433 | Ga0436360_1218347 | |||
| 1434 | Ga0436363_0242732 | |||
| 1435 | Ga0436363_0408341 | |||
| 1436 | Ga0436363_1328907 | |||
| 1437 | Ga0436363_1562350 | |||
| 1438 | Ga0436362_0066625 | |||
| 1439 | Ga0436362_0683596 | |||
| 1440 | Ga0439439_0007547 | |||
| 1441 | Ga0439461_0052441 | |||
| 1442 | Ga0439461_0072390 | |||
| 1443 | Ga0451787_275374 | |||
| 1444 | Ga0439431_0016311 | |||
| 1445 | Ga0439433_0057551 | |||
| 1446 | Ga0439443_001283 | |||
| 1447 | Ga0439455_0048461 | |||
| 1448 | Ga0450920_015104 | |||
| 1449 | Ga0450920_055342 | |||
| 1450 | Ga0450922_004663 | |||
| 1451 | Ga0450923_005519 | |||
| 1452 | Ga0450923_012011 | |||
| 1453 | Ga0450895_004324 | |||
| 1454 | Ga0450896_000043 | |||
| 1455 | Ga0450898_008132 | |||
| 1456 | Ga0450906_005321 | |||
| 1457 | Ga0450910_002669 | |||
| 1458 | Ga0439446_0000625 | |||
| 1459 | Ga0439446_0005284 | |||
| 1460 | Ga0450908_000158 | |||
| 1461 | Ga0439434_0000161 | |||
| 1462 | Ga0439434_0121465 | |||
| 1463 | Ga0439435_0000638 | |||
| 1464 | Ga0439464_0031830 | |||
| 1465 | Ga0439464_0100179 | |||
| 1466 | Ga0450916_029259 | |||
| 1467 | Ga0450918_025111 | |||
| 1468 | Ga0451577_0111990 | |||
| 1469 | Ga0466969_0001004 | |||
| 1470 | Ga0466969_0001145 | |||
| 1471 | Ga0466969_0055883 | |||
| 1472 | Ga0466972_0015610 | |||
| 1473 | Ga0466965_0021037 | |||
| 1474 | Ga0466966_0000115 | |||
| 1475 | Ga0466966_0095424 | |||
| 1476 | Ga0466966_0173503 | |||
| 1477 | Ga0466961_0000137 | |||
| 1478 | Ga0466964_0000061 | |||
| 1479 | Ga0453684_0706975 | |||
| 1480 | Ga0466971_0000102 | |||
| 1481 | Ga0466968_0072545 | |||
| 1482 | Ga0466970_0000553 | |||
| 1483 | Ga0466957_0006358 | |||
| 1484 | Ga0466959_0001065 | |||
| 1485 | Ga0466959_0010240 | |||
| 1486 | Ga0466959_0036423 | |||
| 1487 | Ga0466959_0052252 | |||
| 1488 | Ga0466959_0099012 | |||
| 1489 | Ga0451576_0143341 | |||
| 1490 | Ga0466958_0081788 | |||
| 1491 | Ga0466958_0087949 | |||
| 1492 | Ga0495603_0293472 | |||
| 1493 | Ga0495629_0251213 | |||
| 1494 | Ga0495638_0007774 | |||
| 1495 | Ga0495638_0077538 | |||
| 1496 | Ga0495650_0056464 | |||
| 1497 | Ga0495580_0004499 | |||
| 1498 | Ga0495580_0004701 | |||
| 1499 | Ga0495580_0102354 | |||
| 1500 | Ga0495582_0213906 | |||
| 1501 | Ga0495639_0291648 | |||
| 1502 | Ga0495594_0421571 | |||
| 1503 | Ga0495606_0146447 | |||
| 1504 | Ga0495630_0029743 | |||
| 1505 | Ga0495632_0058846 | |||
| 1506 | Ga0495632_0075526 | |||
| 1507 | Ga0495632_0281869 | |||
| 1508 | Ga0495586_0007092 | |||
| 1509 | Ga0495587_0240066 | |||
| 1510 | Ga0495611_0121128 | |||
| 1511 | Ga0495625_0034546 | |||
| 1512 | Ga0495625_0106672 | |||
| 1513 | Ga0495625_0207423 | |||
| 1514 | Ga0495635_0516421 | |||
| 1515 | Ga0495646_0319036 | |||
| 1516 | Ga0495613_0501652 | |||
| 1517 | Ga0495671_0091841 | |||
| 1518 | Ga0495674_0206606 | |||
| 1519 | Ga0495674_0319647 | |||
| 1520 | Ga0495672_0025433 | |||
| 1521 | Ga0495683_0337586 | |||
| 1522 | Ga0495686_0089440 | |||
| 1523 | Ga0495626_0280968 | |||
| 1524 | Ga0496100_0064832 | |||
| 1525 | Ga0496100_0120810 | |||
| 1526 | Ga0496101_0002467 | |||
| 1527 | Ga0496102_0010382 | |||
| 1528 | Ga0496102_0120199 | |||
| 1529 | Ga0496102_0395477 | |||
| 1530 | Ga0496103_0059820 | |||
| 1531 | Ga0496103_0114242 | |||
| 1532 | Ga0496106_0004490 | |||
| 1533 | Ga0496107_0045942 | |||
| 1534 | Ga0496107_0212796 | |||
| 1535 | Ga0496107_0730535 | |||
| 1536 | Ga0496108_0025584 | |||
| 1537 | Ga0496108_0036334 | |||
| 1538 | Ga0496109_0012647 | |||
| 1539 | Ga0496109_0434732 | |||
| 1540 | Ga0496110_0023555 | |||
| 1541 | Ga0496110_0060976 | |||
| 1542 | Ga0496111_0001145 | |||
| 1543 | Ga0496112_0009020 | |||
| 1544 | Ga0496112_0058535 | |||
| 1545 | Ga0496112_0156130 | |||
| 1546 | Ga0496113_0069692 | |||
| 1547 | Ga0496114_0147715 | |||
| 1548 | Ga0496115_0049582 | |||
| 1549 | Ga0496115_0166668 | |||
| 1550 | Ga0496116_0002908 | |||
| 1551 | Ga0496117_0000140 | |||
| 1552 | Ga0496118_0000102 | |||
| 1553 | Ga0496118_0093711 | |||
| 1554 | Ga0496119_0032426 | |||
| 1555 | Ga0496120_0002491 | |||
| 1556 | Ga0496120_0041201 | |||
| 1557 | Ga0496121_0014518 | |||
| 1558 | Ga0496121_0027937 | |||
| 1559 | Ga0496121_0136736 | |||
| 1560 | Ga0496121_0249043 | |||
| 1561 | Ga0496124_0090228 | |||
| 1562 | Ga0496125_0000690 | |||
| 1563 | Ga0496125_0035666 | |||
| 1564 | Ga0496125_0146311 | |||
| 1565 | Ga0496125_0196877 | |||
| 1566 | Ga0496126_0044577 | |||
| 1567 | Ga0496126_0048097 | |||
| 1568 | Ga0496126_0086690 | |||
| 1569 | Ga0496126_0142243 | |||
| 1570 | Ga0501299_009438 | |||
| 1571 | Ga0501031_0120188 | |||
| 1572 | Ga0501032_0027305 | |||
| 1573 | Ga0501033_0247248 | |||
| 1574 | Ga0501033_0379978 | |||
| 1575 | Ga0501034_0440423 | |||
| 1576 | Ga0501036_0001259 | |||
| 1577 | Ga0501036_0151731 | |||
| 1578 | Ga0501036_0415632 | |||
| 1579 | Ga0501037_0023306 | |||
| 1580 | Ga0501037_0046548 | |||
| 1581 | Ga0501038_0303108 | |||
| 1582 | Ga0501039_0000810 | |||
| 1583 | Ga0501039_0080485 | |||
| 1584 | Ga0501039_0086988 | |||
| 1585 | Ga0501039_0128277 | |||
| 1586 | Ga0501039_0412657 | |||
| 1587 | Ga0501040_0004684 | |||
| 1588 | Ga0501040_0004869 | |||
| 1589 | Ga0501040_0010830 | |||
| 1590 | Ga0501040_0015857 | |||
| 1591 | Ga0501040_0020786 | |||
| 1592 | Ga0501040_0258797 | |||
| 1593 | Ga0501041_0000218 | |||
| 1594 | Ga0501041_0011756 | |||
| 1595 | Ga0501041_0044475 | |||
| 1596 | Ga0501041_0079418 | |||
| 1597 | Ga0501041_0095658 | |||
| 1598 | Ga0501041_0607226 | |||
| 1599 | Ga0501042_0009188 | |||
| 1600 | Ga0501042_0029488 | |||
| 1601 | Ga0501042_0075884 | |||
| 1602 | Ga0501042_0106922 | |||
| 1603 | Ga0501042_0156392 | |||
| 1604 | Ga0501043_0323091 | |||
| 1605 | Ga0501043_0361887 | |||
| 1606 | Ga0501046_0032270 | |||
| 1607 | Ga0501046_0055562 | |||
| 1608 | Ga0501046_0079959 | |||
| 1609 | Ga0501048_0053820 | |||
| 1610 | Ga0501048_0064137 | |||
| 1611 | Ga0501048_0080804 | |||
| 1612 | Ga0501067_0002110 | |||
| 1613 | Ga0501068_0030587 | |||
| 1614 | Ga0501068_0235702 | |||
| 1615 | Ga0501069_0017735 | |||
| 1616 | Ga0501069_0487742 | |||
| 1617 | Ga0501071_0011560 | |||
| 1618 | Ga0501071_0017929 | |||
| 1619 | Ga0501071_0183110 | |||
| 1620 | Ga0501071_0303900 | |||
| 1621 | Ga0501071_0456693 | |||
| 1622 | Ga0501071_0613746 | |||
| 1623 | Ga0501072_0000330 | |||
| 1624 | Ga0501072_0005171 | |||
| 1625 | Ga0501072_0005396 | |||
| 1626 | Ga0501072_0112542 | |||
| 1627 | Ga0501072_0190544 | |||
| 1628 | Ga0501072_0461765 | |||
| 1629 | Ga0501072_0641228 | |||
| 1630 | Ga0501073_0018358 | |||
| 1631 | Ga0501073_0038211 | |||
| 1632 | Ga0501073_0394134 | |||
| 1633 | Ga0501073_0442783 | |||
| 1634 | Ga0501074_0007873 | |||
| 1635 | Ga0501074_0099180 | |||
| 1636 | Ga0501075_0045992 | |||
| 1637 | Ga0501075_0056710 | |||
| 1638 | Ga0501075_0201350 | |||
| 1639 | Ga0501075_0206353 | |||
| 1640 | Ga0501076_0009540 | |||
| 1641 | Ga0501076_0013454 | |||
| 1642 | Ga0501076_0025566 | |||
| 1643 | Ga0501076_0058390 | |||
| 1644 | Ga0501076_0073896 | |||
| 1645 | Ga0501076_0179508 | |||
| 1646 | Ga0501076_0384844 | |||
| 1647 | Ga0501076_0455384 | |||
| 1648 | Ga0501077_0015063 | |||
| 1649 | Ga0501077_0035113 | |||
| 1650 | Ga0501077_0106075 | |||
| 1651 | Ga0501077_0117545 | |||
| 1652 | Ga0501079_0000621 | |||
| 1653 | Ga0501079_0027098 | |||
| 1654 | Ga0501079_0032462 | |||
| 1655 | Ga0501079_0055880 | |||
| 1656 | Ga0501079_0092501 | |||
| 1657 | Ga0501079_0279873 | |||
| 1658 | Ga0501080_0001908 | |||
| 1659 | Ga0501080_0014235 | |||
| 1660 | Ga0501080_0015672 | |||
| 1661 | Ga0501080_0044736 | |||
| 1662 | Ga0501080_0251503 | |||
| 1663 | Ga0501081_0003178 | |||
| 1664 | Ga0501081_0015558 | |||
| 1665 | Ga0501081_0017496 | |||
| 1666 | Ga0501081_0029299 | |||
| 1667 | Ga0501081_0078372 | |||
| 1668 | Ga0501081_0659446 | |||
| 1669 | Ga0501083_0031993 | |||
| 1670 | Ga0501083_0145997 | |||
| 1671 | Ga0501083_0277981 | |||
| 1672 | Ga0501083_0306475 | |||
| 1673 | Ga0501083_0598511 | |||
| 1674 | Ga0501035_0006537 | |||
| 1675 | Ga0501035_0017291 | |||
| 1676 | Ga0501035_0267905 | |||
| 1677 | Ga0501035_0597947 | |||
| 1678 | Ga0501044_0061457 | |||
| 1679 | Ga0501045_0000097 | |||
| 1680 | Ga0501045_0019438 | |||
| 1681 | Ga0501045_0057703 | |||
| 1682 | nmdc:mga05p37_21733_c1 | |||
| 1683 | nmdc:mga05p37_691449_c1 | |||
| 1684 | nmdc:mga05p37_75240_c1 | |||
| 1685 | nmdc:mga05p37_83523_c1 | |||
| 1686 | nmdc:mga09592_1167_c1 | |||
| 1687 | nmdc:mga09592_20418_c1 | |||
| 1688 | nmdc:mga09592_76662_c1 | |||
| 1689 | nmdc:mga0qj67_155512_c1 | |||
| 1690 | nmdc:mga0qj67_220180_c1 | |||
| 1691 | nmdc:mga0qj67_251269_c1 | |||
| 1692 | nmdc:mga0qj67_319477_c1 | |||
| 1693 | nmdc:mga06r32_75_c1 | |||
| 1694 | nmdc:mga06r32_77956_c1 | |||
| 1695 | nmdc:mga08y16_1433_c1 | |||
| 1696 | nmdc:mga08y16_201_c1 | |||
| 1697 | nmdc:mga08y16_369877_c1 | |||
| 1698 | nmdc:mga08y16_461818_c1 | |||
| 1699 | nmdc:mga08y16_63856_c1 | |||
| 1700 | nmdc:mga0n895_1704_c1 | |||
| 1701 | nmdc:mga0a205_1481_c1 | |||
| 1702 | Ga0500583_0049792 | |||
| 1703 | Ga0500583_0053543 | |||
| 1704 | Ga0500583_0057774 | |||
| 1705 | Ga0500583_0131716 | |||
| 1706 | Ga0500583_0179866 | |||
| 1707 | Ga0500651_0213590 | |||
| 1708 | Ga0500641_0022160 | |||
| 1709 | Ga0500641_0086975 | |||
| 1710 | Ga0500650_0120515 | |||
| 1711 | Ga0500556_0000806 | |||
| 1712 | Ga0500556_0066435 | |||
| 1713 | Ga0500617_017315 | |||
| 1714 | Ga0500642_0213871 | |||
| 1715 | Ga0500642_0267615 | |||
| 1716 | Ga0500658_0055866 | |||
| 1717 | Ga0500568_0066733 | |||
| 1718 | Ga0500568_0108478 | |||
| 1719 | Ga0500588_0001169 | |||
| 1720 | Ga0500588_0084362 | |||
| 1721 | Ga0500588_0094053 | |||
| 1722 | Ga0500616_0007166 | |||
| 1723 | Ga0500622_0067142 | |||
| 1724 | Ga0500622_0090055 | |||
| 1725 | Ga0500622_0091027 | |||
| 1726 | Ga0500630_022217 | |||
| 1727 | Ga0500636_0041079 | |||
| 1728 | Ga0500637_0001461 | |||
| 1729 | Ga0500637_0021113 | |||
| 1730 | Ga0500637_0115310 | |||
| 1731 | Ga0500637_0131368 | |||
| 1732 | Ga0501084_0017200 | |||
| 1733 | Ga0501084_0072488 | |||
| 1734 | Ga0501084_0097724 | |||
| 1735 | Ga0501084_0127555 | |||
| 1736 | Ga0501084_0440304 | |||
| 1737 | Ga0501084_0804981 | |||
| 1738 | Ga0501082_0000238 | |||
| 1739 | Ga0501082_0006893 | |||
| 1740 | Ga0501082_0068455 | |||
| 1741 | Ga0501082_0167849 | |||
| 1742 | Ga0501082_0417516 | |||
| 1743 | Ga0501082_0646141 | |||
| 1744 | Ga0501082_1276945 | |||
| 1745 | Ga0466962_0000766 | |||
| 1746 | Ga0530510_0010796 | |||
| 1747 | Ga0530510_0038580 | |||
| 1748 | Ga0530510_0043942 | |||
| 1749 | Ga0530510_0056289 | |||
| 1750 | Ga0530510_0071389 | |||
| 1751 | Ga0530510_0385098 | |||
| 1752 | Ga0530510_0566113 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2v6y-assembly1.cif.gz_A | structure of the mit domain from a s. solfataricus vps4-like atpase | 0.5891 | 90 | 160 |
| 2v6y-assembly1.cif.gz_A | structure of the mit domain from a s. solfataricus vps4-like atpase | 0.5493 | 90 | 160 |
| 7dgu-assembly1.cif.gz_A | de novo designed protein h4a1r | 0.5482 | 73 | 171 |
| 6dg6-assembly5.cif.gz_E | structure of a de novo designed interleukin-2/interleukin-15 mimetic | 0.5382 | 90 | 169 |
| 6dg6-assembly4.cif.gz_D | structure of a de novo designed interleukin-2/interleukin-15 mimetic | 0.5373 | 90 | 169 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9ER38_326_385_1.10.8.60 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.6093 | 16 | 65 | 1.10.8.60 |
| 2v6yB00 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit | 0.5947 | 90 | 160 | 1.20.58.80 |
| 2v6yA00 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit | 0.5891 | 90 | 160 | 1.20.58.80 |
| af_Q9H497_319_397_1.10.8.60 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.5706 | 12 | 71 | 1.10.8.60 |
| af_Q5M936_326_395_1.10.8.60 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.5673 | 12 | 65 | 1.10.8.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A534C3F8-F1-model_v4 | Uncharacterized protein | 0.9114 | 5 | 174 |
|
| AF-A0A534C3F8-F1-model_v4 | Uncharacterized protein | 0.8958 | 5 | 174 |
|
| AF-A0A2E2WN81-F1-model_v4 | Uncharacterized protein | 0.8689 | 10 | 165 |
|
| AF-A0A7C3D1K2-F1-model_v4 | Uncharacterized protein | 0.8674 | 11 | 153 |
|
| AF-A0A3B9W4Q8-F1-model_v4 | Uncharacterized protein | 0.867 | 17 | 168 |
|