F484126
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 869 | 423 | 797 | 174 |
Family's Representative Sequence
| Representative Sequence | 3300046558|Ga0495633_0010539|Ga0495633_0010539_2889_3473 |
| Length | 194 |
| Sequence | MSMTSYKRLFCESLTKAAHIPVRGLFSCLALVLLLAGCARGVSSAPGDAPNLERWVAEVRARPAPALEPLPVMQQFETFEYAAQGMRDPFADAWVNPDAGNGLRPDPNRRKEPLEAFPLDSLNMVGTIGTGPAQVALVMAPDKVTYRVRSGIYMGQSDGRVTGVSDGHIELIELVPDGAGGWLERPASIALDDQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2524614729 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 3 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 4 | 2571042365 | Lysobacter oryzae DSM 21044 | Isolate | Rhizosphere |
| 5 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 6 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 7 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 8 | 2627854209 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 9 | 2643221559 | Lysobacter sp. Root559 | Isolate | Unclassified |
| 10 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 11 | 2643221579 | Pseudoxanthomonas sp. Root630 | Isolate | Unclassified |
| 12 | 2643221581 | Pseudoxanthomonas sp. Root65 | Isolate | Unclassified |
| 13 | 2643221586 | Lysobacter sp. Root667 | Isolate | Unclassified |
| 14 | 2643221593 | Lysobacter sp. Root690 | Isolate | Unclassified |
| 15 | 2643221612 | Lysobacter sp. Root76 | Isolate | Unclassified |
| 16 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 17 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 18 | 2643221727 | Lysobacter sp. Root96 | Isolate | Unclassified |
| 19 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 20 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 21 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 22 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 23 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 24 | 2747842428 | Stenotrophomonas sp. WCS2014-113 | Isolate | Unclassified |
| 25 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 26 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 27 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 28 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 29 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 30 | 2842757796 | Stenotrophomonas sp. R-72406 | Isolate | Unclassified |
| 31 | 2842780639 | Pseudoxanthomonas sp. R-71986 | Isolate | Unclassified |
| 32 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 33 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 34 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 35 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 36 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 37 | 2874220319 | Stenotrophomonas maltophilia PS5 | Isolate | Unclassified |
| 38 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 39 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 40 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 41 | 2895522137 | Pseudoxanthomonas sp. SGNA-20 | Isolate | Rhizosphere |
| 42 | 2895525241 | Pseudoxanthomonas sp. SGT-18 | Isolate | Rhizosphere |
| 43 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 44 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 45 | 2919089067 | Stenotrophomonas sp. 1337 | Isolate | Rhizosphere |
| 46 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 47 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 48 | 2919513703 | Luteimonas sp. 3794 | Isolate | Unclassified |
| 49 | 2919675420 | Luteimonas terrae 4099 | Isolate | Unclassified |
| 50 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 51 | 2928496128 | Stenotrophomonas indicatrix 1163 | Isolate | Unclassified |
| 52 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 53 | 2931380184 | Stenotrophomonas sp. DR822 | Isolate | Rhizosphere |
| 54 | 2937610967 | Stenotrophomonas maltophilia EP20 | Isolate | Unclassified |
| 55 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 56 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 57 | 2939626828 | Stenotrophomonas sp. 2694 | Isolate | Rhizosphere |
| 58 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 59 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 60 | 2941489479 | Lysobacter enzymogenes 2943 | Isolate | Rhizosphere |
| 61 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 62 | 2961047084 | Stenotrophomonas maltophilia EP5 | Isolate | Unclassified |
| 63 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 64 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 65 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 66 | 2984514374 | Stenotrophomonas sp. SORGH_AS282 | Isolate | Aerial Root |
| 67 | 2987605356 | Stenotrophomonas sp. ATCM1_4 | Isolate | Unclassified |
| 68 | 2995948881 | Lysobacter enzymogenes B25 | Isolate | Unclassified |
| 69 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 70 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 71 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 72 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 73 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 74 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 75 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 76 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 77 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 78 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 79 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 80 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 81 | 3300003558 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_10_fullP_mix1_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 82 | 3300003567 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 83 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 84 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 85 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 86 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 87 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 88 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 89 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 90 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 91 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 92 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 93 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 94 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 95 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 96 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 97 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 98 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 101 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 102 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 114 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 117 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 118 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 119 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 120 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 123 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 125 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 127 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 128 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 129 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 130 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 131 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 132 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 133 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 134 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 135 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 136 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 147 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300012482 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 | Metagenome | Rhizosphere |
| 149 | 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Metagenome | Rhizosphere |
| 150 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 151 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 152 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 161 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 163 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 164 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 165 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 166 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 168 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 169 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 170 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 174 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 175 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 176 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 178 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 179 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 180 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 182 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 184 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 187 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 190 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 244 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 245 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 246 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 247 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 248 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 249 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 250 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 251 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 252 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 253 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 254 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 255 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 256 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 257 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 258 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 259 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 260 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 261 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 262 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 263 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 264 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 265 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 266 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 267 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 268 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 269 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 270 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 271 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 272 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 273 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 274 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 275 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 276 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 277 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 278 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 279 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 280 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 281 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 282 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 283 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 284 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 285 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 286 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 287 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 288 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 289 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 290 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 291 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 292 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 293 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 294 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 295 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 296 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 297 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 298 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 299 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 300 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 301 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 302 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 346 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 347 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 348 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 349 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 350 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 351 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 352 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 353 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 354 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 355 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 356 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 357 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 358 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 359 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 360 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 361 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 362 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 363 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 364 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 365 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 366 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 367 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 368 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 369 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 372 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 390 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 391 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 392 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 393 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 394 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 395 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 396 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 399 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 400 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 401 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 402 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 406 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 407 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 408 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 409 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 410 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 411 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 412 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 413 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 414 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 415 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 416 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 417 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 418 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 419 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
| 420 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
| 421 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 422 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 423 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.91 |
| Metatranscriptomes | 0.81 |
| Isolates | 8.29 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.12 |
| Bulb | 0 |
| Endosphere | 13.81 |
| Nodule | 0.12 |
| Rhizoplane | 4.95 |
| Rhizosphere | 62.49 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 18.53 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3797405 | 2162886007 | Bacteria | 1475 |
| 2 | JGI24736J21556_1001617 | 3300001904 | Bacteria | 4089 |
| 3 | JGI24740J21852_10040405 | 3300001979 | Bacteria | 1414 |
| 4 | JGI24738J21930_10001153 | 3300002075 | Bacteria | 7468 |
| 5 | JGI25156J39149_1007841 | 3300002705 | Bacteria | 2755 |
| 6 | JGI25157J39369_1001663 | 3300002741 | Bacteria | 7572 |
| 7 | JGI25152J39213_1000069 | 3300002773 | Bacteria | 67815 |
| 8 | JGI25150J39212_1000214 | 3300002774 | Bacteria | 31523 |
| 9 | JGI25150J39212_1000407 | 3300002774 | Bacteria | 19982 |
| 10 | JGI25150J39212_1027756 | 3300002774 | Bacteria | 807 |
| 11 | JGI25151J46595_10000105 | 3300003187 | Bacteria | 113763 |
| 12 | JGI25151J46595_10000116 | 3300003187 | Bacteria | 107172 |
| 13 | JGI25153J46596_10000077 | 3300003215 | Bacteria | 113763 |
| 14 | rootH2_10004458 | 3300003320 | Bacteria | 5849 |
| 15 | rootH2_10044786 | 3300003320 | Bacteria | 1918 |
| 16 | rootL2_10073749 | 3300003322 | Bacteria | 1619 |
| 17 | rootH1_10107485 | 3300003323 | Bacteria | 1101 |
| 18 | rootH1_10232895 | 3300003323 | Bacteria | 1448 |
| 19 | Ga0006558J51389_1028497 | 3300003558 | Bacteria | 1276 |
| 20 | Ga0006554J51385_1022338 | 3300003567 | Bacteria | 3527 |
| 21 | Ga0006562J51391_1012709 | 3300003578 | Bacteria | 7210 |
| 22 | Ga0006562J51391_1012711 | 3300003578 | Bacteria | 2130 |
| 23 | Ga0055542_1012758 | 3300003762 | Bacteria | 1442 |
| 24 | Ga0055529_1005753 | 3300003763 | Bacteria | 1768 |
| 25 | Ga0055526_1003098 | 3300003771 | Bacteria | 10789 |
| 26 | Ga0055537_1000088 | 3300003773 | Bacteria | 66713 |
| 27 | Ga0055537_1000812 | 3300003773 | Bacteria | 15462 |
| 28 | Ga0055524_1000074 | 3300003775 | Bacteria | 122843 |
| 29 | Ga0055524_1016948 | 3300003775 | Bacteria | 2588 |
| 30 | Ga0055524_1061261 | 3300003775 | Bacteria | 778 |
| 31 | Ga0055536_1001746 | 3300003781 | Bacteria | 12830 |
| 32 | Ga0055536_1006277 | 3300003781 | Bacteria | 5598 |
| 33 | Ga0055534_1000097 | 3300003784 | Bacteria | 67619 |
| 34 | Ga0055534_1000154 | 3300003784 | Bacteria | 51139 |
| 35 | Ga0055534_1011218 | 3300003784 | Bacteria | 1833 |
| 36 | Ga0055528_1000028 | 3300003790 | Bacteria | 122843 |
| 37 | Ga0055528_1001412 | 3300003790 | Bacteria | 14714 |
| 38 | Ga0055528_1002336 | 3300003790 | Bacteria | 10259 |
| 39 | Ga0055530_10001477 | 3300003791 | Bacteria | 17070 |
| 40 | Ga0055531_10002804 | 3300003794 | Bacteria | 11428 |
| 41 | Ga0055531_10013393 | 3300003794 | Bacteria | 3780 |
| 42 | Ga0055531_10017692 | 3300003794 | Bacteria | 2992 |
| 43 | Ga0055531_10030559 | 3300003794 | Bacteria | 1805 |
| 44 | Ga0058692_1000013 | 3300003856 | Bacteria | 316299 |
| 45 | Ga0058692_1000035 | 3300003856 | Bacteria | 152983 |
| 46 | Ga0065165_1000913 | 3300005262 | Bacteria | 38106 |
| 47 | Ga0065704_10098945 | 3300005289 | Bacteria | 2332 |
| 48 | Ga0065704_10281216 | 3300005289 | Bacteria | 921 |
| 49 | Ga0065715_10170654 | 3300005293 | Bacteria | 1549 |
| 50 | Ga0070658_10709156 | 3300005327 | Bacteria | 873 |
| 51 | Ga0070670_100022831 | 3300005331 | Bacteria | 5384 |
| 52 | Ga0070670_100046378 | 3300005331 | Bacteria | 3736 |
| 53 | Ga0070670_100073464 | 3300005331 | Bacteria | 2937 |
| 54 | Ga0070680_100389732 | 3300005336 | Bacteria | 1187 |
| 55 | Ga0070682_100008369 | 3300005337 | Bacteria | 5835 |
| 56 | Ga0070682_100105533 | 3300005337 | Bacteria | 1868 |
| 57 | Ga0070660_100089225 | 3300005339 | Bacteria | 2429 |
| 58 | Ga0070661_100214433 | 3300005344 | Bacteria | 1475 |
| 59 | Ga0070661_100330707 | 3300005344 | Bacteria | 1192 |
| 60 | Ga0070661_100491765 | 3300005344 | Bacteria | 981 |
| 61 | Ga0070668_100070732 | 3300005347 | Bacteria | 2717 |
| 62 | Ga0070668_100203858 | 3300005347 | Bacteria | 1624 |
| 63 | Ga0070668_101260099 | 3300005347 | Bacteria | 671 |
| 64 | Ga0070669_100054658 | 3300005353 | Bacteria | 2925 |
| 65 | Ga0070669_101051101 | 3300005353 | Bacteria | 700 |
| 66 | Ga0070675_100494163 | 3300005354 | Bacteria | 1102 |
| 67 | Ga0070671_100010249 | 3300005355 | Bacteria | 7523 |
| 68 | Ga0070671_101041160 | 3300005355 | Bacteria | 718 |
| 69 | Ga0070674_100053729 | 3300005356 | Bacteria | 2783 |
| 70 | Ga0070673_100426619 | 3300005364 | Bacteria | 1189 |
| 71 | Ga0070673_101124699 | 3300005364 | Bacteria | 734 |
| 72 | Ga0070659_100144222 | 3300005366 | Bacteria | 1940 |
| 73 | Ga0070667_100000085 | 3300005367 | Bacteria | 117695 |
| 74 | Ga0070714_100752166 | 3300005435 | Bacteria | 942 |
| 75 | Ga0070700_100575143 | 3300005441 | Bacteria | 879 |
| 76 | Ga0070663_100000045 | 3300005455 | Bacteria | 56569 |
| 77 | Ga0070663_100081842 | 3300005455 | Bacteria | 2374 |
| 78 | Ga0070663_100194098 | 3300005455 | Bacteria | 1582 |
| 79 | Ga0070678_100011851 | 3300005456 | Bacteria | 5394 |
| 80 | Ga0070678_100094369 | 3300005456 | Bacteria | 2303 |
| 81 | Ga0070681_10336561 | 3300005458 | Bacteria | 1419 |
| 82 | Ga0070681_10350114 | 3300005458 | Bacteria | 1387 |
| 83 | Ga0068867_100047934 | 3300005459 | Bacteria | 3142 |
| 84 | Ga0070679_100058369 | 3300005530 | Bacteria | 3845 |
| 85 | Ga0068853_100003376 | 3300005539 | Bacteria | 12224 |
| 86 | Ga0068853_100170552 | 3300005539 | Bacteria | 1968 |
| 87 | Ga0070672_100057956 | 3300005543 | Bacteria | 3042 |
| 88 | Ga0070696_100004017 | 3300005546 | Bacteria | 9808 |
| 89 | Ga0070693_100017003 | 3300005547 | Bacteria | 3775 |
| 90 | Ga0070665_100071908 | 3300005548 | Bacteria | 3466 |
| 91 | Ga0070665_100166741 | 3300005548 | Bacteria | 2205 |
| 92 | Ga0070665_100924316 | 3300005548 | Bacteria | 885 |
| 93 | Ga0068855_100013007 | 3300005563 | Bacteria | 10042 |
| 94 | Ga0068855_101271375 | 3300005563 | Bacteria | 763 |
| 95 | Ga0070664_100084386 | 3300005564 | Bacteria | 2742 |
| 96 | Ga0070664_101231545 | 3300005564 | Bacteria | 706 |
| 97 | Ga0068854_100176852 | 3300005578 | Bacteria | 1664 |
| 98 | Ga0068856_100000524 | 3300005614 | Bacteria | 42396 |
| 99 | Ga0068851_10354686 | 3300005834 | Bacteria | 854 |
| 100 | Ga0068851_10625703 | 3300005834 | Bacteria | 657 |
| 101 | Ga0068863_100123053 | 3300005841 | Bacteria | 2475 |
| 102 | Ga0068858_101627569 | 3300005842 | Unclassified | 637 |
| 103 | Ga0081539_10019407 | 3300005985 | Bacteria | 4655 |
| 104 | Ga0075365_10193304 | 3300006038 | Bacteria | 1424 |
| 105 | Ga0075364_10000775 | 3300006051 | Bacteria | 16800 |
| 106 | Ga0075364_10010917 | 3300006051 | Bacteria | 5504 |
| 107 | Ga0075364_10037648 | 3300006051 | Bacteria | 3133 |
| 108 | Ga0075364_10577264 | 3300006051 | Bacteria | 768 |
| 109 | Ga0075369_10181360 | 3300006186 | Bacteria | 969 |
| 110 | Ga0075369_10296146 | 3300006186 | Bacteria | 755 |
| 111 | Ga0075370_10085036 | 3300006353 | Bacteria | 1821 |
| 112 | Ga0097620_100383554 | 3300006931 | Bacteria | 1501 |
| 113 | Ga0105251_10019456 | 3300009011 | Bacteria | 3586 |
| 114 | Ga0105244_10023892 | 3300009036 | Bacteria | 3343 |
| 115 | Ga0105244_10038830 | 3300009036 | Bacteria | 2481 |
| 116 | Ga0105244_10104717 | 3300009036 | Bacteria | 1381 |
| 117 | Ga0105240_10023122 | 3300009093 | Bacteria | 8229 |
| 118 | Ga0105240_10128175 | 3300009093 | Bacteria | 3046 |
| 119 | Ga0105240_10130625 | 3300009093 | Bacteria | 3013 |
| 120 | Ga0105247_10002807 | 3300009101 | Bacteria | 11651 |
| 121 | Ga0105247_10640208 | 3300009101 | Bacteria | 793 |
| 122 | Ga0105243_10122895 | 3300009148 | Bacteria | 2192 |
| 123 | Ga0105243_10207021 | 3300009148 | Bacteria | 1724 |
| 124 | Ga0105241_10252420 | 3300009174 | Bacteria | 1496 |
| 125 | Ga0105248_10000980 | 3300009177 | Bacteria | 31690 |
| 126 | Ga0105237_10000036 | 3300009545 | Bacteria | 191142 |
| 127 | Ga0105237_10006112 | 3300009545 | Bacteria | 13457 |
| 128 | Ga0105237_10546847 | 3300009545 | Bacteria | 1164 |
| 129 | Ga0105249_10000335 | 3300009553 | Bacteria | 47511 |
| 130 | Ga0105028_107380 | 3300009993 | Bacteria | 1149 |
| 131 | Ga0105239_10000027 | 3300010375 | Bacteria | 248028 |
| 132 | Ga0105239_10202899 | 3300010375 | Bacteria | 2222 |
| 133 | Ga0105239_10416482 | 3300010375 | Bacteria | 1521 |
| 134 | Ga0105239_10992781 | 3300010375 | Bacteria | 965 |
| 135 | Ga0157318_1002656 | 3300012482 | Bacteria | 990 |
| 136 | Ga0157329_1001393 | 3300012491 | Bacteria | 1221 |
| 137 | Ga0157313_1002762 | 3300012503 | Bacteria | 1080 |
| 138 | Ga0157327_1000513 | 3300012512 | Bacteria | 2101 |
| 139 | Ga0157373_10073514 | 3300013100 | Bacteria | 2412 |
| 140 | Ga0157373_10152758 | 3300013100 | Bacteria | 1624 |
| 141 | Ga0157373_10377225 | 3300013100 | Bacteria | 1014 |
| 142 | Ga0157371_10000184 | 3300013102 | Bacteria | 92100 |
| 143 | Ga0157371_10079356 | 3300013102 | Bacteria | 2325 |
| 144 | Ga0157371_10120730 | 3300013102 | Bacteria | 1863 |
| 145 | Ga0157371_10190080 | 3300013102 | Bacteria | 1470 |
| 146 | Ga0157371_10678202 | 3300013102 | Bacteria | 770 |
| 147 | Ga0157370_10000045 | 3300013104 | Bacteria | 127627 |
| 148 | Ga0157370_10001564 | 3300013104 | Bacteria | 28327 |
| 149 | Ga0157370_10015409 | 3300013104 | Bacteria | 7770 |
| 150 | Ga0157370_10019467 | 3300013104 | Bacteria | 6808 |
| 151 | Ga0157370_10096821 | 3300013104 | Bacteria | 2768 |
| 152 | Ga0157370_10270060 | 3300013104 | Bacteria | 1571 |
| 153 | Ga0157370_10366785 | 3300013104 | Bacteria | 1327 |
| 154 | Ga0157370_10435598 | 3300013104 | Bacteria | 1206 |
| 155 | Ga0157369_10000745 | 3300013105 | Bacteria | 41913 |
| 156 | Ga0157369_10011268 | 3300013105 | Bacteria | 10158 |
| 157 | Ga0157369_10048745 | 3300013105 | Bacteria | 4595 |
| 158 | Ga0163162_10325108 | 3300013306 | Bacteria | 1670 |
| 159 | Ga0163162_10398573 | 3300013306 | Bacteria | 1509 |
| 160 | Ga0157372_10021401 | 3300013307 | Bacteria | 6986 |
| 161 | Ga0157372_10162705 | 3300013307 | Bacteria | 2580 |
| 162 | Ga0157372_10787582 | 3300013307 | Bacteria | 1105 |
| 163 | Ga0157375_10140509 | 3300013308 | Bacteria | 2542 |
| 164 | Ga0157375_10169912 | 3300013308 | Bacteria | 2327 |
| 165 | Ga0157380_10098081 | 3300014326 | Bacteria | 2434 |
| 166 | Ga0157380_10371759 | 3300014326 | Bacteria | 1346 |
| 167 | Ga0157380_10530188 | 3300014326 | Bacteria | 1150 |
| 168 | Ga0182008_10004060 | 3300014497 | Bacteria | 8640 |
| 169 | Ga0182008_10023563 | 3300014497 | Bacteria | 3142 |
| 170 | Ga0182008_10037026 | 3300014497 | Bacteria | 2441 |
| 171 | Ga0182008_10311799 | 3300014497 | Bacteria | 826 |
| 172 | Ga0157379_10935563 | 3300014968 | Bacteria | 824 |
| 173 | Ga0182006_1000479 | 3300015261 | Bacteria | 31307 |
| 174 | Ga0182006_1003624 | 3300015261 | Bacteria | 7845 |
| 175 | Ga0182006_1022419 | 3300015261 | Bacteria | 2625 |
| 176 | Ga0182007_10000219 | 3300015262 | Bacteria | 38463 |
| 177 | Ga0182007_10033459 | 3300015262 | Bacteria | 1742 |
| 178 | Ga0182005_1000113 | 3300015265 | Bacteria | 58004 |
| 179 | Ga0182005_1000213 | 3300015265 | Bacteria | 38351 |
| 180 | Ga0182005_1001646 | 3300015265 | Bacteria | 8686 |
| 181 | Ga0182005_1001924 | 3300015265 | Bacteria | 7868 |
| 182 | Ga0182005_1006350 | 3300015265 | Bacteria | 3624 |
| 183 | Ga0183360_10001 | 3300015689 | Bacteria | 3943671 |
| 184 | Ga0163161_10007925 | 3300017792 | Bacteria | 7353 |
| 185 | Ga0163161_10020842 | 3300017792 | Bacteria | 4603 |
| 186 | Ga0163161_10050833 | 3300017792 | Bacteria | 3001 |
| 187 | Ga0163161_10118324 | 3300017792 | Bacteria | 1988 |
| 188 | Ga0163161_10480889 | 3300017792 | Bacteria | 1008 |
| 189 | Ga0206356_10491941 | 3300020070 | Bacteria | 2892 |
| 190 | Ga0206353_10172233 | 3300020082 | Bacteria | 1369 |
| 191 | Ga0224712_10118197 | 3300022467 | Bacteria | 1145 |
| 192 | Ga0209674_100791 | 3300025226 | Bacteria | 10635 |
| 193 | Ga0209147_102946 | 3300025229 | Bacteria | 3688 |
| 194 | Ga0209437_102834 | 3300025233 | Bacteria | 3253 |
| 195 | Ga0207425_1000045 | 3300025245 | Bacteria | 194257 |
| 196 | Ga0207425_1004713 | 3300025245 | Bacteria | 4025 |
| 197 | Ga0209646_1002196 | 3300025246 | Bacteria | 4508 |
| 198 | Ga0209026_1000223 | 3300025250 | Bacteria | 77328 |
| 199 | Ga0209148_1000762 | 3300025254 | Bacteria | 24561 |
| 200 | Ga0209759_1014486 | 3300025256 | Bacteria | 2083 |
| 201 | Ga0209129_1000057 | 3300025258 | Bacteria | 253632 |
| 202 | Ga0209129_1001090 | 3300025258 | Bacteria | 15870 |
| 203 | Ga0209565_1000023 | 3300025263 | Bacteria | 388244 |
| 204 | Ga0209565_1000034 | 3300025263 | Bacteria | 312950 |
| 205 | Ga0209565_1019738 | 3300025263 | Bacteria | 1433 |
| 206 | Ga0209455_1000430 | 3300025272 | Bacteria | 32798 |
| 207 | Ga0209673_1000039 | 3300025273 | Bacteria | 312950 |
| 208 | Ga0209673_1000047 | 3300025273 | Bacteria | 289276 |
| 209 | Ga0209673_1029483 | 3300025273 | Bacteria | 1746 |
| 210 | Ga0209130_1002629 | 3300025284 | Bacteria | 8633 |
| 211 | Ga0209130_1024994 | 3300025284 | Bacteria | 1298 |
| 212 | Ga0209675_1000016 | 3300025291 | Bacteria | 391965 |
| 213 | Ga0209675_1000023 | 3300025291 | Bacteria | 312950 |
| 214 | Ga0209675_1008269 | 3300025291 | Bacteria | 3851 |
| 215 | Ga0209675_1046930 | 3300025291 | Bacteria | 910 |
| 216 | Ga0209676_1000027 | 3300025292 | Bacteria | 560222 |
| 217 | Ga0209676_1000037 | 3300025292 | Bacteria | 457562 |
| 218 | Ga0209676_1000160 | 3300025292 | Bacteria | 161069 |
| 219 | Ga0209676_1000280 | 3300025292 | Bacteria | 105988 |
| 220 | Ga0209676_1002509 | 3300025292 | Bacteria | 12849 |
| 221 | Ga0209676_1003026 | 3300025292 | Bacteria | 10906 |
| 222 | Ga0209025_1000013 | 3300025294 | Bacteria | 871757 |
| 223 | Ga0209025_1000023 | 3300025294 | Bacteria | 541307 |
| 224 | Ga0209025_1002654 | 3300025294 | Bacteria | 18290 |
| 225 | Ga0209025_1028791 | 3300025294 | Bacteria | 2709 |
| 226 | Ga0209025_1030183 | 3300025294 | Bacteria | 2601 |
| 227 | Ga0209564_1000066 | 3300025295 | Bacteria | 312899 |
| 228 | Ga0209564_1000194 | 3300025295 | Bacteria | 141518 |
| 229 | Ga0209564_1004607 | 3300025295 | Bacteria | 8314 |
| 230 | Ga0209758_1000014 | 3300025297 | Bacteria | 871757 |
| 231 | Ga0209758_1008048 | 3300025297 | Bacteria | 6957 |
| 232 | Ga0209050_1000352 | 3300025298 | Bacteria | 88558 |
| 233 | Ga0209050_1000714 | 3300025298 | Bacteria | 48752 |
| 234 | Ga0209050_1000833 | 3300025298 | Bacteria | 42666 |
| 235 | Ga0209050_1010110 | 3300025298 | Bacteria | 4698 |
| 236 | Ga0209050_1026372 | 3300025298 | Bacteria | 1946 |
| 237 | Ga0209256_1000048 | 3300025299 | Bacteria | 312899 |
| 238 | Ga0209256_1003154 | 3300025299 | Bacteria | 11970 |
| 239 | Ga0209256_1003863 | 3300025299 | Bacteria | 9967 |
| 240 | Ga0209256_1005406 | 3300025299 | Bacteria | 7382 |
| 241 | Ga0209256_1020798 | 3300025299 | Bacteria | 2036 |
| 242 | Ga0209256_1020801 | 3300025299 | Bacteria | 2036 |
| 243 | Ga0207426_1017565 | 3300025302 | Bacteria | 2540 |
| 244 | Ga0209051_1001947 | 3300025303 | Bacteria | 15883 |
| 245 | Ga0209051_1002836 | 3300025303 | Bacteria | 11944 |
| 246 | Ga0209051_1006389 | 3300025303 | Bacteria | 6657 |
| 247 | Ga0209257_1000046 | 3300025304 | Bacteria | 477765 |
| 248 | Ga0209257_1000177 | 3300025304 | Bacteria | 161069 |
| 249 | Ga0209257_1000198 | 3300025304 | Bacteria | 149013 |
| 250 | Ga0209257_1000219 | 3300025304 | Bacteria | 135666 |
| 251 | Ga0209257_1000383 | 3300025304 | Bacteria | 88315 |
| 252 | Ga0209257_1003088 | 3300025304 | Bacteria | 14974 |
| 253 | Ga0209257_1003813 | 3300025304 | Bacteria | 12380 |
| 254 | Ga0209257_1007629 | 3300025304 | Bacteria | 6484 |
| 255 | Ga0209257_1026691 | 3300025304 | Bacteria | 1939 |
| 256 | Ga0209257_1034119 | 3300025304 | Bacteria | 1592 |
| 257 | Ga0209257_1066742 | 3300025304 | Bacteria | 961 |
| 258 | Ga0207655_1033595 | 3300025728 | Bacteria | 2321 |
| 259 | Ga0207713_1066409 | 3300025735 | Bacteria | 1350 |
| 260 | Ga0207682_10014641 | 3300025893 | Bacteria | 3057 |
| 261 | Ga0207710_10005864 | 3300025900 | Bacteria | 5268 |
| 262 | Ga0207647_10000015 | 3300025904 | Bacteria | 138626 |
| 263 | Ga0207647_10076216 | 3300025904 | Bacteria | 2017 |
| 264 | Ga0207705_10108347 | 3300025909 | Bacteria | 2050 |
| 265 | Ga0207654_10128999 | 3300025911 | Bacteria | 1598 |
| 266 | Ga0207707_10026404 | 3300025912 | Bacteria | 5076 |
| 267 | Ga0207707_10369250 | 3300025912 | Bacteria | 1235 |
| 268 | Ga0207695_10000441 | 3300025913 | Bacteria | 90937 |
| 269 | Ga0207695_10003481 | 3300025913 | Bacteria | 22147 |
| 270 | Ga0207671_10000135 | 3300025914 | Bacteria | 112401 |
| 271 | Ga0207671_10003134 | 3300025914 | Bacteria | 16798 |
| 272 | Ga0207657_10003190 | 3300025919 | Bacteria | 17543 |
| 273 | Ga0207657_10351503 | 3300025919 | Bacteria | 1162 |
| 274 | Ga0207649_10152857 | 3300025920 | Bacteria | 1591 |
| 275 | Ga0207652_10131701 | 3300025921 | Bacteria | 2230 |
| 276 | Ga0207652_10494603 | 3300025921 | Bacteria | 1101 |
| 277 | Ga0207681_10041006 | 3300025923 | Bacteria | 3084 |
| 278 | Ga0207681_10690832 | 3300025923 | Bacteria | 848 |
| 279 | Ga0207694_10025255 | 3300025924 | Bacteria | 4515 |
| 280 | Ga0207694_10159608 | 3300025924 | Bacteria | 1820 |
| 281 | Ga0207650_10047972 | 3300025925 | Bacteria | 3149 |
| 282 | Ga0207650_10048024 | 3300025925 | Bacteria | 3146 |
| 283 | Ga0207650_10051036 | 3300025925 | Bacteria | 3060 |
| 284 | Ga0207644_10060876 | 3300025931 | Bacteria | 2732 |
| 285 | Ga0207644_10113072 | 3300025931 | Bacteria | 2056 |
| 286 | Ga0207690_10250292 | 3300025932 | Bacteria | 1368 |
| 287 | Ga0207706_10589886 | 3300025933 | Bacteria | 955 |
| 288 | Ga0207709_10002407 | 3300025935 | Bacteria | 11766 |
| 289 | Ga0207709_10020776 | 3300025935 | Bacteria | 3708 |
| 290 | Ga0207669_10045553 | 3300025937 | Bacteria | 2585 |
| 291 | Ga0207691_10019809 | 3300025940 | Bacteria | 6364 |
| 292 | Ga0207711_10004824 | 3300025941 | Bacteria | 11459 |
| 293 | Ga0207679_10124890 | 3300025945 | Bacteria | 2055 |
| 294 | Ga0207667_10075026 | 3300025949 | Bacteria | 3512 |
| 295 | Ga0207667_10263378 | 3300025949 | Bacteria | 1763 |
| 296 | Ga0207667_11129593 | 3300025949 | Bacteria | 766 |
| 297 | Ga0207651_10216836 | 3300025960 | Bacteria | 1544 |
| 298 | Ga0207712_10001764 | 3300025961 | Bacteria | 14433 |
| 299 | Ga0207668_10023924 | 3300025972 | Bacteria | 3935 |
| 300 | Ga0207640_10003213 | 3300025981 | Bacteria | 8805 |
| 301 | Ga0207658_10000032 | 3300025986 | Bacteria | 162260 |
| 302 | Ga0207658_10244527 | 3300025986 | Bacteria | 1522 |
| 303 | Ga0207677_10307158 | 3300026023 | Bacteria | 1313 |
| 304 | Ga0207639_10031649 | 3300026041 | Bacteria | 3889 |
| 305 | Ga0207639_10131720 | 3300026041 | Bacteria | 2071 |
| 306 | Ga0207678_10000457 | 3300026067 | Bacteria | 37030 |
| 307 | Ga0207678_10000643 | 3300026067 | Bacteria | 32112 |
| 308 | Ga0207678_10147929 | 3300026067 | Bacteria | 2005 |
| 309 | Ga0207702_10003652 | 3300026078 | Bacteria | 13940 |
| 310 | Ga0207641_10243464 | 3300026088 | Bacteria | 1677 |
| 311 | Ga0207648_10208557 | 3300026089 | Bacteria | 1734 |
| 312 | Ga0207676_10065408 | 3300026095 | Bacteria | 2895 |
| 313 | Ga0207683_10020246 | 3300026121 | Bacteria | 5688 |
| 314 | Ga0207683_10022073 | 3300026121 | Bacteria | 5462 |
| 315 | Ga0209371_1000007 | 3300027312 | Bacteria | 1050654 |
| 316 | Ga0209371_1000043 | 3300027312 | Bacteria | 331009 |
| 317 | Ga0209981_1027589 | 3300027378 | Bacteria | 827 |
| 318 | Ga0209981_1030747 | 3300027378 | Bacteria | 787 |
| 319 | Ga0209984_1003224 | 3300027424 | Bacteria | 1857 |
| 320 | Ga0210000_1003909 | 3300027462 | Bacteria | 2157 |
| 321 | Ga0209995_1000902 | 3300027471 | Bacteria | 4606 |
| 322 | Ga0209999_1000249 | 3300027543 | Bacteria | 7797 |
| 323 | Ga0209982_1002809 | 3300027552 | Bacteria | 2452 |
| 324 | Ga0209970_1002517 | 3300027614 | Bacteria | 3108 |
| 325 | Ga0209983_1006804 | 3300027665 | Bacteria | 2346 |
| 326 | Ga0209971_1000743 | 3300027682 | Bacteria | 8388 |
| 327 | Ga0209974_10034122 | 3300027876 | Bacteria | 1690 |
| 328 | Ga0268266_10124490 | 3300028379 | Bacteria | 2298 |
| 329 | Ga0268266_10187018 | 3300028379 | Bacteria | 1889 |
| 330 | Ga0268266_10358741 | 3300028379 | Bacteria | 1371 |
| 331 | Ga0268266_10727213 | 3300028379 | Bacteria | 957 |
| 332 | Ga0268256_1000008 | 3300030500 | Bacteria | 1050654 |
| 333 | Ga0268256_1000044 | 3300030500 | Bacteria | 330997 |
| 334 | Ga0316176_1036603 | 3300030732 | Bacteria | 2284 |
| 335 | Ga0316176_1043775 | 3300030732 | Bacteria | 994 |
| 336 | Ga0314311_1072890 | 3300030733 | Bacteria | 2202 |
| 337 | Ga0316183_1159014 | 3300030742 | Bacteria | 2300 |
| 338 | Ga0316181_1256419 | 3300030744 | Bacteria | 1529 |
| 339 | Ga0316182_1115502 | 3300030745 | Bacteria | 4516 |
| 340 | Ga0307513_10037233 | 3300031456 | Bacteria | 5417 |
| 341 | Ga0307513_10267221 | 3300031456 | Bacteria | 1496 |
| 342 | Ga0307408_100022323 | 3300031548 | Bacteria | 4299 |
| 343 | Ga0307408_100216471 | 3300031548 | Bacteria | 1560 |
| 344 | Ga0307408_101240522 | 3300031548 | Bacteria | 697 |
| 345 | Ga0307405_10022245 | 3300031731 | Bacteria | 3581 |
| 346 | Ga0307405_10070178 | 3300031731 | Bacteria | 2249 |
| 347 | Ga0307413_10001208 | 3300031824 | Bacteria | 9557 |
| 348 | Ga0307413_10020613 | 3300031824 | Bacteria | 3511 |
| 349 | Ga0307413_10041782 | 3300031824 | Bacteria | 2688 |
| 350 | Ga0307413_10044622 | 3300031824 | Bacteria | 2621 |
| 351 | Ga0307413_10050947 | 3300031824 | Bacteria | 2491 |
| 352 | Ga0307413_10073588 | 3300031824 | Bacteria | 2160 |
| 353 | Ga0307413_10388326 | 3300031824 | Bacteria | 1090 |
| 354 | Ga0307413_10475602 | 3300031824 | Bacteria | 997 |
| 355 | Ga0307413_10773997 | 3300031824 | Bacteria | 804 |
| 356 | Ga0307413_10870234 | 3300031824 | Bacteria | 763 |
| 357 | Ga0307413_11370484 | 3300031824 | Bacteria | 621 |
| 358 | Ga0307410_10014783 | 3300031852 | Bacteria | 4607 |
| 359 | Ga0307410_10123834 | 3300031852 | Bacteria | 1889 |
| 360 | Ga0307410_10149155 | 3300031852 | Bacteria | 1739 |
| 361 | Ga0307410_10300824 | 3300031852 | Bacteria | 1266 |
| 362 | Ga0307410_10368852 | 3300031852 | Bacteria | 1152 |
| 363 | Ga0307406_10000978 | 3300031901 | Bacteria | 15942 |
| 364 | Ga0307406_10013019 | 3300031901 | Bacteria | 4756 |
| 365 | Ga0307406_10312628 | 3300031901 | Bacteria | 1212 |
| 366 | Ga0307406_10699296 | 3300031901 | Bacteria | 846 |
| 367 | Ga0307407_10076809 | 3300031903 | Bacteria | 2006 |
| 368 | Ga0307407_10127462 | 3300031903 | Bacteria | 1623 |
| 369 | Ga0307407_10228856 | 3300031903 | Bacteria | 1261 |
| 370 | Ga0307412_10000418 | 3300031911 | Bacteria | 25962 |
| 371 | Ga0307412_10001816 | 3300031911 | Bacteria | 11811 |
| 372 | Ga0307412_10031352 | 3300031911 | Bacteria | 3357 |
| 373 | Ga0307412_10045343 | 3300031911 | Bacteria | 2873 |
| 374 | Ga0307412_10075722 | 3300031911 | Bacteria | 2309 |
| 375 | Ga0307412_10091960 | 3300031911 | Bacteria | 2125 |
| 376 | Ga0307412_10192504 | 3300031911 | Bacteria | 1543 |
| 377 | Ga0307412_10335285 | 3300031911 | Bacteria | 1208 |
| 378 | Ga0307409_100031440 | 3300031995 | Bacteria | 3831 |
| 379 | Ga0307409_100046744 | 3300031995 | Bacteria | 3279 |
| 380 | Ga0307409_100996607 | 3300031995 | Bacteria | 856 |
| 381 | Ga0307416_100014059 | 3300032002 | Bacteria | 5466 |
| 382 | Ga0307416_100039180 | 3300032002 | Bacteria | 3666 |
| 383 | Ga0307416_101238140 | 3300032002 | Bacteria | 852 |
| 384 | Ga0307414_10001338 | 3300032004 | Bacteria | 12742 |
| 385 | Ga0307414_10003104 | 3300032004 | Bacteria | 8824 |
| 386 | Ga0307414_10021898 | 3300032004 | Bacteria | 4023 |
| 387 | Ga0307414_10036736 | 3300032004 | Bacteria | 3273 |
| 388 | Ga0307414_10055143 | 3300032004 | Bacteria | 2781 |
| 389 | Ga0307414_10062348 | 3300032004 | Bacteria | 2645 |
| 390 | Ga0307414_10079320 | 3300032004 | Bacteria | 2396 |
| 391 | Ga0307414_10116249 | 3300032004 | Bacteria | 2047 |
| 392 | Ga0307414_10155622 | 3300032004 | Bacteria | 1809 |
| 393 | Ga0307414_10260251 | 3300032004 | Bacteria | 1447 |
| 394 | Ga0307414_10344181 | 3300032004 | Bacteria | 1277 |
| 395 | Ga0307414_10641852 | 3300032004 | Bacteria | 956 |
| 396 | Ga0307414_10676518 | 3300032004 | Bacteria | 932 |
| 397 | Ga0307411_10002861 | 3300032005 | Bacteria | 7797 |
| 398 | Ga0307411_10054444 | 3300032005 | Bacteria | 2627 |
| 399 | Ga0307411_10056552 | 3300032005 | Bacteria | 2586 |
| 400 | Ga0307411_10105527 | 3300032005 | Bacteria | 2003 |
| 401 | Ga0307411_10165982 | 3300032005 | Bacteria | 1660 |
| 402 | Ga0307411_10183876 | 3300032005 | Bacteria | 1589 |
| 403 | Ga0307411_10203128 | 3300032005 | Bacteria | 1524 |
| 404 | Ga0307411_10237077 | 3300032005 | Bacteria | 1426 |
| 405 | Ga0307411_10506159 | 3300032005 | Bacteria | 1022 |
| 406 | Ga0307411_10558553 | 3300032005 | Bacteria | 978 |
| 407 | Ga0307411_10562721 | 3300032005 | Bacteria | 974 |
| 408 | Ga0373928_0179764 | 3300035084 | Bacteria | 601 |
| 409 | Ga0395899_0017129 | 3300037312 | Bacteria | 5522 |
| 410 | Ga0395900_0042677 | 3300037418 | Bacteria | 4673 |
| 411 | Ga0395898_0176943 | 3300037466 | Bacteria | 2039 |
| 412 | Ga0395905_0000337 | 3300037471 | Bacteria | 67116 |
| 413 | Ga0395905_0006093 | 3300037471 | Bacteria | 12181 |
| 414 | Ga0395905_0019088 | 3300037471 | Bacteria | 6503 |
| 415 | Ga0395905_0376645 | 3300037471 | Bacteria | 1313 |
| 416 | Ga0395905_0565449 | 3300037471 | Bacteria | 1038 |
| 417 | Ga0395901_0088389 | 3300038443 | Bacteria | 3241 |
| 418 | Ga0395901_0578455 | 3300038443 | Bacteria | 1135 |
| 419 | Ga0237819_00177 | 3300038705 | Bacteria | 23554 |
| 420 | Ga0237819_02977 | 3300038705 | Bacteria | 3158 |
| 421 | Ga0237816_03081 | 3300039145 | Bacteria | 1236 |
| 422 | Ga0439436_0000007 | 3300041404 | Bacteria | 120812 |
| 423 | Ga0439436_0034362 | 3300041404 | Bacteria | 1466 |
| 424 | Ga0439439_0018180 | 3300041406 | Bacteria | 1735 |
| 425 | Ga0439447_000808 | 3300041407 | Bacteria | 11507 |
| 426 | Ga0439465_0000214 | 3300041413 | Bacteria | 15475 |
| 427 | Ga0439465_0000377 | 3300041413 | Bacteria | 12805 |
| 428 | Ga0439465_0000615 | 3300041413 | Bacteria | 10825 |
| 429 | Ga0439465_0003455 | 3300041413 | Bacteria | 5153 |
| 430 | Ga0439465_0017038 | 3300041413 | Bacteria | 2267 |
| 431 | Ga0451787_725098 | 3300041441 | Bacteria | 935 |
| 432 | Ga0451789_0245027 | 3300041443 | Bacteria | 704 |
| 433 | Ga0451789_1055925 | 3300041443 | Bacteria | 932 |
| 434 | Ga0451791_0725227 | 3300041451 | Bacteria | 669 |
| 435 | Ga0451791_0976915 | 3300041451 | Bacteria | 1541 |
| 436 | Ga0451791_1601024 | 3300041451 | Bacteria | 728 |
| 437 | Ga0451793_1805861 | 3300041452 | Bacteria | 1186 |
| 438 | Ga0451797_1565887 | 3300041453 | Bacteria | 849 |
| 439 | Ga0451795_0661403 | 3300041456 | Bacteria | 1255 |
| 440 | Ga0451800_1649814 | 3300041459 | Bacteria | 2090 |
| 441 | Ga0451806_152401 | 3300041462 | Bacteria | 4074 |
| 442 | Ga0451804_0876128 | 3300041463 | Bacteria | 735 |
| 443 | Ga0451804_1077436 | 3300041463 | Bacteria | 3811 |
| 444 | Ga0451804_1170276 | 3300041463 | Bacteria | 621 |
| 445 | Ga0451807_0590162 | 3300041486 | Bacteria | 4065 |
| 446 | Ga0451807_1916965 | 3300041486 | Bacteria | 1280 |
| 447 | Ga0451837_1238404 | 3300041494 | Bacteria | 940 |
| 448 | Ga0451837_1399073 | 3300041494 | Bacteria | 2360 |
| 449 | Ga0451847_0196122 | 3300041503 | Bacteria | 1097 |
| 450 | Ga0451843_0056262 | 3300041509 | Bacteria | 2570 |
| 451 | Ga0451843_0193634 | 3300041509 | Bacteria | 1300 |
| 452 | Ga0451843_1149050 | 3300041509 | Bacteria | 2679 |
| 453 | Ga0451853_1261890 | 3300041512 | Bacteria | 2001 |
| 454 | Ga0451853_1606826 | 3300041512 | Bacteria | 698 |
| 455 | Ga0451853_3210631 | 3300041512 | Unclassified | 688 |
| 456 | Ga0451853_4086402 | 3300041512 | Bacteria | 847 |
| 457 | Ga0439433_0026674 | 3300041999 | Bacteria | 1308 |
| 458 | Ga0439433_0030390 | 3300041999 | Bacteria | 1235 |
| 459 | Ga0439433_0077449 | 3300041999 | Bacteria | 806 |
| 460 | Ga0439445_0012311 | 3300042004 | Bacteria | 2053 |
| 461 | Ga0439445_0064993 | 3300042004 | Bacteria | 1003 |
| 462 | Ga0439432_009293 | 3300042006 | Bacteria | 3432 |
| 463 | Ga0439432_015910 | 3300042006 | Bacteria | 2534 |
| 464 | Ga0439432_022919 | 3300042006 | Bacteria | 2060 |
| 465 | Ga0439432_026696 | 3300042006 | Bacteria | 1890 |
| 466 | Ga0439449_0000277 | 3300042007 | Bacteria | 18577 |
| 467 | Ga0439449_0003655 | 3300042007 | Bacteria | 5969 |
| 468 | Ga0439449_0009760 | 3300042007 | Bacteria | 3632 |
| 469 | Ga0439449_0022386 | 3300042007 | Bacteria | 2366 |
| 470 | Ga0439449_0050465 | 3300042007 | Bacteria | 1539 |
| 471 | Ga0439452_009962 | 3300042010 | Bacteria | 2782 |
| 472 | Ga0439455_0043457 | 3300042012 | Bacteria | 1157 |
| 473 | Ga0439462_0060166 | 3300042015 | Bacteria | 1028 |
| 474 | Ga0450911_000685 | 3300042115 | Bacteria | 10057 |
| 475 | Ga0450923_020142 | 3300042125 | Bacteria | 1291 |
| 476 | Ga0450908_000033 | 3300042184 | Bacteria | 31285 |
| 477 | Ga0466982_0010498 | 3300044672 | Bacteria | 4813 |
| 478 | Ga0453684_0000159 | 3300044712 | Bacteria | 300297 |
| 479 | Ga0466957_0041473 | 3300044842 | Bacteria | 2784 |
| 480 | Ga0451576_0000120 | 3300045051 | Bacteria | 199365 |
| 481 | Ga0466958_0509475 | 3300045836 | Bacteria | 781 |
| 482 | Ga0495617_000196 | 3300046452 | Bacteria | 38054 |
| 483 | Ga0495617_000318 | 3300046452 | Bacteria | 27031 |
| 484 | Ga0495627_010605 | 3300046453 | Bacteria | 3342 |
| 485 | Ga0495627_032692 | 3300046453 | Bacteria | 1636 |
| 486 | Ga0495627_051825 | 3300046453 | Bacteria | 1232 |
| 487 | Ga0495591_034329 | 3300046458 | Bacteria | 1494 |
| 488 | Ga0495638_0002849 | 3300046460 | Bacteria | 13863 |
| 489 | Ga0495638_0004464 | 3300046460 | Bacteria | 10598 |
| 490 | Ga0495638_0132268 | 3300046460 | Bacteria | 1464 |
| 491 | Ga0495650_0011065 | 3300046471 | Bacteria | 4979 |
| 492 | Ga0495584_0000437 | 3300046491 | Bacteria | 28733 |
| 493 | Ga0495585_0001305 | 3300046492 | Bacteria | 19892 |
| 494 | Ga0495585_0176303 | 3300046492 | Bacteria | 1101 |
| 495 | Ga0495607_0004515 | 3300046501 | Bacteria | 10213 |
| 496 | Ga0495607_0015294 | 3300046501 | Bacteria | 4976 |
| 497 | Ga0495607_0016250 | 3300046501 | Bacteria | 4805 |
| 498 | Ga0495607_0020055 | 3300046501 | Bacteria | 4232 |
| 499 | Ga0495607_0422864 | 3300046501 | Bacteria | 602 |
| 500 | Ga0495583_0015969 | 3300046506 | Bacteria | 4056 |
| 501 | Ga0495606_0003552 | 3300046507 | Bacteria | 16459 |
| 502 | Ga0495606_0005186 | 3300046507 | Bacteria | 12602 |
| 503 | Ga0495606_0060310 | 3300046507 | Bacteria | 2430 |
| 504 | Ga0495606_0077532 | 3300046507 | Bacteria | 2074 |
| 505 | Ga0495606_0127978 | 3300046507 | Bacteria | 1512 |
| 506 | Ga0495610_0000971 | 3300046512 | Bacteria | 26490 |
| 507 | Ga0495610_0015601 | 3300046512 | Bacteria | 4406 |
| 508 | Ga0495610_0016193 | 3300046512 | Bacteria | 4303 |
| 509 | Ga0495616_0001042 | 3300046513 | Bacteria | 19821 |
| 510 | Ga0495616_0184079 | 3300046513 | Bacteria | 926 |
| 511 | Ga0495620_0000846 | 3300046515 | Bacteria | 18912 |
| 512 | Ga0495620_0001915 | 3300046515 | Bacteria | 12191 |
| 513 | Ga0495631_0000878 | 3300046518 | Bacteria | 18807 |
| 514 | Ga0495631_0002764 | 3300046518 | Bacteria | 9736 |
| 515 | Ga0495631_0010947 | 3300046518 | Bacteria | 4477 |
| 516 | Ga0495632_0000014 | 3300046519 | Bacteria | 243913 |
| 517 | Ga0495632_0005070 | 3300046519 | Bacteria | 8810 |
| 518 | Ga0495632_0071240 | 3300046519 | Bacteria | 1670 |
| 519 | Ga0495643_0002141 | 3300046522 | Bacteria | 16245 |
| 520 | Ga0495648_0002749 | 3300046524 | Bacteria | 15883 |
| 521 | Ga0495648_0053514 | 3300046524 | Bacteria | 2445 |
| 522 | Ga0495663_0001222 | 3300046525 | Bacteria | 8226 |
| 523 | Ga0495663_0001801 | 3300046525 | Bacteria | 6631 |
| 524 | Ga0495663_0003902 | 3300046525 | Bacteria | 4248 |
| 525 | Ga0495663_0009609 | 3300046525 | Bacteria | 2682 |
| 526 | Ga0495663_0009906 | 3300046525 | Bacteria | 2647 |
| 527 | Ga0495663_0032003 | 3300046525 | Bacteria | 1564 |
| 528 | Ga0495663_0228027 | 3300046525 | Bacteria | 656 |
| 529 | Ga0495598_0001908 | 3300046537 | Bacteria | 4217 |
| 530 | Ga0495609_0002407 | 3300046538 | Bacteria | 11518 |
| 531 | Ga0495609_0223113 | 3300046538 | Bacteria | 782 |
| 532 | Ga0495621_0031148 | 3300046539 | Bacteria | 1828 |
| 533 | Ga0495621_0044186 | 3300046539 | Bacteria | 1574 |
| 534 | Ga0495622_0068953 | 3300046557 | Bacteria | 1633 |
| 535 | Ga0495633_0010539 | 3300046558 | Bacteria | 5039 |
| 536 | Ga0495633_0023836 | 3300046558 | Bacteria | 3028 |
| 537 | Ga0495633_0100422 | 3300046558 | Bacteria | 1343 |
| 538 | Ga0495633_0191777 | 3300046558 | Bacteria | 939 |
| 539 | Ga0495656_0003602 | 3300046615 | Bacteria | 5247 |
| 540 | Ga0495656_0063588 | 3300046615 | Bacteria | 1618 |
| 541 | Ga0495668_0000890 | 3300046616 | Bacteria | 33634 |
| 542 | Ga0495668_0002891 | 3300046616 | Bacteria | 13564 |
| 543 | Ga0495668_0413290 | 3300046616 | Bacteria | 742 |
| 544 | Ga0495611_0000003 | 3300046648 | Bacteria | 395679 |
| 545 | Ga0495611_0002170 | 3300046648 | Bacteria | 9153 |
| 546 | Ga0495625_0000019 | 3300046660 | Bacteria | 298330 |
| 547 | Ga0495625_0053094 | 3300046660 | Bacteria | 2900 |
| 548 | Ga0495625_0107868 | 3300046660 | Bacteria | 1905 |
| 549 | Ga0495659_0005748 | 3300046664 | Bacteria | 3911 |
| 550 | Ga0495661_0008753 | 3300046665 | Bacteria | 6984 |
| 551 | Ga0495670_0000478 | 3300046691 | Bacteria | 18969 |
| 552 | Ga0495670_0002610 | 3300046691 | Bacteria | 8900 |
| 553 | Ga0495670_0051527 | 3300046691 | Bacteria | 2060 |
| 554 | Ga0495670_0061678 | 3300046691 | Bacteria | 1885 |
| 555 | Ga0495670_0380437 | 3300046691 | Bacteria | 762 |
| 556 | Ga0495671_0003233 | 3300046692 | Bacteria | 10116 |
| 557 | Ga0495671_0004102 | 3300046692 | Bacteria | 8783 |
| 558 | Ga0495649_0030625 | 3300046694 | Bacteria | 2971 |
| 559 | Ga0495589_0000408 | 3300046794 | Bacteria | 32385 |
| 560 | Ga0495660_0000122 | 3300046810 | Bacteria | 85116 |
| 561 | Ga0495660_0000268 | 3300046810 | Bacteria | 48969 |
| 562 | Ga0495660_0047807 | 3300046810 | Bacteria | 2341 |
| 563 | Ga0495660_0188229 | 3300046810 | Bacteria | 994 |
| 564 | Ga0495636_0008861 | 3300047318 | Bacteria | 3961 |
| 565 | Ga0495636_0021723 | 3300047318 | Bacteria | 2592 |
| 566 | Ga0495636_0027609 | 3300047318 | Bacteria | 2312 |
| 567 | Ga0495636_0028371 | 3300047318 | Bacteria | 2283 |
| 568 | Ga0495672_0001225 | 3300047320 | Bacteria | 25853 |
| 569 | Ga0495683_0004599 | 3300047323 | Bacteria | 7789 |
| 570 | Ga0495677_0104255 | 3300047445 | Bacteria | 1075 |
| 571 | Ga0495679_000017 | 3300047446 | Bacteria | 263230 |
| 572 | Ga0495673_0000004 | 3300047469 | Bacteria | 1354526 |
| 573 | Ga0495673_0000347 | 3300047469 | Bacteria | 58250 |
| 574 | Ga0495673_0001675 | 3300047469 | Bacteria | 17049 |
| 575 | Ga0495681_0286146 | 3300047470 | Bacteria | 641 |
| 576 | Ga0495686_0000024 | 3300047472 | Bacteria | 400343 |
| 577 | Ga0495686_0000409 | 3300047472 | Bacteria | 67869 |
| 578 | Ga0495686_0004194 | 3300047472 | Bacteria | 11971 |
| 579 | Ga0495686_0007418 | 3300047472 | Bacteria | 8224 |
| 580 | Ga0495686_0016046 | 3300047472 | Bacteria | 5090 |
| 581 | Ga0495686_0037336 | 3300047472 | Bacteria | 3112 |
| 582 | Ga0495686_0092833 | 3300047472 | Bacteria | 1830 |
| 583 | Ga0495686_0117408 | 3300047472 | Bacteria | 1589 |
| 584 | Ga0495615_0022313 | 3300048090 | Bacteria | 1439 |
| 585 | Ga0496100_0028515 | 3300048903 | Bacteria | 3444 |
| 586 | Ga0496100_0323639 | 3300048903 | Bacteria | 1159 |
| 587 | Ga0496100_0513306 | 3300048903 | Bacteria | 924 |
| 588 | Ga0496101_0002654 | 3300048904 | Bacteria | 10984 |
| 589 | Ga0496101_0044626 | 3300048904 | Bacteria | 3172 |
| 590 | Ga0496101_0449636 | 3300048904 | Bacteria | 1016 |
| 591 | Ga0496102_0202573 | 3300048905 | Bacteria | 1871 |
| 592 | Ga0496104_0014408 | 3300048907 | Bacteria | 7145 |
| 593 | Ga0496104_0148328 | 3300048907 | Bacteria | 2252 |
| 594 | Ga0496105_0028149 | 3300048908 | Bacteria | 4595 |
| 595 | Ga0496105_0045875 | 3300048908 | Bacteria | 3606 |
| 596 | Ga0496106_0010123 | 3300048909 | Bacteria | 6965 |
| 597 | Ga0496106_0037617 | 3300048909 | Bacteria | 3621 |
| 598 | Ga0496106_0411828 | 3300048909 | Bacteria | 1086 |
| 599 | Ga0496108_0018627 | 3300048911 | Bacteria | 5688 |
| 600 | Ga0496108_0164470 | 3300048911 | Bacteria | 1918 |
| 601 | Ga0496108_0832326 | 3300048911 | Bacteria | 795 |
| 602 | Ga0496108_1267421 | 3300048911 | Bacteria | 621 |
| 603 | Ga0496109_0043422 | 3300048912 | Bacteria | 4074 |
| 604 | Ga0496109_0592418 | 3300048912 | Bacteria | 1045 |
| 605 | Ga0496110_0756592 | 3300048913 | Bacteria | 875 |
| 606 | Ga0496110_0860118 | 3300048913 | Bacteria | 812 |
| 607 | Ga0496111_0007874 | 3300048914 | Bacteria | 7021 |
| 608 | Ga0496112_0055973 | 3300048915 | Bacteria | 3881 |
| 609 | Ga0496113_0046111 | 3300048916 | Bacteria | 3235 |
| 610 | Ga0496113_0105163 | 3300048916 | Bacteria | 2191 |
| 611 | Ga0496114_0004048 | 3300048917 | Bacteria | 11322 |
| 612 | Ga0496116_0002306 | 3300048919 | Bacteria | 20233 |
| 613 | Ga0496116_0019218 | 3300048919 | Bacteria | 5237 |
| 614 | Ga0496116_0064796 | 3300048919 | Bacteria | 2347 |
| 615 | Ga0496116_0101306 | 3300048919 | Bacteria | 1720 |
| 616 | Ga0496117_0001871 | 3300048920 | Bacteria | 28369 |
| 617 | Ga0496117_0004092 | 3300048920 | Bacteria | 16354 |
| 618 | Ga0496117_0004983 | 3300048920 | Bacteria | 14248 |
| 619 | Ga0496117_0008606 | 3300048920 | Bacteria | 9668 |
| 620 | Ga0496117_0024752 | 3300048920 | Bacteria | 4735 |
| 621 | Ga0496117_0048375 | 3300048920 | Bacteria | 3038 |
| 622 | Ga0496117_0073042 | 3300048920 | Bacteria | 2290 |
| 623 | Ga0496117_0268874 | 3300048920 | Bacteria | 919 |
| 624 | Ga0496117_0374621 | 3300048920 | Bacteria | 727 |
| 625 | Ga0496118_0001013 | 3300048921 | Bacteria | 43722 |
| 626 | Ga0496118_0001607 | 3300048921 | Bacteria | 33397 |
| 627 | Ga0496118_0002036 | 3300048921 | Bacteria | 28593 |
| 628 | Ga0496118_0035718 | 3300048921 | Bacteria | 4030 |
| 629 | Ga0496118_0049568 | 3300048921 | Bacteria | 3232 |
| 630 | Ga0496118_0054643 | 3300048921 | Bacteria | 3022 |
| 631 | Ga0496118_0099230 | 3300048921 | Bacteria | 1975 |
| 632 | Ga0496118_0160364 | 3300048921 | Bacteria | 1392 |
| 633 | Ga0496118_0175261 | 3300048921 | Bacteria | 1303 |
| 634 | Ga0496118_0198680 | 3300048921 | Bacteria | 1190 |
| 635 | Ga0496119_0000235 | 3300048922 | Bacteria | 77921 |
| 636 | Ga0496119_0003558 | 3300048922 | Bacteria | 16083 |
| 637 | Ga0496119_0010179 | 3300048922 | Bacteria | 7940 |
| 638 | Ga0496119_0010619 | 3300048922 | Bacteria | 7722 |
| 639 | Ga0496119_0046207 | 3300048922 | Bacteria | 2721 |
| 640 | Ga0496120_0000208 | 3300048923 | Bacteria | 100328 |
| 641 | Ga0496120_0000282 | 3300048923 | Bacteria | 85605 |
| 642 | Ga0496120_0000970 | 3300048923 | Bacteria | 39064 |
| 643 | Ga0496120_0283125 | 3300048923 | Bacteria | 765 |
| 644 | Ga0496121_0000109 | 3300048924 | Bacteria | 187307 |
| 645 | Ga0496121_0000480 | 3300048924 | Bacteria | 77305 |
| 646 | Ga0496121_0000752 | 3300048924 | Bacteria | 59582 |
| 647 | Ga0496121_0002095 | 3300048924 | Bacteria | 31379 |
| 648 | Ga0496121_0007074 | 3300048924 | Bacteria | 13624 |
| 649 | Ga0496121_0011014 | 3300048924 | Bacteria | 10095 |
| 650 | Ga0496121_0017014 | 3300048924 | Bacteria | 7462 |
| 651 | Ga0496121_0018291 | 3300048924 | Bacteria | 7077 |
| 652 | Ga0496121_0079150 | 3300048924 | Bacteria | 2610 |
| 653 | Ga0496121_0100282 | 3300048924 | Bacteria | 2235 |
| 654 | Ga0496122_0001004 | 3300048925 | Bacteria | 49981 |
| 655 | Ga0496122_0009282 | 3300048925 | Bacteria | 10401 |
| 656 | Ga0496122_0025748 | 3300048925 | Bacteria | 5096 |
| 657 | Ga0496122_0026466 | 3300048925 | Bacteria | 4998 |
| 658 | Ga0496122_0034096 | 3300048925 | Bacteria | 4173 |
| 659 | Ga0496122_0095588 | 3300048925 | Bacteria | 2007 |
| 660 | Ga0496122_0177692 | 3300048925 | Bacteria | 1274 |
| 661 | Ga0496122_0251634 | 3300048925 | Bacteria | 987 |
| 662 | Ga0496122_0346190 | 3300048925 | Bacteria | 778 |
| 663 | Ga0496123_0000239 | 3300048926 | Bacteria | 110475 |
| 664 | Ga0496123_0003580 | 3300048926 | Bacteria | 17215 |
| 665 | Ga0496123_0008951 | 3300048926 | Bacteria | 9101 |
| 666 | Ga0496123_0029599 | 3300048926 | Bacteria | 4026 |
| 667 | Ga0496123_0044731 | 3300048926 | Bacteria | 3024 |
| 668 | Ga0496123_0057107 | 3300048926 | Bacteria | 2544 |
| 669 | Ga0496123_0057633 | 3300048926 | Bacteria | 2526 |
| 670 | Ga0496123_0062757 | 3300048926 | Bacteria | 2378 |
| 671 | Ga0496123_0063283 | 3300048926 | Bacteria | 2365 |
| 672 | Ga0496124_0000218 | 3300048927 | Bacteria | 112156 |
| 673 | Ga0496124_0001341 | 3300048927 | Bacteria | 36941 |
| 674 | Ga0496124_0001511 | 3300048927 | Bacteria | 33889 |
| 675 | Ga0496124_0003515 | 3300048927 | Bacteria | 19085 |
| 676 | Ga0496124_0004411 | 3300048927 | Bacteria | 16416 |
| 677 | Ga0496124_0006332 | 3300048927 | Bacteria | 12919 |
| 678 | Ga0496124_0007149 | 3300048927 | Bacteria | 11948 |
| 679 | Ga0496124_0008850 | 3300048927 | Bacteria | 10453 |
| 680 | Ga0496124_0077460 | 3300048927 | Bacteria | 2742 |
| 681 | Ga0496124_0080829 | 3300048927 | Bacteria | 2673 |
| 682 | Ga0496124_0134881 | 3300048927 | Bacteria | 1955 |
| 683 | Ga0496124_0230198 | 3300048927 | Bacteria | 1386 |
| 684 | Ga0496124_0271211 | 3300048927 | Bacteria | 1242 |
| 685 | Ga0496125_0004406 | 3300048928 | Bacteria | 16271 |
| 686 | Ga0496125_0005552 | 3300048928 | Bacteria | 13957 |
| 687 | Ga0496125_0005750 | 3300048928 | Bacteria | 13642 |
| 688 | Ga0496125_0006890 | 3300048928 | Bacteria | 12166 |
| 689 | Ga0496125_0044519 | 3300048928 | Bacteria | 3752 |
| 690 | Ga0496125_0056447 | 3300048928 | Bacteria | 3188 |
| 691 | Ga0496125_0090789 | 3300048928 | Bacteria | 2291 |
| 692 | Ga0496126_0005914 | 3300048929 | Bacteria | 13798 |
| 693 | Ga0496126_0009365 | 3300048929 | Bacteria | 10408 |
| 694 | Ga0496126_0042951 | 3300048929 | Bacteria | 4173 |
| 695 | Ga0496126_0061724 | 3300048929 | Bacteria | 3366 |
| 696 | Ga0496126_0136876 | 3300048929 | Bacteria | 2112 |
| 697 | Ga0496126_0149731 | 3300048929 | Bacteria | 2001 |
| 698 | Ga0496126_0196653 | 3300048929 | Bacteria | 1705 |
| 699 | Ga0496126_0235085 | 3300048929 | Bacteria | 1533 |
| 700 | Ga0496126_0620767 | 3300048929 | Bacteria | 849 |
| 701 | Ga0495678_000496 | 3300049459 | Bacteria | 38859 |
| 702 | Ga0495682_0005490 | 3300049460 | Bacteria | 5258 |
| 703 | Ga0495682_0011390 | 3300049460 | Bacteria | 3422 |
| 704 | Ga0501290_022888 | 3300049513 | Bacteria | 864 |
| 705 | Ga0501031_0005288 | 3300049568 | Bacteria | 8410 |
| 706 | Ga0501031_0017026 | 3300049568 | Bacteria | 4722 |
| 707 | Ga0501031_0251651 | 3300049568 | Bacteria | 1148 |
| 708 | Ga0501032_0034586 | 3300049569 | Bacteria | 3458 |
| 709 | Ga0501032_0079460 | 3300049569 | Bacteria | 2184 |
| 710 | Ga0501033_0000625 | 3300049570 | Bacteria | 32789 |
| 711 | Ga0501033_0068791 | 3300049570 | Bacteria | 2603 |
| 712 | Ga0501033_0240145 | 3300049570 | Bacteria | 1285 |
| 713 | Ga0501033_0244952 | 3300049570 | Bacteria | 1271 |
| 714 | Ga0501033_0270756 | 3300049570 | Bacteria | 1200 |
| 715 | Ga0501034_0001242 | 3300049571 | Bacteria | 34633 |
| 716 | Ga0501034_0008327 | 3300049571 | Bacteria | 10972 |
| 717 | Ga0501034_0020621 | 3300049571 | Bacteria | 6732 |
| 718 | Ga0501034_0391135 | 3300049571 | Bacteria | 1314 |
| 719 | Ga0501034_0412529 | 3300049571 | Bacteria | 1272 |
| 720 | Ga0501034_0501945 | 3300049571 | Bacteria | 1127 |
| 721 | Ga0501036_0014053 | 3300049572 | Bacteria | 6654 |
| 722 | Ga0501036_0039262 | 3300049572 | Bacteria | 4006 |
| 723 | Ga0501037_0001197 | 3300049573 | Bacteria | 19151 |
| 724 | Ga0501037_0211476 | 3300049573 | Bacteria | 1367 |
| 725 | Ga0501038_0001241 | 3300049574 | Bacteria | 23114 |
| 726 | Ga0501038_0021584 | 3300049574 | Bacteria | 5778 |
| 727 | Ga0501038_0489529 | 3300049574 | Bacteria | 942 |
| 728 | Ga0501039_0020714 | 3300049575 | Bacteria | 5039 |
| 729 | Ga0501039_0040990 | 3300049575 | Bacteria | 3575 |
| 730 | Ga0501039_0578773 | 3300049575 | Bacteria | 880 |
| 731 | Ga0501042_0627364 | 3300049578 | Bacteria | 781 |
| 732 | Ga0501043_0020013 | 3300049579 | Bacteria | 5253 |
| 733 | Ga0501043_0053496 | 3300049579 | Bacteria | 3170 |
| 734 | Ga0501043_0178100 | 3300049579 | Bacteria | 1657 |
| 735 | Ga0501043_0697854 | 3300049579 | Bacteria | 741 |
| 736 | Ga0501043_0818585 | 3300049579 | Bacteria | 672 |
| 737 | Ga0501046_0130135 | 3300049580 | Bacteria | 1909 |
| 738 | Ga0501047_0055064 | 3300049581 | Bacteria | 3847 |
| 739 | Ga0501047_0201272 | 3300049581 | Bacteria | 1852 |
| 740 | Ga0501047_0370336 | 3300049581 | Bacteria | 1267 |
| 741 | Ga0501047_0400592 | 3300049581 | Bacteria | 1205 |
| 742 | Ga0501048_0219207 | 3300049582 | Bacteria | 1349 |
| 743 | Ga0501068_0072238 | 3300049584 | Bacteria | 2107 |
| 744 | Ga0501069_0565928 | 3300049585 | Bacteria | 681 |
| 745 | Ga0501070_0271621 | 3300049586 | Bacteria | 1384 |
| 746 | Ga0501070_0518607 | 3300049586 | Bacteria | 956 |
| 747 | Ga0501070_0794491 | 3300049586 | Bacteria | 743 |
| 748 | Ga0501073_0031382 | 3300049589 | Bacteria | 3791 |
| 749 | Ga0501217_112051 | 3300049661 | Bacteria | 785 |
| 750 | Ga0501223_008846 | 3300049663 | Bacteria | 2049 |
| 751 | Ga0501239_012302 | 3300049672 | Bacteria | 967 |
| 752 | Ga0501243_005519 | 3300049675 | Bacteria | 1901 |
| 753 | Ga0501253_033769 | 3300049683 | Bacteria | 992 |
| 754 | Ga0501225_0103046 | 3300049705 | Bacteria | 835 |
| 755 | Ga0501245_014636 | 3300049708 | Bacteria | 1173 |
| 756 | Ga0501079_0166991 | 3300049741 | Bacteria | 1716 |
| 757 | Ga0501080_0002129 | 3300049742 | Bacteria | 17199 |
| 758 | Ga0501080_0023252 | 3300049742 | Bacteria | 5747 |
| 759 | Ga0501266_003858 | 3300049763 | Bacteria | 1856 |
| 760 | Ga0501266_018515 | 3300049763 | Bacteria | 937 |
| 761 | Ga0501266_021107 | 3300049763 | Bacteria | 889 |
| 762 | Ga0501267_013704 | 3300049764 | Bacteria | 845 |
| 763 | Ga0501268_026763 | 3300049765 | Bacteria | 1021 |
| 764 | Ga0501270_018667 | 3300049767 | Bacteria | 1030 |
| 765 | Ga0501035_0002247 | 3300049822 | Bacteria | 19119 |
| 766 | Ga0501035_0009719 | 3300049822 | Bacteria | 8947 |
| 767 | Ga0501035_0076487 | 3300049822 | Bacteria | 2960 |
| 768 | Ga0501035_0084774 | 3300049822 | Bacteria | 2794 |
| 769 | Ga0501035_0301957 | 3300049822 | Bacteria | 1349 |
| 770 | Ga0501035_0349423 | 3300049822 | Bacteria | 1237 |
| 771 | Ga0501044_0002685 | 3300049823 | Bacteria | 20231 |
| 772 | Ga0501044_0019061 | 3300049823 | Bacteria | 7345 |
| 773 | Ga0501044_0037487 | 3300049823 | Bacteria | 5067 |
| 774 | Ga0501044_0051758 | 3300049823 | Bacteria | 4233 |
| 775 | Ga0501044_0096927 | 3300049823 | Bacteria | 2970 |
| 776 | Ga0501044_0277800 | 3300049823 | Bacteria | 1609 |
| 777 | Ga0501045_0279450 | 3300049824 | Bacteria | 1243 |
| 778 | nmdc:mga03n38_197259_c1 | 3300050490 | Bacteria | 1040 |
| 779 | nmdc:mga00v17_113447_c1 | 3300050491 | Bacteria | 1721 |
| 780 | nmdc:mga00v17_1287_c1 | 3300050491 | Bacteria | 13178 |
| 781 | nmdc:mga00v17_129755_c1 | 3300050491 | Bacteria | 1610 |
| 782 | nmdc:mga00v17_18002_c1 | 3300050491 | Bacteria | 4009 |
| 783 | nmdc:mga00v17_56465_c1 | 3300050491 | Bacteria | 2401 |
| 784 | nmdc:mga0yw44_122802_c1 | 3300050492 | Bacteria | 1674 |
| 785 | nmdc:mga0yw44_307442_c1 | 3300050492 | Bacteria | 1063 |
| 786 | nmdc:mga07m45_127220_c1 | 3300050496 | Bacteria | 1473 |
| 787 | nmdc:mga0sz30_40870_c2 | 3300050516 | Bacteria | 1583 |
| 788 | Ga0500643_000029 | 3300053087 | Bacteria | 211149 |
| 789 | Ga0500643_006120 | 3300053087 | Bacteria | 5081 |
| 790 | Ga0500555_000324 | 3300053103 | Bacteria | 20582 |
| 791 | Ga0500572_070424 | 3300053111 | Bacteria | 1080 |
| 792 | Ga0500597_000107 | 3300053120 | Bacteria | 17442 |
| 793 | Ga0500626_103771 | 3300053128 | Bacteria | 1236 |
| 794 | Ga0500622_0211417 | 3300053156 | Bacteria | 875 |
| 795 | Ga0500633_0019341 | 3300053160 | Bacteria | 2035 |
| 796 | Ga0500634_0000022 | 3300053161 | Bacteria | 95424 |
| 797 | Ga0500645_001107 | 3300053730 | Bacteria | 14742 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025981 | Ga0207640_10003213 | Ga0207640_100032137 | 137 |
| 2 | 3300003320 | rootH2_10004458 | rootH2_100044583 | 144 |
| 3 | 3300003323 | rootH1_10232895 | rootH1_102328952 | 144 |
| 4 | 3300049663 | Ga0501223_008846 | Ga0501223_008846_1492_2016 | 145 |
| 5 | 3300049763 | Ga0501266_021107 | Ga0501266_021107_313_837 | 145 |
| 6 | 3300003856 | Ga0058692_1000035 | Ga0058692_100003512 | 146 |
| 7 | 3300009148 | Ga0105243_10122895 | Ga0105243_101228953 | 146 |
| 8 | 3300027312 | Ga0209371_1000043 | Ga0209371_1000043123 | 146 |
| 9 | 3300030500 | Ga0268256_1000044 | Ga0268256_1000044123 | 146 |
| 10 | 3300041406 | Ga0439439_0018180 | Ga0439439_0018180_1136_1669 | 146 |
| 11 | 3300042006 | Ga0439432_009293 | Ga0439432_009293_2357_2890 | 146 |
| 12 | 3300042007 | Ga0439449_0022386 | Ga0439449_0022386_1685_2218 | 146 |
| 13 | 3300042015 | Ga0439462_0060166 | Ga0439462_0060166_349_882 | 146 |
| 14 | 3300042115 | Ga0450911_000685 | Ga0450911_000685_9415_9921 | 146 |
| 15 | 3300046525 | Ga0495663_0003902 | Ga0495663_0003902_3610_4116 | 146 |
| 16 | 3300046558 | Ga0495633_0100422 | Ga0495633_0100422_621_1127 | 146 |
| 17 | 3300048919 | Ga0496116_0002306 | Ga0496116_0002306_16400_16906 | 146 |
| 18 | 3300048920 | Ga0496117_0048375 | Ga0496117_0048375_274_780 | 146 |
| 19 | 3300048922 | Ga0496119_0046207 | Ga0496119_0046207_1941_2447 | 146 |
| 20 | 3300048923 | Ga0496120_0283125 | Ga0496120_0283125_40_546 | 146 |
| 21 | 3300048924 | Ga0496121_0011014 | Ga0496121_0011014_255_761 | 146 |
| 22 | 3300048925 | Ga0496122_0251634 | Ga0496122_0251634_121_627 | 146 |
| 23 | 3300048927 | Ga0496124_0080829 | Ga0496124_0080829_1922_2428 | 146 |
| 24 | 3300049573 | Ga0501037_0211476 | Ga0501037_0211476_865_1353 | 146 |
| 25 | 3300049763 | Ga0501266_018515 | Ga0501266_018515_17_550 | 146 |
| 26 | 3300038705 | Ga0237819_02977 | Ga0237819_02977_2174_2680 | 147 |
| 27 | 3300041459 | Ga0451800_1649814 | Ga0451800_1649814_768_1292 | 147 |
| 28 | 3300041462 | Ga0451806_152401 | Ga0451806_152401_2784_3308 | 147 |
| 29 | 3300041463 | Ga0451804_1077436 | Ga0451804_1077436_2631_3155 | 147 |
| 30 | 3300041486 | Ga0451807_0590162 | Ga0451807_0590162_2795_3319 | 147 |
| 31 | 3300041503 | Ga0451847_0196122 | Ga0451847_0196122_364_888 | 147 |
| 32 | 3300046525 | Ga0495663_0032003 | Ga0495663_0032003_831_1385 | 147 |
| 33 | 3300046539 | Ga0495621_0031148 | Ga0495621_0031148_1175_1729 | 147 |
| 34 | 3300046664 | Ga0495659_0005748 | Ga0495659_0005748_2340_2894 | 147 |
| 35 | 3300046691 | Ga0495670_0051527 | Ga0495670_0051527_472_1026 | 147 |
| 36 | 3300047318 | Ga0495636_0008861 | Ga0495636_0008861_3392_3946 | 147 |
| 37 | 3300032005 | Ga0307411_10237077 | Ga0307411_102370772 | 148 |
| 38 | 3300030745 | Ga0316182_1115502 | Ga0316182_11155025 | 149 |
| 39 | 3300048928 | Ga0496125_0090789 | Ga0496125_0090789_658_1188 | 149 |
| 40 | 3300049765 | Ga0501268_026763 | Ga0501268_026763_39_593 | 149 |
| 41 | 3300025229 | Ga0209147_102946 | Ga0209147_1029464 | 150 |
| 42 | 3300025303 | Ga0209051_1001947 | Ga0209051_10019472 | 150 |
| 43 | 3300031824 | Ga0307413_10020613 | Ga0307413_100206132 | 150 |
| 44 | 3300031903 | Ga0307407_10228856 | Ga0307407_102288562 | 150 |
| 45 | 3300031911 | Ga0307412_10335285 | Ga0307412_103352852 | 150 |
| 46 | 3300032005 | Ga0307411_10056552 | Ga0307411_100565522 | 150 |
| 47 | 3300042006 | Ga0439432_022919 | Ga0439432_022919_323_877 | 150 |
| 48 | 3300009093 | Ga0105240_10128175 | Ga0105240_101281751 | 151 |
| 49 | 3300009093 | Ga0105240_10130625 | Ga0105240_101306251 | 151 |
| 50 | 3300010375 | Ga0105239_10000027 | Ga0105239_10000027114 | 151 |
| 51 | 3300015265 | Ga0182005_1001924 | Ga0182005_10019247 | 151 |
| 52 | 3300025913 | Ga0207695_10000441 | Ga0207695_100004414 | 151 |
| 53 | 3300025935 | Ga0207709_10020776 | Ga0207709_100207764 | 151 |
| 54 | 3300031548 | Ga0307408_100022323 | Ga0307408_1000223233 | 151 |
| 55 | 3300031901 | Ga0307406_10699296 | Ga0307406_106992962 | 151 |
| 56 | 3300031911 | Ga0307412_10075722 | Ga0307412_100757224 | 151 |
| 57 | 3300032002 | Ga0307416_100014059 | Ga0307416_1000140594 | 151 |
| 58 | 3300032005 | Ga0307411_10002861 | Ga0307411_100028613 | 151 |
| 59 | 3300048907 | Ga0496104_0014408 | Ga0496104_0014408_3387_3920 | 151 |
| 60 | 3300048908 | Ga0496105_0028149 | Ga0496105_0028149_80_613 | 151 |
| 61 | 3300048919 | Ga0496116_0101306 | Ga0496116_0101306_312_845 | 151 |
| 62 | 3300048920 | Ga0496117_0004983 | Ga0496117_0004983_7370_7903 | 151 |
| 63 | 3300048921 | Ga0496118_0198680 | Ga0496118_0198680_119_652 | 151 |
| 64 | 3300048922 | Ga0496119_0000235 | Ga0496119_0000235_68231_68764 | 151 |
| 65 | 3300048923 | Ga0496120_0000208 | Ga0496120_0000208_31332_31865 | 151 |
| 66 | 3300048924 | Ga0496121_0000480 | Ga0496121_0000480_68769_69302 | 151 |
| 67 | 3300022467 | Ga0224712_10118197 | Ga0224712_101181971 | 152 |
| 68 | 3300003320 | rootH2_10044786 | rootH2_100447862 | 153 |
| 69 | 3300003323 | rootH1_10107485 | rootH1_101074852 | 153 |
| 70 | 3300003781 | Ga0055536_1001746 | Ga0055536_10017465 | 153 |
| 71 | 3300003856 | Ga0058692_1000013 | Ga0058692_100001399 | 153 |
| 72 | 3300005289 | Ga0065704_10281216 | Ga0065704_102812161 | 153 |
| 73 | 3300005456 | Ga0070678_100011851 | Ga0070678_1000118515 | 153 |
| 74 | 3300005548 | Ga0070665_100924316 | Ga0070665_1009243162 | 153 |
| 75 | 3300005985 | Ga0081539_10019407 | Ga0081539_100194072 | 153 |
| 76 | 3300009036 | Ga0105244_10023892 | Ga0105244_100238923 | 153 |
| 77 | 3300013104 | Ga0157370_10096821 | Ga0157370_100968212 | 153 |
| 78 | 3300015261 | Ga0182006_1022419 | Ga0182006_10224192 | 153 |
| 79 | 3300017792 | Ga0163161_10020842 | Ga0163161_100208423 | 153 |
| 80 | 3300025292 | Ga0209676_1000037 | Ga0209676_1000037154 | 153 |
| 81 | 3300025728 | Ga0207655_1033595 | Ga0207655_10335952 | 153 |
| 82 | 3300025935 | Ga0207709_10002407 | Ga0207709_100024077 | 153 |
| 83 | 3300026121 | Ga0207683_10022073 | Ga0207683_100220732 | 153 |
| 84 | 3300027312 | Ga0209371_1000007 | Ga0209371_1000007779 | 153 |
| 85 | 3300027378 | Ga0209981_1030747 | Ga0209981_10307472 | 153 |
| 86 | 3300028379 | Ga0268266_10727213 | Ga0268266_107272132 | 153 |
| 87 | 3300030500 | Ga0268256_1000008 | Ga0268256_1000008172 | 153 |
| 88 | 3300031911 | Ga0307412_10001816 | Ga0307412_100018164 | 153 |
| 89 | 3300032004 | Ga0307414_10055143 | Ga0307414_100551434 | 153 |
| 90 | 3300006186 | Ga0075369_10181360 | Ga0075369_101813602 | 154 |
| 91 | 3300025298 | Ga0209050_1010110 | Ga0209050_10101104 | 154 |
| 92 | 3300025304 | Ga0209257_1034119 | Ga0209257_10341192 | 154 |
| 93 | 3300041999 | Ga0439433_0030390 | Ga0439433_0030390_545_1099 | 154 |
| 94 | 3300048909 | Ga0496106_0411828 | Ga0496106_0411828_63_536 | 154 |
| 95 | 3300048920 | Ga0496117_0008606 | Ga0496117_0008606_1641_2114 | 154 |
| 96 | 3300048921 | Ga0496118_0001013 | Ga0496118_0001013_32857_33330 | 154 |
| 97 | 3300048924 | Ga0496121_0000109 | Ga0496121_0000109_15310_15783 | 154 |
| 98 | 3300048929 | Ga0496126_0136876 | Ga0496126_0136876_934_1407 | 154 |
| 99 | 3300049568 | Ga0501031_0017026 | Ga0501031_0017026_153_677 | 154 |
| 100 | 3300049571 | Ga0501034_0008327 | Ga0501034_0008327_4210_4743 | 154 |
| 101 | 3300030732 | Ga0316176_1043775 | Ga0316176_10437752 | 155 |
| 102 | 3300042006 | Ga0439432_026696 | Ga0439432_026696_493_1041 | 155 |
| 103 | 3300048903 | Ga0496100_0513306 | Ga0496100_0513306_291_824 | 155 |
| 104 | 3300048921 | Ga0496118_0054643 | Ga0496118_0054643_2463_2996 | 155 |
| 105 | 3300048922 | Ga0496119_0010619 | Ga0496119_0010619_6627_7160 | 155 |
| 106 | 3300048923 | Ga0496120_0000282 | Ga0496120_0000282_77656_78189 | 155 |
| 107 | 3300048929 | Ga0496126_0009365 | Ga0496126_0009365_6184_6717 | 155 |
| 108 | 3300048929 | Ga0496126_0235085 | Ga0496126_0235085_29_562 | 155 |
| 109 | 3300049579 | Ga0501043_0818585 | Ga0501043_0818585_32_571 | 155 |
| 110 | 3300049581 | Ga0501047_0201272 | Ga0501047_0201272_32_571 | 155 |
| 111 | 3300049822 | Ga0501035_0349423 | Ga0501035_0349423_13_552 | 155 |
| 112 | 3300049823 | Ga0501044_0019061 | Ga0501044_0019061_1272_1811 | 155 |
| 113 | 3300005546 | Ga0070696_100004017 | Ga0070696_1000040177 | 156 |
| 114 | 3300005614 | Ga0068856_100000524 | Ga0068856_10000052435 | 156 |
| 115 | 3300009177 | Ga0105248_10000980 | Ga0105248_100009802 | 156 |
| 116 | 3300013105 | Ga0157369_10011268 | Ga0157369_100112683 | 156 |
| 117 | 3300026078 | Ga0207702_10003652 | Ga0207702_100036529 | 156 |
| 118 | 3300049570 | Ga0501033_0270756 | Ga0501033_0270756_202_741 | 156 |
| 119 | 3300049571 | Ga0501034_0391135 | Ga0501034_0391135_372_911 | 156 |
| 120 | 3300049572 | Ga0501036_0039262 | Ga0501036_0039262_599_1138 | 156 |
| 121 | 3300049575 | Ga0501039_0578773 | Ga0501039_0578773_207_746 | 156 |
| 122 | 3300049578 | Ga0501042_0627364 | Ga0501042_0627364_31_570 | 156 |
| 123 | 3300049579 | Ga0501043_0697854 | Ga0501043_0697854_32_571 | 156 |
| 124 | 3300049580 | Ga0501046_0130135 | Ga0501046_0130135_599_1138 | 156 |
| 125 | 3300049581 | Ga0501047_0370336 | Ga0501047_0370336_32_571 | 156 |
| 126 | 3300049582 | Ga0501048_0219207 | Ga0501048_0219207_68_607 | 156 |
| 127 | 3300049585 | Ga0501069_0565928 | Ga0501069_0565928_19_558 | 156 |
| 128 | 3300049586 | Ga0501070_0794491 | Ga0501070_0794491_47_586 | 156 |
| 129 | 3300049742 | Ga0501080_0023252 | Ga0501080_0023252_317_856 | 156 |
| 130 | 3300049822 | Ga0501035_0301957 | Ga0501035_0301957_74_613 | 156 |
| 131 | 3300049823 | Ga0501044_0051758 | Ga0501044_0051758_400_939 | 156 |
| 132 | 3300049823 | Ga0501044_0096927 | Ga0501044_0096927_1451_1990 | 156 |
| 133 | 3300014326 | Ga0157380_10530188 | Ga0157380_105301882 | 157 |
| 134 | 3300046507 | Ga0495606_0077532 | Ga0495606_0077532_1513_2001 | 157 |
| 135 | 3300046691 | Ga0495670_0000478 | Ga0495670_0000478_7500_7997 | 157 |
| 136 | iso_pu_bacteria | 2842918807 | 2842920676 | 157 |
| 137 | 3300005458 | Ga0070681_10350114 | Ga0070681_103501141 | 158 |
| 138 | 3300025912 | Ga0207707_10026404 | Ga0207707_100264044 | 158 |
| 139 | 3300025921 | Ga0207652_10131701 | Ga0207652_101317012 | 158 |
| 140 | 3300005355 | Ga0070671_101041160 | Ga0070671_1010411602 | 159 |
| 141 | 3300025893 | Ga0207682_10014641 | Ga0207682_100146412 | 159 |
| 142 | 3300041441 | Ga0451787_725098 | Ga0451787_725098_428_907 | 159 |
| 143 | 3300041463 | Ga0451804_0876128 | Ga0451804_0876128_224_703 | 159 |
| 144 | 3300041512 | Ga0451853_3210631 | Ga0451853_3210631_41_571 | 159 |
| 145 | 3300005364 | Ga0070673_101124699 | Ga0070673_1011246991 | 160 |
| 146 | 3300005539 | Ga0068853_100170552 | Ga0068853_1001705522 | 160 |
| 147 | 3300014497 | Ga0182008_10311799 | Ga0182008_103117991 | 160 |
| 148 | 3300014968 | Ga0157379_10935563 | Ga0157379_109355632 | 160 |
| 149 | 3300020070 | Ga0206356_10491941 | Ga0206356_104919412 | 160 |
| 150 | 3300026023 | Ga0207677_10307158 | Ga0207677_103071582 | 160 |
| 151 | 3300026041 | Ga0207639_10131720 | Ga0207639_101317202 | 160 |
| 152 | 3300032005 | Ga0307411_10558553 | Ga0307411_105585532 | 160 |
| 153 | 3300041512 | Ga0451853_1606826 | Ga0451853_1606826_59_610 | 160 |
| 154 | 3300001979 | JGI24740J21852_10040405 | JGI24740J21852_100404052 | 161 |
| 155 | 3300002705 | JGI25156J39149_1007841 | JGI25156J39149_10078412 | 161 |
| 156 | 3300002741 | JGI25157J39369_1001663 | JGI25157J39369_10016632 | 161 |
| 157 | 3300003763 | Ga0055529_1005753 | Ga0055529_10057533 | 161 |
| 158 | 3300005337 | Ga0070682_100008369 | Ga0070682_1000083695 | 161 |
| 159 | 3300005354 | Ga0070675_100494163 | Ga0070675_1004941631 | 161 |
| 160 | 3300005455 | Ga0070663_100081842 | Ga0070663_1000818422 | 161 |
| 161 | 3300005456 | Ga0070678_100094369 | Ga0070678_1000943693 | 161 |
| 162 | 3300005547 | Ga0070693_100017003 | Ga0070693_1000170032 | 161 |
| 163 | 3300005563 | Ga0068855_100013007 | Ga0068855_1000130077 | 161 |
| 164 | 3300005564 | Ga0070664_100084386 | Ga0070664_1000843862 | 161 |
| 165 | 3300005578 | Ga0068854_100176852 | Ga0068854_1001768522 | 161 |
| 166 | 3300009093 | Ga0105240_10023122 | Ga0105240_100231227 | 161 |
| 167 | 3300009174 | Ga0105241_10252420 | Ga0105241_102524202 | 161 |
| 168 | 3300009545 | Ga0105237_10000036 | Ga0105237_10000036105 | 161 |
| 169 | 3300013104 | Ga0157370_10015409 | Ga0157370_100154095 | 161 |
| 170 | 3300013307 | Ga0157372_10162705 | Ga0157372_101627052 | 161 |
| 171 | 3300020082 | Ga0206353_10172233 | Ga0206353_101722333 | 161 |
| 172 | 3300025246 | Ga0209646_1002196 | Ga0209646_10021963 | 161 |
| 173 | 3300025250 | Ga0209026_1000223 | Ga0209026_100022360 | 161 |
| 174 | 3300025256 | Ga0209759_1014486 | Ga0209759_10144862 | 161 |
| 175 | 3300025272 | Ga0209455_1000430 | Ga0209455_10004306 | 161 |
| 176 | 3300025904 | Ga0207647_10076216 | Ga0207647_100762162 | 161 |
| 177 | 3300025911 | Ga0207654_10128999 | Ga0207654_101289992 | 161 |
| 178 | 3300025913 | Ga0207695_10003481 | Ga0207695_1000348110 | 161 |
| 179 | 3300025914 | Ga0207671_10000135 | Ga0207671_1000013595 | 161 |
| 180 | 3300025924 | Ga0207694_10159608 | Ga0207694_101596082 | 161 |
| 181 | 3300025931 | Ga0207644_10113072 | Ga0207644_101130722 | 161 |
| 182 | 3300025945 | Ga0207679_10124890 | Ga0207679_101248902 | 161 |
| 183 | 3300025949 | Ga0207667_10075026 | Ga0207667_100750262 | 161 |
| 184 | 3300026067 | Ga0207678_10000643 | Ga0207678_100006437 | 161 |
| 185 | 3300026121 | Ga0207683_10020246 | Ga0207683_100202463 | 161 |
| 186 | 3300014326 | Ga0157380_10371759 | Ga0157380_103717592 | 162 |
| 187 | 3300025304 | Ga0209257_1000219 | Ga0209257_100021923 | 162 |
| 188 | 3300042007 | Ga0439449_0000277 | Ga0439449_0000277_278_766 | 162 |
| 189 | 3300046453 | Ga0495627_051825 | Ga0495627_051825_491_982 | 162 |
| 190 | 3300049822 | Ga0501035_0084774 | Ga0501035_0084774_1037_1585 | 162 |
| 191 | 3300053161 | Ga0500634_0000022 | Ga0500634_0000022_37079_37570 | 162 |
| 192 | iso_pu_bacteria | 2593339238 | 2595449018 | 162 |
| 193 | iso_pu_bacteria | 2593339239 | 2595450316 | 162 |
| 194 | iso_pu_bacteria | 2718218334 | 2721025785 | 162 |
| 195 | iso_pu_bacteria | 2738543009 | 2739225661 | 162 |
| 196 | iso_pu_bacteria | 2818991440 | 2819566271 | 162 |
| 197 | iso_pu_bacteria | 2842914999 | 2842917114 | 162 |
| 198 | iso_pu_bacteria | 2884338543 | 2884339122 | 162 |
| 199 | iso_pu_bacteria | 2904463128 | 2904466547 | 162 |
| 200 | iso_pu_bacteria | 2919085039 | 2919086202 | 162 |
| 201 | iso_pu_bacteria | 2919404418 | 2919406861 | 162 |
| 202 | iso_pu_bacteria | 2941471342 | 2941471955 | 162 |
| 203 | iso_pu_bacteria | 2953994433 | 2953995953 | 162 |
| 204 | 3300005367 | Ga0070667_100000085 | Ga0070667_10000008566 | 163 |
| 205 | 3300005455 | Ga0070663_100000045 | Ga0070663_10000004543 | 163 |
| 206 | 3300005539 | Ga0068853_100003376 | Ga0068853_10000337611 | 163 |
| 207 | 3300005842 | Ga0068858_101627569 | Ga0068858_1016275691 | 163 |
| 208 | 3300009101 | Ga0105247_10640208 | Ga0105247_106402082 | 163 |
| 209 | 3300009545 | Ga0105237_10006112 | Ga0105237_100061129 | 163 |
| 210 | 3300009553 | Ga0105249_10000335 | Ga0105249_100003357 | 163 |
| 211 | 3300010375 | Ga0105239_10416482 | Ga0105239_104164822 | 163 |
| 212 | 3300025914 | Ga0207671_10003134 | Ga0207671_100031348 | 163 |
| 213 | 3300025941 | Ga0207711_10004824 | Ga0207711_100048248 | 163 |
| 214 | 3300025961 | Ga0207712_10001764 | Ga0207712_1000176410 | 163 |
| 215 | 3300025986 | Ga0207658_10000032 | Ga0207658_10000032118 | 163 |
| 216 | 3300026041 | Ga0207639_10031649 | Ga0207639_100316493 | 163 |
| 217 | 3300026067 | Ga0207678_10000457 | Ga0207678_1000045727 | 163 |
| 218 | 3300031824 | Ga0307413_11370484 | Ga0307413_113704841 | 163 |
| 219 | 3300032004 | Ga0307414_10155622 | Ga0307414_101556222 | 163 |
| 220 | 3300041456 | Ga0451795_0661403 | Ga0451795_0661403_508_1026 | 163 |
| 221 | 3300047472 | Ga0495686_0000409 | Ga0495686_0000409_65015_65533 | 163 |
| 222 | 3300047472 | Ga0495686_0007418 | Ga0495686_0007418_7030_7563 | 163 |
| 223 | 3300048911 | Ga0496108_1267421 | Ga0496108_1267421_12_506 | 163 |
| 224 | 3300048925 | Ga0496122_0001004 | Ga0496122_0001004_5972_6505 | 163 |
| 225 | 3300048926 | Ga0496123_0000239 | Ga0496123_0000239_6591_7124 | 163 |
| 226 | 3300048927 | Ga0496124_0006332 | Ga0496124_0006332_2404_2901 | 163 |
| 227 | 3300053087 | Ga0500643_006120 | Ga0500643_006120_1223_1759 | 163 |
| 228 | 3300053111 | Ga0500572_070424 | Ga0500572_070424_10_510 | 163 |
| 229 | 3300053120 | Ga0500597_000107 | Ga0500597_000107_13365_13898 | 163 |
| 230 | iso_pu_bacteria | 2734482264 | 2735834242 | 163 |
| 231 | 3300001904 | JGI24736J21556_1001617 | JGI24736J21556_10016174 | 164 |
| 232 | 3300005441 | Ga0070700_100575143 | Ga0070700_1005751431 | 164 |
| 233 | 3300009545 | Ga0105237_10546847 | Ga0105237_105468472 | 164 |
| 234 | 3300013104 | Ga0157370_10019467 | Ga0157370_100194676 | 164 |
| 235 | 3300013104 | Ga0157370_10270060 | Ga0157370_102700603 | 164 |
| 236 | 3300013105 | Ga0157369_10000745 | Ga0157369_1000074512 | 164 |
| 237 | 3300025904 | Ga0207647_10000015 | Ga0207647_10000015106 | 164 |
| 238 | 3300041453 | Ga0451797_1565887 | Ga0451797_1565887_79_579 | 164 |
| 239 | 3300041463 | Ga0451804_1170276 | Ga0451804_1170276_89_595 | 164 |
| 240 | 3300041999 | Ga0439433_0077449 | Ga0439433_0077449_32_529 | 164 |
| 241 | 3300047318 | Ga0495636_0027609 | Ga0495636_0027609_264_797 | 164 |
| 242 | 3300047472 | Ga0495686_0000024 | Ga0495686_0000024_301188_301715 | 164 |
| 243 | 3300048920 | Ga0496117_0073042 | Ga0496117_0073042_1479_2006 | 164 |
| 244 | 3300048921 | Ga0496118_0001607 | Ga0496118_0001607_6543_7070 | 164 |
| 245 | 3300048925 | Ga0496122_0025748 | Ga0496122_0025748_1001_1528 | 164 |
| 246 | 3300048925 | Ga0496122_0346190 | Ga0496122_0346190_76_603 | 164 |
| 247 | 3300048926 | Ga0496123_0029599 | Ga0496123_0029599_1395_1922 | 164 |
| 248 | 3300048928 | Ga0496125_0004406 | Ga0496125_0004406_1001_1528 | 164 |
| 249 | 3300049574 | Ga0501038_0489529 | Ga0501038_0489529_41_538 | 164 |
| 250 | iso_pu_bacteria | 2524614729 | 2525556445 | 164 |
| 251 | iso_pu_bacteria | 2537561836 | 2538833582 | 164 |
| 252 | iso_pu_bacteria | 2627854209 | 2630649674 | 164 |
| 253 | iso_pu_bacteria | 2687453130 | 2687584496 | 164 |
| 254 | iso_pu_bacteria | 2857442823 | 2857445138 | 164 |
| 255 | iso_pu_bacteria | 2895511927 | 2895512449 | 164 |
| 256 | iso_pu_bacteria | 2895522137 | 2895522460 | 164 |
| 257 | iso_pu_bacteria | 2895525241 | 2895525768 | 164 |
| 258 | iso_pu_bacteria | 2987605356 | 2987608591 | 164 |
| 259 | 3300002075 | JGI24738J21930_10001153 | JGI24738J21930_100011532 | 165 |
| 260 | 3300003558 | Ga0006558J51389_1028497 | Ga0006558J51389_10284972 | 165 |
| 261 | 3300003567 | Ga0006554J51385_1022338 | Ga0006554J51385_10223382 | 165 |
| 262 | 3300003578 | Ga0006562J51391_1012709 | Ga0006562J51391_10127095 | 165 |
| 263 | 3300003578 | Ga0006562J51391_1012711 | Ga0006562J51391_10127112 | 165 |
| 264 | 3300003762 | Ga0055542_1012758 | Ga0055542_10127582 | 165 |
| 265 | 3300003775 | Ga0055524_1061261 | Ga0055524_10612611 | 165 |
| 266 | 3300005262 | Ga0065165_1000913 | Ga0065165_10009139 | 165 |
| 267 | 3300005331 | Ga0070670_100022831 | Ga0070670_1000228313 | 165 |
| 268 | 3300005344 | Ga0070661_100214433 | Ga0070661_1002144332 | 165 |
| 269 | 3300005455 | Ga0070663_100194098 | Ga0070663_1001940982 | 165 |
| 270 | 3300005564 | Ga0070664_101231545 | Ga0070664_1012315451 | 165 |
| 271 | 3300005834 | Ga0068851_10625703 | Ga0068851_106257032 | 165 |
| 272 | 3300006186 | Ga0075369_10296146 | Ga0075369_102961462 | 165 |
| 273 | 3300006931 | Ga0097620_100383554 | Ga0097620_1003835542 | 165 |
| 274 | 3300009101 | Ga0105247_10002807 | Ga0105247_100028077 | 165 |
| 275 | 3300010375 | Ga0105239_10202899 | Ga0105239_102028993 | 165 |
| 276 | 3300010375 | Ga0105239_10992781 | Ga0105239_109927812 | 165 |
| 277 | 3300013104 | Ga0157370_10000045 | Ga0157370_10000045101 | 165 |
| 278 | 3300013306 | Ga0163162_10398573 | Ga0163162_103985732 | 165 |
| 279 | 3300014497 | Ga0182008_10004060 | Ga0182008_100040605 | 165 |
| 280 | 3300015261 | Ga0182006_1000479 | Ga0182006_10004797 | 165 |
| 281 | 3300015261 | Ga0182006_1003624 | Ga0182006_10036242 | 165 |
| 282 | 3300015262 | Ga0182007_10033459 | Ga0182007_100334592 | 165 |
| 283 | 3300015265 | Ga0182005_1000113 | Ga0182005_10001137 | 165 |
| 284 | 3300015265 | Ga0182005_1001646 | Ga0182005_10016463 | 165 |
| 285 | 3300015265 | Ga0182005_1006350 | Ga0182005_10063502 | 165 |
| 286 | 3300017792 | Ga0163161_10007925 | Ga0163161_100079254 | 165 |
| 287 | 3300017792 | Ga0163161_10050833 | Ga0163161_100508332 | 165 |
| 288 | 3300017792 | Ga0163161_10480889 | Ga0163161_104808891 | 165 |
| 289 | 3300025226 | Ga0209674_100791 | Ga0209674_1007914 | 165 |
| 290 | 3300025233 | Ga0209437_102834 | Ga0209437_1028344 | 165 |
| 291 | 3300025254 | Ga0209148_1000762 | Ga0209148_100076215 | 165 |
| 292 | 3300025258 | Ga0209129_1001090 | Ga0209129_100109010 | 165 |
| 293 | 3300025299 | Ga0209256_1003863 | Ga0209256_10038639 | 165 |
| 294 | 3300025302 | Ga0207426_1017565 | Ga0207426_10175652 | 165 |
| 295 | 3300025304 | Ga0209257_1026691 | Ga0209257_10266912 | 165 |
| 296 | 3300025900 | Ga0207710_10005864 | Ga0207710_100058643 | 165 |
| 297 | 3300025920 | Ga0207649_10152857 | Ga0207649_101528572 | 165 |
| 298 | 3300025924 | Ga0207694_10025255 | Ga0207694_100252554 | 165 |
| 299 | 3300025925 | Ga0207650_10051036 | Ga0207650_100510362 | 165 |
| 300 | 3300026067 | Ga0207678_10147929 | Ga0207678_101479293 | 165 |
| 301 | 3300031731 | Ga0307405_10070178 | Ga0307405_100701784 | 165 |
| 302 | 3300031824 | Ga0307413_10388326 | Ga0307413_103883262 | 165 |
| 303 | 3300031852 | Ga0307410_10368852 | Ga0307410_103688522 | 165 |
| 304 | 3300031911 | Ga0307412_10000418 | Ga0307412_1000041823 | 165 |
| 305 | 3300032005 | Ga0307411_10165982 | Ga0307411_101659822 | 165 |
| 306 | 3300041404 | Ga0439436_0000007 | Ga0439436_0000007_103684_104211 | 165 |
| 307 | 3300041413 | Ga0439465_0000377 | Ga0439465_0000377_4567_5094 | 165 |
| 308 | 3300042184 | Ga0450908_000033 | Ga0450908_000033_24759_25286 | 165 |
| 309 | 3300044672 | Ga0466982_0010498 | Ga0466982_0010498_820_1347 | 165 |
| 310 | 3300044842 | Ga0466957_0041473 | Ga0466957_0041473_1542_2069 | 165 |
| 311 | 3300046452 | Ga0495617_000196 | Ga0495617_000196_34970_35500 | 165 |
| 312 | 3300046452 | Ga0495617_000318 | Ga0495617_000318_24164_24694 | 165 |
| 313 | 3300046460 | Ga0495638_0004464 | Ga0495638_0004464_7464_7994 | 165 |
| 314 | 3300046460 | Ga0495638_0132268 | Ga0495638_0132268_57_584 | 165 |
| 315 | 3300046471 | Ga0495650_0011065 | Ga0495650_0011065_1994_2521 | 165 |
| 316 | 3300046491 | Ga0495584_0000437 | Ga0495584_0000437_22121_22648 | 165 |
| 317 | 3300046492 | Ga0495585_0001305 | Ga0495585_0001305_2498_3025 | 165 |
| 318 | 3300046492 | Ga0495585_0176303 | Ga0495585_0176303_197_724 | 165 |
| 319 | 3300046501 | Ga0495607_0004515 | Ga0495607_0004515_2739_3266 | 165 |
| 320 | 3300046501 | Ga0495607_0015294 | Ga0495607_0015294_2528_3055 | 165 |
| 321 | 3300046501 | Ga0495607_0016250 | Ga0495607_0016250_4024_4554 | 165 |
| 322 | 3300046506 | Ga0495583_0015969 | Ga0495583_0015969_469_999 | 165 |
| 323 | 3300046507 | Ga0495606_0003552 | Ga0495606_0003552_23_553 | 165 |
| 324 | 3300046507 | Ga0495606_0005186 | Ga0495606_0005186_4582_5109 | 165 |
| 325 | 3300046507 | Ga0495606_0127978 | Ga0495606_0127978_911_1438 | 165 |
| 326 | 3300046512 | Ga0495610_0000971 | Ga0495610_0000971_2688_3215 | 165 |
| 327 | 3300046512 | Ga0495610_0016193 | Ga0495610_0016193_1857_2384 | 165 |
| 328 | 3300046513 | Ga0495616_0001042 | Ga0495616_0001042_17456_17986 | 165 |
| 329 | 3300046515 | Ga0495620_0000846 | Ga0495620_0000846_15860_16390 | 165 |
| 330 | 3300046515 | Ga0495620_0001915 | Ga0495620_0001915_8280_8807 | 165 |
| 331 | 3300046518 | Ga0495631_0000878 | Ga0495631_0000878_1504_2031 | 165 |
| 332 | 3300046518 | Ga0495631_0002764 | Ga0495631_0002764_1909_2436 | 165 |
| 333 | 3300046519 | Ga0495632_0000014 | Ga0495632_0000014_138519_139046 | 165 |
| 334 | 3300046519 | Ga0495632_0005070 | Ga0495632_0005070_8213_8740 | 165 |
| 335 | 3300046519 | Ga0495632_0071240 | Ga0495632_0071240_677_1204 | 165 |
| 336 | 3300046524 | Ga0495648_0002749 | Ga0495648_0002749_82_612 | 165 |
| 337 | 3300046524 | Ga0495648_0053514 | Ga0495648_0053514_481_1008 | 165 |
| 338 | 3300046538 | Ga0495609_0002407 | Ga0495609_0002407_8539_9069 | 165 |
| 339 | 3300046557 | Ga0495622_0068953 | Ga0495622_0068953_281_808 | 165 |
| 340 | 3300046616 | Ga0495668_0002891 | Ga0495668_0002891_6087_6617 | 165 |
| 341 | 3300046648 | Ga0495611_0000003 | Ga0495611_0000003_35772_36302 | 165 |
| 342 | 3300046648 | Ga0495611_0002170 | Ga0495611_0002170_2474_3001 | 165 |
| 343 | 3300046660 | Ga0495625_0000019 | Ga0495625_0000019_270348_270878 | 165 |
| 344 | 3300046660 | Ga0495625_0053094 | Ga0495625_0053094_1579_2106 | 165 |
| 345 | 3300046665 | Ga0495661_0008753 | Ga0495661_0008753_3824_4351 | 165 |
| 346 | 3300046691 | Ga0495670_0002610 | Ga0495670_0002610_6054_6584 | 165 |
| 347 | 3300046691 | Ga0495670_0061678 | Ga0495670_0061678_1289_1816 | 165 |
| 348 | 3300046692 | Ga0495671_0004102 | Ga0495671_0004102_2612_3142 | 165 |
| 349 | 3300046694 | Ga0495649_0030625 | Ga0495649_0030625_1526_2053 | 165 |
| 350 | 3300046794 | Ga0495589_0000408 | Ga0495589_0000408_2598_3128 | 165 |
| 351 | 3300046810 | Ga0495660_0000122 | Ga0495660_0000122_26210_26740 | 165 |
| 352 | 3300046810 | Ga0495660_0000268 | Ga0495660_0000268_23626_24156 | 165 |
| 353 | 3300047323 | Ga0495683_0004599 | Ga0495683_0004599_1244_1771 | 165 |
| 354 | 3300047446 | Ga0495679_000017 | Ga0495679_000017_226911_227441 | 165 |
| 355 | 3300047469 | Ga0495673_0000004 | Ga0495673_0000004_927485_928015 | 165 |
| 356 | 3300047469 | Ga0495673_0000347 | Ga0495673_0000347_14212_14739 | 165 |
| 357 | 3300047469 | Ga0495673_0001675 | Ga0495673_0001675_30_560 | 165 |
| 358 | 3300047470 | Ga0495681_0286146 | Ga0495681_0286146_43_573 | 165 |
| 359 | 3300047472 | Ga0495686_0037336 | Ga0495686_0037336_72_599 | 165 |
| 360 | 3300047472 | Ga0495686_0092833 | Ga0495686_0092833_473_1000 | 165 |
| 361 | 3300047472 | Ga0495686_0117408 | Ga0495686_0117408_813_1343 | 165 |
| 362 | 3300048903 | Ga0496100_0028515 | Ga0496100_0028515_363_890 | 165 |
| 363 | 3300048904 | Ga0496101_0002654 | Ga0496101_0002654_9682_10209 | 165 |
| 364 | 3300048909 | Ga0496106_0010123 | Ga0496106_0010123_2770_3297 | 165 |
| 365 | 3300048920 | Ga0496117_0374621 | Ga0496117_0374621_29_556 | 165 |
| 366 | 3300048921 | Ga0496118_0099230 | Ga0496118_0099230_46_573 | 165 |
| 367 | 3300048921 | Ga0496118_0160364 | Ga0496118_0160364_279_806 | 165 |
| 368 | 3300048922 | Ga0496119_0010179 | Ga0496119_0010179_2567_3094 | 165 |
| 369 | 3300048924 | Ga0496121_0002095 | Ga0496121_0002095_7068_7598 | 165 |
| 370 | 3300048924 | Ga0496121_0018291 | Ga0496121_0018291_6477_7004 | 165 |
| 371 | 3300048924 | Ga0496121_0100282 | Ga0496121_0100282_1632_2162 | 165 |
| 372 | 3300048925 | Ga0496122_0026466 | Ga0496122_0026466_4133_4660 | 165 |
| 373 | 3300048925 | Ga0496122_0177692 | Ga0496122_0177692_362_889 | 165 |
| 374 | 3300048926 | Ga0496123_0003580 | Ga0496123_0003580_15016_15543 | 165 |
| 375 | 3300048926 | Ga0496123_0063283 | Ga0496123_0063283_818_1345 | 165 |
| 376 | 3300048927 | Ga0496124_0001511 | Ga0496124_0001511_2511_3038 | 165 |
| 377 | 3300048927 | Ga0496124_0003515 | Ga0496124_0003515_15236_15763 | 165 |
| 378 | 3300048929 | Ga0496126_0196653 | Ga0496126_0196653_1083_1613 | 165 |
| 379 | 3300049459 | Ga0495678_000496 | Ga0495678_000496_35691_36221 | 165 |
| 380 | 3300049460 | Ga0495682_0005490 | Ga0495682_0005490_880_1410 | 165 |
| 381 | 3300049460 | Ga0495682_0011390 | Ga0495682_0011390_1880_2407 | 165 |
| 382 | 3300049570 | Ga0501033_0000625 | Ga0501033_0000625_19676_20200 | 165 |
| 383 | 3300050516 | nmdc:mga0sz30_40870_c2 | nmdc:mga0sz30_40870_c2_860_1387 | 165 |
| 384 | 3300053087 | Ga0500643_000029 | Ga0500643_000029_35693_36223 | 165 |
| 385 | 3300053103 | Ga0500555_000324 | Ga0500555_000324_17452_17982 | 165 |
| 386 | 3300053160 | Ga0500633_0019341 | Ga0500633_0019341_603_1130 | 165 |
| 387 | 3300053730 | Ga0500645_001107 | Ga0500645_001107_7444_7971 | 165 |
| 388 | 3300005293 | Ga0065715_10170654 | Ga0065715_101706542 | 166 |
| 389 | 3300013308 | Ga0157375_10169912 | Ga0157375_101699123 | 166 |
| 390 | 3300046501 | Ga0495607_0020055 | Ga0495607_0020055_74_592 | 166 |
| 391 | 3300046501 | Ga0495607_0422864 | Ga0495607_0422864_74_592 | 166 |
| 392 | 3300046507 | Ga0495606_0060310 | Ga0495606_0060310_1790_2308 | 166 |
| 393 | 3300046616 | Ga0495668_0413290 | Ga0495668_0413290_54_569 | 166 |
| 394 | 3300046810 | Ga0495660_0188229 | Ga0495660_0188229_175_693 | 166 |
| 395 | 3300053156 | Ga0500622_0211417 | Ga0500622_0211417_20_538 | 166 |
| 396 | iso_pu_bacteria | 2816332141 | 2816518656 | 166 |
| 397 | iso_pu_bacteria | 2842391507 | 2842395553 | 166 |
| 398 | iso_pu_bacteria | 2842780639 | 2842783243 | 166 |
| 399 | iso_pu_bacteria | 2895498888 | 2895499428 | 166 |
| 400 | iso_pu_bacteria | 2961064222 | 2961066570 | 166 |
| 401 | 3300025960 | Ga0207651_10216836 | Ga0207651_102168361 | 167 |
| 402 | 3300035084 | Ga0373928_0179764 | Ga0373928_0179764_14_535 | 167 |
| 403 | 3300048904 | Ga0496101_0449636 | Ga0496101_0449636_140_658 | 167 |
| 404 | 3300048913 | Ga0496110_0756592 | Ga0496110_0756592_305_841 | 167 |
| 405 | 3300049822 | Ga0501035_0009719 | Ga0501035_0009719_1859_2398 | 167 |
| 406 | iso_pu_bacteria | 2643221559 | 2643816764 | 167 |
| 407 | iso_pu_bacteria | 2643221573 | 2643880859 | 167 |
| 408 | iso_pu_bacteria | 2643221586 | 2643938556 | 167 |
| 409 | iso_pu_bacteria | 2643221612 | 2644077697 | 167 |
| 410 | iso_pu_bacteria | 2643221720 | 2644661429 | 167 |
| 411 | iso_pu_bacteria | 2643221727 | 2644693988 | 167 |
| 412 | iso_pu_bacteria | 2643221728 | 2644699510 | 167 |
| 413 | iso_pu_bacteria | 2747842428 | 2747950267 | 167 |
| 414 | iso_pu_bacteria | 2765235840 | 2765580318 | 167 |
| 415 | iso_pu_bacteria | 2874220319 | 2874222990 | 167 |
| 416 | iso_pu_bacteria | 2919089067 | 2919092833 | 167 |
| 417 | iso_pu_bacteria | 2919134579 | 2919137423 | 167 |
| 418 | iso_pu_bacteria | 2928496128 | 2928499189 | 167 |
| 419 | iso_pu_bacteria | 2931380184 | 2931383547 | 167 |
| 420 | iso_pu_bacteria | 2937610967 | 2937614958 | 167 |
| 421 | iso_pu_bacteria | 2939626828 | 2939630267 | 167 |
| 422 | iso_pu_bacteria | 2961047084 | 2961049755 | 167 |
| 423 | 3300002774 | JGI25150J39212_1027756 | JGI25150J39212_10277561 | 168 |
| 424 | 3300003187 | JGI25151J46595_10000116 | JGI25151J46595_1000011642 | 168 |
| 425 | 3300025245 | Ga0207425_1004713 | Ga0207425_10047132 | 168 |
| 426 | 3300025294 | Ga0209025_1000023 | Ga0209025_1000023397 | 168 |
| 427 | 3300025297 | Ga0209758_1008048 | Ga0209758_10080482 | 168 |
| 428 | 3300025931 | Ga0207644_10060876 | Ga0207644_100608762 | 168 |
| 429 | 3300028379 | Ga0268266_10358741 | Ga0268266_103587412 | 168 |
| 430 | 3300031824 | Ga0307413_10050947 | Ga0307413_100509472 | 168 |
| 431 | 3300032004 | Ga0307414_10036736 | Ga0307414_100367364 | 168 |
| 432 | 3300044712 | Ga0453684_0000159 | Ga0453684_0000159_97680_98213 | 168 |
| 433 | 3300045051 | Ga0451576_0000120 | Ga0451576_0000120_97680_98213 | 168 |
| 434 | 3300048927 | Ga0496124_0000218 | Ga0496124_0000218_55431_55967 | 168 |
| 435 | 3300049568 | Ga0501031_0251651 | Ga0501031_0251651_251_775 | 168 |
| 436 | 3300049569 | Ga0501032_0079460 | Ga0501032_0079460_925_1449 | 168 |
| 437 | 3300049570 | Ga0501033_0068791 | Ga0501033_0068791_2055_2579 | 168 |
| 438 | 3300049570 | Ga0501033_0240145 | Ga0501033_0240145_538_1062 | 168 |
| 439 | 3300049571 | Ga0501034_0412529 | Ga0501034_0412529_325_849 | 168 |
| 440 | 3300049574 | Ga0501038_0021584 | Ga0501038_0021584_3565_4089 | 168 |
| 441 | 3300049575 | Ga0501039_0040990 | Ga0501039_0040990_2145_2669 | 168 |
| 442 | 3300049579 | Ga0501043_0178100 | Ga0501043_0178100_924_1448 | 168 |
| 443 | 3300049581 | Ga0501047_0400592 | Ga0501047_0400592_162_686 | 168 |
| 444 | 3300049586 | Ga0501070_0518607 | Ga0501070_0518607_17_541 | 168 |
| 445 | 3300049822 | Ga0501035_0076487 | Ga0501035_0076487_669_1193 | 168 |
| 446 | 3300049823 | Ga0501044_0037487 | Ga0501044_0037487_348_872 | 168 |
| 447 | 3300049823 | Ga0501044_0277800 | Ga0501044_0277800_664_1188 | 168 |
| 448 | iso_pu_bacteria | 2576861471 | 2578457177 | 168 |
| 449 | iso_pu_bacteria | 2747842501 | 2748019521 | 168 |
| 450 | iso_pu_bacteria | 2842757796 | 2842759151 | 168 |
| 451 | iso_pu_bacteria | 2852649853 | 2852652312 | 168 |
| 452 | iso_pu_bacteria | 2939589442 | 2939589636 | 168 |
| 453 | iso_pu_bacteria | 2939622612 | 2939624300 | 168 |
| 454 | iso_pu_bacteria | 2941475908 | 2941478928 | 168 |
| 455 | iso_pu_bacteria | 2974307012 | 2974307809 | 168 |
| 456 | iso_pu_bacteria | 2977247770 | 2977248528 | 168 |
| 457 | iso_pu_bacteria | 2984514374 | 2984516985 | 168 |
| 458 | 3300042007 | Ga0439449_0009760 | Ga0439449_0009760_1074_1616 | 169 |
| 459 | 3300045836 | Ga0466958_0509475 | Ga0466958_0509475_71_610 | 169 |
| 460 | 3300047472 | Ga0495686_0016046 | Ga0495686_0016046_2513_3040 | 169 |
| 461 | 3300049568 | Ga0501031_0005288 | Ga0501031_0005288_4077_4610 | 169 |
| 462 | 3300049569 | Ga0501032_0034586 | Ga0501032_0034586_1055_1588 | 169 |
| 463 | 3300049570 | Ga0501033_0244952 | Ga0501033_0244952_74_607 | 169 |
| 464 | 3300049571 | Ga0501034_0020621 | Ga0501034_0020621_3244_3777 | 169 |
| 465 | 3300049572 | Ga0501036_0014053 | Ga0501036_0014053_3166_3699 | 169 |
| 466 | 3300049573 | Ga0501037_0001197 | Ga0501037_0001197_16944_17477 | 169 |
| 467 | 3300049574 | Ga0501038_0001241 | Ga0501038_0001241_14843_15376 | 169 |
| 468 | 3300049575 | Ga0501039_0020714 | Ga0501039_0020714_2431_2964 | 169 |
| 469 | 3300049579 | Ga0501043_0053496 | Ga0501043_0053496_1213_1746 | 169 |
| 470 | 3300049581 | Ga0501047_0055064 | Ga0501047_0055064_760_1293 | 169 |
| 471 | 3300049584 | Ga0501068_0072238 | Ga0501068_0072238_1042_1575 | 169 |
| 472 | 3300049586 | Ga0501070_0271621 | Ga0501070_0271621_255_788 | 169 |
| 473 | 3300049589 | Ga0501073_0031382 | Ga0501073_0031382_3019_3552 | 169 |
| 474 | 3300049741 | Ga0501079_0166991 | Ga0501079_0166991_192_725 | 169 |
| 475 | 3300049742 | Ga0501080_0002129 | Ga0501080_0002129_4384_4917 | 169 |
| 476 | 3300049822 | Ga0501035_0002247 | Ga0501035_0002247_3214_3747 | 169 |
| 477 | 3300049823 | Ga0501044_0002685 | Ga0501044_0002685_16781_17314 | 169 |
| 478 | iso_pu_bacteria | 2571042365 | 2572254414 | 169 |
| 479 | iso_pu_bacteria | 2643221695 | 2644528286 | 169 |
| 480 | iso_pu_bacteria | 2941489479 | 2941493088 | 169 |
| 481 | iso_pu_bacteria | 8003014200 | 8003016991 | 169 |
| 482 | 3300005327 | Ga0070658_10709156 | Ga0070658_107091561 | 170 |
| 483 | 3300005336 | Ga0070680_100389732 | Ga0070680_1003897322 | 170 |
| 484 | 3300005339 | Ga0070660_100089225 | Ga0070660_1000892252 | 170 |
| 485 | 3300005344 | Ga0070661_100330707 | Ga0070661_1003307071 | 170 |
| 486 | 3300005366 | Ga0070659_100144222 | Ga0070659_1001442222 | 170 |
| 487 | 3300005458 | Ga0070681_10336561 | Ga0070681_103365612 | 170 |
| 488 | 3300005530 | Ga0070679_100058369 | Ga0070679_1000583692 | 170 |
| 489 | 3300005563 | Ga0068855_101271375 | Ga0068855_1012713752 | 170 |
| 490 | 3300005834 | Ga0068851_10354686 | Ga0068851_103546862 | 170 |
| 491 | 3300006051 | Ga0075364_10000775 | Ga0075364_1000077510 | 170 |
| 492 | 3300013100 | Ga0157373_10073514 | Ga0157373_100735142 | 170 |
| 493 | 3300013102 | Ga0157371_10079356 | Ga0157371_100793562 | 170 |
| 494 | 3300013105 | Ga0157369_10048745 | Ga0157369_100487452 | 170 |
| 495 | 3300013307 | Ga0157372_10021401 | Ga0157372_100214014 | 170 |
| 496 | 3300025909 | Ga0207705_10108347 | Ga0207705_101083472 | 170 |
| 497 | 3300025912 | Ga0207707_10369250 | Ga0207707_103692502 | 170 |
| 498 | 3300025919 | Ga0207657_10003190 | Ga0207657_100031905 | 170 |
| 499 | 3300025919 | Ga0207657_10351503 | Ga0207657_103515032 | 170 |
| 500 | 3300025921 | Ga0207652_10494603 | Ga0207652_104946032 | 170 |
| 501 | 3300025932 | Ga0207690_10250292 | Ga0207690_102502922 | 170 |
| 502 | 3300025933 | Ga0207706_10589886 | Ga0207706_105898862 | 170 |
| 503 | 3300025949 | Ga0207667_10263378 | Ga0207667_102633782 | 170 |
| 504 | 3300025949 | Ga0207667_11129593 | Ga0207667_111295932 | 170 |
| 505 | 3300037312 | Ga0395899_0017129 | Ga0395899_0017129_708_1259 | 170 |
| 506 | 3300037418 | Ga0395900_0042677 | Ga0395900_0042677_717_1250 | 170 |
| 507 | 3300037466 | Ga0395898_0176943 | Ga0395898_0176943_1104_1637 | 170 |
| 508 | 3300037471 | Ga0395905_0000337 | Ga0395905_0000337_34003_34554 | 170 |
| 509 | 3300037471 | Ga0395905_0376645 | Ga0395905_0376645_87_620 | 170 |
| 510 | 3300038443 | Ga0395901_0578455 | Ga0395901_0578455_524_1057 | 170 |
| 511 | 3300042012 | Ga0439455_0043457 | Ga0439455_0043457_510_1043 | 170 |
| 512 | 3300048904 | Ga0496101_0044626 | Ga0496101_0044626_2306_2857 | 170 |
| 513 | 3300048912 | Ga0496109_0592418 | Ga0496109_0592418_98_634 | 170 |
| 514 | 3300048916 | Ga0496113_0105163 | Ga0496113_0105163_278_829 | 170 |
| 515 | 3300049571 | Ga0501034_0501945 | Ga0501034_0501945_119_670 | 170 |
| 516 | 3300050491 | nmdc:mga00v17_1287_c1 | nmdc:mga00v17_1287_c1_1738_2289 | 170 |
| 517 | iso_pu_bacteria | 2643221581 | 2643914929 | 170 |
| 518 | iso_pu_bacteria | 2852684882 | 2852686958 | 170 |
| 519 | iso_pu_bacteria | 2919675420 | 2919676350 | 170 |
| 520 | iso_pu_bacteria | 2929195423 | 2929196502 | 170 |
| 521 | iso_pu_bacteria | 8021622325 | 8021626250 | 170 |
| 522 | iso_pu_bacteria | 8021626552 | 8021627691 | 170 |
| 523 | iso_pu_bacteria | 8021648035 | 8021651299 | 170 |
| 524 | 3300002773 | JGI25152J39213_1000069 | JGI25152J39213_100006928 | 171 |
| 525 | 3300002774 | JGI25150J39212_1000214 | JGI25150J39212_100021424 | 171 |
| 526 | 3300002774 | JGI25150J39212_1000407 | JGI25150J39212_100040715 | 171 |
| 527 | 3300003187 | JGI25151J46595_10000105 | JGI25151J46595_1000010553 | 171 |
| 528 | 3300003215 | JGI25153J46596_10000077 | JGI25153J46596_1000007743 | 171 |
| 529 | 3300003771 | Ga0055526_1003098 | Ga0055526_10030985 | 171 |
| 530 | 3300003773 | Ga0055537_1000812 | Ga0055537_10008126 | 171 |
| 531 | 3300003775 | Ga0055524_1016948 | Ga0055524_10169482 | 171 |
| 532 | 3300003784 | Ga0055534_1000154 | Ga0055534_100015410 | 171 |
| 533 | 3300003790 | Ga0055528_1001412 | Ga0055528_10014122 | 171 |
| 534 | 3300003790 | Ga0055528_1002336 | Ga0055528_10023369 | 171 |
| 535 | 3300003794 | Ga0055531_10002804 | Ga0055531_1000280410 | 171 |
| 536 | 3300005331 | Ga0070670_100073464 | Ga0070670_1000734642 | 171 |
| 537 | 3300005347 | Ga0070668_100070732 | Ga0070668_1000707321 | 171 |
| 538 | 3300005347 | Ga0070668_101260099 | Ga0070668_1012600992 | 171 |
| 539 | 3300005353 | Ga0070669_100054658 | Ga0070669_1000546584 | 171 |
| 540 | 3300005356 | Ga0070674_100053729 | Ga0070674_1000537293 | 171 |
| 541 | 3300005459 | Ga0068867_100047934 | Ga0068867_1000479343 | 171 |
| 542 | 3300005543 | Ga0070672_100057956 | Ga0070672_1000579564 | 171 |
| 543 | 3300005548 | Ga0070665_100071908 | Ga0070665_1000719082 | 171 |
| 544 | 3300006038 | Ga0075365_10193304 | Ga0075365_101933042 | 171 |
| 545 | 3300006051 | Ga0075364_10037648 | Ga0075364_100376484 | 171 |
| 546 | 3300006051 | Ga0075364_10577264 | Ga0075364_105772641 | 171 |
| 547 | 3300006353 | Ga0075370_10085036 | Ga0075370_100850362 | 171 |
| 548 | 3300009011 | Ga0105251_10019456 | Ga0105251_100194562 | 171 |
| 549 | 3300009036 | Ga0105244_10038830 | Ga0105244_100388302 | 171 |
| 550 | 3300009036 | Ga0105244_10104717 | Ga0105244_101047172 | 171 |
| 551 | 3300009148 | Ga0105243_10207021 | Ga0105243_102070212 | 171 |
| 552 | 3300013100 | Ga0157373_10152758 | Ga0157373_101527582 | 171 |
| 553 | 3300013100 | Ga0157373_10377225 | Ga0157373_103772252 | 171 |
| 554 | 3300013102 | Ga0157371_10000184 | Ga0157371_1000018470 | 171 |
| 555 | 3300013102 | Ga0157371_10190080 | Ga0157371_101900802 | 171 |
| 556 | 3300013102 | Ga0157371_10678202 | Ga0157371_106782022 | 171 |
| 557 | 3300013104 | Ga0157370_10001564 | Ga0157370_100015649 | 171 |
| 558 | 3300013104 | Ga0157370_10366785 | Ga0157370_103667852 | 171 |
| 559 | 3300013104 | Ga0157370_10435598 | Ga0157370_104355982 | 171 |
| 560 | 3300013306 | Ga0163162_10325108 | Ga0163162_103251083 | 171 |
| 561 | 3300013308 | Ga0157375_10140509 | Ga0157375_101405092 | 171 |
| 562 | 3300014326 | Ga0157380_10098081 | Ga0157380_100980813 | 171 |
| 563 | 3300014497 | Ga0182008_10023563 | Ga0182008_100235631 | 171 |
| 564 | 3300014497 | Ga0182008_10037026 | Ga0182008_100370262 | 171 |
| 565 | 3300015262 | Ga0182007_10000219 | Ga0182007_1000021925 | 171 |
| 566 | 3300015265 | Ga0182005_1000213 | Ga0182005_10002139 | 171 |
| 567 | 3300015689 | Ga0183360_10001 | Ga0183360_1000134 | 171 |
| 568 | 3300017792 | Ga0163161_10118324 | Ga0163161_101183243 | 171 |
| 569 | 3300025245 | Ga0207425_1000045 | Ga0207425_100004552 | 171 |
| 570 | 3300025258 | Ga0209129_1000057 | Ga0209129_100005777 | 171 |
| 571 | 3300025263 | Ga0209565_1000023 | Ga0209565_100002370 | 171 |
| 572 | 3300025263 | Ga0209565_1019738 | Ga0209565_10197382 | 171 |
| 573 | 3300025273 | Ga0209673_1000047 | Ga0209673_1000047243 | 171 |
| 574 | 3300025284 | Ga0209130_1002629 | Ga0209130_10026294 | 171 |
| 575 | 3300025291 | Ga0209675_1000016 | Ga0209675_1000016176 | 171 |
| 576 | 3300025292 | Ga0209676_1000160 | Ga0209676_100016085 | 171 |
| 577 | 3300025294 | Ga0209025_1000013 | Ga0209025_1000013144 | 171 |
| 578 | 3300025294 | Ga0209025_1002654 | Ga0209025_100265410 | 171 |
| 579 | 3300025295 | Ga0209564_1000194 | Ga0209564_100019435 | 171 |
| 580 | 3300025297 | Ga0209758_1000014 | Ga0209758_1000014144 | 171 |
| 581 | 3300025298 | Ga0209050_1000352 | Ga0209050_100035258 | 171 |
| 582 | 3300025299 | Ga0209256_1005406 | Ga0209256_10054067 | 171 |
| 583 | 3300025303 | Ga0209051_1002836 | Ga0209051_10028365 | 171 |
| 584 | 3300025304 | Ga0209257_1000177 | Ga0209257_100017758 | 171 |
| 585 | 3300025304 | Ga0209257_1000383 | Ga0209257_10003834 | 171 |
| 586 | 3300025304 | Ga0209257_1066742 | Ga0209257_10667422 | 171 |
| 587 | 3300025735 | Ga0207713_1066409 | Ga0207713_10664092 | 171 |
| 588 | 3300025923 | Ga0207681_10041006 | Ga0207681_100410064 | 171 |
| 589 | 3300025925 | Ga0207650_10048024 | Ga0207650_100480242 | 171 |
| 590 | 3300025937 | Ga0207669_10045553 | Ga0207669_100455533 | 171 |
| 591 | 3300025940 | Ga0207691_10019809 | Ga0207691_100198095 | 171 |
| 592 | 3300025972 | Ga0207668_10023924 | Ga0207668_100239242 | 171 |
| 593 | 3300025986 | Ga0207658_10244527 | Ga0207658_102445271 | 171 |
| 594 | 3300026089 | Ga0207648_10208557 | Ga0207648_102085573 | 171 |
| 595 | 3300028379 | Ga0268266_10124490 | Ga0268266_101244901 | 171 |
| 596 | 3300030732 | Ga0316176_1036603 | Ga0316176_10366033 | 171 |
| 597 | 3300030742 | Ga0316183_1159014 | Ga0316183_11590143 | 171 |
| 598 | 3300030744 | Ga0316181_1256419 | Ga0316181_12564192 | 171 |
| 599 | 3300032002 | Ga0307416_101238140 | Ga0307416_1012381401 | 171 |
| 600 | 3300032004 | Ga0307414_10260251 | Ga0307414_102602512 | 171 |
| 601 | 3300032005 | Ga0307411_10203128 | Ga0307411_102031282 | 171 |
| 602 | 3300038705 | Ga0237819_00177 | Ga0237819_00177_2834_3367 | 171 |
| 603 | 3300041443 | Ga0451789_0245027 | Ga0451789_0245027_117_653 | 171 |
| 604 | 3300041509 | Ga0451843_0193634 | Ga0451843_0193634_546_1079 | 171 |
| 605 | 3300041512 | Ga0451853_4086402 | Ga0451853_4086402_190_726 | 171 |
| 606 | 3300041999 | Ga0439433_0026674 | Ga0439433_0026674_592_1140 | 171 |
| 607 | 3300046453 | Ga0495627_010605 | Ga0495627_010605_955_1488 | 171 |
| 608 | 3300046453 | Ga0495627_032692 | Ga0495627_032692_271_804 | 171 |
| 609 | 3300046458 | Ga0495591_034329 | Ga0495591_034329_228_761 | 171 |
| 610 | 3300046460 | Ga0495638_0002849 | Ga0495638_0002849_10077_10610 | 171 |
| 611 | 3300046512 | Ga0495610_0015601 | Ga0495610_0015601_1653_2189 | 171 |
| 612 | 3300046518 | Ga0495631_0010947 | Ga0495631_0010947_1659_2195 | 171 |
| 613 | 3300046522 | Ga0495643_0002141 | Ga0495643_0002141_8170_8706 | 171 |
| 614 | 3300046525 | Ga0495663_0001801 | Ga0495663_0001801_3081_3614 | 171 |
| 615 | 3300046525 | Ga0495663_0009609 | Ga0495663_0009609_662_1195 | 171 |
| 616 | 3300046525 | Ga0495663_0228027 | Ga0495663_0228027_50_586 | 171 |
| 617 | 3300046537 | Ga0495598_0001908 | Ga0495598_0001908_1638_2183 | 171 |
| 618 | 3300046538 | Ga0495609_0223113 | Ga0495609_0223113_133_666 | 171 |
| 619 | 3300046539 | Ga0495621_0044186 | Ga0495621_0044186_546_1091 | 171 |
| 620 | 3300046558 | Ga0495633_0023836 | Ga0495633_0023836_691_1224 | 171 |
| 621 | 3300046558 | Ga0495633_0191777 | Ga0495633_0191777_158_691 | 171 |
| 622 | 3300046660 | Ga0495625_0107868 | Ga0495625_0107868_782_1318 | 171 |
| 623 | 3300046810 | Ga0495660_0047807 | Ga0495660_0047807_613_1149 | 171 |
| 624 | 3300047320 | Ga0495672_0001225 | Ga0495672_0001225_11829_12365 | 171 |
| 625 | 3300047472 | Ga0495686_0004194 | Ga0495686_0004194_9907_10443 | 171 |
| 626 | 3300048907 | Ga0496104_0148328 | Ga0496104_0148328_542_1078 | 171 |
| 627 | 3300048908 | Ga0496105_0045875 | Ga0496105_0045875_2055_2591 | 171 |
| 628 | 3300048911 | Ga0496108_0832326 | Ga0496108_0832326_145_690 | 171 |
| 629 | 3300048919 | Ga0496116_0019218 | Ga0496116_0019218_1713_2249 | 171 |
| 630 | 3300048919 | Ga0496116_0064796 | Ga0496116_0064796_1176_1712 | 171 |
| 631 | 3300048920 | Ga0496117_0001871 | Ga0496117_0001871_9787_10320 | 171 |
| 632 | 3300048920 | Ga0496117_0004092 | Ga0496117_0004092_10383_10916 | 171 |
| 633 | 3300048920 | Ga0496117_0024752 | Ga0496117_0024752_2534_3067 | 171 |
| 634 | 3300048920 | Ga0496117_0268874 | Ga0496117_0268874_256_792 | 171 |
| 635 | 3300048921 | Ga0496118_0002036 | Ga0496118_0002036_10025_10558 | 171 |
| 636 | 3300048921 | Ga0496118_0035718 | Ga0496118_0035718_1738_2271 | 171 |
| 637 | 3300048921 | Ga0496118_0049568 | Ga0496118_0049568_1104_1640 | 171 |
| 638 | 3300048921 | Ga0496118_0175261 | Ga0496118_0175261_211_747 | 171 |
| 639 | 3300048922 | Ga0496119_0003558 | Ga0496119_0003558_7093_7629 | 171 |
| 640 | 3300048923 | Ga0496120_0000970 | Ga0496120_0000970_29877_30413 | 171 |
| 641 | 3300048924 | Ga0496121_0000752 | Ga0496121_0000752_49160_49702 | 171 |
| 642 | 3300048924 | Ga0496121_0007074 | Ga0496121_0007074_9920_10453 | 171 |
| 643 | 3300048924 | Ga0496121_0017014 | Ga0496121_0017014_6526_7062 | 171 |
| 644 | 3300048924 | Ga0496121_0079150 | Ga0496121_0079150_619_1155 | 171 |
| 645 | 3300048925 | Ga0496122_0009282 | Ga0496122_0009282_159_695 | 171 |
| 646 | 3300048926 | Ga0496123_0044731 | Ga0496123_0044731_227_760 | 171 |
| 647 | 3300048926 | Ga0496123_0057633 | Ga0496123_0057633_1767_2300 | 171 |
| 648 | 3300048926 | Ga0496123_0062757 | Ga0496123_0062757_1730_2266 | 171 |
| 649 | 3300048927 | Ga0496124_0001341 | Ga0496124_0001341_20895_21431 | 171 |
| 650 | 3300048927 | Ga0496124_0004411 | Ga0496124_0004411_13281_13817 | 171 |
| 651 | 3300048927 | Ga0496124_0007149 | Ga0496124_0007149_2193_2726 | 171 |
| 652 | 3300048927 | Ga0496124_0008850 | Ga0496124_0008850_9459_9995 | 171 |
| 653 | 3300048927 | Ga0496124_0077460 | Ga0496124_0077460_1921_2454 | 171 |
| 654 | 3300048927 | Ga0496124_0134881 | Ga0496124_0134881_41_574 | 171 |
| 655 | 3300048927 | Ga0496124_0271211 | Ga0496124_0271211_41_574 | 171 |
| 656 | 3300048928 | Ga0496125_0005552 | Ga0496125_0005552_11320_11856 | 171 |
| 657 | 3300048928 | Ga0496125_0005750 | Ga0496125_0005750_3201_3734 | 171 |
| 658 | 3300048928 | Ga0496125_0006890 | Ga0496125_0006890_1472_2008 | 171 |
| 659 | 3300048928 | Ga0496125_0044519 | Ga0496125_0044519_2468_3004 | 171 |
| 660 | 3300048928 | Ga0496125_0056447 | Ga0496125_0056447_1569_2105 | 171 |
| 661 | 3300048929 | Ga0496126_0005914 | Ga0496126_0005914_3224_3760 | 171 |
| 662 | 3300048929 | Ga0496126_0061724 | Ga0496126_0061724_1103_1636 | 171 |
| 663 | 3300048929 | Ga0496126_0149731 | Ga0496126_0149731_1327_1860 | 171 |
| 664 | 3300050490 | nmdc:mga03n38_197259_c1 | nmdc:mga03n38_197259_c1_299_835 | 171 |
| 665 | 3300050491 | nmdc:mga00v17_113447_c1 | nmdc:mga00v17_113447_c1_152_685 | 171 |
| 666 | 3300050491 | nmdc:mga00v17_129755_c1 | nmdc:mga00v17_129755_c1_753_1289 | 171 |
| 667 | 3300050491 | nmdc:mga00v17_18002_c1 | nmdc:mga00v17_18002_c1_1809_2345 | 171 |
| 668 | 3300050492 | nmdc:mga0yw44_122802_c1 | nmdc:mga0yw44_122802_c1_23_556 | 171 |
| 669 | 3300050492 | nmdc:mga0yw44_307442_c1 | nmdc:mga0yw44_307442_c1_306_842 | 171 |
| 670 | 3300050496 | nmdc:mga07m45_127220_c1 | nmdc:mga07m45_127220_c1_362_898 | 171 |
| 671 | 3300053128 | Ga0500626_103771 | Ga0500626_103771_297_830 | 171 |
| 672 | iso_pu_bacteria | 2643221579 | 2643905242 | 171 |
| 673 | iso_pu_bacteria | 2643221593 | 2643973780 | 171 |
| 674 | iso_pu_bacteria | 2919513703 | 2919515029 | 171 |
| 675 | iso_pu_bacteria | 2923516293 | 2923517356 | 171 |
| 676 | iso_pu_bacteria | 8002869464 | 8002871102 | 171 |
| 677 | 3300003322 | rootL2_10073749 | rootL2_100737492 | 172 |
| 678 | 3300003781 | Ga0055536_1006277 | Ga0055536_10062774 | 172 |
| 679 | 3300003784 | Ga0055534_1011218 | Ga0055534_10112182 | 172 |
| 680 | 3300003791 | Ga0055530_10001477 | Ga0055530_100014774 | 172 |
| 681 | 3300003794 | Ga0055531_10013393 | Ga0055531_100133932 | 172 |
| 682 | 3300003794 | Ga0055531_10017692 | Ga0055531_100176922 | 172 |
| 683 | 3300003794 | Ga0055531_10030559 | Ga0055531_100305592 | 172 |
| 684 | 3300005337 | Ga0070682_100105533 | Ga0070682_1001055332 | 172 |
| 685 | 3300005347 | Ga0070668_100203858 | Ga0070668_1002038582 | 172 |
| 686 | 3300006051 | Ga0075364_10010917 | Ga0075364_100109174 | 172 |
| 687 | 3300009993 | Ga0105028_107380 | Ga0105028_1073802 | 172 |
| 688 | 3300013102 | Ga0157371_10120730 | Ga0157371_101207302 | 172 |
| 689 | 3300013307 | Ga0157372_10787582 | Ga0157372_107875822 | 172 |
| 690 | 3300025273 | Ga0209673_1029483 | Ga0209673_10294832 | 172 |
| 691 | 3300025284 | Ga0209130_1024994 | Ga0209130_10249942 | 172 |
| 692 | 3300025291 | Ga0209675_1008269 | Ga0209675_10082691 | 172 |
| 693 | 3300025291 | Ga0209675_1046930 | Ga0209675_10469301 | 172 |
| 694 | 3300025292 | Ga0209676_1000027 | Ga0209676_1000027378 | 172 |
| 695 | 3300025292 | Ga0209676_1000280 | Ga0209676_100028026 | 172 |
| 696 | 3300025292 | Ga0209676_1002509 | Ga0209676_10025098 | 172 |
| 697 | 3300025292 | Ga0209676_1003026 | Ga0209676_10030267 | 172 |
| 698 | 3300025294 | Ga0209025_1028791 | Ga0209025_10287912 | 172 |
| 699 | 3300025294 | Ga0209025_1030183 | Ga0209025_10301834 | 172 |
| 700 | 3300025295 | Ga0209564_1004607 | Ga0209564_10046077 | 172 |
| 701 | 3300025298 | Ga0209050_1000714 | Ga0209050_100071440 | 172 |
| 702 | 3300025298 | Ga0209050_1000833 | Ga0209050_100083316 | 172 |
| 703 | 3300025298 | Ga0209050_1026372 | Ga0209050_10263722 | 172 |
| 704 | 3300025299 | Ga0209256_1003154 | Ga0209256_10031544 | 172 |
| 705 | 3300025299 | Ga0209256_1020798 | Ga0209256_10207981 | 172 |
| 706 | 3300025299 | Ga0209256_1020801 | Ga0209256_10208011 | 172 |
| 707 | 3300025303 | Ga0209051_1006389 | Ga0209051_10063892 | 172 |
| 708 | 3300025304 | Ga0209257_1000198 | Ga0209257_100019845 | 172 |
| 709 | 3300025304 | Ga0209257_1003088 | Ga0209257_10030881 | 172 |
| 710 | 3300025304 | Ga0209257_1003813 | Ga0209257_10038139 | 172 |
| 711 | 3300025304 | Ga0209257_1007629 | Ga0209257_10076293 | 172 |
| 712 | 3300027378 | Ga0209981_1027589 | Ga0209981_10275892 | 172 |
| 713 | 3300027424 | Ga0209984_1003224 | Ga0209984_10032243 | 172 |
| 714 | 3300027462 | Ga0210000_1003909 | Ga0210000_10039092 | 172 |
| 715 | 3300027471 | Ga0209995_1000902 | Ga0209995_10009025 | 172 |
| 716 | 3300027543 | Ga0209999_1000249 | Ga0209999_10002493 | 172 |
| 717 | 3300027552 | Ga0209982_1002809 | Ga0209982_10028092 | 172 |
| 718 | 3300027614 | Ga0209970_1002517 | Ga0209970_10025172 | 172 |
| 719 | 3300027665 | Ga0209983_1006804 | Ga0209983_10068042 | 172 |
| 720 | 3300027682 | Ga0209971_1000743 | Ga0209971_10007435 | 172 |
| 721 | 3300027876 | Ga0209974_10034122 | Ga0209974_100341222 | 172 |
| 722 | 3300032004 | Ga0307414_10641852 | Ga0307414_106418522 | 172 |
| 723 | 3300041413 | Ga0439465_0017038 | Ga0439465_0017038_1497_2051 | 172 |
| 724 | 3300042006 | Ga0439432_015910 | Ga0439432_015910_1599_2153 | 172 |
| 725 | 3300042007 | Ga0439449_0050465 | Ga0439449_0050465_761_1315 | 172 |
| 726 | 3300042010 | Ga0439452_009962 | Ga0439452_009962_1488_2042 | 172 |
| 727 | 3300046691 | Ga0495670_0380437 | Ga0495670_0380437_113_667 | 172 |
| 728 | 3300047318 | Ga0495636_0021723 | Ga0495636_0021723_434_988 | 172 |
| 729 | 3300047445 | Ga0495677_0104255 | Ga0495677_0104255_471_1004 | 172 |
| 730 | 3300048913 | Ga0496110_0860118 | Ga0496110_0860118_44_577 | 172 |
| 731 | 3300049579 | Ga0501043_0020013 | Ga0501043_0020013_1704_2255 | 172 |
| 732 | 3300049824 | Ga0501045_0279450 | Ga0501045_0279450_298_852 | 172 |
| 733 | 3300050491 | nmdc:mga00v17_56465_c1 | nmdc:mga00v17_56465_c1_1543_2085 | 172 |
| 734 | iso_pu_bacteria | 2995948881 | 2995953169 | 172 |
| 735 | 3300005331 | Ga0070670_100046378 | Ga0070670_1000463782 | 173 |
| 736 | 3300005344 | Ga0070661_100491765 | Ga0070661_1004917652 | 173 |
| 737 | 3300005353 | Ga0070669_101051101 | Ga0070669_1010511011 | 173 |
| 738 | 3300005355 | Ga0070671_100010249 | Ga0070671_1000102496 | 173 |
| 739 | 3300005364 | Ga0070673_100426619 | Ga0070673_1004266192 | 173 |
| 740 | 3300005841 | Ga0068863_100123053 | Ga0068863_1001230533 | 173 |
| 741 | 3300012482 | Ga0157318_1002656 | Ga0157318_10026562 | 173 |
| 742 | 3300012491 | Ga0157329_1001393 | Ga0157329_10013932 | 173 |
| 743 | 3300012503 | Ga0157313_1002762 | Ga0157313_10027622 | 173 |
| 744 | 3300012512 | Ga0157327_1000513 | Ga0157327_10005132 | 173 |
| 745 | 3300025923 | Ga0207681_10690832 | Ga0207681_106908322 | 173 |
| 746 | 3300025925 | Ga0207650_10047972 | Ga0207650_100479722 | 173 |
| 747 | 3300026088 | Ga0207641_10243464 | Ga0207641_102434642 | 173 |
| 748 | 3300026095 | Ga0207676_10065408 | Ga0207676_100654082 | 173 |
| 749 | 3300031548 | Ga0307408_101240522 | Ga0307408_1012405222 | 173 |
| 750 | 3300031824 | Ga0307413_10001208 | Ga0307413_100012084 | 173 |
| 751 | 3300031852 | Ga0307410_10149155 | Ga0307410_101491552 | 173 |
| 752 | 3300031901 | Ga0307406_10312628 | Ga0307406_103126282 | 173 |
| 753 | 3300031911 | Ga0307412_10031352 | Ga0307412_100313522 | 173 |
| 754 | 3300031911 | Ga0307412_10091960 | Ga0307412_100919602 | 173 |
| 755 | 3300032004 | Ga0307414_10116249 | Ga0307414_101162492 | 173 |
| 756 | 3300032004 | Ga0307414_10676518 | Ga0307414_106765182 | 173 |
| 757 | 3300032005 | Ga0307411_10506159 | Ga0307411_105061592 | 173 |
| 758 | 3300037471 | Ga0395905_0565449 | Ga0395905_0565449_462_1019 | 173 |
| 759 | 3300041451 | Ga0451791_1601024 | Ga0451791_1601024_44_586 | 173 |
| 760 | 3300046525 | Ga0495663_0009906 | Ga0495663_0009906_687_1223 | 173 |
| 761 | 3300046615 | Ga0495656_0003602 | Ga0495656_0003602_3705_4241 | 173 |
| 762 | 3300047318 | Ga0495636_0028371 | Ga0495636_0028371_1461_1997 | 173 |
| 763 | 3300048903 | Ga0496100_0323639 | Ga0496100_0323639_140_676 | 173 |
| 764 | 3300048909 | Ga0496106_0037617 | Ga0496106_0037617_402_938 | 173 |
| 765 | 3300048911 | Ga0496108_0018627 | Ga0496108_0018627_3136_3672 | 173 |
| 766 | 3300048912 | Ga0496109_0043422 | Ga0496109_0043422_3385_3921 | 173 |
| 767 | 3300048914 | Ga0496111_0007874 | Ga0496111_0007874_3385_3921 | 173 |
| 768 | 3300048915 | Ga0496112_0055973 | Ga0496112_0055973_1889_2425 | 173 |
| 769 | 3300048916 | Ga0496113_0046111 | Ga0496113_0046111_500_1036 | 173 |
| 770 | 3300048925 | Ga0496122_0095588 | Ga0496122_0095588_308_844 | 173 |
| 771 | 3300048926 | Ga0496123_0008951 | Ga0496123_0008951_6697_7233 | 173 |
| 772 | 3300048929 | Ga0496126_0620767 | Ga0496126_0620767_259_795 | 173 |
| 773 | 3300003773 | Ga0055537_1000088 | Ga0055537_10000886 | 174 |
| 774 | 3300003775 | Ga0055524_1000074 | Ga0055524_100007457 | 174 |
| 775 | 3300003784 | Ga0055534_1000097 | Ga0055534_10000976 | 174 |
| 776 | 3300003790 | Ga0055528_1000028 | Ga0055528_100002857 | 174 |
| 777 | 3300025263 | Ga0209565_1000034 | Ga0209565_1000034218 | 174 |
| 778 | 3300025273 | Ga0209673_1000039 | Ga0209673_1000039218 | 174 |
| 779 | 3300025291 | Ga0209675_1000023 | Ga0209675_1000023218 | 174 |
| 780 | 3300025295 | Ga0209564_1000066 | Ga0209564_100006655 | 174 |
| 781 | 3300025299 | Ga0209256_1000048 | Ga0209256_1000048218 | 174 |
| 782 | 3300030733 | Ga0314311_1072890 | Ga0314311_10728902 | 174 |
| 783 | 3300031548 | Ga0307408_100216471 | Ga0307408_1002164712 | 174 |
| 784 | 3300031731 | Ga0307405_10022245 | Ga0307405_100222453 | 174 |
| 785 | 3300031824 | Ga0307413_10044622 | Ga0307413_100446224 | 174 |
| 786 | 3300031824 | Ga0307413_10073588 | Ga0307413_100735883 | 174 |
| 787 | 3300031824 | Ga0307413_10870234 | Ga0307413_108702341 | 174 |
| 788 | 3300031852 | Ga0307410_10014783 | Ga0307410_100147833 | 174 |
| 789 | 3300031852 | Ga0307410_10123834 | Ga0307410_101238341 | 174 |
| 790 | 3300031901 | Ga0307406_10000978 | Ga0307406_100009782 | 174 |
| 791 | 3300031901 | Ga0307406_10013019 | Ga0307406_100130192 | 174 |
| 792 | 3300031903 | Ga0307407_10076809 | Ga0307407_100768092 | 174 |
| 793 | 3300031903 | Ga0307407_10127462 | Ga0307407_101274621 | 174 |
| 794 | 3300031911 | Ga0307412_10045343 | Ga0307412_100453432 | 174 |
| 795 | 3300031911 | Ga0307412_10192504 | Ga0307412_101925042 | 174 |
| 796 | 3300031995 | Ga0307409_100031440 | Ga0307409_1000314405 | 174 |
| 797 | 3300031995 | Ga0307409_100046744 | Ga0307409_1000467442 | 174 |
| 798 | 3300031995 | Ga0307409_100996607 | Ga0307409_1009966072 | 174 |
| 799 | 3300032002 | Ga0307416_100039180 | Ga0307416_1000391804 | 174 |
| 800 | 3300032004 | Ga0307414_10003104 | Ga0307414_100031042 | 174 |
| 801 | 3300032004 | Ga0307414_10062348 | Ga0307414_100623482 | 174 |
| 802 | 3300032004 | Ga0307414_10079320 | Ga0307414_100793202 | 174 |
| 803 | 3300032005 | Ga0307411_10105527 | Ga0307411_101055272 | 174 |
| 804 | 3300032005 | Ga0307411_10562721 | Ga0307411_105627211 | 174 |
| 805 | 3300039145 | Ga0237816_03081 | Ga0237816_03081_294_833 | 174 |
| 806 | 3300041404 | Ga0439436_0034362 | Ga0439436_0034362_326_877 | 174 |
| 807 | 3300041407 | Ga0439447_000808 | Ga0439447_000808_8346_8897 | 174 |
| 808 | 3300041413 | Ga0439465_0000214 | Ga0439465_0000214_8671_9210 | 174 |
| 809 | 3300042004 | Ga0439445_0012311 | Ga0439445_0012311_143_682 | 174 |
| 810 | 3300046558 | Ga0495633_0010539 | Ga0495633_0010539_2889_3473 | 174 |
| 811 | 3300046616 | Ga0495668_0000890 | Ga0495668_0000890_9048_9599 | 174 |
| 812 | 3300048911 | Ga0496108_0164470 | Ga0496108_0164470_1085_1636 | 174 |
| 813 | 3300049513 | Ga0501290_022888 | Ga0501290_022888_68_607 | 174 |
| 814 | 3300049661 | Ga0501217_112051 | Ga0501217_112051_83_622 | 174 |
| 815 | 3300049672 | Ga0501239_012302 | Ga0501239_012302_235_774 | 174 |
| 816 | 3300049675 | Ga0501243_005519 | Ga0501243_005519_609_1148 | 174 |
| 817 | 3300049683 | Ga0501253_033769 | Ga0501253_033769_307_846 | 174 |
| 818 | 3300049705 | Ga0501225_0103046 | Ga0501225_0103046_271_810 | 174 |
| 819 | 3300049708 | Ga0501245_014636 | Ga0501245_014636_71_610 | 174 |
| 820 | 3300049763 | Ga0501266_003858 | Ga0501266_003858_943_1482 | 174 |
| 821 | 3300049764 | Ga0501267_013704 | Ga0501267_013704_91_630 | 174 |
| 822 | 3300049767 | Ga0501270_018667 | Ga0501270_018667_365_904 | 174 |
| 823 | 2162886007 | SwRhRL2b_contig_3797405 | SwRhRL2b_0206.00004290 | 175 |
| 824 | 3300005289 | Ga0065704_10098945 | Ga0065704_100989452 | 175 |
| 825 | 3300005435 | Ga0070714_100752166 | Ga0070714_1007521662 | 175 |
| 826 | 3300005548 | Ga0070665_100166741 | Ga0070665_1001667412 | 175 |
| 827 | 3300025304 | Ga0209257_1000046 | Ga0209257_100004692 | 175 |
| 828 | 3300028379 | Ga0268266_10187018 | Ga0268266_101870182 | 175 |
| 829 | 3300031456 | Ga0307513_10037233 | Ga0307513_100372334 | 175 |
| 830 | 3300031456 | Ga0307513_10267221 | Ga0307513_102672212 | 175 |
| 831 | 3300031824 | Ga0307413_10041782 | Ga0307413_100417824 | 175 |
| 832 | 3300031824 | Ga0307413_10475602 | Ga0307413_104756022 | 175 |
| 833 | 3300031824 | Ga0307413_10773997 | Ga0307413_107739972 | 175 |
| 834 | 3300031852 | Ga0307410_10300824 | Ga0307410_103008242 | 175 |
| 835 | 3300032004 | Ga0307414_10001338 | Ga0307414_100013389 | 175 |
| 836 | 3300032004 | Ga0307414_10021898 | Ga0307414_100218982 | 175 |
| 837 | 3300032004 | Ga0307414_10344181 | Ga0307414_103441811 | 175 |
| 838 | 3300032005 | Ga0307411_10054444 | Ga0307411_100544443 | 175 |
| 839 | 3300032005 | Ga0307411_10183876 | Ga0307411_101838762 | 175 |
| 840 | 3300037471 | Ga0395905_0006093 | Ga0395905_0006093_9120_9677 | 175 |
| 841 | 3300037471 | Ga0395905_0019088 | Ga0395905_0019088_3084_3641 | 175 |
| 842 | 3300038443 | Ga0395901_0088389 | Ga0395901_0088389_230_787 | 175 |
| 843 | 3300041413 | Ga0439465_0000615 | Ga0439465_0000615_689_1237 | 175 |
| 844 | 3300041413 | Ga0439465_0003455 | Ga0439465_0003455_38_586 | 175 |
| 845 | 3300041443 | Ga0451789_1055925 | Ga0451789_1055925_367_915 | 175 |
| 846 | 3300041451 | Ga0451791_0725227 | Ga0451791_0725227_104_655 | 175 |
| 847 | 3300041451 | Ga0451791_0976915 | Ga0451791_0976915_322_870 | 175 |
| 848 | 3300041452 | Ga0451793_1805861 | Ga0451793_1805861_127_675 | 175 |
| 849 | 3300041486 | Ga0451807_1916965 | Ga0451807_1916965_71_619 | 175 |
| 850 | 3300041494 | Ga0451837_1238404 | Ga0451837_1238404_282_833 | 175 |
| 851 | 3300041494 | Ga0451837_1399073 | Ga0451837_1399073_670_1218 | 175 |
| 852 | 3300041509 | Ga0451843_0056262 | Ga0451843_0056262_1744_2295 | 175 |
| 853 | 3300041509 | Ga0451843_1149050 | Ga0451843_1149050_1851_2399 | 175 |
| 854 | 3300041512 | Ga0451853_1261890 | Ga0451853_1261890_160_708 | 175 |
| 855 | 3300042004 | Ga0439445_0064993 | Ga0439445_0064993_408_956 | 175 |
| 856 | 3300042007 | Ga0439449_0003655 | Ga0439449_0003655_4374_4922 | 175 |
| 857 | 3300042125 | Ga0450923_020142 | Ga0450923_020142_171_719 | 175 |
| 858 | 3300046513 | Ga0495616_0184079 | Ga0495616_0184079_177_725 | 175 |
| 859 | 3300046525 | Ga0495663_0001222 | Ga0495663_0001222_5270_5818 | 175 |
| 860 | 3300046615 | Ga0495656_0063588 | Ga0495656_0063588_387_935 | 175 |
| 861 | 3300046692 | Ga0495671_0003233 | Ga0495671_0003233_3236_3784 | 175 |
| 862 | 3300048090 | Ga0495615_0022313 | Ga0495615_0022313_337_885 | 175 |
| 863 | 3300048905 | Ga0496102_0202573 | Ga0496102_0202573_664_1215 | 175 |
| 864 | 3300048917 | Ga0496114_0004048 | Ga0496114_0004048_4635_5162 | 175 |
| 865 | 3300048925 | Ga0496122_0034096 | Ga0496122_0034096_2406_2954 | 175 |
| 866 | 3300048926 | Ga0496123_0057107 | Ga0496123_0057107_765_1313 | 175 |
| 867 | 3300048927 | Ga0496124_0230198 | Ga0496124_0230198_819_1361 | 175 |
| 868 | 3300048929 | Ga0496126_0042951 | Ga0496126_0042951_2669_3196 | 175 |
| 869 | 3300049571 | Ga0501034_0001242 | Ga0501034_0001242_26501_27028 | 175 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2y4y-assembly1.cif.gz_A-2 | structure of a domain from the type iv pilus biogenesis lipoprotein pilp, from pseudomonas aeruginosa | 0.9279 | 84 | 173 |
| 2y4y-assembly1.cif.gz_C-2 | structure of a domain from the type iv pilus biogenesis lipoprotein pilp, from pseudomonas aeruginosa | 0.9172 | 90 | 173 |
| 2y4y-assembly1.cif.gz_A-2 | structure of a domain from the type iv pilus biogenesis lipoprotein pilp, from pseudomonas aeruginosa | 0.9172 | 84 | 173 |
| 2y4y-assembly1.cif.gz_D-2 | structure of a domain from the type iv pilus biogenesis lipoprotein pilp, from pseudomonas aeruginosa | 0.9123 | 88 | 172 |
| 2y4y-assembly1.cif.gz_B-2 | structure of a domain from the type iv pilus biogenesis lipoprotein pilp, from pseudomonas aeruginosa | 0.9047 | 90 | 173 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2y4yC00 | Mainly Beta;Roll;SH3 type barrels.; | 0.9172 | 90 | 173 | 2.30.30.830 |
| 2y4yC00 | Mainly Beta;Roll;SH3 type barrels.; | 0.8862 | 90 | 173 | 2.30.30.830 |
| 2lc4A00 | Mainly Beta;Roll;SH3 type barrels.; | 0.8465 | 82 | 175 | 2.30.30.830 |
| 2ivwA01 | Mainly Beta;Roll;SH3 type barrels.; | 0.8084 | 93 | 173 | 2.30.30.830 |
| 2ivwA01 | Mainly Beta;Roll;SH3 type barrels.; | 0.8 | 93 | 173 | 2.30.30.830 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3A4P2N5-F1-model_v4 | Pilus assembly protein PilP | 0.9401 | 93 | 172 |
|
| AF-A0A382ZGV8-F1-model_v4 | Pilus assembly protein PilP | 0.939 | 83 | 175 |
|
| AF-A0A534Q0G7-F1-model_v4 | Pilus assembly protein PilP | 0.9377 | 90 | 173 |
|
| AF-A0A382XQ63-F1-model_v4 | Pilus assembly protein PilP | 0.9373 | 84 | 175 |
|
| AF-A0A3B8WSG9-F1-model_v4 | Pilus assembly protein PilP | 0.9324 | 82 | 172 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar