F484126

General Info

Members Datasets Scaffolds Average Seq Length
869 423 797 174

Family's Representative Sequence

Representative Sequence 3300046558|Ga0495633_0010539|Ga0495633_0010539_2889_3473
Length 194
Sequence MSMTSYKRLFCESLTKAAHIPVRGLFSCLALVLLLAGCARGVSSAPGDAPNLERWVAEVRARPAPALEPLPVMQQFETFEYAAQGMRDPFADAWVNPDAGNGLRPDPNRRKEPLEAFPLDSLNMVGTIGTGPAQVALVMAPDKVTYRVRSGIYMGQSDGRVTGVSDGHIELIELVPDGAGGWLERPASIALDDQ

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
3 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
4 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
5 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
6 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
7 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
8 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
9 2643221559 Lysobacter sp. Root559 Isolate Unclassified
10 2643221573 Lysobacter sp. Root604 Isolate Unclassified
11 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
12 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
13 2643221586 Lysobacter sp. Root667 Isolate Unclassified
14 2643221593 Lysobacter sp. Root690 Isolate Unclassified
15 2643221612 Lysobacter sp. Root76 Isolate Unclassified
16 2643221695 Lysobacter sp. Root494 Isolate Unclassified
17 2643221720 Lysobacter sp. Root916 Isolate Unclassified
18 2643221727 Lysobacter sp. Root96 Isolate Unclassified
19 2643221728 Lysobacter sp. Root983 Isolate Unclassified
20 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
21 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
22 2734482264 Dyella sp. AD052 Isolate Unclassified
23 2738543009 Luteibacter sp. OK325 Isolate Unclassified
24 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
25 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
26 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
27 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
28 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
29 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
30 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
31 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
32 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
33 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
34 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
35 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
36 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
37 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
38 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
39 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
40 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
41 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
42 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
43 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
44 2919085039 Luteibacter sp. 1214 Isolate Unclassified
45 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
46 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
47 2919404418 Luteibacter sp. 3190 Isolate Unclassified
48 2919513703 Luteimonas sp. 3794 Isolate Unclassified
49 2919675420 Luteimonas terrae 4099 Isolate Unclassified
50 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
51 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
52 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
53 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
54 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
55 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
56 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
57 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
58 2941471342 Luteibacter sp. 621 Isolate Unclassified
59 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
60 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
61 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
62 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
63 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
64 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
65 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
66 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
67 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
68 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
69 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
70 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
71 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
72 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
73 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
74 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
75 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
76 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
77 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
78 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
79 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
80 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
81 3300003558 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_10_fullP_mix1_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
82 3300003567 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
83 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
84 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
85 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
86 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
87 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
88 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
89 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
90 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
91 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
92 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
93 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
94 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
95 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
96 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
97 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
98 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
99 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
100 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
101 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
102 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
103 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
104 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
105 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
106 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
107 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
108 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
109 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
110 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
111 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
112 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
113 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
114 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
115 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
116 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
117 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
118 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
119 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
120 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
121 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
122 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
123 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
124 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
125 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
126 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
127 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
128 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
129 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
130 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
131 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
132 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
133 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
134 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
135 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
136 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
137 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
138 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
139 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
140 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
141 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
142 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
143 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
144 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
145 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
146 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
147 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
148 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
149 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
150 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
151 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
152 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
153 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
154 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
155 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
156 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
157 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
158 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
159 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
160 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
161 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
162 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
163 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
164 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
165 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
166 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
167 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
168 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
169 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
170 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
173 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
174 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
175 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
176 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
178 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
179 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
180 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
182 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
183 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
184 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
186 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
187 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
188 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
190 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
191 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
192 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
193 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
241 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
242 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
244 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
245 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
246 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
247 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
248 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
249 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
250 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
251 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
252 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
253 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
254 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
255 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
256 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
257 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
258 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
259 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
260 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
261 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
262 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
263 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
264 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
265 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
266 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
267 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
268 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
269 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
270 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
271 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
272 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
273 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
274 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
275 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
276 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
277 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
278 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
279 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
280 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
281 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
282 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
283 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
284 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
285 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
286 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
287 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
288 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
289 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
290 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
291 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
292 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
293 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
294 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
295 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
296 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
297 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
298 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
299 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
300 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
301 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
302 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
303 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
304 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
305 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
306 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
307 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
308 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
309 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
310 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
311 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
312 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
313 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
314 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
315 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
316 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
317 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
318 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
319 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
320 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
321 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
322 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
323 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
324 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
325 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
326 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
327 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
328 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
329 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
330 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
331 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
332 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
333 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
334 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
335 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
336 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
337 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
338 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
339 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
340 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
341 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
342 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
343 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
344 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
345 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
346 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
347 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
348 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
349 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
350 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
351 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
352 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
353 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
354 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
355 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
356 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
357 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
358 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
359 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
360 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
361 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
362 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
363 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
364 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
365 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
366 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
367 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
368 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
369 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
370 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
371 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
372 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
373 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
374 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
375 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
376 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
377 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
378 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
379 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
380 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
381 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
382 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
383 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
385 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
386 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
387 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
388 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
389 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
390 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
391 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
392 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
393 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
394 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
395 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
396 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
397 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
398 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
399 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
400 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
401 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
402 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
403 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
404 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
405 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
406 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
407 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
408 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
409 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
410 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
411 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
412 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
413 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
414 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
415 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
416 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
417 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
418 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
419 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
420 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
421 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
422 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
423 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.91
Metatranscriptomes 0.81
Isolates 8.29

Biome Distribution

Category Percentage (%)
Aerial Root 0.12
Bulb 0
Endosphere 13.81
Nodule 0.12
Rhizoplane 4.95
Rhizosphere 62.49
Stem 0
Stem Tuber 0
Unclassified 18.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3797405 2162886007 Bacteria 1475
2 JGI24736J21556_1001617 3300001904 Bacteria 4089
3 JGI24740J21852_10040405 3300001979 Bacteria 1414
4 JGI24738J21930_10001153 3300002075 Bacteria 7468
5 JGI25156J39149_1007841 3300002705 Bacteria 2755
6 JGI25157J39369_1001663 3300002741 Bacteria 7572
7 JGI25152J39213_1000069 3300002773 Bacteria 67815
8 JGI25150J39212_1000214 3300002774 Bacteria 31523
9 JGI25150J39212_1000407 3300002774 Bacteria 19982
10 JGI25150J39212_1027756 3300002774 Bacteria 807
11 JGI25151J46595_10000105 3300003187 Bacteria 113763
12 JGI25151J46595_10000116 3300003187 Bacteria 107172
13 JGI25153J46596_10000077 3300003215 Bacteria 113763
14 rootH2_10004458 3300003320 Bacteria 5849
15 rootH2_10044786 3300003320 Bacteria 1918
16 rootL2_10073749 3300003322 Bacteria 1619
17 rootH1_10107485 3300003323 Bacteria 1101
18 rootH1_10232895 3300003323 Bacteria 1448
19 Ga0006558J51389_1028497 3300003558 Bacteria 1276
20 Ga0006554J51385_1022338 3300003567 Bacteria 3527
21 Ga0006562J51391_1012709 3300003578 Bacteria 7210
22 Ga0006562J51391_1012711 3300003578 Bacteria 2130
23 Ga0055542_1012758 3300003762 Bacteria 1442
24 Ga0055529_1005753 3300003763 Bacteria 1768
25 Ga0055526_1003098 3300003771 Bacteria 10789
26 Ga0055537_1000088 3300003773 Bacteria 66713
27 Ga0055537_1000812 3300003773 Bacteria 15462
28 Ga0055524_1000074 3300003775 Bacteria 122843
29 Ga0055524_1016948 3300003775 Bacteria 2588
30 Ga0055524_1061261 3300003775 Bacteria 778
31 Ga0055536_1001746 3300003781 Bacteria 12830
32 Ga0055536_1006277 3300003781 Bacteria 5598
33 Ga0055534_1000097 3300003784 Bacteria 67619
34 Ga0055534_1000154 3300003784 Bacteria 51139
35 Ga0055534_1011218 3300003784 Bacteria 1833
36 Ga0055528_1000028 3300003790 Bacteria 122843
37 Ga0055528_1001412 3300003790 Bacteria 14714
38 Ga0055528_1002336 3300003790 Bacteria 10259
39 Ga0055530_10001477 3300003791 Bacteria 17070
40 Ga0055531_10002804 3300003794 Bacteria 11428
41 Ga0055531_10013393 3300003794 Bacteria 3780
42 Ga0055531_10017692 3300003794 Bacteria 2992
43 Ga0055531_10030559 3300003794 Bacteria 1805
44 Ga0058692_1000013 3300003856 Bacteria 316299
45 Ga0058692_1000035 3300003856 Bacteria 152983
46 Ga0065165_1000913 3300005262 Bacteria 38106
47 Ga0065704_10098945 3300005289 Bacteria 2332
48 Ga0065704_10281216 3300005289 Bacteria 921
49 Ga0065715_10170654 3300005293 Bacteria 1549
50 Ga0070658_10709156 3300005327 Bacteria 873
51 Ga0070670_100022831 3300005331 Bacteria 5384
52 Ga0070670_100046378 3300005331 Bacteria 3736
53 Ga0070670_100073464 3300005331 Bacteria 2937
54 Ga0070680_100389732 3300005336 Bacteria 1187
55 Ga0070682_100008369 3300005337 Bacteria 5835
56 Ga0070682_100105533 3300005337 Bacteria 1868
57 Ga0070660_100089225 3300005339 Bacteria 2429
58 Ga0070661_100214433 3300005344 Bacteria 1475
59 Ga0070661_100330707 3300005344 Bacteria 1192
60 Ga0070661_100491765 3300005344 Bacteria 981
61 Ga0070668_100070732 3300005347 Bacteria 2717
62 Ga0070668_100203858 3300005347 Bacteria 1624
63 Ga0070668_101260099 3300005347 Bacteria 671
64 Ga0070669_100054658 3300005353 Bacteria 2925
65 Ga0070669_101051101 3300005353 Bacteria 700
66 Ga0070675_100494163 3300005354 Bacteria 1102
67 Ga0070671_100010249 3300005355 Bacteria 7523
68 Ga0070671_101041160 3300005355 Bacteria 718
69 Ga0070674_100053729 3300005356 Bacteria 2783
70 Ga0070673_100426619 3300005364 Bacteria 1189
71 Ga0070673_101124699 3300005364 Bacteria 734
72 Ga0070659_100144222 3300005366 Bacteria 1940
73 Ga0070667_100000085 3300005367 Bacteria 117695
74 Ga0070714_100752166 3300005435 Bacteria 942
75 Ga0070700_100575143 3300005441 Bacteria 879
76 Ga0070663_100000045 3300005455 Bacteria 56569
77 Ga0070663_100081842 3300005455 Bacteria 2374
78 Ga0070663_100194098 3300005455 Bacteria 1582
79 Ga0070678_100011851 3300005456 Bacteria 5394
80 Ga0070678_100094369 3300005456 Bacteria 2303
81 Ga0070681_10336561 3300005458 Bacteria 1419
82 Ga0070681_10350114 3300005458 Bacteria 1387
83 Ga0068867_100047934 3300005459 Bacteria 3142
84 Ga0070679_100058369 3300005530 Bacteria 3845
85 Ga0068853_100003376 3300005539 Bacteria 12224
86 Ga0068853_100170552 3300005539 Bacteria 1968
87 Ga0070672_100057956 3300005543 Bacteria 3042
88 Ga0070696_100004017 3300005546 Bacteria 9808
89 Ga0070693_100017003 3300005547 Bacteria 3775
90 Ga0070665_100071908 3300005548 Bacteria 3466
91 Ga0070665_100166741 3300005548 Bacteria 2205
92 Ga0070665_100924316 3300005548 Bacteria 885
93 Ga0068855_100013007 3300005563 Bacteria 10042
94 Ga0068855_101271375 3300005563 Bacteria 763
95 Ga0070664_100084386 3300005564 Bacteria 2742
96 Ga0070664_101231545 3300005564 Bacteria 706
97 Ga0068854_100176852 3300005578 Bacteria 1664
98 Ga0068856_100000524 3300005614 Bacteria 42396
99 Ga0068851_10354686 3300005834 Bacteria 854
100 Ga0068851_10625703 3300005834 Bacteria 657
101 Ga0068863_100123053 3300005841 Bacteria 2475
102 Ga0068858_101627569 3300005842 Unclassified 637
103 Ga0081539_10019407 3300005985 Bacteria 4655
104 Ga0075365_10193304 3300006038 Bacteria 1424
105 Ga0075364_10000775 3300006051 Bacteria 16800
106 Ga0075364_10010917 3300006051 Bacteria 5504
107 Ga0075364_10037648 3300006051 Bacteria 3133
108 Ga0075364_10577264 3300006051 Bacteria 768
109 Ga0075369_10181360 3300006186 Bacteria 969
110 Ga0075369_10296146 3300006186 Bacteria 755
111 Ga0075370_10085036 3300006353 Bacteria 1821
112 Ga0097620_100383554 3300006931 Bacteria 1501
113 Ga0105251_10019456 3300009011 Bacteria 3586
114 Ga0105244_10023892 3300009036 Bacteria 3343
115 Ga0105244_10038830 3300009036 Bacteria 2481
116 Ga0105244_10104717 3300009036 Bacteria 1381
117 Ga0105240_10023122 3300009093 Bacteria 8229
118 Ga0105240_10128175 3300009093 Bacteria 3046
119 Ga0105240_10130625 3300009093 Bacteria 3013
120 Ga0105247_10002807 3300009101 Bacteria 11651
121 Ga0105247_10640208 3300009101 Bacteria 793
122 Ga0105243_10122895 3300009148 Bacteria 2192
123 Ga0105243_10207021 3300009148 Bacteria 1724
124 Ga0105241_10252420 3300009174 Bacteria 1496
125 Ga0105248_10000980 3300009177 Bacteria 31690
126 Ga0105237_10000036 3300009545 Bacteria 191142
127 Ga0105237_10006112 3300009545 Bacteria 13457
128 Ga0105237_10546847 3300009545 Bacteria 1164
129 Ga0105249_10000335 3300009553 Bacteria 47511
130 Ga0105028_107380 3300009993 Bacteria 1149
131 Ga0105239_10000027 3300010375 Bacteria 248028
132 Ga0105239_10202899 3300010375 Bacteria 2222
133 Ga0105239_10416482 3300010375 Bacteria 1521
134 Ga0105239_10992781 3300010375 Bacteria 965
135 Ga0157318_1002656 3300012482 Bacteria 990
136 Ga0157329_1001393 3300012491 Bacteria 1221
137 Ga0157313_1002762 3300012503 Bacteria 1080
138 Ga0157327_1000513 3300012512 Bacteria 2101
139 Ga0157373_10073514 3300013100 Bacteria 2412
140 Ga0157373_10152758 3300013100 Bacteria 1624
141 Ga0157373_10377225 3300013100 Bacteria 1014
142 Ga0157371_10000184 3300013102 Bacteria 92100
143 Ga0157371_10079356 3300013102 Bacteria 2325
144 Ga0157371_10120730 3300013102 Bacteria 1863
145 Ga0157371_10190080 3300013102 Bacteria 1470
146 Ga0157371_10678202 3300013102 Bacteria 770
147 Ga0157370_10000045 3300013104 Bacteria 127627
148 Ga0157370_10001564 3300013104 Bacteria 28327
149 Ga0157370_10015409 3300013104 Bacteria 7770
150 Ga0157370_10019467 3300013104 Bacteria 6808
151 Ga0157370_10096821 3300013104 Bacteria 2768
152 Ga0157370_10270060 3300013104 Bacteria 1571
153 Ga0157370_10366785 3300013104 Bacteria 1327
154 Ga0157370_10435598 3300013104 Bacteria 1206
155 Ga0157369_10000745 3300013105 Bacteria 41913
156 Ga0157369_10011268 3300013105 Bacteria 10158
157 Ga0157369_10048745 3300013105 Bacteria 4595
158 Ga0163162_10325108 3300013306 Bacteria 1670
159 Ga0163162_10398573 3300013306 Bacteria 1509
160 Ga0157372_10021401 3300013307 Bacteria 6986
161 Ga0157372_10162705 3300013307 Bacteria 2580
162 Ga0157372_10787582 3300013307 Bacteria 1105
163 Ga0157375_10140509 3300013308 Bacteria 2542
164 Ga0157375_10169912 3300013308 Bacteria 2327
165 Ga0157380_10098081 3300014326 Bacteria 2434
166 Ga0157380_10371759 3300014326 Bacteria 1346
167 Ga0157380_10530188 3300014326 Bacteria 1150
168 Ga0182008_10004060 3300014497 Bacteria 8640
169 Ga0182008_10023563 3300014497 Bacteria 3142
170 Ga0182008_10037026 3300014497 Bacteria 2441
171 Ga0182008_10311799 3300014497 Bacteria 826
172 Ga0157379_10935563 3300014968 Bacteria 824
173 Ga0182006_1000479 3300015261 Bacteria 31307
174 Ga0182006_1003624 3300015261 Bacteria 7845
175 Ga0182006_1022419 3300015261 Bacteria 2625
176 Ga0182007_10000219 3300015262 Bacteria 38463
177 Ga0182007_10033459 3300015262 Bacteria 1742
178 Ga0182005_1000113 3300015265 Bacteria 58004
179 Ga0182005_1000213 3300015265 Bacteria 38351
180 Ga0182005_1001646 3300015265 Bacteria 8686
181 Ga0182005_1001924 3300015265 Bacteria 7868
182 Ga0182005_1006350 3300015265 Bacteria 3624
183 Ga0183360_10001 3300015689 Bacteria 3943671
184 Ga0163161_10007925 3300017792 Bacteria 7353
185 Ga0163161_10020842 3300017792 Bacteria 4603
186 Ga0163161_10050833 3300017792 Bacteria 3001
187 Ga0163161_10118324 3300017792 Bacteria 1988
188 Ga0163161_10480889 3300017792 Bacteria 1008
189 Ga0206356_10491941 3300020070 Bacteria 2892
190 Ga0206353_10172233 3300020082 Bacteria 1369
191 Ga0224712_10118197 3300022467 Bacteria 1145
192 Ga0209674_100791 3300025226 Bacteria 10635
193 Ga0209147_102946 3300025229 Bacteria 3688
194 Ga0209437_102834 3300025233 Bacteria 3253
195 Ga0207425_1000045 3300025245 Bacteria 194257
196 Ga0207425_1004713 3300025245 Bacteria 4025
197 Ga0209646_1002196 3300025246 Bacteria 4508
198 Ga0209026_1000223 3300025250 Bacteria 77328
199 Ga0209148_1000762 3300025254 Bacteria 24561
200 Ga0209759_1014486 3300025256 Bacteria 2083
201 Ga0209129_1000057 3300025258 Bacteria 253632
202 Ga0209129_1001090 3300025258 Bacteria 15870
203 Ga0209565_1000023 3300025263 Bacteria 388244
204 Ga0209565_1000034 3300025263 Bacteria 312950
205 Ga0209565_1019738 3300025263 Bacteria 1433
206 Ga0209455_1000430 3300025272 Bacteria 32798
207 Ga0209673_1000039 3300025273 Bacteria 312950
208 Ga0209673_1000047 3300025273 Bacteria 289276
209 Ga0209673_1029483 3300025273 Bacteria 1746
210 Ga0209130_1002629 3300025284 Bacteria 8633
211 Ga0209130_1024994 3300025284 Bacteria 1298
212 Ga0209675_1000016 3300025291 Bacteria 391965
213 Ga0209675_1000023 3300025291 Bacteria 312950
214 Ga0209675_1008269 3300025291 Bacteria 3851
215 Ga0209675_1046930 3300025291 Bacteria 910
216 Ga0209676_1000027 3300025292 Bacteria 560222
217 Ga0209676_1000037 3300025292 Bacteria 457562
218 Ga0209676_1000160 3300025292 Bacteria 161069
219 Ga0209676_1000280 3300025292 Bacteria 105988
220 Ga0209676_1002509 3300025292 Bacteria 12849
221 Ga0209676_1003026 3300025292 Bacteria 10906
222 Ga0209025_1000013 3300025294 Bacteria 871757
223 Ga0209025_1000023 3300025294 Bacteria 541307
224 Ga0209025_1002654 3300025294 Bacteria 18290
225 Ga0209025_1028791 3300025294 Bacteria 2709
226 Ga0209025_1030183 3300025294 Bacteria 2601
227 Ga0209564_1000066 3300025295 Bacteria 312899
228 Ga0209564_1000194 3300025295 Bacteria 141518
229 Ga0209564_1004607 3300025295 Bacteria 8314
230 Ga0209758_1000014 3300025297 Bacteria 871757
231 Ga0209758_1008048 3300025297 Bacteria 6957
232 Ga0209050_1000352 3300025298 Bacteria 88558
233 Ga0209050_1000714 3300025298 Bacteria 48752
234 Ga0209050_1000833 3300025298 Bacteria 42666
235 Ga0209050_1010110 3300025298 Bacteria 4698
236 Ga0209050_1026372 3300025298 Bacteria 1946
237 Ga0209256_1000048 3300025299 Bacteria 312899
238 Ga0209256_1003154 3300025299 Bacteria 11970
239 Ga0209256_1003863 3300025299 Bacteria 9967
240 Ga0209256_1005406 3300025299 Bacteria 7382
241 Ga0209256_1020798 3300025299 Bacteria 2036
242 Ga0209256_1020801 3300025299 Bacteria 2036
243 Ga0207426_1017565 3300025302 Bacteria 2540
244 Ga0209051_1001947 3300025303 Bacteria 15883
245 Ga0209051_1002836 3300025303 Bacteria 11944
246 Ga0209051_1006389 3300025303 Bacteria 6657
247 Ga0209257_1000046 3300025304 Bacteria 477765
248 Ga0209257_1000177 3300025304 Bacteria 161069
249 Ga0209257_1000198 3300025304 Bacteria 149013
250 Ga0209257_1000219 3300025304 Bacteria 135666
251 Ga0209257_1000383 3300025304 Bacteria 88315
252 Ga0209257_1003088 3300025304 Bacteria 14974
253 Ga0209257_1003813 3300025304 Bacteria 12380
254 Ga0209257_1007629 3300025304 Bacteria 6484
255 Ga0209257_1026691 3300025304 Bacteria 1939
256 Ga0209257_1034119 3300025304 Bacteria 1592
257 Ga0209257_1066742 3300025304 Bacteria 961
258 Ga0207655_1033595 3300025728 Bacteria 2321
259 Ga0207713_1066409 3300025735 Bacteria 1350
260 Ga0207682_10014641 3300025893 Bacteria 3057
261 Ga0207710_10005864 3300025900 Bacteria 5268
262 Ga0207647_10000015 3300025904 Bacteria 138626
263 Ga0207647_10076216 3300025904 Bacteria 2017
264 Ga0207705_10108347 3300025909 Bacteria 2050
265 Ga0207654_10128999 3300025911 Bacteria 1598
266 Ga0207707_10026404 3300025912 Bacteria 5076
267 Ga0207707_10369250 3300025912 Bacteria 1235
268 Ga0207695_10000441 3300025913 Bacteria 90937
269 Ga0207695_10003481 3300025913 Bacteria 22147
270 Ga0207671_10000135 3300025914 Bacteria 112401
271 Ga0207671_10003134 3300025914 Bacteria 16798
272 Ga0207657_10003190 3300025919 Bacteria 17543
273 Ga0207657_10351503 3300025919 Bacteria 1162
274 Ga0207649_10152857 3300025920 Bacteria 1591
275 Ga0207652_10131701 3300025921 Bacteria 2230
276 Ga0207652_10494603 3300025921 Bacteria 1101
277 Ga0207681_10041006 3300025923 Bacteria 3084
278 Ga0207681_10690832 3300025923 Bacteria 848
279 Ga0207694_10025255 3300025924 Bacteria 4515
280 Ga0207694_10159608 3300025924 Bacteria 1820
281 Ga0207650_10047972 3300025925 Bacteria 3149
282 Ga0207650_10048024 3300025925 Bacteria 3146
283 Ga0207650_10051036 3300025925 Bacteria 3060
284 Ga0207644_10060876 3300025931 Bacteria 2732
285 Ga0207644_10113072 3300025931 Bacteria 2056
286 Ga0207690_10250292 3300025932 Bacteria 1368
287 Ga0207706_10589886 3300025933 Bacteria 955
288 Ga0207709_10002407 3300025935 Bacteria 11766
289 Ga0207709_10020776 3300025935 Bacteria 3708
290 Ga0207669_10045553 3300025937 Bacteria 2585
291 Ga0207691_10019809 3300025940 Bacteria 6364
292 Ga0207711_10004824 3300025941 Bacteria 11459
293 Ga0207679_10124890 3300025945 Bacteria 2055
294 Ga0207667_10075026 3300025949 Bacteria 3512
295 Ga0207667_10263378 3300025949 Bacteria 1763
296 Ga0207667_11129593 3300025949 Bacteria 766
297 Ga0207651_10216836 3300025960 Bacteria 1544
298 Ga0207712_10001764 3300025961 Bacteria 14433
299 Ga0207668_10023924 3300025972 Bacteria 3935
300 Ga0207640_10003213 3300025981 Bacteria 8805
301 Ga0207658_10000032 3300025986 Bacteria 162260
302 Ga0207658_10244527 3300025986 Bacteria 1522
303 Ga0207677_10307158 3300026023 Bacteria 1313
304 Ga0207639_10031649 3300026041 Bacteria 3889
305 Ga0207639_10131720 3300026041 Bacteria 2071
306 Ga0207678_10000457 3300026067 Bacteria 37030
307 Ga0207678_10000643 3300026067 Bacteria 32112
308 Ga0207678_10147929 3300026067 Bacteria 2005
309 Ga0207702_10003652 3300026078 Bacteria 13940
310 Ga0207641_10243464 3300026088 Bacteria 1677
311 Ga0207648_10208557 3300026089 Bacteria 1734
312 Ga0207676_10065408 3300026095 Bacteria 2895
313 Ga0207683_10020246 3300026121 Bacteria 5688
314 Ga0207683_10022073 3300026121 Bacteria 5462
315 Ga0209371_1000007 3300027312 Bacteria 1050654
316 Ga0209371_1000043 3300027312 Bacteria 331009
317 Ga0209981_1027589 3300027378 Bacteria 827
318 Ga0209981_1030747 3300027378 Bacteria 787
319 Ga0209984_1003224 3300027424 Bacteria 1857
320 Ga0210000_1003909 3300027462 Bacteria 2157
321 Ga0209995_1000902 3300027471 Bacteria 4606
322 Ga0209999_1000249 3300027543 Bacteria 7797
323 Ga0209982_1002809 3300027552 Bacteria 2452
324 Ga0209970_1002517 3300027614 Bacteria 3108
325 Ga0209983_1006804 3300027665 Bacteria 2346
326 Ga0209971_1000743 3300027682 Bacteria 8388
327 Ga0209974_10034122 3300027876 Bacteria 1690
328 Ga0268266_10124490 3300028379 Bacteria 2298
329 Ga0268266_10187018 3300028379 Bacteria 1889
330 Ga0268266_10358741 3300028379 Bacteria 1371
331 Ga0268266_10727213 3300028379 Bacteria 957
332 Ga0268256_1000008 3300030500 Bacteria 1050654
333 Ga0268256_1000044 3300030500 Bacteria 330997
334 Ga0316176_1036603 3300030732 Bacteria 2284
335 Ga0316176_1043775 3300030732 Bacteria 994
336 Ga0314311_1072890 3300030733 Bacteria 2202
337 Ga0316183_1159014 3300030742 Bacteria 2300
338 Ga0316181_1256419 3300030744 Bacteria 1529
339 Ga0316182_1115502 3300030745 Bacteria 4516
340 Ga0307513_10037233 3300031456 Bacteria 5417
341 Ga0307513_10267221 3300031456 Bacteria 1496
342 Ga0307408_100022323 3300031548 Bacteria 4299
343 Ga0307408_100216471 3300031548 Bacteria 1560
344 Ga0307408_101240522 3300031548 Bacteria 697
345 Ga0307405_10022245 3300031731 Bacteria 3581
346 Ga0307405_10070178 3300031731 Bacteria 2249
347 Ga0307413_10001208 3300031824 Bacteria 9557
348 Ga0307413_10020613 3300031824 Bacteria 3511
349 Ga0307413_10041782 3300031824 Bacteria 2688
350 Ga0307413_10044622 3300031824 Bacteria 2621
351 Ga0307413_10050947 3300031824 Bacteria 2491
352 Ga0307413_10073588 3300031824 Bacteria 2160
353 Ga0307413_10388326 3300031824 Bacteria 1090
354 Ga0307413_10475602 3300031824 Bacteria 997
355 Ga0307413_10773997 3300031824 Bacteria 804
356 Ga0307413_10870234 3300031824 Bacteria 763
357 Ga0307413_11370484 3300031824 Bacteria 621
358 Ga0307410_10014783 3300031852 Bacteria 4607
359 Ga0307410_10123834 3300031852 Bacteria 1889
360 Ga0307410_10149155 3300031852 Bacteria 1739
361 Ga0307410_10300824 3300031852 Bacteria 1266
362 Ga0307410_10368852 3300031852 Bacteria 1152
363 Ga0307406_10000978 3300031901 Bacteria 15942
364 Ga0307406_10013019 3300031901 Bacteria 4756
365 Ga0307406_10312628 3300031901 Bacteria 1212
366 Ga0307406_10699296 3300031901 Bacteria 846
367 Ga0307407_10076809 3300031903 Bacteria 2006
368 Ga0307407_10127462 3300031903 Bacteria 1623
369 Ga0307407_10228856 3300031903 Bacteria 1261
370 Ga0307412_10000418 3300031911 Bacteria 25962
371 Ga0307412_10001816 3300031911 Bacteria 11811
372 Ga0307412_10031352 3300031911 Bacteria 3357
373 Ga0307412_10045343 3300031911 Bacteria 2873
374 Ga0307412_10075722 3300031911 Bacteria 2309
375 Ga0307412_10091960 3300031911 Bacteria 2125
376 Ga0307412_10192504 3300031911 Bacteria 1543
377 Ga0307412_10335285 3300031911 Bacteria 1208
378 Ga0307409_100031440 3300031995 Bacteria 3831
379 Ga0307409_100046744 3300031995 Bacteria 3279
380 Ga0307409_100996607 3300031995 Bacteria 856
381 Ga0307416_100014059 3300032002 Bacteria 5466
382 Ga0307416_100039180 3300032002 Bacteria 3666
383 Ga0307416_101238140 3300032002 Bacteria 852
384 Ga0307414_10001338 3300032004 Bacteria 12742
385 Ga0307414_10003104 3300032004 Bacteria 8824
386 Ga0307414_10021898 3300032004 Bacteria 4023
387 Ga0307414_10036736 3300032004 Bacteria 3273
388 Ga0307414_10055143 3300032004 Bacteria 2781
389 Ga0307414_10062348 3300032004 Bacteria 2645
390 Ga0307414_10079320 3300032004 Bacteria 2396
391 Ga0307414_10116249 3300032004 Bacteria 2047
392 Ga0307414_10155622 3300032004 Bacteria 1809
393 Ga0307414_10260251 3300032004 Bacteria 1447
394 Ga0307414_10344181 3300032004 Bacteria 1277
395 Ga0307414_10641852 3300032004 Bacteria 956
396 Ga0307414_10676518 3300032004 Bacteria 932
397 Ga0307411_10002861 3300032005 Bacteria 7797
398 Ga0307411_10054444 3300032005 Bacteria 2627
399 Ga0307411_10056552 3300032005 Bacteria 2586
400 Ga0307411_10105527 3300032005 Bacteria 2003
401 Ga0307411_10165982 3300032005 Bacteria 1660
402 Ga0307411_10183876 3300032005 Bacteria 1589
403 Ga0307411_10203128 3300032005 Bacteria 1524
404 Ga0307411_10237077 3300032005 Bacteria 1426
405 Ga0307411_10506159 3300032005 Bacteria 1022
406 Ga0307411_10558553 3300032005 Bacteria 978
407 Ga0307411_10562721 3300032005 Bacteria 974
408 Ga0373928_0179764 3300035084 Bacteria 601
409 Ga0395899_0017129 3300037312 Bacteria 5522
410 Ga0395900_0042677 3300037418 Bacteria 4673
411 Ga0395898_0176943 3300037466 Bacteria 2039
412 Ga0395905_0000337 3300037471 Bacteria 67116
413 Ga0395905_0006093 3300037471 Bacteria 12181
414 Ga0395905_0019088 3300037471 Bacteria 6503
415 Ga0395905_0376645 3300037471 Bacteria 1313
416 Ga0395905_0565449 3300037471 Bacteria 1038
417 Ga0395901_0088389 3300038443 Bacteria 3241
418 Ga0395901_0578455 3300038443 Bacteria 1135
419 Ga0237819_00177 3300038705 Bacteria 23554
420 Ga0237819_02977 3300038705 Bacteria 3158
421 Ga0237816_03081 3300039145 Bacteria 1236
422 Ga0439436_0000007 3300041404 Bacteria 120812
423 Ga0439436_0034362 3300041404 Bacteria 1466
424 Ga0439439_0018180 3300041406 Bacteria 1735
425 Ga0439447_000808 3300041407 Bacteria 11507
426 Ga0439465_0000214 3300041413 Bacteria 15475
427 Ga0439465_0000377 3300041413 Bacteria 12805
428 Ga0439465_0000615 3300041413 Bacteria 10825
429 Ga0439465_0003455 3300041413 Bacteria 5153
430 Ga0439465_0017038 3300041413 Bacteria 2267
431 Ga0451787_725098 3300041441 Bacteria 935
432 Ga0451789_0245027 3300041443 Bacteria 704
433 Ga0451789_1055925 3300041443 Bacteria 932
434 Ga0451791_0725227 3300041451 Bacteria 669
435 Ga0451791_0976915 3300041451 Bacteria 1541
436 Ga0451791_1601024 3300041451 Bacteria 728
437 Ga0451793_1805861 3300041452 Bacteria 1186
438 Ga0451797_1565887 3300041453 Bacteria 849
439 Ga0451795_0661403 3300041456 Bacteria 1255
440 Ga0451800_1649814 3300041459 Bacteria 2090
441 Ga0451806_152401 3300041462 Bacteria 4074
442 Ga0451804_0876128 3300041463 Bacteria 735
443 Ga0451804_1077436 3300041463 Bacteria 3811
444 Ga0451804_1170276 3300041463 Bacteria 621
445 Ga0451807_0590162 3300041486 Bacteria 4065
446 Ga0451807_1916965 3300041486 Bacteria 1280
447 Ga0451837_1238404 3300041494 Bacteria 940
448 Ga0451837_1399073 3300041494 Bacteria 2360
449 Ga0451847_0196122 3300041503 Bacteria 1097
450 Ga0451843_0056262 3300041509 Bacteria 2570
451 Ga0451843_0193634 3300041509 Bacteria 1300
452 Ga0451843_1149050 3300041509 Bacteria 2679
453 Ga0451853_1261890 3300041512 Bacteria 2001
454 Ga0451853_1606826 3300041512 Bacteria 698
455 Ga0451853_3210631 3300041512 Unclassified 688
456 Ga0451853_4086402 3300041512 Bacteria 847
457 Ga0439433_0026674 3300041999 Bacteria 1308
458 Ga0439433_0030390 3300041999 Bacteria 1235
459 Ga0439433_0077449 3300041999 Bacteria 806
460 Ga0439445_0012311 3300042004 Bacteria 2053
461 Ga0439445_0064993 3300042004 Bacteria 1003
462 Ga0439432_009293 3300042006 Bacteria 3432
463 Ga0439432_015910 3300042006 Bacteria 2534
464 Ga0439432_022919 3300042006 Bacteria 2060
465 Ga0439432_026696 3300042006 Bacteria 1890
466 Ga0439449_0000277 3300042007 Bacteria 18577
467 Ga0439449_0003655 3300042007 Bacteria 5969
468 Ga0439449_0009760 3300042007 Bacteria 3632
469 Ga0439449_0022386 3300042007 Bacteria 2366
470 Ga0439449_0050465 3300042007 Bacteria 1539
471 Ga0439452_009962 3300042010 Bacteria 2782
472 Ga0439455_0043457 3300042012 Bacteria 1157
473 Ga0439462_0060166 3300042015 Bacteria 1028
474 Ga0450911_000685 3300042115 Bacteria 10057
475 Ga0450923_020142 3300042125 Bacteria 1291
476 Ga0450908_000033 3300042184 Bacteria 31285
477 Ga0466982_0010498 3300044672 Bacteria 4813
478 Ga0453684_0000159 3300044712 Bacteria 300297
479 Ga0466957_0041473 3300044842 Bacteria 2784
480 Ga0451576_0000120 3300045051 Bacteria 199365
481 Ga0466958_0509475 3300045836 Bacteria 781
482 Ga0495617_000196 3300046452 Bacteria 38054
483 Ga0495617_000318 3300046452 Bacteria 27031
484 Ga0495627_010605 3300046453 Bacteria 3342
485 Ga0495627_032692 3300046453 Bacteria 1636
486 Ga0495627_051825 3300046453 Bacteria 1232
487 Ga0495591_034329 3300046458 Bacteria 1494
488 Ga0495638_0002849 3300046460 Bacteria 13863
489 Ga0495638_0004464 3300046460 Bacteria 10598
490 Ga0495638_0132268 3300046460 Bacteria 1464
491 Ga0495650_0011065 3300046471 Bacteria 4979
492 Ga0495584_0000437 3300046491 Bacteria 28733
493 Ga0495585_0001305 3300046492 Bacteria 19892
494 Ga0495585_0176303 3300046492 Bacteria 1101
495 Ga0495607_0004515 3300046501 Bacteria 10213
496 Ga0495607_0015294 3300046501 Bacteria 4976
497 Ga0495607_0016250 3300046501 Bacteria 4805
498 Ga0495607_0020055 3300046501 Bacteria 4232
499 Ga0495607_0422864 3300046501 Bacteria 602
500 Ga0495583_0015969 3300046506 Bacteria 4056
501 Ga0495606_0003552 3300046507 Bacteria 16459
502 Ga0495606_0005186 3300046507 Bacteria 12602
503 Ga0495606_0060310 3300046507 Bacteria 2430
504 Ga0495606_0077532 3300046507 Bacteria 2074
505 Ga0495606_0127978 3300046507 Bacteria 1512
506 Ga0495610_0000971 3300046512 Bacteria 26490
507 Ga0495610_0015601 3300046512 Bacteria 4406
508 Ga0495610_0016193 3300046512 Bacteria 4303
509 Ga0495616_0001042 3300046513 Bacteria 19821
510 Ga0495616_0184079 3300046513 Bacteria 926
511 Ga0495620_0000846 3300046515 Bacteria 18912
512 Ga0495620_0001915 3300046515 Bacteria 12191
513 Ga0495631_0000878 3300046518 Bacteria 18807
514 Ga0495631_0002764 3300046518 Bacteria 9736
515 Ga0495631_0010947 3300046518 Bacteria 4477
516 Ga0495632_0000014 3300046519 Bacteria 243913
517 Ga0495632_0005070 3300046519 Bacteria 8810
518 Ga0495632_0071240 3300046519 Bacteria 1670
519 Ga0495643_0002141 3300046522 Bacteria 16245
520 Ga0495648_0002749 3300046524 Bacteria 15883
521 Ga0495648_0053514 3300046524 Bacteria 2445
522 Ga0495663_0001222 3300046525 Bacteria 8226
523 Ga0495663_0001801 3300046525 Bacteria 6631
524 Ga0495663_0003902 3300046525 Bacteria 4248
525 Ga0495663_0009609 3300046525 Bacteria 2682
526 Ga0495663_0009906 3300046525 Bacteria 2647
527 Ga0495663_0032003 3300046525 Bacteria 1564
528 Ga0495663_0228027 3300046525 Bacteria 656
529 Ga0495598_0001908 3300046537 Bacteria 4217
530 Ga0495609_0002407 3300046538 Bacteria 11518
531 Ga0495609_0223113 3300046538 Bacteria 782
532 Ga0495621_0031148 3300046539 Bacteria 1828
533 Ga0495621_0044186 3300046539 Bacteria 1574
534 Ga0495622_0068953 3300046557 Bacteria 1633
535 Ga0495633_0010539 3300046558 Bacteria 5039
536 Ga0495633_0023836 3300046558 Bacteria 3028
537 Ga0495633_0100422 3300046558 Bacteria 1343
538 Ga0495633_0191777 3300046558 Bacteria 939
539 Ga0495656_0003602 3300046615 Bacteria 5247
540 Ga0495656_0063588 3300046615 Bacteria 1618
541 Ga0495668_0000890 3300046616 Bacteria 33634
542 Ga0495668_0002891 3300046616 Bacteria 13564
543 Ga0495668_0413290 3300046616 Bacteria 742
544 Ga0495611_0000003 3300046648 Bacteria 395679
545 Ga0495611_0002170 3300046648 Bacteria 9153
546 Ga0495625_0000019 3300046660 Bacteria 298330
547 Ga0495625_0053094 3300046660 Bacteria 2900
548 Ga0495625_0107868 3300046660 Bacteria 1905
549 Ga0495659_0005748 3300046664 Bacteria 3911
550 Ga0495661_0008753 3300046665 Bacteria 6984
551 Ga0495670_0000478 3300046691 Bacteria 18969
552 Ga0495670_0002610 3300046691 Bacteria 8900
553 Ga0495670_0051527 3300046691 Bacteria 2060
554 Ga0495670_0061678 3300046691 Bacteria 1885
555 Ga0495670_0380437 3300046691 Bacteria 762
556 Ga0495671_0003233 3300046692 Bacteria 10116
557 Ga0495671_0004102 3300046692 Bacteria 8783
558 Ga0495649_0030625 3300046694 Bacteria 2971
559 Ga0495589_0000408 3300046794 Bacteria 32385
560 Ga0495660_0000122 3300046810 Bacteria 85116
561 Ga0495660_0000268 3300046810 Bacteria 48969
562 Ga0495660_0047807 3300046810 Bacteria 2341
563 Ga0495660_0188229 3300046810 Bacteria 994
564 Ga0495636_0008861 3300047318 Bacteria 3961
565 Ga0495636_0021723 3300047318 Bacteria 2592
566 Ga0495636_0027609 3300047318 Bacteria 2312
567 Ga0495636_0028371 3300047318 Bacteria 2283
568 Ga0495672_0001225 3300047320 Bacteria 25853
569 Ga0495683_0004599 3300047323 Bacteria 7789
570 Ga0495677_0104255 3300047445 Bacteria 1075
571 Ga0495679_000017 3300047446 Bacteria 263230
572 Ga0495673_0000004 3300047469 Bacteria 1354526
573 Ga0495673_0000347 3300047469 Bacteria 58250
574 Ga0495673_0001675 3300047469 Bacteria 17049
575 Ga0495681_0286146 3300047470 Bacteria 641
576 Ga0495686_0000024 3300047472 Bacteria 400343
577 Ga0495686_0000409 3300047472 Bacteria 67869
578 Ga0495686_0004194 3300047472 Bacteria 11971
579 Ga0495686_0007418 3300047472 Bacteria 8224
580 Ga0495686_0016046 3300047472 Bacteria 5090
581 Ga0495686_0037336 3300047472 Bacteria 3112
582 Ga0495686_0092833 3300047472 Bacteria 1830
583 Ga0495686_0117408 3300047472 Bacteria 1589
584 Ga0495615_0022313 3300048090 Bacteria 1439
585 Ga0496100_0028515 3300048903 Bacteria 3444
586 Ga0496100_0323639 3300048903 Bacteria 1159
587 Ga0496100_0513306 3300048903 Bacteria 924
588 Ga0496101_0002654 3300048904 Bacteria 10984
589 Ga0496101_0044626 3300048904 Bacteria 3172
590 Ga0496101_0449636 3300048904 Bacteria 1016
591 Ga0496102_0202573 3300048905 Bacteria 1871
592 Ga0496104_0014408 3300048907 Bacteria 7145
593 Ga0496104_0148328 3300048907 Bacteria 2252
594 Ga0496105_0028149 3300048908 Bacteria 4595
595 Ga0496105_0045875 3300048908 Bacteria 3606
596 Ga0496106_0010123 3300048909 Bacteria 6965
597 Ga0496106_0037617 3300048909 Bacteria 3621
598 Ga0496106_0411828 3300048909 Bacteria 1086
599 Ga0496108_0018627 3300048911 Bacteria 5688
600 Ga0496108_0164470 3300048911 Bacteria 1918
601 Ga0496108_0832326 3300048911 Bacteria 795
602 Ga0496108_1267421 3300048911 Bacteria 621
603 Ga0496109_0043422 3300048912 Bacteria 4074
604 Ga0496109_0592418 3300048912 Bacteria 1045
605 Ga0496110_0756592 3300048913 Bacteria 875
606 Ga0496110_0860118 3300048913 Bacteria 812
607 Ga0496111_0007874 3300048914 Bacteria 7021
608 Ga0496112_0055973 3300048915 Bacteria 3881
609 Ga0496113_0046111 3300048916 Bacteria 3235
610 Ga0496113_0105163 3300048916 Bacteria 2191
611 Ga0496114_0004048 3300048917 Bacteria 11322
612 Ga0496116_0002306 3300048919 Bacteria 20233
613 Ga0496116_0019218 3300048919 Bacteria 5237
614 Ga0496116_0064796 3300048919 Bacteria 2347
615 Ga0496116_0101306 3300048919 Bacteria 1720
616 Ga0496117_0001871 3300048920 Bacteria 28369
617 Ga0496117_0004092 3300048920 Bacteria 16354
618 Ga0496117_0004983 3300048920 Bacteria 14248
619 Ga0496117_0008606 3300048920 Bacteria 9668
620 Ga0496117_0024752 3300048920 Bacteria 4735
621 Ga0496117_0048375 3300048920 Bacteria 3038
622 Ga0496117_0073042 3300048920 Bacteria 2290
623 Ga0496117_0268874 3300048920 Bacteria 919
624 Ga0496117_0374621 3300048920 Bacteria 727
625 Ga0496118_0001013 3300048921 Bacteria 43722
626 Ga0496118_0001607 3300048921 Bacteria 33397
627 Ga0496118_0002036 3300048921 Bacteria 28593
628 Ga0496118_0035718 3300048921 Bacteria 4030
629 Ga0496118_0049568 3300048921 Bacteria 3232
630 Ga0496118_0054643 3300048921 Bacteria 3022
631 Ga0496118_0099230 3300048921 Bacteria 1975
632 Ga0496118_0160364 3300048921 Bacteria 1392
633 Ga0496118_0175261 3300048921 Bacteria 1303
634 Ga0496118_0198680 3300048921 Bacteria 1190
635 Ga0496119_0000235 3300048922 Bacteria 77921
636 Ga0496119_0003558 3300048922 Bacteria 16083
637 Ga0496119_0010179 3300048922 Bacteria 7940
638 Ga0496119_0010619 3300048922 Bacteria 7722
639 Ga0496119_0046207 3300048922 Bacteria 2721
640 Ga0496120_0000208 3300048923 Bacteria 100328
641 Ga0496120_0000282 3300048923 Bacteria 85605
642 Ga0496120_0000970 3300048923 Bacteria 39064
643 Ga0496120_0283125 3300048923 Bacteria 765
644 Ga0496121_0000109 3300048924 Bacteria 187307
645 Ga0496121_0000480 3300048924 Bacteria 77305
646 Ga0496121_0000752 3300048924 Bacteria 59582
647 Ga0496121_0002095 3300048924 Bacteria 31379
648 Ga0496121_0007074 3300048924 Bacteria 13624
649 Ga0496121_0011014 3300048924 Bacteria 10095
650 Ga0496121_0017014 3300048924 Bacteria 7462
651 Ga0496121_0018291 3300048924 Bacteria 7077
652 Ga0496121_0079150 3300048924 Bacteria 2610
653 Ga0496121_0100282 3300048924 Bacteria 2235
654 Ga0496122_0001004 3300048925 Bacteria 49981
655 Ga0496122_0009282 3300048925 Bacteria 10401
656 Ga0496122_0025748 3300048925 Bacteria 5096
657 Ga0496122_0026466 3300048925 Bacteria 4998
658 Ga0496122_0034096 3300048925 Bacteria 4173
659 Ga0496122_0095588 3300048925 Bacteria 2007
660 Ga0496122_0177692 3300048925 Bacteria 1274
661 Ga0496122_0251634 3300048925 Bacteria 987
662 Ga0496122_0346190 3300048925 Bacteria 778
663 Ga0496123_0000239 3300048926 Bacteria 110475
664 Ga0496123_0003580 3300048926 Bacteria 17215
665 Ga0496123_0008951 3300048926 Bacteria 9101
666 Ga0496123_0029599 3300048926 Bacteria 4026
667 Ga0496123_0044731 3300048926 Bacteria 3024
668 Ga0496123_0057107 3300048926 Bacteria 2544
669 Ga0496123_0057633 3300048926 Bacteria 2526
670 Ga0496123_0062757 3300048926 Bacteria 2378
671 Ga0496123_0063283 3300048926 Bacteria 2365
672 Ga0496124_0000218 3300048927 Bacteria 112156
673 Ga0496124_0001341 3300048927 Bacteria 36941
674 Ga0496124_0001511 3300048927 Bacteria 33889
675 Ga0496124_0003515 3300048927 Bacteria 19085
676 Ga0496124_0004411 3300048927 Bacteria 16416
677 Ga0496124_0006332 3300048927 Bacteria 12919
678 Ga0496124_0007149 3300048927 Bacteria 11948
679 Ga0496124_0008850 3300048927 Bacteria 10453
680 Ga0496124_0077460 3300048927 Bacteria 2742
681 Ga0496124_0080829 3300048927 Bacteria 2673
682 Ga0496124_0134881 3300048927 Bacteria 1955
683 Ga0496124_0230198 3300048927 Bacteria 1386
684 Ga0496124_0271211 3300048927 Bacteria 1242
685 Ga0496125_0004406 3300048928 Bacteria 16271
686 Ga0496125_0005552 3300048928 Bacteria 13957
687 Ga0496125_0005750 3300048928 Bacteria 13642
688 Ga0496125_0006890 3300048928 Bacteria 12166
689 Ga0496125_0044519 3300048928 Bacteria 3752
690 Ga0496125_0056447 3300048928 Bacteria 3188
691 Ga0496125_0090789 3300048928 Bacteria 2291
692 Ga0496126_0005914 3300048929 Bacteria 13798
693 Ga0496126_0009365 3300048929 Bacteria 10408
694 Ga0496126_0042951 3300048929 Bacteria 4173
695 Ga0496126_0061724 3300048929 Bacteria 3366
696 Ga0496126_0136876 3300048929 Bacteria 2112
697 Ga0496126_0149731 3300048929 Bacteria 2001
698 Ga0496126_0196653 3300048929 Bacteria 1705
699 Ga0496126_0235085 3300048929 Bacteria 1533
700 Ga0496126_0620767 3300048929 Bacteria 849
701 Ga0495678_000496 3300049459 Bacteria 38859
702 Ga0495682_0005490 3300049460 Bacteria 5258
703 Ga0495682_0011390 3300049460 Bacteria 3422
704 Ga0501290_022888 3300049513 Bacteria 864
705 Ga0501031_0005288 3300049568 Bacteria 8410
706 Ga0501031_0017026 3300049568 Bacteria 4722
707 Ga0501031_0251651 3300049568 Bacteria 1148
708 Ga0501032_0034586 3300049569 Bacteria 3458
709 Ga0501032_0079460 3300049569 Bacteria 2184
710 Ga0501033_0000625 3300049570 Bacteria 32789
711 Ga0501033_0068791 3300049570 Bacteria 2603
712 Ga0501033_0240145 3300049570 Bacteria 1285
713 Ga0501033_0244952 3300049570 Bacteria 1271
714 Ga0501033_0270756 3300049570 Bacteria 1200
715 Ga0501034_0001242 3300049571 Bacteria 34633
716 Ga0501034_0008327 3300049571 Bacteria 10972
717 Ga0501034_0020621 3300049571 Bacteria 6732
718 Ga0501034_0391135 3300049571 Bacteria 1314
719 Ga0501034_0412529 3300049571 Bacteria 1272
720 Ga0501034_0501945 3300049571 Bacteria 1127
721 Ga0501036_0014053 3300049572 Bacteria 6654
722 Ga0501036_0039262 3300049572 Bacteria 4006
723 Ga0501037_0001197 3300049573 Bacteria 19151
724 Ga0501037_0211476 3300049573 Bacteria 1367
725 Ga0501038_0001241 3300049574 Bacteria 23114
726 Ga0501038_0021584 3300049574 Bacteria 5778
727 Ga0501038_0489529 3300049574 Bacteria 942
728 Ga0501039_0020714 3300049575 Bacteria 5039
729 Ga0501039_0040990 3300049575 Bacteria 3575
730 Ga0501039_0578773 3300049575 Bacteria 880
731 Ga0501042_0627364 3300049578 Bacteria 781
732 Ga0501043_0020013 3300049579 Bacteria 5253
733 Ga0501043_0053496 3300049579 Bacteria 3170
734 Ga0501043_0178100 3300049579 Bacteria 1657
735 Ga0501043_0697854 3300049579 Bacteria 741
736 Ga0501043_0818585 3300049579 Bacteria 672
737 Ga0501046_0130135 3300049580 Bacteria 1909
738 Ga0501047_0055064 3300049581 Bacteria 3847
739 Ga0501047_0201272 3300049581 Bacteria 1852
740 Ga0501047_0370336 3300049581 Bacteria 1267
741 Ga0501047_0400592 3300049581 Bacteria 1205
742 Ga0501048_0219207 3300049582 Bacteria 1349
743 Ga0501068_0072238 3300049584 Bacteria 2107
744 Ga0501069_0565928 3300049585 Bacteria 681
745 Ga0501070_0271621 3300049586 Bacteria 1384
746 Ga0501070_0518607 3300049586 Bacteria 956
747 Ga0501070_0794491 3300049586 Bacteria 743
748 Ga0501073_0031382 3300049589 Bacteria 3791
749 Ga0501217_112051 3300049661 Bacteria 785
750 Ga0501223_008846 3300049663 Bacteria 2049
751 Ga0501239_012302 3300049672 Bacteria 967
752 Ga0501243_005519 3300049675 Bacteria 1901
753 Ga0501253_033769 3300049683 Bacteria 992
754 Ga0501225_0103046 3300049705 Bacteria 835
755 Ga0501245_014636 3300049708 Bacteria 1173
756 Ga0501079_0166991 3300049741 Bacteria 1716
757 Ga0501080_0002129 3300049742 Bacteria 17199
758 Ga0501080_0023252 3300049742 Bacteria 5747
759 Ga0501266_003858 3300049763 Bacteria 1856
760 Ga0501266_018515 3300049763 Bacteria 937
761 Ga0501266_021107 3300049763 Bacteria 889
762 Ga0501267_013704 3300049764 Bacteria 845
763 Ga0501268_026763 3300049765 Bacteria 1021
764 Ga0501270_018667 3300049767 Bacteria 1030
765 Ga0501035_0002247 3300049822 Bacteria 19119
766 Ga0501035_0009719 3300049822 Bacteria 8947
767 Ga0501035_0076487 3300049822 Bacteria 2960
768 Ga0501035_0084774 3300049822 Bacteria 2794
769 Ga0501035_0301957 3300049822 Bacteria 1349
770 Ga0501035_0349423 3300049822 Bacteria 1237
771 Ga0501044_0002685 3300049823 Bacteria 20231
772 Ga0501044_0019061 3300049823 Bacteria 7345
773 Ga0501044_0037487 3300049823 Bacteria 5067
774 Ga0501044_0051758 3300049823 Bacteria 4233
775 Ga0501044_0096927 3300049823 Bacteria 2970
776 Ga0501044_0277800 3300049823 Bacteria 1609
777 Ga0501045_0279450 3300049824 Bacteria 1243
778 nmdc:mga03n38_197259_c1 3300050490 Bacteria 1040
779 nmdc:mga00v17_113447_c1 3300050491 Bacteria 1721
780 nmdc:mga00v17_1287_c1 3300050491 Bacteria 13178
781 nmdc:mga00v17_129755_c1 3300050491 Bacteria 1610
782 nmdc:mga00v17_18002_c1 3300050491 Bacteria 4009
783 nmdc:mga00v17_56465_c1 3300050491 Bacteria 2401
784 nmdc:mga0yw44_122802_c1 3300050492 Bacteria 1674
785 nmdc:mga0yw44_307442_c1 3300050492 Bacteria 1063
786 nmdc:mga07m45_127220_c1 3300050496 Bacteria 1473
787 nmdc:mga0sz30_40870_c2 3300050516 Bacteria 1583
788 Ga0500643_000029 3300053087 Bacteria 211149
789 Ga0500643_006120 3300053087 Bacteria 5081
790 Ga0500555_000324 3300053103 Bacteria 20582
791 Ga0500572_070424 3300053111 Bacteria 1080
792 Ga0500597_000107 3300053120 Bacteria 17442
793 Ga0500626_103771 3300053128 Bacteria 1236
794 Ga0500622_0211417 3300053156 Bacteria 875
795 Ga0500633_0019341 3300053160 Bacteria 2035
796 Ga0500634_0000022 3300053161 Bacteria 95424
797 Ga0500645_001107 3300053730 Bacteria 14742

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025981 Ga0207640_10003213 Ga0207640_100032137 137
2 3300003320 rootH2_10004458 rootH2_100044583 144
3 3300003323 rootH1_10232895 rootH1_102328952 144
4 3300049663 Ga0501223_008846 Ga0501223_008846_1492_2016 145
5 3300049763 Ga0501266_021107 Ga0501266_021107_313_837 145
6 3300003856 Ga0058692_1000035 Ga0058692_100003512 146
7 3300009148 Ga0105243_10122895 Ga0105243_101228953 146
8 3300027312 Ga0209371_1000043 Ga0209371_1000043123 146
9 3300030500 Ga0268256_1000044 Ga0268256_1000044123 146
10 3300041406 Ga0439439_0018180 Ga0439439_0018180_1136_1669 146
11 3300042006 Ga0439432_009293 Ga0439432_009293_2357_2890 146
12 3300042007 Ga0439449_0022386 Ga0439449_0022386_1685_2218 146
13 3300042015 Ga0439462_0060166 Ga0439462_0060166_349_882 146
14 3300042115 Ga0450911_000685 Ga0450911_000685_9415_9921 146
15 3300046525 Ga0495663_0003902 Ga0495663_0003902_3610_4116 146
16 3300046558 Ga0495633_0100422 Ga0495633_0100422_621_1127 146
17 3300048919 Ga0496116_0002306 Ga0496116_0002306_16400_16906 146
18 3300048920 Ga0496117_0048375 Ga0496117_0048375_274_780 146
19 3300048922 Ga0496119_0046207 Ga0496119_0046207_1941_2447 146
20 3300048923 Ga0496120_0283125 Ga0496120_0283125_40_546 146
21 3300048924 Ga0496121_0011014 Ga0496121_0011014_255_761 146
22 3300048925 Ga0496122_0251634 Ga0496122_0251634_121_627 146
23 3300048927 Ga0496124_0080829 Ga0496124_0080829_1922_2428 146
24 3300049573 Ga0501037_0211476 Ga0501037_0211476_865_1353 146
25 3300049763 Ga0501266_018515 Ga0501266_018515_17_550 146
26 3300038705 Ga0237819_02977 Ga0237819_02977_2174_2680 147
27 3300041459 Ga0451800_1649814 Ga0451800_1649814_768_1292 147
28 3300041462 Ga0451806_152401 Ga0451806_152401_2784_3308 147
29 3300041463 Ga0451804_1077436 Ga0451804_1077436_2631_3155 147
30 3300041486 Ga0451807_0590162 Ga0451807_0590162_2795_3319 147
31 3300041503 Ga0451847_0196122 Ga0451847_0196122_364_888 147
32 3300046525 Ga0495663_0032003 Ga0495663_0032003_831_1385 147
33 3300046539 Ga0495621_0031148 Ga0495621_0031148_1175_1729 147
34 3300046664 Ga0495659_0005748 Ga0495659_0005748_2340_2894 147
35 3300046691 Ga0495670_0051527 Ga0495670_0051527_472_1026 147
36 3300047318 Ga0495636_0008861 Ga0495636_0008861_3392_3946 147
37 3300032005 Ga0307411_10237077 Ga0307411_102370772 148
38 3300030745 Ga0316182_1115502 Ga0316182_11155025 149
39 3300048928 Ga0496125_0090789 Ga0496125_0090789_658_1188 149
40 3300049765 Ga0501268_026763 Ga0501268_026763_39_593 149
41 3300025229 Ga0209147_102946 Ga0209147_1029464 150
42 3300025303 Ga0209051_1001947 Ga0209051_10019472 150
43 3300031824 Ga0307413_10020613 Ga0307413_100206132 150
44 3300031903 Ga0307407_10228856 Ga0307407_102288562 150
45 3300031911 Ga0307412_10335285 Ga0307412_103352852 150
46 3300032005 Ga0307411_10056552 Ga0307411_100565522 150
47 3300042006 Ga0439432_022919 Ga0439432_022919_323_877 150
48 3300009093 Ga0105240_10128175 Ga0105240_101281751 151
49 3300009093 Ga0105240_10130625 Ga0105240_101306251 151
50 3300010375 Ga0105239_10000027 Ga0105239_10000027114 151
51 3300015265 Ga0182005_1001924 Ga0182005_10019247 151
52 3300025913 Ga0207695_10000441 Ga0207695_100004414 151
53 3300025935 Ga0207709_10020776 Ga0207709_100207764 151
54 3300031548 Ga0307408_100022323 Ga0307408_1000223233 151
55 3300031901 Ga0307406_10699296 Ga0307406_106992962 151
56 3300031911 Ga0307412_10075722 Ga0307412_100757224 151
57 3300032002 Ga0307416_100014059 Ga0307416_1000140594 151
58 3300032005 Ga0307411_10002861 Ga0307411_100028613 151
59 3300048907 Ga0496104_0014408 Ga0496104_0014408_3387_3920 151
60 3300048908 Ga0496105_0028149 Ga0496105_0028149_80_613 151
61 3300048919 Ga0496116_0101306 Ga0496116_0101306_312_845 151
62 3300048920 Ga0496117_0004983 Ga0496117_0004983_7370_7903 151
63 3300048921 Ga0496118_0198680 Ga0496118_0198680_119_652 151
64 3300048922 Ga0496119_0000235 Ga0496119_0000235_68231_68764 151
65 3300048923 Ga0496120_0000208 Ga0496120_0000208_31332_31865 151
66 3300048924 Ga0496121_0000480 Ga0496121_0000480_68769_69302 151
67 3300022467 Ga0224712_10118197 Ga0224712_101181971 152
68 3300003320 rootH2_10044786 rootH2_100447862 153
69 3300003323 rootH1_10107485 rootH1_101074852 153
70 3300003781 Ga0055536_1001746 Ga0055536_10017465 153
71 3300003856 Ga0058692_1000013 Ga0058692_100001399 153
72 3300005289 Ga0065704_10281216 Ga0065704_102812161 153
73 3300005456 Ga0070678_100011851 Ga0070678_1000118515 153
74 3300005548 Ga0070665_100924316 Ga0070665_1009243162 153
75 3300005985 Ga0081539_10019407 Ga0081539_100194072 153
76 3300009036 Ga0105244_10023892 Ga0105244_100238923 153
77 3300013104 Ga0157370_10096821 Ga0157370_100968212 153
78 3300015261 Ga0182006_1022419 Ga0182006_10224192 153
79 3300017792 Ga0163161_10020842 Ga0163161_100208423 153
80 3300025292 Ga0209676_1000037 Ga0209676_1000037154 153
81 3300025728 Ga0207655_1033595 Ga0207655_10335952 153
82 3300025935 Ga0207709_10002407 Ga0207709_100024077 153
83 3300026121 Ga0207683_10022073 Ga0207683_100220732 153
84 3300027312 Ga0209371_1000007 Ga0209371_1000007779 153
85 3300027378 Ga0209981_1030747 Ga0209981_10307472 153
86 3300028379 Ga0268266_10727213 Ga0268266_107272132 153
87 3300030500 Ga0268256_1000008 Ga0268256_1000008172 153
88 3300031911 Ga0307412_10001816 Ga0307412_100018164 153
89 3300032004 Ga0307414_10055143 Ga0307414_100551434 153
90 3300006186 Ga0075369_10181360 Ga0075369_101813602 154
91 3300025298 Ga0209050_1010110 Ga0209050_10101104 154
92 3300025304 Ga0209257_1034119 Ga0209257_10341192 154
93 3300041999 Ga0439433_0030390 Ga0439433_0030390_545_1099 154
94 3300048909 Ga0496106_0411828 Ga0496106_0411828_63_536 154
95 3300048920 Ga0496117_0008606 Ga0496117_0008606_1641_2114 154
96 3300048921 Ga0496118_0001013 Ga0496118_0001013_32857_33330 154
97 3300048924 Ga0496121_0000109 Ga0496121_0000109_15310_15783 154
98 3300048929 Ga0496126_0136876 Ga0496126_0136876_934_1407 154
99 3300049568 Ga0501031_0017026 Ga0501031_0017026_153_677 154
100 3300049571 Ga0501034_0008327 Ga0501034_0008327_4210_4743 154
101 3300030732 Ga0316176_1043775 Ga0316176_10437752 155
102 3300042006 Ga0439432_026696 Ga0439432_026696_493_1041 155
103 3300048903 Ga0496100_0513306 Ga0496100_0513306_291_824 155
104 3300048921 Ga0496118_0054643 Ga0496118_0054643_2463_2996 155
105 3300048922 Ga0496119_0010619 Ga0496119_0010619_6627_7160 155
106 3300048923 Ga0496120_0000282 Ga0496120_0000282_77656_78189 155
107 3300048929 Ga0496126_0009365 Ga0496126_0009365_6184_6717 155
108 3300048929 Ga0496126_0235085 Ga0496126_0235085_29_562 155
109 3300049579 Ga0501043_0818585 Ga0501043_0818585_32_571 155
110 3300049581 Ga0501047_0201272 Ga0501047_0201272_32_571 155
111 3300049822 Ga0501035_0349423 Ga0501035_0349423_13_552 155
112 3300049823 Ga0501044_0019061 Ga0501044_0019061_1272_1811 155
113 3300005546 Ga0070696_100004017 Ga0070696_1000040177 156
114 3300005614 Ga0068856_100000524 Ga0068856_10000052435 156
115 3300009177 Ga0105248_10000980 Ga0105248_100009802 156
116 3300013105 Ga0157369_10011268 Ga0157369_100112683 156
117 3300026078 Ga0207702_10003652 Ga0207702_100036529 156
118 3300049570 Ga0501033_0270756 Ga0501033_0270756_202_741 156
119 3300049571 Ga0501034_0391135 Ga0501034_0391135_372_911 156
120 3300049572 Ga0501036_0039262 Ga0501036_0039262_599_1138 156
121 3300049575 Ga0501039_0578773 Ga0501039_0578773_207_746 156
122 3300049578 Ga0501042_0627364 Ga0501042_0627364_31_570 156
123 3300049579 Ga0501043_0697854 Ga0501043_0697854_32_571 156
124 3300049580 Ga0501046_0130135 Ga0501046_0130135_599_1138 156
125 3300049581 Ga0501047_0370336 Ga0501047_0370336_32_571 156
126 3300049582 Ga0501048_0219207 Ga0501048_0219207_68_607 156
127 3300049585 Ga0501069_0565928 Ga0501069_0565928_19_558 156
128 3300049586 Ga0501070_0794491 Ga0501070_0794491_47_586 156
129 3300049742 Ga0501080_0023252 Ga0501080_0023252_317_856 156
130 3300049822 Ga0501035_0301957 Ga0501035_0301957_74_613 156
131 3300049823 Ga0501044_0051758 Ga0501044_0051758_400_939 156
132 3300049823 Ga0501044_0096927 Ga0501044_0096927_1451_1990 156
133 3300014326 Ga0157380_10530188 Ga0157380_105301882 157
134 3300046507 Ga0495606_0077532 Ga0495606_0077532_1513_2001 157
135 3300046691 Ga0495670_0000478 Ga0495670_0000478_7500_7997 157
136 iso_pu_bacteria 2842918807 2842920676 157
137 3300005458 Ga0070681_10350114 Ga0070681_103501141 158
138 3300025912 Ga0207707_10026404 Ga0207707_100264044 158
139 3300025921 Ga0207652_10131701 Ga0207652_101317012 158
140 3300005355 Ga0070671_101041160 Ga0070671_1010411602 159
141 3300025893 Ga0207682_10014641 Ga0207682_100146412 159
142 3300041441 Ga0451787_725098 Ga0451787_725098_428_907 159
143 3300041463 Ga0451804_0876128 Ga0451804_0876128_224_703 159
144 3300041512 Ga0451853_3210631 Ga0451853_3210631_41_571 159
145 3300005364 Ga0070673_101124699 Ga0070673_1011246991 160
146 3300005539 Ga0068853_100170552 Ga0068853_1001705522 160
147 3300014497 Ga0182008_10311799 Ga0182008_103117991 160
148 3300014968 Ga0157379_10935563 Ga0157379_109355632 160
149 3300020070 Ga0206356_10491941 Ga0206356_104919412 160
150 3300026023 Ga0207677_10307158 Ga0207677_103071582 160
151 3300026041 Ga0207639_10131720 Ga0207639_101317202 160
152 3300032005 Ga0307411_10558553 Ga0307411_105585532 160
153 3300041512 Ga0451853_1606826 Ga0451853_1606826_59_610 160
154 3300001979 JGI24740J21852_10040405 JGI24740J21852_100404052 161
155 3300002705 JGI25156J39149_1007841 JGI25156J39149_10078412 161
156 3300002741 JGI25157J39369_1001663 JGI25157J39369_10016632 161
157 3300003763 Ga0055529_1005753 Ga0055529_10057533 161
158 3300005337 Ga0070682_100008369 Ga0070682_1000083695 161
159 3300005354 Ga0070675_100494163 Ga0070675_1004941631 161
160 3300005455 Ga0070663_100081842 Ga0070663_1000818422 161
161 3300005456 Ga0070678_100094369 Ga0070678_1000943693 161
162 3300005547 Ga0070693_100017003 Ga0070693_1000170032 161
163 3300005563 Ga0068855_100013007 Ga0068855_1000130077 161
164 3300005564 Ga0070664_100084386 Ga0070664_1000843862 161
165 3300005578 Ga0068854_100176852 Ga0068854_1001768522 161
166 3300009093 Ga0105240_10023122 Ga0105240_100231227 161
167 3300009174 Ga0105241_10252420 Ga0105241_102524202 161
168 3300009545 Ga0105237_10000036 Ga0105237_10000036105 161
169 3300013104 Ga0157370_10015409 Ga0157370_100154095 161
170 3300013307 Ga0157372_10162705 Ga0157372_101627052 161
171 3300020082 Ga0206353_10172233 Ga0206353_101722333 161
172 3300025246 Ga0209646_1002196 Ga0209646_10021963 161
173 3300025250 Ga0209026_1000223 Ga0209026_100022360 161
174 3300025256 Ga0209759_1014486 Ga0209759_10144862 161
175 3300025272 Ga0209455_1000430 Ga0209455_10004306 161
176 3300025904 Ga0207647_10076216 Ga0207647_100762162 161
177 3300025911 Ga0207654_10128999 Ga0207654_101289992 161
178 3300025913 Ga0207695_10003481 Ga0207695_1000348110 161
179 3300025914 Ga0207671_10000135 Ga0207671_1000013595 161
180 3300025924 Ga0207694_10159608 Ga0207694_101596082 161
181 3300025931 Ga0207644_10113072 Ga0207644_101130722 161
182 3300025945 Ga0207679_10124890 Ga0207679_101248902 161
183 3300025949 Ga0207667_10075026 Ga0207667_100750262 161
184 3300026067 Ga0207678_10000643 Ga0207678_100006437 161
185 3300026121 Ga0207683_10020246 Ga0207683_100202463 161
186 3300014326 Ga0157380_10371759 Ga0157380_103717592 162
187 3300025304 Ga0209257_1000219 Ga0209257_100021923 162
188 3300042007 Ga0439449_0000277 Ga0439449_0000277_278_766 162
189 3300046453 Ga0495627_051825 Ga0495627_051825_491_982 162
190 3300049822 Ga0501035_0084774 Ga0501035_0084774_1037_1585 162
191 3300053161 Ga0500634_0000022 Ga0500634_0000022_37079_37570 162
192 iso_pu_bacteria 2593339238 2595449018 162
193 iso_pu_bacteria 2593339239 2595450316 162
194 iso_pu_bacteria 2718218334 2721025785 162
195 iso_pu_bacteria 2738543009 2739225661 162
196 iso_pu_bacteria 2818991440 2819566271 162
197 iso_pu_bacteria 2842914999 2842917114 162
198 iso_pu_bacteria 2884338543 2884339122 162
199 iso_pu_bacteria 2904463128 2904466547 162
200 iso_pu_bacteria 2919085039 2919086202 162
201 iso_pu_bacteria 2919404418 2919406861 162
202 iso_pu_bacteria 2941471342 2941471955 162
203 iso_pu_bacteria 2953994433 2953995953 162
204 3300005367 Ga0070667_100000085 Ga0070667_10000008566 163
205 3300005455 Ga0070663_100000045 Ga0070663_10000004543 163
206 3300005539 Ga0068853_100003376 Ga0068853_10000337611 163
207 3300005842 Ga0068858_101627569 Ga0068858_1016275691 163
208 3300009101 Ga0105247_10640208 Ga0105247_106402082 163
209 3300009545 Ga0105237_10006112 Ga0105237_100061129 163
210 3300009553 Ga0105249_10000335 Ga0105249_100003357 163
211 3300010375 Ga0105239_10416482 Ga0105239_104164822 163
212 3300025914 Ga0207671_10003134 Ga0207671_100031348 163
213 3300025941 Ga0207711_10004824 Ga0207711_100048248 163
214 3300025961 Ga0207712_10001764 Ga0207712_1000176410 163
215 3300025986 Ga0207658_10000032 Ga0207658_10000032118 163
216 3300026041 Ga0207639_10031649 Ga0207639_100316493 163
217 3300026067 Ga0207678_10000457 Ga0207678_1000045727 163
218 3300031824 Ga0307413_11370484 Ga0307413_113704841 163
219 3300032004 Ga0307414_10155622 Ga0307414_101556222 163
220 3300041456 Ga0451795_0661403 Ga0451795_0661403_508_1026 163
221 3300047472 Ga0495686_0000409 Ga0495686_0000409_65015_65533 163
222 3300047472 Ga0495686_0007418 Ga0495686_0007418_7030_7563 163
223 3300048911 Ga0496108_1267421 Ga0496108_1267421_12_506 163
224 3300048925 Ga0496122_0001004 Ga0496122_0001004_5972_6505 163
225 3300048926 Ga0496123_0000239 Ga0496123_0000239_6591_7124 163
226 3300048927 Ga0496124_0006332 Ga0496124_0006332_2404_2901 163
227 3300053087 Ga0500643_006120 Ga0500643_006120_1223_1759 163
228 3300053111 Ga0500572_070424 Ga0500572_070424_10_510 163
229 3300053120 Ga0500597_000107 Ga0500597_000107_13365_13898 163
230 iso_pu_bacteria 2734482264 2735834242 163
231 3300001904 JGI24736J21556_1001617 JGI24736J21556_10016174 164
232 3300005441 Ga0070700_100575143 Ga0070700_1005751431 164
233 3300009545 Ga0105237_10546847 Ga0105237_105468472 164
234 3300013104 Ga0157370_10019467 Ga0157370_100194676 164
235 3300013104 Ga0157370_10270060 Ga0157370_102700603 164
236 3300013105 Ga0157369_10000745 Ga0157369_1000074512 164
237 3300025904 Ga0207647_10000015 Ga0207647_10000015106 164
238 3300041453 Ga0451797_1565887 Ga0451797_1565887_79_579 164
239 3300041463 Ga0451804_1170276 Ga0451804_1170276_89_595 164
240 3300041999 Ga0439433_0077449 Ga0439433_0077449_32_529 164
241 3300047318 Ga0495636_0027609 Ga0495636_0027609_264_797 164
242 3300047472 Ga0495686_0000024 Ga0495686_0000024_301188_301715 164
243 3300048920 Ga0496117_0073042 Ga0496117_0073042_1479_2006 164
244 3300048921 Ga0496118_0001607 Ga0496118_0001607_6543_7070 164
245 3300048925 Ga0496122_0025748 Ga0496122_0025748_1001_1528 164
246 3300048925 Ga0496122_0346190 Ga0496122_0346190_76_603 164
247 3300048926 Ga0496123_0029599 Ga0496123_0029599_1395_1922 164
248 3300048928 Ga0496125_0004406 Ga0496125_0004406_1001_1528 164
249 3300049574 Ga0501038_0489529 Ga0501038_0489529_41_538 164
250 iso_pu_bacteria 2524614729 2525556445 164
251 iso_pu_bacteria 2537561836 2538833582 164
252 iso_pu_bacteria 2627854209 2630649674 164
253 iso_pu_bacteria 2687453130 2687584496 164
254 iso_pu_bacteria 2857442823 2857445138 164
255 iso_pu_bacteria 2895511927 2895512449 164
256 iso_pu_bacteria 2895522137 2895522460 164
257 iso_pu_bacteria 2895525241 2895525768 164
258 iso_pu_bacteria 2987605356 2987608591 164
259 3300002075 JGI24738J21930_10001153 JGI24738J21930_100011532 165
260 3300003558 Ga0006558J51389_1028497 Ga0006558J51389_10284972 165
261 3300003567 Ga0006554J51385_1022338 Ga0006554J51385_10223382 165
262 3300003578 Ga0006562J51391_1012709 Ga0006562J51391_10127095 165
263 3300003578 Ga0006562J51391_1012711 Ga0006562J51391_10127112 165
264 3300003762 Ga0055542_1012758 Ga0055542_10127582 165
265 3300003775 Ga0055524_1061261 Ga0055524_10612611 165
266 3300005262 Ga0065165_1000913 Ga0065165_10009139 165
267 3300005331 Ga0070670_100022831 Ga0070670_1000228313 165
268 3300005344 Ga0070661_100214433 Ga0070661_1002144332 165
269 3300005455 Ga0070663_100194098 Ga0070663_1001940982 165
270 3300005564 Ga0070664_101231545 Ga0070664_1012315451 165
271 3300005834 Ga0068851_10625703 Ga0068851_106257032 165
272 3300006186 Ga0075369_10296146 Ga0075369_102961462 165
273 3300006931 Ga0097620_100383554 Ga0097620_1003835542 165
274 3300009101 Ga0105247_10002807 Ga0105247_100028077 165
275 3300010375 Ga0105239_10202899 Ga0105239_102028993 165
276 3300010375 Ga0105239_10992781 Ga0105239_109927812 165
277 3300013104 Ga0157370_10000045 Ga0157370_10000045101 165
278 3300013306 Ga0163162_10398573 Ga0163162_103985732 165
279 3300014497 Ga0182008_10004060 Ga0182008_100040605 165
280 3300015261 Ga0182006_1000479 Ga0182006_10004797 165
281 3300015261 Ga0182006_1003624 Ga0182006_10036242 165
282 3300015262 Ga0182007_10033459 Ga0182007_100334592 165
283 3300015265 Ga0182005_1000113 Ga0182005_10001137 165
284 3300015265 Ga0182005_1001646 Ga0182005_10016463 165
285 3300015265 Ga0182005_1006350 Ga0182005_10063502 165
286 3300017792 Ga0163161_10007925 Ga0163161_100079254 165
287 3300017792 Ga0163161_10050833 Ga0163161_100508332 165
288 3300017792 Ga0163161_10480889 Ga0163161_104808891 165
289 3300025226 Ga0209674_100791 Ga0209674_1007914 165
290 3300025233 Ga0209437_102834 Ga0209437_1028344 165
291 3300025254 Ga0209148_1000762 Ga0209148_100076215 165
292 3300025258 Ga0209129_1001090 Ga0209129_100109010 165
293 3300025299 Ga0209256_1003863 Ga0209256_10038639 165
294 3300025302 Ga0207426_1017565 Ga0207426_10175652 165
295 3300025304 Ga0209257_1026691 Ga0209257_10266912 165
296 3300025900 Ga0207710_10005864 Ga0207710_100058643 165
297 3300025920 Ga0207649_10152857 Ga0207649_101528572 165
298 3300025924 Ga0207694_10025255 Ga0207694_100252554 165
299 3300025925 Ga0207650_10051036 Ga0207650_100510362 165
300 3300026067 Ga0207678_10147929 Ga0207678_101479293 165
301 3300031731 Ga0307405_10070178 Ga0307405_100701784 165
302 3300031824 Ga0307413_10388326 Ga0307413_103883262 165
303 3300031852 Ga0307410_10368852 Ga0307410_103688522 165
304 3300031911 Ga0307412_10000418 Ga0307412_1000041823 165
305 3300032005 Ga0307411_10165982 Ga0307411_101659822 165
306 3300041404 Ga0439436_0000007 Ga0439436_0000007_103684_104211 165
307 3300041413 Ga0439465_0000377 Ga0439465_0000377_4567_5094 165
308 3300042184 Ga0450908_000033 Ga0450908_000033_24759_25286 165
309 3300044672 Ga0466982_0010498 Ga0466982_0010498_820_1347 165
310 3300044842 Ga0466957_0041473 Ga0466957_0041473_1542_2069 165
311 3300046452 Ga0495617_000196 Ga0495617_000196_34970_35500 165
312 3300046452 Ga0495617_000318 Ga0495617_000318_24164_24694 165
313 3300046460 Ga0495638_0004464 Ga0495638_0004464_7464_7994 165
314 3300046460 Ga0495638_0132268 Ga0495638_0132268_57_584 165
315 3300046471 Ga0495650_0011065 Ga0495650_0011065_1994_2521 165
316 3300046491 Ga0495584_0000437 Ga0495584_0000437_22121_22648 165
317 3300046492 Ga0495585_0001305 Ga0495585_0001305_2498_3025 165
318 3300046492 Ga0495585_0176303 Ga0495585_0176303_197_724 165
319 3300046501 Ga0495607_0004515 Ga0495607_0004515_2739_3266 165
320 3300046501 Ga0495607_0015294 Ga0495607_0015294_2528_3055 165
321 3300046501 Ga0495607_0016250 Ga0495607_0016250_4024_4554 165
322 3300046506 Ga0495583_0015969 Ga0495583_0015969_469_999 165
323 3300046507 Ga0495606_0003552 Ga0495606_0003552_23_553 165
324 3300046507 Ga0495606_0005186 Ga0495606_0005186_4582_5109 165
325 3300046507 Ga0495606_0127978 Ga0495606_0127978_911_1438 165
326 3300046512 Ga0495610_0000971 Ga0495610_0000971_2688_3215 165
327 3300046512 Ga0495610_0016193 Ga0495610_0016193_1857_2384 165
328 3300046513 Ga0495616_0001042 Ga0495616_0001042_17456_17986 165
329 3300046515 Ga0495620_0000846 Ga0495620_0000846_15860_16390 165
330 3300046515 Ga0495620_0001915 Ga0495620_0001915_8280_8807 165
331 3300046518 Ga0495631_0000878 Ga0495631_0000878_1504_2031 165
332 3300046518 Ga0495631_0002764 Ga0495631_0002764_1909_2436 165
333 3300046519 Ga0495632_0000014 Ga0495632_0000014_138519_139046 165
334 3300046519 Ga0495632_0005070 Ga0495632_0005070_8213_8740 165
335 3300046519 Ga0495632_0071240 Ga0495632_0071240_677_1204 165
336 3300046524 Ga0495648_0002749 Ga0495648_0002749_82_612 165
337 3300046524 Ga0495648_0053514 Ga0495648_0053514_481_1008 165
338 3300046538 Ga0495609_0002407 Ga0495609_0002407_8539_9069 165
339 3300046557 Ga0495622_0068953 Ga0495622_0068953_281_808 165
340 3300046616 Ga0495668_0002891 Ga0495668_0002891_6087_6617 165
341 3300046648 Ga0495611_0000003 Ga0495611_0000003_35772_36302 165
342 3300046648 Ga0495611_0002170 Ga0495611_0002170_2474_3001 165
343 3300046660 Ga0495625_0000019 Ga0495625_0000019_270348_270878 165
344 3300046660 Ga0495625_0053094 Ga0495625_0053094_1579_2106 165
345 3300046665 Ga0495661_0008753 Ga0495661_0008753_3824_4351 165
346 3300046691 Ga0495670_0002610 Ga0495670_0002610_6054_6584 165
347 3300046691 Ga0495670_0061678 Ga0495670_0061678_1289_1816 165
348 3300046692 Ga0495671_0004102 Ga0495671_0004102_2612_3142 165
349 3300046694 Ga0495649_0030625 Ga0495649_0030625_1526_2053 165
350 3300046794 Ga0495589_0000408 Ga0495589_0000408_2598_3128 165
351 3300046810 Ga0495660_0000122 Ga0495660_0000122_26210_26740 165
352 3300046810 Ga0495660_0000268 Ga0495660_0000268_23626_24156 165
353 3300047323 Ga0495683_0004599 Ga0495683_0004599_1244_1771 165
354 3300047446 Ga0495679_000017 Ga0495679_000017_226911_227441 165
355 3300047469 Ga0495673_0000004 Ga0495673_0000004_927485_928015 165
356 3300047469 Ga0495673_0000347 Ga0495673_0000347_14212_14739 165
357 3300047469 Ga0495673_0001675 Ga0495673_0001675_30_560 165
358 3300047470 Ga0495681_0286146 Ga0495681_0286146_43_573 165
359 3300047472 Ga0495686_0037336 Ga0495686_0037336_72_599 165
360 3300047472 Ga0495686_0092833 Ga0495686_0092833_473_1000 165
361 3300047472 Ga0495686_0117408 Ga0495686_0117408_813_1343 165
362 3300048903 Ga0496100_0028515 Ga0496100_0028515_363_890 165
363 3300048904 Ga0496101_0002654 Ga0496101_0002654_9682_10209 165
364 3300048909 Ga0496106_0010123 Ga0496106_0010123_2770_3297 165
365 3300048920 Ga0496117_0374621 Ga0496117_0374621_29_556 165
366 3300048921 Ga0496118_0099230 Ga0496118_0099230_46_573 165
367 3300048921 Ga0496118_0160364 Ga0496118_0160364_279_806 165
368 3300048922 Ga0496119_0010179 Ga0496119_0010179_2567_3094 165
369 3300048924 Ga0496121_0002095 Ga0496121_0002095_7068_7598 165
370 3300048924 Ga0496121_0018291 Ga0496121_0018291_6477_7004 165
371 3300048924 Ga0496121_0100282 Ga0496121_0100282_1632_2162 165
372 3300048925 Ga0496122_0026466 Ga0496122_0026466_4133_4660 165
373 3300048925 Ga0496122_0177692 Ga0496122_0177692_362_889 165
374 3300048926 Ga0496123_0003580 Ga0496123_0003580_15016_15543 165
375 3300048926 Ga0496123_0063283 Ga0496123_0063283_818_1345 165
376 3300048927 Ga0496124_0001511 Ga0496124_0001511_2511_3038 165
377 3300048927 Ga0496124_0003515 Ga0496124_0003515_15236_15763 165
378 3300048929 Ga0496126_0196653 Ga0496126_0196653_1083_1613 165
379 3300049459 Ga0495678_000496 Ga0495678_000496_35691_36221 165
380 3300049460 Ga0495682_0005490 Ga0495682_0005490_880_1410 165
381 3300049460 Ga0495682_0011390 Ga0495682_0011390_1880_2407 165
382 3300049570 Ga0501033_0000625 Ga0501033_0000625_19676_20200 165
383 3300050516 nmdc:mga0sz30_40870_c2 nmdc:mga0sz30_40870_c2_860_1387 165
384 3300053087 Ga0500643_000029 Ga0500643_000029_35693_36223 165
385 3300053103 Ga0500555_000324 Ga0500555_000324_17452_17982 165
386 3300053160 Ga0500633_0019341 Ga0500633_0019341_603_1130 165
387 3300053730 Ga0500645_001107 Ga0500645_001107_7444_7971 165
388 3300005293 Ga0065715_10170654 Ga0065715_101706542 166
389 3300013308 Ga0157375_10169912 Ga0157375_101699123 166
390 3300046501 Ga0495607_0020055 Ga0495607_0020055_74_592 166
391 3300046501 Ga0495607_0422864 Ga0495607_0422864_74_592 166
392 3300046507 Ga0495606_0060310 Ga0495606_0060310_1790_2308 166
393 3300046616 Ga0495668_0413290 Ga0495668_0413290_54_569 166
394 3300046810 Ga0495660_0188229 Ga0495660_0188229_175_693 166
395 3300053156 Ga0500622_0211417 Ga0500622_0211417_20_538 166
396 iso_pu_bacteria 2816332141 2816518656 166
397 iso_pu_bacteria 2842391507 2842395553 166
398 iso_pu_bacteria 2842780639 2842783243 166
399 iso_pu_bacteria 2895498888 2895499428 166
400 iso_pu_bacteria 2961064222 2961066570 166
401 3300025960 Ga0207651_10216836 Ga0207651_102168361 167
402 3300035084 Ga0373928_0179764 Ga0373928_0179764_14_535 167
403 3300048904 Ga0496101_0449636 Ga0496101_0449636_140_658 167
404 3300048913 Ga0496110_0756592 Ga0496110_0756592_305_841 167
405 3300049822 Ga0501035_0009719 Ga0501035_0009719_1859_2398 167
406 iso_pu_bacteria 2643221559 2643816764 167
407 iso_pu_bacteria 2643221573 2643880859 167
408 iso_pu_bacteria 2643221586 2643938556 167
409 iso_pu_bacteria 2643221612 2644077697 167
410 iso_pu_bacteria 2643221720 2644661429 167
411 iso_pu_bacteria 2643221727 2644693988 167
412 iso_pu_bacteria 2643221728 2644699510 167
413 iso_pu_bacteria 2747842428 2747950267 167
414 iso_pu_bacteria 2765235840 2765580318 167
415 iso_pu_bacteria 2874220319 2874222990 167
416 iso_pu_bacteria 2919089067 2919092833 167
417 iso_pu_bacteria 2919134579 2919137423 167
418 iso_pu_bacteria 2928496128 2928499189 167
419 iso_pu_bacteria 2931380184 2931383547 167
420 iso_pu_bacteria 2937610967 2937614958 167
421 iso_pu_bacteria 2939626828 2939630267 167
422 iso_pu_bacteria 2961047084 2961049755 167
423 3300002774 JGI25150J39212_1027756 JGI25150J39212_10277561 168
424 3300003187 JGI25151J46595_10000116 JGI25151J46595_1000011642 168
425 3300025245 Ga0207425_1004713 Ga0207425_10047132 168
426 3300025294 Ga0209025_1000023 Ga0209025_1000023397 168
427 3300025297 Ga0209758_1008048 Ga0209758_10080482 168
428 3300025931 Ga0207644_10060876 Ga0207644_100608762 168
429 3300028379 Ga0268266_10358741 Ga0268266_103587412 168
430 3300031824 Ga0307413_10050947 Ga0307413_100509472 168
431 3300032004 Ga0307414_10036736 Ga0307414_100367364 168
432 3300044712 Ga0453684_0000159 Ga0453684_0000159_97680_98213 168
433 3300045051 Ga0451576_0000120 Ga0451576_0000120_97680_98213 168
434 3300048927 Ga0496124_0000218 Ga0496124_0000218_55431_55967 168
435 3300049568 Ga0501031_0251651 Ga0501031_0251651_251_775 168
436 3300049569 Ga0501032_0079460 Ga0501032_0079460_925_1449 168
437 3300049570 Ga0501033_0068791 Ga0501033_0068791_2055_2579 168
438 3300049570 Ga0501033_0240145 Ga0501033_0240145_538_1062 168
439 3300049571 Ga0501034_0412529 Ga0501034_0412529_325_849 168
440 3300049574 Ga0501038_0021584 Ga0501038_0021584_3565_4089 168
441 3300049575 Ga0501039_0040990 Ga0501039_0040990_2145_2669 168
442 3300049579 Ga0501043_0178100 Ga0501043_0178100_924_1448 168
443 3300049581 Ga0501047_0400592 Ga0501047_0400592_162_686 168
444 3300049586 Ga0501070_0518607 Ga0501070_0518607_17_541 168
445 3300049822 Ga0501035_0076487 Ga0501035_0076487_669_1193 168
446 3300049823 Ga0501044_0037487 Ga0501044_0037487_348_872 168
447 3300049823 Ga0501044_0277800 Ga0501044_0277800_664_1188 168
448 iso_pu_bacteria 2576861471 2578457177 168
449 iso_pu_bacteria 2747842501 2748019521 168
450 iso_pu_bacteria 2842757796 2842759151 168
451 iso_pu_bacteria 2852649853 2852652312 168
452 iso_pu_bacteria 2939589442 2939589636 168
453 iso_pu_bacteria 2939622612 2939624300 168
454 iso_pu_bacteria 2941475908 2941478928 168
455 iso_pu_bacteria 2974307012 2974307809 168
456 iso_pu_bacteria 2977247770 2977248528 168
457 iso_pu_bacteria 2984514374 2984516985 168
458 3300042007 Ga0439449_0009760 Ga0439449_0009760_1074_1616 169
459 3300045836 Ga0466958_0509475 Ga0466958_0509475_71_610 169
460 3300047472 Ga0495686_0016046 Ga0495686_0016046_2513_3040 169
461 3300049568 Ga0501031_0005288 Ga0501031_0005288_4077_4610 169
462 3300049569 Ga0501032_0034586 Ga0501032_0034586_1055_1588 169
463 3300049570 Ga0501033_0244952 Ga0501033_0244952_74_607 169
464 3300049571 Ga0501034_0020621 Ga0501034_0020621_3244_3777 169
465 3300049572 Ga0501036_0014053 Ga0501036_0014053_3166_3699 169
466 3300049573 Ga0501037_0001197 Ga0501037_0001197_16944_17477 169
467 3300049574 Ga0501038_0001241 Ga0501038_0001241_14843_15376 169
468 3300049575 Ga0501039_0020714 Ga0501039_0020714_2431_2964 169
469 3300049579 Ga0501043_0053496 Ga0501043_0053496_1213_1746 169
470 3300049581 Ga0501047_0055064 Ga0501047_0055064_760_1293 169
471 3300049584 Ga0501068_0072238 Ga0501068_0072238_1042_1575 169
472 3300049586 Ga0501070_0271621 Ga0501070_0271621_255_788 169
473 3300049589 Ga0501073_0031382 Ga0501073_0031382_3019_3552 169
474 3300049741 Ga0501079_0166991 Ga0501079_0166991_192_725 169
475 3300049742 Ga0501080_0002129 Ga0501080_0002129_4384_4917 169
476 3300049822 Ga0501035_0002247 Ga0501035_0002247_3214_3747 169
477 3300049823 Ga0501044_0002685 Ga0501044_0002685_16781_17314 169
478 iso_pu_bacteria 2571042365 2572254414 169
479 iso_pu_bacteria 2643221695 2644528286 169
480 iso_pu_bacteria 2941489479 2941493088 169
481 iso_pu_bacteria 8003014200 8003016991 169
482 3300005327 Ga0070658_10709156 Ga0070658_107091561 170
483 3300005336 Ga0070680_100389732 Ga0070680_1003897322 170
484 3300005339 Ga0070660_100089225 Ga0070660_1000892252 170
485 3300005344 Ga0070661_100330707 Ga0070661_1003307071 170
486 3300005366 Ga0070659_100144222 Ga0070659_1001442222 170
487 3300005458 Ga0070681_10336561 Ga0070681_103365612 170
488 3300005530 Ga0070679_100058369 Ga0070679_1000583692 170
489 3300005563 Ga0068855_101271375 Ga0068855_1012713752 170
490 3300005834 Ga0068851_10354686 Ga0068851_103546862 170
491 3300006051 Ga0075364_10000775 Ga0075364_1000077510 170
492 3300013100 Ga0157373_10073514 Ga0157373_100735142 170
493 3300013102 Ga0157371_10079356 Ga0157371_100793562 170
494 3300013105 Ga0157369_10048745 Ga0157369_100487452 170
495 3300013307 Ga0157372_10021401 Ga0157372_100214014 170
496 3300025909 Ga0207705_10108347 Ga0207705_101083472 170
497 3300025912 Ga0207707_10369250 Ga0207707_103692502 170
498 3300025919 Ga0207657_10003190 Ga0207657_100031905 170
499 3300025919 Ga0207657_10351503 Ga0207657_103515032 170
500 3300025921 Ga0207652_10494603 Ga0207652_104946032 170
501 3300025932 Ga0207690_10250292 Ga0207690_102502922 170
502 3300025933 Ga0207706_10589886 Ga0207706_105898862 170
503 3300025949 Ga0207667_10263378 Ga0207667_102633782 170
504 3300025949 Ga0207667_11129593 Ga0207667_111295932 170
505 3300037312 Ga0395899_0017129 Ga0395899_0017129_708_1259 170
506 3300037418 Ga0395900_0042677 Ga0395900_0042677_717_1250 170
507 3300037466 Ga0395898_0176943 Ga0395898_0176943_1104_1637 170
508 3300037471 Ga0395905_0000337 Ga0395905_0000337_34003_34554 170
509 3300037471 Ga0395905_0376645 Ga0395905_0376645_87_620 170
510 3300038443 Ga0395901_0578455 Ga0395901_0578455_524_1057 170
511 3300042012 Ga0439455_0043457 Ga0439455_0043457_510_1043 170
512 3300048904 Ga0496101_0044626 Ga0496101_0044626_2306_2857 170
513 3300048912 Ga0496109_0592418 Ga0496109_0592418_98_634 170
514 3300048916 Ga0496113_0105163 Ga0496113_0105163_278_829 170
515 3300049571 Ga0501034_0501945 Ga0501034_0501945_119_670 170
516 3300050491 nmdc:mga00v17_1287_c1 nmdc:mga00v17_1287_c1_1738_2289 170
517 iso_pu_bacteria 2643221581 2643914929 170
518 iso_pu_bacteria 2852684882 2852686958 170
519 iso_pu_bacteria 2919675420 2919676350 170
520 iso_pu_bacteria 2929195423 2929196502 170
521 iso_pu_bacteria 8021622325 8021626250 170
522 iso_pu_bacteria 8021626552 8021627691 170
523 iso_pu_bacteria 8021648035 8021651299 170
524 3300002773 JGI25152J39213_1000069 JGI25152J39213_100006928 171
525 3300002774 JGI25150J39212_1000214 JGI25150J39212_100021424 171
526 3300002774 JGI25150J39212_1000407 JGI25150J39212_100040715 171
527 3300003187 JGI25151J46595_10000105 JGI25151J46595_1000010553 171
528 3300003215 JGI25153J46596_10000077 JGI25153J46596_1000007743 171
529 3300003771 Ga0055526_1003098 Ga0055526_10030985 171
530 3300003773 Ga0055537_1000812 Ga0055537_10008126 171
531 3300003775 Ga0055524_1016948 Ga0055524_10169482 171
532 3300003784 Ga0055534_1000154 Ga0055534_100015410 171
533 3300003790 Ga0055528_1001412 Ga0055528_10014122 171
534 3300003790 Ga0055528_1002336 Ga0055528_10023369 171
535 3300003794 Ga0055531_10002804 Ga0055531_1000280410 171
536 3300005331 Ga0070670_100073464 Ga0070670_1000734642 171
537 3300005347 Ga0070668_100070732 Ga0070668_1000707321 171
538 3300005347 Ga0070668_101260099 Ga0070668_1012600992 171
539 3300005353 Ga0070669_100054658 Ga0070669_1000546584 171
540 3300005356 Ga0070674_100053729 Ga0070674_1000537293 171
541 3300005459 Ga0068867_100047934 Ga0068867_1000479343 171
542 3300005543 Ga0070672_100057956 Ga0070672_1000579564 171
543 3300005548 Ga0070665_100071908 Ga0070665_1000719082 171
544 3300006038 Ga0075365_10193304 Ga0075365_101933042 171
545 3300006051 Ga0075364_10037648 Ga0075364_100376484 171
546 3300006051 Ga0075364_10577264 Ga0075364_105772641 171
547 3300006353 Ga0075370_10085036 Ga0075370_100850362 171
548 3300009011 Ga0105251_10019456 Ga0105251_100194562 171
549 3300009036 Ga0105244_10038830 Ga0105244_100388302 171
550 3300009036 Ga0105244_10104717 Ga0105244_101047172 171
551 3300009148 Ga0105243_10207021 Ga0105243_102070212 171
552 3300013100 Ga0157373_10152758 Ga0157373_101527582 171
553 3300013100 Ga0157373_10377225 Ga0157373_103772252 171
554 3300013102 Ga0157371_10000184 Ga0157371_1000018470 171
555 3300013102 Ga0157371_10190080 Ga0157371_101900802 171
556 3300013102 Ga0157371_10678202 Ga0157371_106782022 171
557 3300013104 Ga0157370_10001564 Ga0157370_100015649 171
558 3300013104 Ga0157370_10366785 Ga0157370_103667852 171
559 3300013104 Ga0157370_10435598 Ga0157370_104355982 171
560 3300013306 Ga0163162_10325108 Ga0163162_103251083 171
561 3300013308 Ga0157375_10140509 Ga0157375_101405092 171
562 3300014326 Ga0157380_10098081 Ga0157380_100980813 171
563 3300014497 Ga0182008_10023563 Ga0182008_100235631 171
564 3300014497 Ga0182008_10037026 Ga0182008_100370262 171
565 3300015262 Ga0182007_10000219 Ga0182007_1000021925 171
566 3300015265 Ga0182005_1000213 Ga0182005_10002139 171
567 3300015689 Ga0183360_10001 Ga0183360_1000134 171
568 3300017792 Ga0163161_10118324 Ga0163161_101183243 171
569 3300025245 Ga0207425_1000045 Ga0207425_100004552 171
570 3300025258 Ga0209129_1000057 Ga0209129_100005777 171
571 3300025263 Ga0209565_1000023 Ga0209565_100002370 171
572 3300025263 Ga0209565_1019738 Ga0209565_10197382 171
573 3300025273 Ga0209673_1000047 Ga0209673_1000047243 171
574 3300025284 Ga0209130_1002629 Ga0209130_10026294 171
575 3300025291 Ga0209675_1000016 Ga0209675_1000016176 171
576 3300025292 Ga0209676_1000160 Ga0209676_100016085 171
577 3300025294 Ga0209025_1000013 Ga0209025_1000013144 171
578 3300025294 Ga0209025_1002654 Ga0209025_100265410 171
579 3300025295 Ga0209564_1000194 Ga0209564_100019435 171
580 3300025297 Ga0209758_1000014 Ga0209758_1000014144 171
581 3300025298 Ga0209050_1000352 Ga0209050_100035258 171
582 3300025299 Ga0209256_1005406 Ga0209256_10054067 171
583 3300025303 Ga0209051_1002836 Ga0209051_10028365 171
584 3300025304 Ga0209257_1000177 Ga0209257_100017758 171
585 3300025304 Ga0209257_1000383 Ga0209257_10003834 171
586 3300025304 Ga0209257_1066742 Ga0209257_10667422 171
587 3300025735 Ga0207713_1066409 Ga0207713_10664092 171
588 3300025923 Ga0207681_10041006 Ga0207681_100410064 171
589 3300025925 Ga0207650_10048024 Ga0207650_100480242 171
590 3300025937 Ga0207669_10045553 Ga0207669_100455533 171
591 3300025940 Ga0207691_10019809 Ga0207691_100198095 171
592 3300025972 Ga0207668_10023924 Ga0207668_100239242 171
593 3300025986 Ga0207658_10244527 Ga0207658_102445271 171
594 3300026089 Ga0207648_10208557 Ga0207648_102085573 171
595 3300028379 Ga0268266_10124490 Ga0268266_101244901 171
596 3300030732 Ga0316176_1036603 Ga0316176_10366033 171
597 3300030742 Ga0316183_1159014 Ga0316183_11590143 171
598 3300030744 Ga0316181_1256419 Ga0316181_12564192 171
599 3300032002 Ga0307416_101238140 Ga0307416_1012381401 171
600 3300032004 Ga0307414_10260251 Ga0307414_102602512 171
601 3300032005 Ga0307411_10203128 Ga0307411_102031282 171
602 3300038705 Ga0237819_00177 Ga0237819_00177_2834_3367 171
603 3300041443 Ga0451789_0245027 Ga0451789_0245027_117_653 171
604 3300041509 Ga0451843_0193634 Ga0451843_0193634_546_1079 171
605 3300041512 Ga0451853_4086402 Ga0451853_4086402_190_726 171
606 3300041999 Ga0439433_0026674 Ga0439433_0026674_592_1140 171
607 3300046453 Ga0495627_010605 Ga0495627_010605_955_1488 171
608 3300046453 Ga0495627_032692 Ga0495627_032692_271_804 171
609 3300046458 Ga0495591_034329 Ga0495591_034329_228_761 171
610 3300046460 Ga0495638_0002849 Ga0495638_0002849_10077_10610 171
611 3300046512 Ga0495610_0015601 Ga0495610_0015601_1653_2189 171
612 3300046518 Ga0495631_0010947 Ga0495631_0010947_1659_2195 171
613 3300046522 Ga0495643_0002141 Ga0495643_0002141_8170_8706 171
614 3300046525 Ga0495663_0001801 Ga0495663_0001801_3081_3614 171
615 3300046525 Ga0495663_0009609 Ga0495663_0009609_662_1195 171
616 3300046525 Ga0495663_0228027 Ga0495663_0228027_50_586 171
617 3300046537 Ga0495598_0001908 Ga0495598_0001908_1638_2183 171
618 3300046538 Ga0495609_0223113 Ga0495609_0223113_133_666 171
619 3300046539 Ga0495621_0044186 Ga0495621_0044186_546_1091 171
620 3300046558 Ga0495633_0023836 Ga0495633_0023836_691_1224 171
621 3300046558 Ga0495633_0191777 Ga0495633_0191777_158_691 171
622 3300046660 Ga0495625_0107868 Ga0495625_0107868_782_1318 171
623 3300046810 Ga0495660_0047807 Ga0495660_0047807_613_1149 171
624 3300047320 Ga0495672_0001225 Ga0495672_0001225_11829_12365 171
625 3300047472 Ga0495686_0004194 Ga0495686_0004194_9907_10443 171
626 3300048907 Ga0496104_0148328 Ga0496104_0148328_542_1078 171
627 3300048908 Ga0496105_0045875 Ga0496105_0045875_2055_2591 171
628 3300048911 Ga0496108_0832326 Ga0496108_0832326_145_690 171
629 3300048919 Ga0496116_0019218 Ga0496116_0019218_1713_2249 171
630 3300048919 Ga0496116_0064796 Ga0496116_0064796_1176_1712 171
631 3300048920 Ga0496117_0001871 Ga0496117_0001871_9787_10320 171
632 3300048920 Ga0496117_0004092 Ga0496117_0004092_10383_10916 171
633 3300048920 Ga0496117_0024752 Ga0496117_0024752_2534_3067 171
634 3300048920 Ga0496117_0268874 Ga0496117_0268874_256_792 171
635 3300048921 Ga0496118_0002036 Ga0496118_0002036_10025_10558 171
636 3300048921 Ga0496118_0035718 Ga0496118_0035718_1738_2271 171
637 3300048921 Ga0496118_0049568 Ga0496118_0049568_1104_1640 171
638 3300048921 Ga0496118_0175261 Ga0496118_0175261_211_747 171
639 3300048922 Ga0496119_0003558 Ga0496119_0003558_7093_7629 171
640 3300048923 Ga0496120_0000970 Ga0496120_0000970_29877_30413 171
641 3300048924 Ga0496121_0000752 Ga0496121_0000752_49160_49702 171
642 3300048924 Ga0496121_0007074 Ga0496121_0007074_9920_10453 171
643 3300048924 Ga0496121_0017014 Ga0496121_0017014_6526_7062 171
644 3300048924 Ga0496121_0079150 Ga0496121_0079150_619_1155 171
645 3300048925 Ga0496122_0009282 Ga0496122_0009282_159_695 171
646 3300048926 Ga0496123_0044731 Ga0496123_0044731_227_760 171
647 3300048926 Ga0496123_0057633 Ga0496123_0057633_1767_2300 171
648 3300048926 Ga0496123_0062757 Ga0496123_0062757_1730_2266 171
649 3300048927 Ga0496124_0001341 Ga0496124_0001341_20895_21431 171
650 3300048927 Ga0496124_0004411 Ga0496124_0004411_13281_13817 171
651 3300048927 Ga0496124_0007149 Ga0496124_0007149_2193_2726 171
652 3300048927 Ga0496124_0008850 Ga0496124_0008850_9459_9995 171
653 3300048927 Ga0496124_0077460 Ga0496124_0077460_1921_2454 171
654 3300048927 Ga0496124_0134881 Ga0496124_0134881_41_574 171
655 3300048927 Ga0496124_0271211 Ga0496124_0271211_41_574 171
656 3300048928 Ga0496125_0005552 Ga0496125_0005552_11320_11856 171
657 3300048928 Ga0496125_0005750 Ga0496125_0005750_3201_3734 171
658 3300048928 Ga0496125_0006890 Ga0496125_0006890_1472_2008 171
659 3300048928 Ga0496125_0044519 Ga0496125_0044519_2468_3004 171
660 3300048928 Ga0496125_0056447 Ga0496125_0056447_1569_2105 171
661 3300048929 Ga0496126_0005914 Ga0496126_0005914_3224_3760 171
662 3300048929 Ga0496126_0061724 Ga0496126_0061724_1103_1636 171
663 3300048929 Ga0496126_0149731 Ga0496126_0149731_1327_1860 171
664 3300050490 nmdc:mga03n38_197259_c1 nmdc:mga03n38_197259_c1_299_835 171
665 3300050491 nmdc:mga00v17_113447_c1 nmdc:mga00v17_113447_c1_152_685 171
666 3300050491 nmdc:mga00v17_129755_c1 nmdc:mga00v17_129755_c1_753_1289 171
667 3300050491 nmdc:mga00v17_18002_c1 nmdc:mga00v17_18002_c1_1809_2345 171
668 3300050492 nmdc:mga0yw44_122802_c1 nmdc:mga0yw44_122802_c1_23_556 171
669 3300050492 nmdc:mga0yw44_307442_c1 nmdc:mga0yw44_307442_c1_306_842 171
670 3300050496 nmdc:mga07m45_127220_c1 nmdc:mga07m45_127220_c1_362_898 171
671 3300053128 Ga0500626_103771 Ga0500626_103771_297_830 171
672 iso_pu_bacteria 2643221579 2643905242 171
673 iso_pu_bacteria 2643221593 2643973780 171
674 iso_pu_bacteria 2919513703 2919515029 171
675 iso_pu_bacteria 2923516293 2923517356 171
676 iso_pu_bacteria 8002869464 8002871102 171
677 3300003322 rootL2_10073749 rootL2_100737492 172
678 3300003781 Ga0055536_1006277 Ga0055536_10062774 172
679 3300003784 Ga0055534_1011218 Ga0055534_10112182 172
680 3300003791 Ga0055530_10001477 Ga0055530_100014774 172
681 3300003794 Ga0055531_10013393 Ga0055531_100133932 172
682 3300003794 Ga0055531_10017692 Ga0055531_100176922 172
683 3300003794 Ga0055531_10030559 Ga0055531_100305592 172
684 3300005337 Ga0070682_100105533 Ga0070682_1001055332 172
685 3300005347 Ga0070668_100203858 Ga0070668_1002038582 172
686 3300006051 Ga0075364_10010917 Ga0075364_100109174 172
687 3300009993 Ga0105028_107380 Ga0105028_1073802 172
688 3300013102 Ga0157371_10120730 Ga0157371_101207302 172
689 3300013307 Ga0157372_10787582 Ga0157372_107875822 172
690 3300025273 Ga0209673_1029483 Ga0209673_10294832 172
691 3300025284 Ga0209130_1024994 Ga0209130_10249942 172
692 3300025291 Ga0209675_1008269 Ga0209675_10082691 172
693 3300025291 Ga0209675_1046930 Ga0209675_10469301 172
694 3300025292 Ga0209676_1000027 Ga0209676_1000027378 172
695 3300025292 Ga0209676_1000280 Ga0209676_100028026 172
696 3300025292 Ga0209676_1002509 Ga0209676_10025098 172
697 3300025292 Ga0209676_1003026 Ga0209676_10030267 172
698 3300025294 Ga0209025_1028791 Ga0209025_10287912 172
699 3300025294 Ga0209025_1030183 Ga0209025_10301834 172
700 3300025295 Ga0209564_1004607 Ga0209564_10046077 172
701 3300025298 Ga0209050_1000714 Ga0209050_100071440 172
702 3300025298 Ga0209050_1000833 Ga0209050_100083316 172
703 3300025298 Ga0209050_1026372 Ga0209050_10263722 172
704 3300025299 Ga0209256_1003154 Ga0209256_10031544 172
705 3300025299 Ga0209256_1020798 Ga0209256_10207981 172
706 3300025299 Ga0209256_1020801 Ga0209256_10208011 172
707 3300025303 Ga0209051_1006389 Ga0209051_10063892 172
708 3300025304 Ga0209257_1000198 Ga0209257_100019845 172
709 3300025304 Ga0209257_1003088 Ga0209257_10030881 172
710 3300025304 Ga0209257_1003813 Ga0209257_10038139 172
711 3300025304 Ga0209257_1007629 Ga0209257_10076293 172
712 3300027378 Ga0209981_1027589 Ga0209981_10275892 172
713 3300027424 Ga0209984_1003224 Ga0209984_10032243 172
714 3300027462 Ga0210000_1003909 Ga0210000_10039092 172
715 3300027471 Ga0209995_1000902 Ga0209995_10009025 172
716 3300027543 Ga0209999_1000249 Ga0209999_10002493 172
717 3300027552 Ga0209982_1002809 Ga0209982_10028092 172
718 3300027614 Ga0209970_1002517 Ga0209970_10025172 172
719 3300027665 Ga0209983_1006804 Ga0209983_10068042 172
720 3300027682 Ga0209971_1000743 Ga0209971_10007435 172
721 3300027876 Ga0209974_10034122 Ga0209974_100341222 172
722 3300032004 Ga0307414_10641852 Ga0307414_106418522 172
723 3300041413 Ga0439465_0017038 Ga0439465_0017038_1497_2051 172
724 3300042006 Ga0439432_015910 Ga0439432_015910_1599_2153 172
725 3300042007 Ga0439449_0050465 Ga0439449_0050465_761_1315 172
726 3300042010 Ga0439452_009962 Ga0439452_009962_1488_2042 172
727 3300046691 Ga0495670_0380437 Ga0495670_0380437_113_667 172
728 3300047318 Ga0495636_0021723 Ga0495636_0021723_434_988 172
729 3300047445 Ga0495677_0104255 Ga0495677_0104255_471_1004 172
730 3300048913 Ga0496110_0860118 Ga0496110_0860118_44_577 172
731 3300049579 Ga0501043_0020013 Ga0501043_0020013_1704_2255 172
732 3300049824 Ga0501045_0279450 Ga0501045_0279450_298_852 172
733 3300050491 nmdc:mga00v17_56465_c1 nmdc:mga00v17_56465_c1_1543_2085 172
734 iso_pu_bacteria 2995948881 2995953169 172
735 3300005331 Ga0070670_100046378 Ga0070670_1000463782 173
736 3300005344 Ga0070661_100491765 Ga0070661_1004917652 173
737 3300005353 Ga0070669_101051101 Ga0070669_1010511011 173
738 3300005355 Ga0070671_100010249 Ga0070671_1000102496 173
739 3300005364 Ga0070673_100426619 Ga0070673_1004266192 173
740 3300005841 Ga0068863_100123053 Ga0068863_1001230533 173
741 3300012482 Ga0157318_1002656 Ga0157318_10026562 173
742 3300012491 Ga0157329_1001393 Ga0157329_10013932 173
743 3300012503 Ga0157313_1002762 Ga0157313_10027622 173
744 3300012512 Ga0157327_1000513 Ga0157327_10005132 173
745 3300025923 Ga0207681_10690832 Ga0207681_106908322 173
746 3300025925 Ga0207650_10047972 Ga0207650_100479722 173
747 3300026088 Ga0207641_10243464 Ga0207641_102434642 173
748 3300026095 Ga0207676_10065408 Ga0207676_100654082 173
749 3300031548 Ga0307408_101240522 Ga0307408_1012405222 173
750 3300031824 Ga0307413_10001208 Ga0307413_100012084 173
751 3300031852 Ga0307410_10149155 Ga0307410_101491552 173
752 3300031901 Ga0307406_10312628 Ga0307406_103126282 173
753 3300031911 Ga0307412_10031352 Ga0307412_100313522 173
754 3300031911 Ga0307412_10091960 Ga0307412_100919602 173
755 3300032004 Ga0307414_10116249 Ga0307414_101162492 173
756 3300032004 Ga0307414_10676518 Ga0307414_106765182 173
757 3300032005 Ga0307411_10506159 Ga0307411_105061592 173
758 3300037471 Ga0395905_0565449 Ga0395905_0565449_462_1019 173
759 3300041451 Ga0451791_1601024 Ga0451791_1601024_44_586 173
760 3300046525 Ga0495663_0009906 Ga0495663_0009906_687_1223 173
761 3300046615 Ga0495656_0003602 Ga0495656_0003602_3705_4241 173
762 3300047318 Ga0495636_0028371 Ga0495636_0028371_1461_1997 173
763 3300048903 Ga0496100_0323639 Ga0496100_0323639_140_676 173
764 3300048909 Ga0496106_0037617 Ga0496106_0037617_402_938 173
765 3300048911 Ga0496108_0018627 Ga0496108_0018627_3136_3672 173
766 3300048912 Ga0496109_0043422 Ga0496109_0043422_3385_3921 173
767 3300048914 Ga0496111_0007874 Ga0496111_0007874_3385_3921 173
768 3300048915 Ga0496112_0055973 Ga0496112_0055973_1889_2425 173
769 3300048916 Ga0496113_0046111 Ga0496113_0046111_500_1036 173
770 3300048925 Ga0496122_0095588 Ga0496122_0095588_308_844 173
771 3300048926 Ga0496123_0008951 Ga0496123_0008951_6697_7233 173
772 3300048929 Ga0496126_0620767 Ga0496126_0620767_259_795 173
773 3300003773 Ga0055537_1000088 Ga0055537_10000886 174
774 3300003775 Ga0055524_1000074 Ga0055524_100007457 174
775 3300003784 Ga0055534_1000097 Ga0055534_10000976 174
776 3300003790 Ga0055528_1000028 Ga0055528_100002857 174
777 3300025263 Ga0209565_1000034 Ga0209565_1000034218 174
778 3300025273 Ga0209673_1000039 Ga0209673_1000039218 174
779 3300025291 Ga0209675_1000023 Ga0209675_1000023218 174
780 3300025295 Ga0209564_1000066 Ga0209564_100006655 174
781 3300025299 Ga0209256_1000048 Ga0209256_1000048218 174
782 3300030733 Ga0314311_1072890 Ga0314311_10728902 174
783 3300031548 Ga0307408_100216471 Ga0307408_1002164712 174
784 3300031731 Ga0307405_10022245 Ga0307405_100222453 174
785 3300031824 Ga0307413_10044622 Ga0307413_100446224 174
786 3300031824 Ga0307413_10073588 Ga0307413_100735883 174
787 3300031824 Ga0307413_10870234 Ga0307413_108702341 174
788 3300031852 Ga0307410_10014783 Ga0307410_100147833 174
789 3300031852 Ga0307410_10123834 Ga0307410_101238341 174
790 3300031901 Ga0307406_10000978 Ga0307406_100009782 174
791 3300031901 Ga0307406_10013019 Ga0307406_100130192 174
792 3300031903 Ga0307407_10076809 Ga0307407_100768092 174
793 3300031903 Ga0307407_10127462 Ga0307407_101274621 174
794 3300031911 Ga0307412_10045343 Ga0307412_100453432 174
795 3300031911 Ga0307412_10192504 Ga0307412_101925042 174
796 3300031995 Ga0307409_100031440 Ga0307409_1000314405 174
797 3300031995 Ga0307409_100046744 Ga0307409_1000467442 174
798 3300031995 Ga0307409_100996607 Ga0307409_1009966072 174
799 3300032002 Ga0307416_100039180 Ga0307416_1000391804 174
800 3300032004 Ga0307414_10003104 Ga0307414_100031042 174
801 3300032004 Ga0307414_10062348 Ga0307414_100623482 174
802 3300032004 Ga0307414_10079320 Ga0307414_100793202 174
803 3300032005 Ga0307411_10105527 Ga0307411_101055272 174
804 3300032005 Ga0307411_10562721 Ga0307411_105627211 174
805 3300039145 Ga0237816_03081 Ga0237816_03081_294_833 174
806 3300041404 Ga0439436_0034362 Ga0439436_0034362_326_877 174
807 3300041407 Ga0439447_000808 Ga0439447_000808_8346_8897 174
808 3300041413 Ga0439465_0000214 Ga0439465_0000214_8671_9210 174
809 3300042004 Ga0439445_0012311 Ga0439445_0012311_143_682 174
810 3300046558 Ga0495633_0010539 Ga0495633_0010539_2889_3473 174
811 3300046616 Ga0495668_0000890 Ga0495668_0000890_9048_9599 174
812 3300048911 Ga0496108_0164470 Ga0496108_0164470_1085_1636 174
813 3300049513 Ga0501290_022888 Ga0501290_022888_68_607 174
814 3300049661 Ga0501217_112051 Ga0501217_112051_83_622 174
815 3300049672 Ga0501239_012302 Ga0501239_012302_235_774 174
816 3300049675 Ga0501243_005519 Ga0501243_005519_609_1148 174
817 3300049683 Ga0501253_033769 Ga0501253_033769_307_846 174
818 3300049705 Ga0501225_0103046 Ga0501225_0103046_271_810 174
819 3300049708 Ga0501245_014636 Ga0501245_014636_71_610 174
820 3300049763 Ga0501266_003858 Ga0501266_003858_943_1482 174
821 3300049764 Ga0501267_013704 Ga0501267_013704_91_630 174
822 3300049767 Ga0501270_018667 Ga0501270_018667_365_904 174
823 2162886007 SwRhRL2b_contig_3797405 SwRhRL2b_0206.00004290 175
824 3300005289 Ga0065704_10098945 Ga0065704_100989452 175
825 3300005435 Ga0070714_100752166 Ga0070714_1007521662 175
826 3300005548 Ga0070665_100166741 Ga0070665_1001667412 175
827 3300025304 Ga0209257_1000046 Ga0209257_100004692 175
828 3300028379 Ga0268266_10187018 Ga0268266_101870182 175
829 3300031456 Ga0307513_10037233 Ga0307513_100372334 175
830 3300031456 Ga0307513_10267221 Ga0307513_102672212 175
831 3300031824 Ga0307413_10041782 Ga0307413_100417824 175
832 3300031824 Ga0307413_10475602 Ga0307413_104756022 175
833 3300031824 Ga0307413_10773997 Ga0307413_107739972 175
834 3300031852 Ga0307410_10300824 Ga0307410_103008242 175
835 3300032004 Ga0307414_10001338 Ga0307414_100013389 175
836 3300032004 Ga0307414_10021898 Ga0307414_100218982 175
837 3300032004 Ga0307414_10344181 Ga0307414_103441811 175
838 3300032005 Ga0307411_10054444 Ga0307411_100544443 175
839 3300032005 Ga0307411_10183876 Ga0307411_101838762 175
840 3300037471 Ga0395905_0006093 Ga0395905_0006093_9120_9677 175
841 3300037471 Ga0395905_0019088 Ga0395905_0019088_3084_3641 175
842 3300038443 Ga0395901_0088389 Ga0395901_0088389_230_787 175
843 3300041413 Ga0439465_0000615 Ga0439465_0000615_689_1237 175
844 3300041413 Ga0439465_0003455 Ga0439465_0003455_38_586 175
845 3300041443 Ga0451789_1055925 Ga0451789_1055925_367_915 175
846 3300041451 Ga0451791_0725227 Ga0451791_0725227_104_655 175
847 3300041451 Ga0451791_0976915 Ga0451791_0976915_322_870 175
848 3300041452 Ga0451793_1805861 Ga0451793_1805861_127_675 175
849 3300041486 Ga0451807_1916965 Ga0451807_1916965_71_619 175
850 3300041494 Ga0451837_1238404 Ga0451837_1238404_282_833 175
851 3300041494 Ga0451837_1399073 Ga0451837_1399073_670_1218 175
852 3300041509 Ga0451843_0056262 Ga0451843_0056262_1744_2295 175
853 3300041509 Ga0451843_1149050 Ga0451843_1149050_1851_2399 175
854 3300041512 Ga0451853_1261890 Ga0451853_1261890_160_708 175
855 3300042004 Ga0439445_0064993 Ga0439445_0064993_408_956 175
856 3300042007 Ga0439449_0003655 Ga0439449_0003655_4374_4922 175
857 3300042125 Ga0450923_020142 Ga0450923_020142_171_719 175
858 3300046513 Ga0495616_0184079 Ga0495616_0184079_177_725 175
859 3300046525 Ga0495663_0001222 Ga0495663_0001222_5270_5818 175
860 3300046615 Ga0495656_0063588 Ga0495656_0063588_387_935 175
861 3300046692 Ga0495671_0003233 Ga0495671_0003233_3236_3784 175
862 3300048090 Ga0495615_0022313 Ga0495615_0022313_337_885 175
863 3300048905 Ga0496102_0202573 Ga0496102_0202573_664_1215 175
864 3300048917 Ga0496114_0004048 Ga0496114_0004048_4635_5162 175
865 3300048925 Ga0496122_0034096 Ga0496122_0034096_2406_2954 175
866 3300048926 Ga0496123_0057107 Ga0496123_0057107_765_1313 175
867 3300048927 Ga0496124_0230198 Ga0496124_0230198_819_1361 175
868 3300048929 Ga0496126_0042951 Ga0496126_0042951_2669_3196 175
869 3300049571 Ga0501034_0001242 Ga0501034_0001242_26501_27028 175

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04351

PilP

Pilus assembly protein, PilP

51

191

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2y4y-assembly1.cif.gz_A-2 structure of a domain from the type iv pilus biogenesis lipoprotein pilp, from pseudomonas aeruginosa 0.9279 84 173
2y4y-assembly1.cif.gz_C-2 structure of a domain from the type iv pilus biogenesis lipoprotein pilp, from pseudomonas aeruginosa 0.9172 90 173
2y4y-assembly1.cif.gz_A-2 structure of a domain from the type iv pilus biogenesis lipoprotein pilp, from pseudomonas aeruginosa 0.9172 84 173
2y4y-assembly1.cif.gz_D-2 structure of a domain from the type iv pilus biogenesis lipoprotein pilp, from pseudomonas aeruginosa 0.9123 88 172
2y4y-assembly1.cif.gz_B-2 structure of a domain from the type iv pilus biogenesis lipoprotein pilp, from pseudomonas aeruginosa 0.9047 90 173
ID Description Score Start End Superfamily
2y4yC00 Mainly Beta;Roll;SH3 type barrels.; 0.9172 90 173 2.30.30.830
2y4yC00 Mainly Beta;Roll;SH3 type barrels.; 0.8862 90 173 2.30.30.830
2lc4A00 Mainly Beta;Roll;SH3 type barrels.; 0.8465 82 175 2.30.30.830
2ivwA01 Mainly Beta;Roll;SH3 type barrels.; 0.8084 93 173 2.30.30.830
2ivwA01 Mainly Beta;Roll;SH3 type barrels.; 0.8 93 173 2.30.30.830
ID Description Score Start End GO Terms
AF-A0A3A4P2N5-F1-model_v4 Pilus assembly protein PilP 0.9401 93 172
AF-A0A382ZGV8-F1-model_v4 Pilus assembly protein PilP 0.939 83 175
AF-A0A534Q0G7-F1-model_v4 Pilus assembly protein PilP 0.9377 90 173
AF-A0A382XQ63-F1-model_v4 Pilus assembly protein PilP 0.9373 84 175
AF-A0A3B8WSG9-F1-model_v4 Pilus assembly protein PilP 0.9324 82 172

Feature Viewer

pLDDT pTM Quality
81.05 0.52 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map