F484111
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 869 | 396 | 826 | 129 |
Family's Representative Sequence
| Representative Sequence | 3300005366|Ga0070659_100301476|Ga0070659_1003014762 |
| Length | 142 |
| Sequence | MGFPAPSKDTNMSEIPGDLKFQKSHEWARVEDAGQVRIGISDHAQGLLGDLVYVELPNVGDRVEAGTGCAVVESVKAASDVYAPVSGEVVAVNEMLADKPETINEDAYGDGWLLLVKADNAEEMDALLGPDDYAELIENDES |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2571042365 | Lysobacter oryzae DSM 21044 | Isolate | Rhizosphere |
| 3 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 4 | 2643221559 | Lysobacter sp. Root559 | Isolate | Unclassified |
| 5 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 6 | 2643221579 | Pseudoxanthomonas sp. Root630 | Isolate | Unclassified |
| 7 | 2643221581 | Pseudoxanthomonas sp. Root65 | Isolate | Unclassified |
| 8 | 2643221586 | Lysobacter sp. Root667 | Isolate | Unclassified |
| 9 | 2643221612 | Lysobacter sp. Root76 | Isolate | Unclassified |
| 10 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 11 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 12 | 2643221727 | Lysobacter sp. Root96 | Isolate | Unclassified |
| 13 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 14 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 15 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 16 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 17 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 18 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 19 | 2842780639 | Pseudoxanthomonas sp. R-71986 | Isolate | Unclassified |
| 20 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 21 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 22 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 23 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 24 | 2919513703 | Luteimonas sp. 3794 | Isolate | Unclassified |
| 25 | 2919675420 | Luteimonas terrae 4099 | Isolate | Unclassified |
| 26 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 27 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 28 | 2937610967 | Stenotrophomonas maltophilia EP20 | Isolate | Unclassified |
| 29 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 30 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 31 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 32 | 2941489479 | Lysobacter enzymogenes 2943 | Isolate | Rhizosphere |
| 33 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 34 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 35 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 36 | 2984514374 | Stenotrophomonas sp. SORGH_AS282 | Isolate | Aerial Root |
| 37 | 2987605356 | Stenotrophomonas sp. ATCM1_4 | Isolate | Unclassified |
| 38 | 2995948881 | Lysobacter enzymogenes B25 | Isolate | Unclassified |
| 39 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 40 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 41 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 42 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 43 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 44 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 45 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 46 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 47 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 48 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 49 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 50 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 51 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 52 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 53 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 54 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 55 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 56 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 57 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 58 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 59 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 60 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 61 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 62 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 63 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 68 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 83 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 86 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 87 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 89 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 93 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 95 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 96 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 97 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 98 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 99 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 100 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 101 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 102 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 103 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 104 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 105 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 106 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 107 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 108 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 109 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 110 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 111 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 113 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 114 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009979 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG | Metagenome | Rhizosphere |
| 127 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 128 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300012478 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 | Metagenome | Rhizosphere |
| 130 | 3300012482 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 | Metagenome | Rhizosphere |
| 131 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 132 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 133 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013874 | Rhizosphere microbial communities from switchgrass harvested rhizosphere in Austin, TX, USA - RS_213 | Metagenome | Rhizosphere |
| 141 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 143 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 144 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 145 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 146 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 147 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 149 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 150 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 151 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 152 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 153 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 154 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 155 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 156 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 157 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 158 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 159 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 160 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 161 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 164 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 167 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 170 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 224 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 225 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 226 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 227 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 228 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 229 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 230 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 231 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 232 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 233 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 234 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 235 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 236 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 237 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 238 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 239 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 240 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 241 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 242 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 243 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 244 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 245 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 246 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 247 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 248 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 249 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 250 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 251 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 252 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 253 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 254 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 255 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 256 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 257 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 258 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 259 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 260 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 261 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 262 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 263 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 264 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 265 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 266 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 267 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 268 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 269 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 270 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 271 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 272 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 273 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 274 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 275 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 276 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 277 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 278 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 279 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 280 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 281 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 282 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 283 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 284 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 285 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 286 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 287 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 288 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 289 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 290 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 316 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 317 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 318 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 319 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 320 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 321 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 322 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 324 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 325 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 326 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 327 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 328 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 329 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 330 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 331 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 332 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 333 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 334 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 335 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 336 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 337 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 338 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 339 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 340 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 360 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 361 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 362 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 363 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 364 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 365 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 366 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 367 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 368 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 369 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 370 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 371 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 373 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 374 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 375 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 376 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 377 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 378 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 381 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 382 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 383 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 387 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 388 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 389 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 390 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 391 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
| 392 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
| 393 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 394 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 395 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
| 396 | 8054357960 | Idiomarina rhizosphaerae M1R2S28 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.17 |
| Metatranscriptomes | 2.88 |
| Isolates | 4.95 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.12 |
| Bulb | 0 |
| Endosphere | 10.13 |
| Nodule | 0.23 |
| Rhizoplane | 5.52 |
| Rhizosphere | 73.3 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.7 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1774666 | 2162886007 | Bacteria | 1025 |
| 2 | SwRhRL2b_contig_333196 | 2162886007 | Bacteria | 2197 |
| 3 | SwRhRL2b_contig_3538589 | 2162886007 | Bacteria | 3738 |
| 4 | JGI24736J21556_1047816 | 3300001904 | Bacteria | 658 |
| 5 | JGI24741J21665_1000917 | 3300001915 | Bacteria | 8902 |
| 6 | JGI24741J21665_1002063 | 3300001915 | Bacteria | 5381 |
| 7 | JGI24741J21665_1003645 | 3300001915 | Bacteria | 3609 |
| 8 | JGI24740J21852_10006510 | 3300001979 | Bacteria | 4828 |
| 9 | JGI24740J21852_10025119 | 3300001979 | Bacteria | 2012 |
| 10 | JGI24740J21852_10061494 | 3300001979 | Bacteria | 1034 |
| 11 | JGI25152J39213_1000126 | 3300002773 | Bacteria | 52109 |
| 12 | JGI25150J39212_1000180 | 3300002774 | Bacteria | 35477 |
| 13 | JGI25151J46595_10000177 | 3300003187 | Bacteria | 81432 |
| 14 | JGI25151J46595_10000320 | 3300003187 | Bacteria | 52025 |
| 15 | JGI25151J46595_10032534 | 3300003187 | Bacteria | 2020 |
| 16 | JGI25153J46596_10000130 | 3300003215 | Bacteria | 81432 |
| 17 | rootH2_10002342 | 3300003320 | Bacteria | 9955 |
| 18 | JGI26145J50221_1018987 | 3300003371 | Bacteria | 655 |
| 19 | Ga0055526_1000034 | 3300003771 | Bacteria | 136991 |
| 20 | Ga0055526_1015942 | 3300003771 | Bacteria | 2981 |
| 21 | Ga0055537_1000085 | 3300003773 | Bacteria | 67908 |
| 22 | Ga0055537_1000256 | 3300003773 | Bacteria | 38830 |
| 23 | Ga0055524_1000060 | 3300003775 | Bacteria | 136991 |
| 24 | Ga0055524_1015646 | 3300003775 | Bacteria | 2755 |
| 25 | Ga0055524_1021849 | 3300003775 | Bacteria | 2107 |
| 26 | Ga0055536_1019715 | 3300003781 | Bacteria | 2110 |
| 27 | Ga0055536_1020627 | 3300003781 | Bacteria | 2028 |
| 28 | Ga0055534_1000021 | 3300003784 | Bacteria | 137167 |
| 29 | Ga0055534_1000113 | 3300003784 | Bacteria | 59704 |
| 30 | Ga0055534_1024998 | 3300003784 | Bacteria | 963 |
| 31 | Ga0055534_1052392 | 3300003784 | Bacteria | 578 |
| 32 | Ga0055528_1000022 | 3300003790 | Bacteria | 137042 |
| 33 | Ga0055528_1002024 | 3300003790 | Bacteria | 11355 |
| 34 | Ga0055530_10006864 | 3300003791 | Bacteria | 4939 |
| 35 | Ga0055530_10101103 | 3300003791 | Bacteria | 579 |
| 36 | Ga0055540_1104255 | 3300003792 | Bacteria | 527 |
| 37 | Ga0055531_10008361 | 3300003794 | Bacteria | 5472 |
| 38 | Ga0055531_10015106 | 3300003794 | Bacteria | 3426 |
| 39 | Ga0055531_10017800 | 3300003794 | Bacteria | 2975 |
| 40 | Ga0055531_10021856 | 3300003794 | Bacteria | 2463 |
| 41 | Ga0055531_10025914 | 3300003794 | Bacteria | 2110 |
| 42 | Ga0055531_10027930 | 3300003794 | Bacteria | 1961 |
| 43 | Ga0055531_10046236 | 3300003794 | Bacteria | 1198 |
| 44 | Ga0058692_1000015 | 3300003856 | Bacteria | 295729 |
| 45 | Ga0058863_11839322 | 3300004799 | Bacteria | 737 |
| 46 | Ga0058861_11774843 | 3300004800 | Bacteria | 650 |
| 47 | Ga0058862_12685554 | 3300004803 | Bacteria | 639 |
| 48 | Ga0065714_10266233 | 3300005288 | Bacteria | 747 |
| 49 | Ga0065704_10210458 | 3300005289 | Bacteria | 1111 |
| 50 | Ga0065704_10217831 | 3300005289 | Bacteria | 1085 |
| 51 | Ga0065704_10535473 | 3300005289 | Bacteria | 644 |
| 52 | Ga0065704_10549927 | 3300005289 | Bacteria | 635 |
| 53 | Ga0070658_10070426 | 3300005327 | Bacteria | 2863 |
| 54 | Ga0070658_10156876 | 3300005327 | Bacteria | 1908 |
| 55 | Ga0070658_10302993 | 3300005327 | Bacteria | 1363 |
| 56 | Ga0070658_10466983 | 3300005327 | Bacteria | 1088 |
| 57 | Ga0070676_10688029 | 3300005328 | Bacteria | 746 |
| 58 | Ga0070683_100082432 | 3300005329 | Bacteria | 3012 |
| 59 | Ga0070683_100103830 | 3300005329 | Bacteria | 2679 |
| 60 | Ga0070683_100648415 | 3300005329 | Bacteria | 1011 |
| 61 | Ga0070670_100018944 | 3300005331 | Bacteria | 5903 |
| 62 | Ga0070670_100032457 | 3300005331 | Bacteria | 4498 |
| 63 | Ga0070680_100023558 | 3300005336 | Bacteria | 4911 |
| 64 | Ga0070680_100090118 | 3300005336 | Bacteria | 2538 |
| 65 | Ga0070680_100136585 | 3300005336 | Bacteria | 2054 |
| 66 | Ga0070680_100189157 | 3300005336 | Bacteria | 1734 |
| 67 | Ga0070680_100358991 | 3300005336 | Bacteria | 1239 |
| 68 | Ga0070682_100057814 | 3300005337 | Bacteria | 2444 |
| 69 | Ga0070682_100205047 | 3300005337 | Bacteria | 1393 |
| 70 | Ga0070682_100352239 | 3300005337 | Bacteria | 1098 |
| 71 | Ga0070660_100062259 | 3300005339 | Bacteria | 2898 |
| 72 | Ga0070660_100069720 | 3300005339 | Bacteria | 2742 |
| 73 | Ga0070660_100081074 | 3300005339 | Bacteria | 2547 |
| 74 | Ga0070691_10007471 | 3300005341 | Bacteria | 5011 |
| 75 | Ga0070691_10161466 | 3300005341 | Bacteria | 1155 |
| 76 | Ga0070691_10163341 | 3300005341 | Bacteria | 1149 |
| 77 | Ga0070691_10254216 | 3300005341 | Bacteria | 943 |
| 78 | Ga0070661_100047164 | 3300005344 | Bacteria | 3153 |
| 79 | Ga0070661_100051713 | 3300005344 | Bacteria | 3007 |
| 80 | Ga0070661_100077859 | 3300005344 | Bacteria | 2445 |
| 81 | Ga0070661_100445642 | 3300005344 | Bacteria | 1029 |
| 82 | Ga0070692_10002504 | 3300005345 | Bacteria | 7151 |
| 83 | Ga0070692_10020344 | 3300005345 | Bacteria | 3217 |
| 84 | Ga0070692_10032916 | 3300005345 | Bacteria | 2610 |
| 85 | Ga0070692_10178726 | 3300005345 | Bacteria | 1228 |
| 86 | Ga0070692_10229695 | 3300005345 | Bacteria | 1101 |
| 87 | Ga0070669_100256027 | 3300005353 | Bacteria | 1395 |
| 88 | Ga0070675_100267033 | 3300005354 | Bacteria | 1501 |
| 89 | Ga0070675_100770260 | 3300005354 | Bacteria | 879 |
| 90 | Ga0070671_100016518 | 3300005355 | Bacteria | 5966 |
| 91 | Ga0070671_100024686 | 3300005355 | Bacteria | 4924 |
| 92 | Ga0070671_100153658 | 3300005355 | Bacteria | 1944 |
| 93 | Ga0070673_100275614 | 3300005364 | Bacteria | 1474 |
| 94 | Ga0070659_100113442 | 3300005366 | Bacteria | 2189 |
| 95 | Ga0070659_100220110 | 3300005366 | Bacteria | 1566 |
| 96 | Ga0070659_100301476 | 3300005366 | Bacteria | 1336 |
| 97 | Ga0070705_101373160 | 3300005440 | Unclassified | 588 |
| 98 | Ga0070708_100902003 | 3300005445 | Unclassified | 830 |
| 99 | Ga0070663_100183087 | 3300005455 | Bacteria | 1626 |
| 100 | Ga0070663_100218141 | 3300005455 | Bacteria | 1496 |
| 101 | Ga0070663_100664777 | 3300005455 | Bacteria | 882 |
| 102 | Ga0070663_100927080 | 3300005455 | Bacteria | 754 |
| 103 | Ga0070662_100061203 | 3300005457 | Bacteria | 2748 |
| 104 | Ga0070681_10000027 | 3300005458 | Bacteria | 104953 |
| 105 | Ga0070681_10007456 | 3300005458 | Bacteria | 10692 |
| 106 | Ga0070681_10014781 | 3300005458 | Bacteria | 7762 |
| 107 | Ga0070681_10317883 | 3300005458 | Bacteria | 1466 |
| 108 | Ga0070681_11135920 | 3300005458 | Bacteria | 702 |
| 109 | Ga0070706_100078212 | 3300005467 | Bacteria | 3062 |
| 110 | Ga0070699_100678595 | 3300005518 | Unclassified | 941 |
| 111 | Ga0070699_101023830 | 3300005518 | Bacteria | 757 |
| 112 | Ga0070679_100004909 | 3300005530 | Bacteria | 12337 |
| 113 | Ga0070679_100102034 | 3300005530 | Bacteria | 2855 |
| 114 | Ga0070679_100340277 | 3300005530 | Bacteria | 1448 |
| 115 | Ga0070679_100452616 | 3300005530 | Bacteria | 1228 |
| 116 | Ga0070679_101488649 | 3300005530 | Bacteria | 624 |
| 117 | Ga0070684_100078982 | 3300005535 | Bacteria | 2908 |
| 118 | Ga0070684_100079375 | 3300005535 | Bacteria | 2901 |
| 119 | Ga0070684_101403196 | 3300005535 | Bacteria | 658 |
| 120 | Ga0070697_100042294 | 3300005536 | Bacteria | 3687 |
| 121 | Ga0068853_100059038 | 3300005539 | Bacteria | 3313 |
| 122 | Ga0068853_100198639 | 3300005539 | Bacteria | 1824 |
| 123 | Ga0068853_100927502 | 3300005539 | Bacteria | 837 |
| 124 | Ga0070672_100003498 | 3300005543 | Bacteria | 10179 |
| 125 | Ga0070696_100053930 | 3300005546 | Bacteria | 2800 |
| 126 | Ga0070696_100314894 | 3300005546 | Bacteria | 1202 |
| 127 | Ga0070696_100362101 | 3300005546 | Bacteria | 1126 |
| 128 | Ga0070696_101794067 | 3300005546 | Bacteria | 530 |
| 129 | Ga0070665_100075637 | 3300005548 | Bacteria | 3374 |
| 130 | Ga0068855_100028237 | 3300005563 | Bacteria | 6710 |
| 131 | Ga0068855_100194420 | 3300005563 | Bacteria | 2286 |
| 132 | Ga0068855_100356439 | 3300005563 | Bacteria | 1610 |
| 133 | Ga0068855_100424734 | 3300005563 | Bacteria | 1453 |
| 134 | Ga0070664_100097123 | 3300005564 | Bacteria | 2557 |
| 135 | Ga0070664_100164350 | 3300005564 | Bacteria | 1966 |
| 136 | Ga0070664_100481998 | 3300005564 | Bacteria | 1141 |
| 137 | Ga0068857_100094399 | 3300005577 | Bacteria | 2679 |
| 138 | Ga0068857_100108070 | 3300005577 | Bacteria | 2499 |
| 139 | Ga0068854_100095202 | 3300005578 | Bacteria | 2222 |
| 140 | Ga0068854_100104350 | 3300005578 | Bacteria | 2129 |
| 141 | Ga0068854_100136302 | 3300005578 | Bacteria | 1879 |
| 142 | Ga0068854_100286783 | 3300005578 | Bacteria | 1327 |
| 143 | Ga0068854_102049236 | 3300005578 | Bacteria | 528 |
| 144 | Ga0068856_100121850 | 3300005614 | Bacteria | 2610 |
| 145 | Ga0068856_100221951 | 3300005614 | Bacteria | 1905 |
| 146 | Ga0068856_100495610 | 3300005614 | Bacteria | 1242 |
| 147 | Ga0068856_100762675 | 3300005614 | Bacteria | 987 |
| 148 | Ga0068852_100009788 | 3300005616 | Bacteria | 7126 |
| 149 | Ga0068852_100176655 | 3300005616 | Bacteria | 2005 |
| 150 | Ga0068852_100373234 | 3300005616 | Bacteria | 1398 |
| 151 | Ga0068852_100517960 | 3300005616 | Bacteria | 1190 |
| 152 | Ga0068852_101021342 | 3300005616 | Bacteria | 846 |
| 153 | Ga0068852_102015717 | 3300005616 | Bacteria | 599 |
| 154 | Ga0068852_102353591 | 3300005616 | Bacteria | 553 |
| 155 | Ga0068859_100314770 | 3300005617 | Bacteria | 1659 |
| 156 | Ga0068864_100101070 | 3300005618 | Bacteria | 2557 |
| 157 | Ga0068851_10036708 | 3300005834 | Bacteria | 2454 |
| 158 | Ga0068862_100228992 | 3300005844 | Bacteria | 1685 |
| 159 | Ga0068862_101346797 | 3300005844 | Bacteria | 716 |
| 160 | Ga0081539_10035642 | 3300005985 | Bacteria | 2986 |
| 161 | Ga0075365_10485594 | 3300006038 | Bacteria | 873 |
| 162 | Ga0075363_100267851 | 3300006048 | Bacteria | 986 |
| 163 | Ga0075364_10001892 | 3300006051 | Bacteria | 11624 |
| 164 | Ga0075364_10021796 | 3300006051 | Bacteria | 4039 |
| 165 | Ga0075364_10026689 | 3300006051 | Bacteria | 3686 |
| 166 | Ga0075364_10089800 | 3300006051 | Bacteria | 2038 |
| 167 | Ga0075364_10119740 | 3300006051 | Bacteria | 1762 |
| 168 | Ga0075364_10832548 | 3300006051 | Bacteria | 629 |
| 169 | Ga0070716_100115940 | 3300006173 | Bacteria | 1668 |
| 170 | Ga0075428_101428252 | 3300006844 | Bacteria | 726 |
| 171 | Ga0075433_10489036 | 3300006852 | Bacteria | 1084 |
| 172 | Ga0075434_100218354 | 3300006871 | Bacteria | 1926 |
| 173 | Ga0075436_100254856 | 3300006914 | Bacteria | 1250 |
| 174 | Ga0097620_100314793 | 3300006931 | Bacteria | 1659 |
| 175 | Ga0099826_10215890 | 3300006948 | Bacteria | 1037 |
| 176 | Ga0075435_100186782 | 3300007076 | Bacteria | 1753 |
| 177 | Ga0075435_100294581 | 3300007076 | Unclassified | 1387 |
| 178 | Ga0105251_10001735 | 3300009011 | Bacteria | 18197 |
| 179 | Ga0105244_10045535 | 3300009036 | Bacteria | 2256 |
| 180 | Ga0105240_10120222 | 3300009093 | Bacteria | 3164 |
| 181 | Ga0105240_10132397 | 3300009093 | Bacteria | 2990 |
| 182 | Ga0105240_10190935 | 3300009093 | Bacteria | 2409 |
| 183 | Ga0105240_10450202 | 3300009093 | Bacteria | 1441 |
| 184 | Ga0105240_11024366 | 3300009093 | Bacteria | 882 |
| 185 | Ga0105245_12130762 | 3300009098 | Bacteria | 614 |
| 186 | Ga0105247_10228349 | 3300009101 | Bacteria | 1263 |
| 187 | Ga0114129_12084456 | 3300009147 | Unclassified | 684 |
| 188 | Ga0105243_10010067 | 3300009148 | Bacteria | 7189 |
| 189 | Ga0105241_10060367 | 3300009174 | Bacteria | 2917 |
| 190 | Ga0105241_10449228 | 3300009174 | Bacteria | 1140 |
| 191 | Ga0105242_10223817 | 3300009176 | Bacteria | 1683 |
| 192 | Ga0105248_10123306 | 3300009177 | Bacteria | 2923 |
| 193 | Ga0105237_10225334 | 3300009545 | Bacteria | 1875 |
| 194 | Ga0105237_10417511 | 3300009545 | Bacteria | 1347 |
| 195 | Ga0105237_10596612 | 3300009545 | Bacteria | 1111 |
| 196 | Ga0105238_10113729 | 3300009551 | Bacteria | 2686 |
| 197 | Ga0105032_104842 | 3300009979 | Bacteria | 1141 |
| 198 | Ga0105028_136500 | 3300009993 | Bacteria | 552 |
| 199 | Ga0105246_11164916 | 3300011119 | Bacteria | 707 |
| 200 | Ga0157328_1001614 | 3300012478 | Bacteria | 990 |
| 201 | Ga0157318_1000351 | 3300012482 | Bacteria | 1883 |
| 202 | Ga0157315_1009297 | 3300012508 | Bacteria | 842 |
| 203 | Ga0157327_1000101 | 3300012512 | Bacteria | 3797 |
| 204 | Ga0157373_10039717 | 3300013100 | Bacteria | 3368 |
| 205 | Ga0157373_10047580 | 3300013100 | Bacteria | 3059 |
| 206 | Ga0157373_10094975 | 3300013100 | Bacteria | 2099 |
| 207 | Ga0157373_10169918 | 3300013100 | Bacteria | 1534 |
| 208 | Ga0157373_10204956 | 3300013100 | Bacteria | 1391 |
| 209 | Ga0157373_10255402 | 3300013100 | Bacteria | 1240 |
| 210 | Ga0157371_10001197 | 3300013102 | Bacteria | 27801 |
| 211 | Ga0157371_10049348 | 3300013102 | Bacteria | 2990 |
| 212 | Ga0157371_10063005 | 3300013102 | Bacteria | 2628 |
| 213 | Ga0157371_10072437 | 3300013102 | Bacteria | 2440 |
| 214 | Ga0157371_10107616 | 3300013102 | Bacteria | 1979 |
| 215 | Ga0157371_10499915 | 3300013102 | Bacteria | 898 |
| 216 | Ga0157371_11345814 | 3300013102 | Bacteria | 553 |
| 217 | Ga0157370_10005494 | 3300013104 | Bacteria | 14213 |
| 218 | Ga0157370_10014388 | 3300013104 | Bacteria | 8091 |
| 219 | Ga0157370_10243533 | 3300013104 | Bacteria | 1664 |
| 220 | Ga0157370_10319621 | 3300013104 | Bacteria | 1432 |
| 221 | Ga0157370_10513745 | 3300013104 | Bacteria | 1100 |
| 222 | Ga0157370_10817540 | 3300013104 | Bacteria | 848 |
| 223 | Ga0157369_10095088 | 3300013105 | Bacteria | 3180 |
| 224 | Ga0157369_10101943 | 3300013105 | Bacteria | 3059 |
| 225 | Ga0157369_10106109 | 3300013105 | Bacteria | 2990 |
| 226 | Ga0157369_10256664 | 3300013105 | Bacteria | 1824 |
| 227 | Ga0163162_10163399 | 3300013306 | Bacteria | 2349 |
| 228 | Ga0163162_11248124 | 3300013306 | Bacteria | 844 |
| 229 | Ga0157372_10010126 | 3300013307 | Bacteria | 10015 |
| 230 | Ga0157372_10116846 | 3300013307 | Bacteria | 3059 |
| 231 | Ga0157372_10154423 | 3300013307 | Bacteria | 2651 |
| 232 | Ga0157372_10278019 | 3300013307 | Bacteria | 1946 |
| 233 | Ga0157372_10388961 | 3300013307 | Bacteria | 1625 |
| 234 | Ga0157372_10507998 | 3300013307 | Bacteria | 1405 |
| 235 | Ga0157375_10045742 | 3300013308 | Bacteria | 4261 |
| 236 | Ga0157375_10874447 | 3300013308 | Bacteria | 1044 |
| 237 | Ga0157514_121698 | 3300013874 | Bacteria | 506 |
| 238 | Ga0157380_10096605 | 3300014326 | Bacteria | 2450 |
| 239 | Ga0182008_10000640 | 3300014497 | Bacteria | 25569 |
| 240 | Ga0182008_10029807 | 3300014497 | Bacteria | 2755 |
| 241 | Ga0182008_10085553 | 3300014497 | Bacteria | 1553 |
| 242 | Ga0182006_1029462 | 3300015261 | Bacteria | 2223 |
| 243 | Ga0182006_1044394 | 3300015261 | Bacteria | 1733 |
| 244 | Ga0182006_1074828 | 3300015261 | Bacteria | 1247 |
| 245 | Ga0182007_10000026 | 3300015262 | Bacteria | 168694 |
| 246 | Ga0182005_1000473 | 3300015265 | Bacteria | 20871 |
| 247 | Ga0182005_1007526 | 3300015265 | Bacteria | 3261 |
| 248 | Ga0183360_10001 | 3300015689 | Bacteria | 3943671 |
| 249 | Ga0163161_10005585 | 3300017792 | Bacteria | 8719 |
| 250 | Ga0163161_11025912 | 3300017792 | Bacteria | 705 |
| 251 | Ga0197907_10010081 | 3300020069 | Bacteria | 769 |
| 252 | Ga0197907_10910264 | 3300020069 | Bacteria | 1740 |
| 253 | Ga0206356_10191945 | 3300020070 | Bacteria | 1877 |
| 254 | Ga0206356_11621496 | 3300020070 | Bacteria | 4264 |
| 255 | Ga0206355_1661501 | 3300020076 | Bacteria | 599 |
| 256 | Ga0206351_10365865 | 3300020077 | Bacteria | 2286 |
| 257 | Ga0206351_10599785 | 3300020077 | Bacteria | 1307 |
| 258 | Ga0206352_10032047 | 3300020078 | Bacteria | 754 |
| 259 | Ga0206352_11104993 | 3300020078 | Bacteria | 685 |
| 260 | Ga0206350_10893779 | 3300020080 | Bacteria | 2436 |
| 261 | Ga0206350_11143801 | 3300020080 | Bacteria | 806 |
| 262 | Ga0206354_10062392 | 3300020081 | Bacteria | 4060 |
| 263 | Ga0206354_11127055 | 3300020081 | Bacteria | 2054 |
| 264 | Ga0206353_10282153 | 3300020082 | Bacteria | 1219 |
| 265 | Ga0206353_10476976 | 3300020082 | Bacteria | 1823 |
| 266 | Ga0154015_1147847 | 3300020610 | Bacteria | 585 |
| 267 | Ga0154015_1306398 | 3300020610 | Bacteria | 7189 |
| 268 | Ga0154015_1459418 | 3300020610 | Bacteria | 964 |
| 269 | Ga0154015_1472900 | 3300020610 | Bacteria | 2489 |
| 270 | Ga0224712_10027926 | 3300022467 | Bacteria | 2012 |
| 271 | Ga0224712_10333768 | 3300022467 | Bacteria | 714 |
| 272 | Ga0207425_1000066 | 3300025245 | Bacteria | 125463 |
| 273 | Ga0207425_1008448 | 3300025245 | Bacteria | 2634 |
| 274 | Ga0209129_1000135 | 3300025258 | Bacteria | 125520 |
| 275 | Ga0209565_1000023 | 3300025263 | Bacteria | 388244 |
| 276 | Ga0209565_1000034 | 3300025263 | Bacteria | 312950 |
| 277 | Ga0209673_1000039 | 3300025273 | Bacteria | 312950 |
| 278 | Ga0209673_1000116 | 3300025273 | Bacteria | 175933 |
| 279 | Ga0209673_1004235 | 3300025273 | Bacteria | 7809 |
| 280 | Ga0209130_1010488 | 3300025284 | Bacteria | 2547 |
| 281 | Ga0209675_1000023 | 3300025291 | Bacteria | 312950 |
| 282 | Ga0209675_1000154 | 3300025291 | Bacteria | 89426 |
| 283 | Ga0209675_1042358 | 3300025291 | Bacteria | 987 |
| 284 | Ga0209676_1011135 | 3300025292 | Bacteria | 3661 |
| 285 | Ga0209025_1000013 | 3300025294 | Bacteria | 871757 |
| 286 | Ga0209025_1000023 | 3300025294 | Bacteria | 541307 |
| 287 | Ga0209025_1004258 | 3300025294 | Bacteria | 12583 |
| 288 | Ga0209025_1059359 | 3300025294 | Bacteria | 1444 |
| 289 | Ga0209564_1000066 | 3300025295 | Bacteria | 312899 |
| 290 | Ga0209564_1000106 | 3300025295 | Bacteria | 216131 |
| 291 | Ga0209564_1014368 | 3300025295 | Bacteria | 3299 |
| 292 | Ga0209758_1000014 | 3300025297 | Bacteria | 871757 |
| 293 | Ga0209758_1026770 | 3300025297 | Bacteria | 2485 |
| 294 | Ga0209758_1058317 | 3300025297 | Bacteria | 1292 |
| 295 | Ga0209758_1084955 | 3300025297 | Bacteria | 944 |
| 296 | Ga0209050_1001331 | 3300025298 | Bacteria | 27512 |
| 297 | Ga0209050_1033477 | 3300025298 | Bacteria | 1557 |
| 298 | Ga0209050_1046790 | 3300025298 | Bacteria | 1133 |
| 299 | Ga0209050_1088452 | 3300025298 | Bacteria | 640 |
| 300 | Ga0209256_1000048 | 3300025299 | Bacteria | 312899 |
| 301 | Ga0209256_1002361 | 3300025299 | Bacteria | 15660 |
| 302 | Ga0209256_1003532 | 3300025299 | Bacteria | 10868 |
| 303 | Ga0209256_1005289 | 3300025299 | Bacteria | 7520 |
| 304 | Ga0209256_1073063 | 3300025299 | Bacteria | 766 |
| 305 | Ga0209051_1009475 | 3300025303 | Bacteria | 5015 |
| 306 | Ga0209257_1000270 | 3300025304 | Bacteria | 119394 |
| 307 | Ga0209257_1000310 | 3300025304 | Bacteria | 103568 |
| 308 | Ga0209257_1000378 | 3300025304 | Bacteria | 88945 |
| 309 | Ga0209257_1023300 | 3300025304 | Bacteria | 2180 |
| 310 | Ga0207656_10053631 | 3300025321 | Bacteria | 1750 |
| 311 | Ga0207655_1169972 | 3300025728 | Bacteria | 674 |
| 312 | Ga0207713_1000324 | 3300025735 | Bacteria | 53955 |
| 313 | Ga0207647_10010962 | 3300025904 | Bacteria | 6376 |
| 314 | Ga0207647_10048229 | 3300025904 | Bacteria | 2646 |
| 315 | Ga0207647_10131667 | 3300025904 | Bacteria | 1470 |
| 316 | Ga0207647_10307769 | 3300025904 | Bacteria | 901 |
| 317 | Ga0207645_10232264 | 3300025907 | Bacteria | 1218 |
| 318 | Ga0207705_10000527 | 3300025909 | Bacteria | 32402 |
| 319 | Ga0207705_10002485 | 3300025909 | Bacteria | 14203 |
| 320 | Ga0207705_10002907 | 3300025909 | Bacteria | 13100 |
| 321 | Ga0207705_10019921 | 3300025909 | Bacteria | 4799 |
| 322 | Ga0207705_10413415 | 3300025909 | Bacteria | 1044 |
| 323 | Ga0207684_10248801 | 3300025910 | Unclassified | 1534 |
| 324 | Ga0207654_10205018 | 3300025911 | Bacteria | 1301 |
| 325 | Ga0207654_10349681 | 3300025911 | Bacteria | 1017 |
| 326 | Ga0207707_10000039 | 3300025912 | Bacteria | 138817 |
| 327 | Ga0207707_10000061 | 3300025912 | Bacteria | 108292 |
| 328 | Ga0207707_10000095 | 3300025912 | Bacteria | 89126 |
| 329 | Ga0207707_10000854 | 3300025912 | Bacteria | 29717 |
| 330 | Ga0207707_10000930 | 3300025912 | Bacteria | 28392 |
| 331 | Ga0207707_10001518 | 3300025912 | Bacteria | 21417 |
| 332 | Ga0207707_10008753 | 3300025912 | Bacteria | 8784 |
| 333 | Ga0207695_10001815 | 3300025913 | Bacteria | 33615 |
| 334 | Ga0207695_10010700 | 3300025913 | Bacteria | 11202 |
| 335 | Ga0207695_10011157 | 3300025913 | Bacteria | 10905 |
| 336 | Ga0207695_10198068 | 3300025913 | Bacteria | 1924 |
| 337 | Ga0207695_10656368 | 3300025913 | Bacteria | 930 |
| 338 | Ga0207663_11114265 | 3300025916 | Unclassified | 635 |
| 339 | Ga0207660_10001101 | 3300025917 | Bacteria | 18049 |
| 340 | Ga0207660_10003239 | 3300025917 | Bacteria | 10656 |
| 341 | Ga0207660_10006078 | 3300025917 | Bacteria | 7836 |
| 342 | Ga0207660_10045054 | 3300025917 | Bacteria | 3106 |
| 343 | Ga0207660_10046286 | 3300025917 | Bacteria | 3069 |
| 344 | Ga0207660_10079597 | 3300025917 | Bacteria | 2404 |
| 345 | Ga0207657_10066686 | 3300025919 | Bacteria | 3063 |
| 346 | Ga0207657_10068618 | 3300025919 | Bacteria | 3011 |
| 347 | Ga0207657_10071330 | 3300025919 | Bacteria | 2942 |
| 348 | Ga0207657_10085229 | 3300025919 | Bacteria | 2647 |
| 349 | Ga0207657_11393869 | 3300025919 | Bacteria | 527 |
| 350 | Ga0207649_10012334 | 3300025920 | Bacteria | 4739 |
| 351 | Ga0207649_10018343 | 3300025920 | Bacteria | 3977 |
| 352 | Ga0207649_10085865 | 3300025920 | Bacteria | 2049 |
| 353 | Ga0207649_10146690 | 3300025920 | Bacteria | 1620 |
| 354 | Ga0207649_10226953 | 3300025920 | Bacteria | 1333 |
| 355 | Ga0207649_10423423 | 3300025920 | Bacteria | 1000 |
| 356 | Ga0207652_10000376 | 3300025921 | Bacteria | 46290 |
| 357 | Ga0207652_10000534 | 3300025921 | Bacteria | 38545 |
| 358 | Ga0207652_10000855 | 3300025921 | Bacteria | 28951 |
| 359 | Ga0207652_10003739 | 3300025921 | Bacteria | 12489 |
| 360 | Ga0207652_10004248 | 3300025921 | Bacteria | 11691 |
| 361 | Ga0207652_10059147 | 3300025921 | Bacteria | 3303 |
| 362 | Ga0207652_10947911 | 3300025921 | Bacteria | 758 |
| 363 | Ga0207681_10346353 | 3300025923 | Bacteria | 1188 |
| 364 | Ga0207681_10499277 | 3300025923 | Bacteria | 996 |
| 365 | Ga0207694_10346855 | 3300025924 | Bacteria | 1228 |
| 366 | Ga0207650_10032905 | 3300025925 | Bacteria | 3753 |
| 367 | Ga0207650_10140463 | 3300025925 | Bacteria | 1898 |
| 368 | Ga0207659_10345814 | 3300025926 | Bacteria | 1233 |
| 369 | Ga0207644_10010205 | 3300025931 | Bacteria | 6188 |
| 370 | Ga0207644_10252271 | 3300025931 | Bacteria | 1408 |
| 371 | Ga0207644_10334671 | 3300025931 | Bacteria | 1226 |
| 372 | Ga0207690_10001346 | 3300025932 | Bacteria | 15446 |
| 373 | Ga0207690_10005785 | 3300025932 | Bacteria | 7314 |
| 374 | Ga0207706_10052564 | 3300025933 | Bacteria | 3596 |
| 375 | Ga0207691_10002069 | 3300025940 | Bacteria | 19572 |
| 376 | Ga0207691_10754647 | 3300025940 | Bacteria | 819 |
| 377 | Ga0207711_10053878 | 3300025941 | Bacteria | 3450 |
| 378 | Ga0207661_10001167 | 3300025944 | Bacteria | 17544 |
| 379 | Ga0207661_10006758 | 3300025944 | Bacteria | 8121 |
| 380 | Ga0207661_10010189 | 3300025944 | Bacteria | 6759 |
| 381 | Ga0207661_10989891 | 3300025944 | Bacteria | 774 |
| 382 | Ga0207661_11027124 | 3300025944 | Bacteria | 759 |
| 383 | Ga0207679_10093100 | 3300025945 | Bacteria | 2336 |
| 384 | Ga0207679_10124200 | 3300025945 | Bacteria | 2060 |
| 385 | Ga0207679_10223437 | 3300025945 | Bacteria | 1586 |
| 386 | Ga0207679_10278865 | 3300025945 | Bacteria | 1433 |
| 387 | Ga0207679_10420122 | 3300025945 | Bacteria | 1180 |
| 388 | Ga0207679_10427332 | 3300025945 | Bacteria | 1170 |
| 389 | Ga0207667_10004910 | 3300025949 | Bacteria | 16333 |
| 390 | Ga0207667_10015525 | 3300025949 | Bacteria | 8644 |
| 391 | Ga0207667_10103144 | 3300025949 | Bacteria | 2942 |
| 392 | Ga0207667_10328640 | 3300025949 | Bacteria | 1561 |
| 393 | Ga0207667_10927960 | 3300025949 | Bacteria | 861 |
| 394 | Ga0207651_10238000 | 3300025960 | Bacteria | 1482 |
| 395 | Ga0207651_10527760 | 3300025960 | Bacteria | 1024 |
| 396 | Ga0207668_10117785 | 3300025972 | Bacteria | 2005 |
| 397 | Ga0207640_10001438 | 3300025981 | Bacteria | 12889 |
| 398 | Ga0207640_10004474 | 3300025981 | Bacteria | 7578 |
| 399 | Ga0207640_10005294 | 3300025981 | Bacteria | 7029 |
| 400 | Ga0207640_10138392 | 3300025981 | Bacteria | 1771 |
| 401 | Ga0207640_10171662 | 3300025981 | Bacteria | 1617 |
| 402 | Ga0207640_10558107 | 3300025981 | Bacteria | 963 |
| 403 | Ga0207639_10029977 | 3300026041 | Bacteria | 3987 |
| 404 | Ga0207639_10086642 | 3300026041 | Bacteria | 2494 |
| 405 | Ga0207639_10507160 | 3300026041 | Bacteria | 1103 |
| 406 | Ga0207639_10829938 | 3300026041 | Bacteria | 862 |
| 407 | Ga0207639_11197388 | 3300026041 | Bacteria | 713 |
| 408 | Ga0207678_10067891 | 3300026067 | Bacteria | 3060 |
| 409 | Ga0207678_10073079 | 3300026067 | Bacteria | 2939 |
| 410 | Ga0207678_10076340 | 3300026067 | Bacteria | 2870 |
| 411 | Ga0207678_10078976 | 3300026067 | Bacteria | 2818 |
| 412 | Ga0207678_10088496 | 3300026067 | Bacteria | 2646 |
| 413 | Ga0207702_10003173 | 3300026078 | Bacteria | 15207 |
| 414 | Ga0207702_10007007 | 3300026078 | Bacteria | 9643 |
| 415 | Ga0207702_10069240 | 3300026078 | Bacteria | 3033 |
| 416 | Ga0207702_10458160 | 3300026078 | Bacteria | 1238 |
| 417 | Ga0207641_10099869 | 3300026088 | Bacteria | 2555 |
| 418 | Ga0207648_10243875 | 3300026089 | Bacteria | 1600 |
| 419 | Ga0207676_10061110 | 3300026095 | Bacteria | 2982 |
| 420 | Ga0207674_10046641 | 3300026116 | Bacteria | 4448 |
| 421 | Ga0207674_10097114 | 3300026116 | Bacteria | 2930 |
| 422 | Ga0207674_10116204 | 3300026116 | Bacteria | 2647 |
| 423 | Ga0207674_10415018 | 3300026116 | Bacteria | 1301 |
| 424 | Ga0207698_10007061 | 3300026142 | Bacteria | 7035 |
| 425 | Ga0207698_10021294 | 3300026142 | Bacteria | 4480 |
| 426 | Ga0207698_10054226 | 3300026142 | Bacteria | 3083 |
| 427 | Ga0207698_10099821 | 3300026142 | Bacteria | 2402 |
| 428 | Ga0207698_10534430 | 3300026142 | Bacteria | 1146 |
| 429 | Ga0207698_10926761 | 3300026142 | Bacteria | 879 |
| 430 | Ga0209973_1046092 | 3300027252 | Bacteria | 649 |
| 431 | Ga0209371_1000011 | 3300027312 | Bacteria | 848456 |
| 432 | Ga0209967_1030722 | 3300027364 | Bacteria | 803 |
| 433 | Ga0209984_1009783 | 3300027424 | Bacteria | 1222 |
| 434 | Ga0210000_1016478 | 3300027462 | Bacteria | 1116 |
| 435 | Ga0209995_1004303 | 3300027471 | Bacteria | 2275 |
| 436 | Ga0209999_1000735 | 3300027543 | Bacteria | 5330 |
| 437 | Ga0209982_1002436 | 3300027552 | Bacteria | 2612 |
| 438 | Ga0209970_1024950 | 3300027614 | Bacteria | 1023 |
| 439 | Ga0209971_1000229 | 3300027682 | Bacteria | 16278 |
| 440 | Ga0209974_10047878 | 3300027876 | Bacteria | 1432 |
| 441 | Ga0209974_10117745 | 3300027876 | Bacteria | 939 |
| 442 | Ga0268266_10553401 | 3300028379 | Bacteria | 1102 |
| 443 | Ga0268265_10117678 | 3300028380 | Bacteria | 2183 |
| 444 | Ga0268265_10170692 | 3300028380 | Bacteria | 1859 |
| 445 | Ga0268265_11209668 | 3300028380 | Bacteria | 753 |
| 446 | Ga0307515_10187071 | 3300028794 | Bacteria | 1996 |
| 447 | Ga0268256_1000011 | 3300030500 | Bacteria | 848625 |
| 448 | Ga0316176_1026051 | 3300030732 | Bacteria | 2557 |
| 449 | Ga0316176_1170387 | 3300030732 | Bacteria | 551 |
| 450 | Ga0314311_1007241 | 3300030733 | Bacteria | 2544 |
| 451 | Ga0316178_1063173 | 3300030735 | Bacteria | 1534 |
| 452 | Ga0307513_10009118 | 3300031456 | Bacteria | 12569 |
| 453 | Ga0307513_10213724 | 3300031456 | Bacteria | 1757 |
| 454 | Ga0307513_10450665 | 3300031456 | Bacteria | 1011 |
| 455 | Ga0307509_10109058 | 3300031507 | Bacteria | 2780 |
| 456 | Ga0307408_100286979 | 3300031548 | Bacteria | 1373 |
| 457 | Ga0307408_100295314 | 3300031548 | Bacteria | 1355 |
| 458 | Ga0307408_100620549 | 3300031548 | Bacteria | 963 |
| 459 | Ga0307408_100694579 | 3300031548 | Bacteria | 914 |
| 460 | Ga0307408_100906971 | 3300031548 | Bacteria | 807 |
| 461 | Ga0307405_10257143 | 3300031731 | Bacteria | 1302 |
| 462 | Ga0307405_10367277 | 3300031731 | Bacteria | 1116 |
| 463 | Ga0307405_10673935 | 3300031731 | Bacteria | 853 |
| 464 | Ga0307405_10830132 | 3300031731 | Bacteria | 776 |
| 465 | Ga0307405_11767922 | 3300031731 | Bacteria | 549 |
| 466 | Ga0307413_10015371 | 3300031824 | Bacteria | 3920 |
| 467 | Ga0307413_10061033 | 3300031824 | Bacteria | 2324 |
| 468 | Ga0307413_10153450 | 3300031824 | Bacteria | 1608 |
| 469 | Ga0307413_10451704 | 3300031824 | Bacteria | 1020 |
| 470 | Ga0307413_10629269 | 3300031824 | Bacteria | 882 |
| 471 | Ga0307413_10680138 | 3300031824 | Bacteria | 852 |
| 472 | Ga0307413_10706724 | 3300031824 | Bacteria | 838 |
| 473 | Ga0307410_10081704 | 3300031852 | Bacteria | 2271 |
| 474 | Ga0307410_10198454 | 3300031852 | Bacteria | 1530 |
| 475 | Ga0307410_10320143 | 3300031852 | Bacteria | 1230 |
| 476 | Ga0307406_10007080 | 3300031901 | Bacteria | 6210 |
| 477 | Ga0307406_10062508 | 3300031901 | Bacteria | 2409 |
| 478 | Ga0307406_10133204 | 3300031901 | Bacteria | 1748 |
| 479 | Ga0307406_10205361 | 3300031901 | Bacteria | 1454 |
| 480 | Ga0307406_10505883 | 3300031901 | Bacteria | 980 |
| 481 | Ga0307407_10037545 | 3300031903 | Bacteria | 2677 |
| 482 | Ga0307412_10036110 | 3300031911 | Bacteria | 3163 |
| 483 | Ga0307412_10274329 | 3300031911 | Bacteria | 1321 |
| 484 | Ga0307412_10291663 | 3300031911 | Bacteria | 1285 |
| 485 | Ga0307412_10426948 | 3300031911 | Bacteria | 1085 |
| 486 | Ga0307412_10433466 | 3300031911 | Bacteria | 1078 |
| 487 | Ga0307412_10813076 | 3300031911 | Bacteria | 812 |
| 488 | Ga0307409_100357362 | 3300031995 | Bacteria | 1381 |
| 489 | Ga0307409_101474530 | 3300031995 | Bacteria | 707 |
| 490 | Ga0307416_100368293 | 3300032002 | Bacteria | 1462 |
| 491 | Ga0307416_101013859 | 3300032002 | Bacteria | 933 |
| 492 | Ga0307416_103153062 | 3300032002 | Bacteria | 552 |
| 493 | Ga0307414_10008768 | 3300032004 | Bacteria | 5765 |
| 494 | Ga0307414_10030087 | 3300032004 | Bacteria | 3543 |
| 495 | Ga0307414_10044393 | 3300032004 | Bacteria | 3035 |
| 496 | Ga0307414_10050488 | 3300032004 | Bacteria | 2881 |
| 497 | Ga0307414_10067758 | 3300032004 | Bacteria | 2558 |
| 498 | Ga0307414_10078327 | 3300032004 | Bacteria | 2409 |
| 499 | Ga0307414_10284362 | 3300032004 | Bacteria | 1391 |
| 500 | Ga0307414_10400047 | 3300032004 | Bacteria | 1193 |
| 501 | Ga0307414_10476922 | 3300032004 | Bacteria | 1099 |
| 502 | Ga0307414_10503125 | 3300032004 | Bacteria | 1072 |
| 503 | Ga0307414_10951008 | 3300032004 | Bacteria | 789 |
| 504 | Ga0307414_11210703 | 3300032004 | Bacteria | 699 |
| 505 | Ga0307411_10023704 | 3300032005 | Bacteria | 3641 |
| 506 | Ga0307411_10080092 | 3300032005 | Bacteria | 2244 |
| 507 | Ga0307411_10095421 | 3300032005 | Bacteria | 2088 |
| 508 | Ga0307411_10227489 | 3300032005 | Bacteria | 1451 |
| 509 | Ga0307411_10261852 | 3300032005 | Bacteria | 1366 |
| 510 | Ga0307411_10364396 | 3300032005 | Bacteria | 1183 |
| 511 | Ga0307411_10364794 | 3300032005 | Bacteria | 1182 |
| 512 | Ga0307411_10673108 | 3300032005 | Bacteria | 898 |
| 513 | Ga0307415_100501713 | 3300032126 | Bacteria | 1061 |
| 514 | Ga0316593_10104724 | 3300032168 | Bacteria | 1006 |
| 515 | Ga0307507_10056649 | 3300033179 | Bacteria | 3701 |
| 516 | Ga0395899_0034387 | 3300037312 | Bacteria | 3805 |
| 517 | Ga0395899_0038864 | 3300037312 | Bacteria | 3563 |
| 518 | Ga0395899_0166668 | 3300037312 | Bacteria | 1554 |
| 519 | Ga0395899_0236422 | 3300037312 | Bacteria | 1259 |
| 520 | Ga0395900_0075723 | 3300037418 | Bacteria | 3459 |
| 521 | Ga0395900_0290324 | 3300037418 | Bacteria | 1624 |
| 522 | Ga0395900_1673767 | 3300037418 | Bacteria | 547 |
| 523 | Ga0395898_0048152 | 3300037466 | Bacteria | 4181 |
| 524 | Ga0395898_0089564 | 3300037466 | Bacteria | 2961 |
| 525 | Ga0395898_0154552 | 3300037466 | Bacteria | 2195 |
| 526 | Ga0395898_0590656 | 3300037466 | Bacteria | 1053 |
| 527 | Ga0395905_0051120 | 3300037471 | Bacteria | 3870 |
| 528 | Ga0395905_0054100 | 3300037471 | Bacteria | 3756 |
| 529 | Ga0395905_0763019 | 3300037471 | Bacteria | 870 |
| 530 | Ga0395905_0930696 | 3300037471 | Bacteria | 772 |
| 531 | Ga0395901_0012189 | 3300038443 | Bacteria | 8724 |
| 532 | Ga0395901_0716732 | 3300038443 | Bacteria | 996 |
| 533 | Ga0395901_0796243 | 3300038443 | Bacteria | 934 |
| 534 | Ga0237819_00312 | 3300038705 | Bacteria | 17856 |
| 535 | Ga0237819_03105 | 3300038705 | Bacteria | 3045 |
| 536 | Ga0237816_00049 | 3300039145 | Bacteria | 7742 |
| 537 | Ga0439436_0003186 | 3300041404 | Bacteria | 4974 |
| 538 | Ga0439436_0033247 | 3300041404 | Bacteria | 1493 |
| 539 | Ga0439436_0075426 | 3300041404 | Bacteria | 939 |
| 540 | Ga0439436_0097733 | 3300041404 | Bacteria | 818 |
| 541 | Ga0439439_0000293 | 3300041406 | Bacteria | 7979 |
| 542 | Ga0439439_0111301 | 3300041406 | Bacteria | 759 |
| 543 | Ga0439447_000711 | 3300041407 | Bacteria | 12310 |
| 544 | Ga0439447_102665 | 3300041407 | Bacteria | 656 |
| 545 | Ga0439461_0011441 | 3300041410 | Bacteria | 1647 |
| 546 | Ga0439466_0145003 | 3300041411 | Bacteria | 728 |
| 547 | Ga0439466_0174451 | 3300041411 | Bacteria | 656 |
| 548 | Ga0439465_0006378 | 3300041413 | Bacteria | 3746 |
| 549 | Ga0439465_0022790 | 3300041413 | Bacteria | 1968 |
| 550 | Ga0439465_0024164 | 3300041413 | Bacteria | 1915 |
| 551 | Ga0439465_0187764 | 3300041413 | Bacteria | 750 |
| 552 | Ga0451789_0567113 | 3300041443 | Bacteria | 1173 |
| 553 | Ga0451789_0603815 | 3300041443 | Bacteria | 805 |
| 554 | Ga0451789_1127422 | 3300041443 | Bacteria | 905 |
| 555 | Ga0451791_1504983 | 3300041451 | Bacteria | 894 |
| 556 | Ga0451793_1421440 | 3300041452 | Bacteria | 1128 |
| 557 | Ga0451797_0011554 | 3300041453 | Bacteria | 716 |
| 558 | Ga0451797_0179888 | 3300041453 | Bacteria | 1362 |
| 559 | Ga0451797_0418348 | 3300041453 | Bacteria | 878 |
| 560 | Ga0451797_1447018 | 3300041453 | Bacteria | 838 |
| 561 | Ga0451795_1389936 | 3300041456 | Bacteria | 2621 |
| 562 | Ga0451800_0436854 | 3300041459 | Bacteria | 554 |
| 563 | Ga0451802_0515276 | 3300041460 | Bacteria | 936 |
| 564 | Ga0451802_0889714 | 3300041460 | Bacteria | 1435 |
| 565 | Ga0451802_1853850 | 3300041460 | Bacteria | 1870 |
| 566 | Ga0451806_430966 | 3300041462 | Bacteria | 555 |
| 567 | Ga0451807_0537170 | 3300041486 | Bacteria | 1391 |
| 568 | Ga0451807_1702852 | 3300041486 | Bacteria | 1987 |
| 569 | Ga0451807_2013840 | 3300041486 | Bacteria | 1320 |
| 570 | Ga0451807_2723370 | 3300041486 | Bacteria | 2888 |
| 571 | Ga0451833_1106277 | 3300041491 | Bacteria | 1498 |
| 572 | Ga0451837_0339579 | 3300041494 | Bacteria | 925 |
| 573 | Ga0451837_0799066 | 3300041494 | Bacteria | 821 |
| 574 | Ga0451837_0894832 | 3300041494 | Bacteria | 579 |
| 575 | Ga0451837_1309318 | 3300041494 | Bacteria | 1152 |
| 576 | Ga0451837_1419138 | 3300041494 | Bacteria | 727 |
| 577 | Ga0451837_1679811 | 3300041494 | Bacteria | 1790 |
| 578 | Ga0451845_0148626 | 3300041501 | Bacteria | 540 |
| 579 | Ga0451849_0874557 | 3300041505 | Bacteria | 617 |
| 580 | Ga0451843_0413118 | 3300041509 | Bacteria | 1935 |
| 581 | Ga0451843_0437456 | 3300041509 | Bacteria | 1267 |
| 582 | Ga0451853_3084322 | 3300041512 | Bacteria | 878 |
| 583 | Ga0451853_3955464 | 3300041512 | Bacteria | 580 |
| 584 | Ga0439433_0049804 | 3300041999 | Bacteria | 986 |
| 585 | Ga0439433_0147788 | 3300041999 | Bacteria | 604 |
| 586 | Ga0439433_0180417 | 3300041999 | Bacteria | 552 |
| 587 | Ga0439445_0016396 | 3300042004 | Bacteria | 1822 |
| 588 | Ga0439448_0245969 | 3300042005 | Bacteria | 631 |
| 589 | Ga0439432_004957 | 3300042006 | Bacteria | 4821 |
| 590 | Ga0439432_016995 | 3300042006 | Bacteria | 2444 |
| 591 | Ga0439432_027819 | 3300042006 | Bacteria | 1844 |
| 592 | Ga0439432_077986 | 3300042006 | Bacteria | 1005 |
| 593 | Ga0439432_229646 | 3300042006 | Bacteria | 534 |
| 594 | Ga0439449_0004380 | 3300042007 | Bacteria | 5446 |
| 595 | Ga0439449_0012155 | 3300042007 | Bacteria | 3236 |
| 596 | Ga0439449_0014456 | 3300042007 | Bacteria | 2968 |
| 597 | Ga0439449_0017729 | 3300042007 | Bacteria | 2673 |
| 598 | Ga0439449_0057610 | 3300042007 | Bacteria | 1434 |
| 599 | Ga0439449_0069480 | 3300042007 | Bacteria | 1298 |
| 600 | Ga0439449_0086846 | 3300042007 | Bacteria | 1154 |
| 601 | Ga0439449_0204400 | 3300042007 | Bacteria | 739 |
| 602 | Ga0439452_010318 | 3300042010 | Bacteria | 2722 |
| 603 | Ga0439457_023359 | 3300042014 | Bacteria | 1368 |
| 604 | Ga0439462_0014720 | 3300042015 | Bacteria | 2012 |
| 605 | Ga0439462_0111678 | 3300042015 | Bacteria | 757 |
| 606 | Ga0450898_007767 | 3300042134 | Bacteria | 1677 |
| 607 | Ga0450898_081837 | 3300042134 | Bacteria | 657 |
| 608 | Ga0450903_058467 | 3300042138 | Bacteria | 560 |
| 609 | Ga0450906_090101 | 3300042145 | Bacteria | 556 |
| 610 | Ga0450908_094951 | 3300042184 | Bacteria | 543 |
| 611 | Ga0439434_0020366 | 3300042435 | Bacteria | 1991 |
| 612 | Ga0439434_0190627 | 3300042435 | Bacteria | 689 |
| 613 | Ga0451577_0001996 | 3300042876 | Bacteria | 25432 |
| 614 | Ga0466965_0619936 | 3300044683 | Bacteria | 616 |
| 615 | Ga0453684_0289684 | 3300044712 | Bacteria | 1865 |
| 616 | Ga0466960_0002465 | 3300044901 | Bacteria | 6961 |
| 617 | Ga0466960_0834620 | 3300044901 | Bacteria | 559 |
| 618 | Ga0466967_1831532 | 3300045976 | Bacteria | 604 |
| 619 | Ga0495627_072343 | 3300046453 | Bacteria | 1006 |
| 620 | Ga0495638_0003232 | 3300046460 | Bacteria | 12884 |
| 621 | Ga0495638_0126553 | 3300046460 | Bacteria | 1505 |
| 622 | Ga0495605_0090099 | 3300046474 | Bacteria | 1423 |
| 623 | Ga0495607_0126486 | 3300046501 | Bacteria | 1335 |
| 624 | Ga0495606_0019707 | 3300046507 | Bacteria | 5004 |
| 625 | Ga0495610_0285691 | 3300046512 | Bacteria | 641 |
| 626 | Ga0495663_0002950 | 3300046525 | Bacteria | 5003 |
| 627 | Ga0495663_0007675 | 3300046525 | Bacteria | 2983 |
| 628 | Ga0495663_0181376 | 3300046525 | Bacteria | 729 |
| 629 | Ga0495663_0292147 | 3300046525 | Bacteria | 585 |
| 630 | Ga0495663_0399936 | 3300046525 | Bacteria | 505 |
| 631 | Ga0495598_0001245 | 3300046537 | Bacteria | 4954 |
| 632 | Ga0495609_0240568 | 3300046538 | Bacteria | 747 |
| 633 | Ga0495621_0044521 | 3300046539 | Bacteria | 1569 |
| 634 | Ga0495622_0504485 | 3300046557 | Bacteria | 517 |
| 635 | Ga0495633_0003001 | 3300046558 | Bacteria | 11522 |
| 636 | Ga0495633_0030964 | 3300046558 | Bacteria | 2597 |
| 637 | Ga0495633_0122642 | 3300046558 | Bacteria | 1204 |
| 638 | Ga0495633_0138203 | 3300046558 | Bacteria | 1127 |
| 639 | Ga0495656_0000506 | 3300046615 | Bacteria | 12780 |
| 640 | Ga0495656_0002280 | 3300046615 | Bacteria | 6332 |
| 641 | Ga0495656_0130046 | 3300046615 | Bacteria | 1197 |
| 642 | Ga0495668_0004061 | 3300046616 | Bacteria | 10627 |
| 643 | Ga0495625_0137962 | 3300046660 | Bacteria | 1647 |
| 644 | Ga0495659_0013928 | 3300046664 | Bacteria | 2624 |
| 645 | Ga0495659_0494975 | 3300046664 | Bacteria | 535 |
| 646 | Ga0495670_0582812 | 3300046691 | Bacteria | 609 |
| 647 | Ga0495671_0095899 | 3300046692 | Bacteria | 1451 |
| 648 | Ga0495660_0262869 | 3300046810 | Bacteria | 796 |
| 649 | Ga0495636_0034397 | 3300047318 | Bacteria | 2085 |
| 650 | Ga0495672_0021447 | 3300047320 | Bacteria | 4214 |
| 651 | Ga0495681_0376174 | 3300047470 | Bacteria | 535 |
| 652 | Ga0495686_0026366 | 3300047472 | Bacteria | 3802 |
| 653 | Ga0496100_0525923 | 3300048903 | Bacteria | 913 |
| 654 | Ga0496101_0467481 | 3300048904 | Bacteria | 995 |
| 655 | Ga0496102_0178340 | 3300048905 | Bacteria | 2001 |
| 656 | Ga0496103_0041894 | 3300048906 | Bacteria | 2816 |
| 657 | Ga0496104_1026115 | 3300048907 | Bacteria | 729 |
| 658 | Ga0496105_0488082 | 3300048908 | Bacteria | 968 |
| 659 | Ga0496106_0025055 | 3300048909 | Bacteria | 4438 |
| 660 | Ga0496106_1206754 | 3300048909 | Bacteria | 590 |
| 661 | Ga0496107_0152561 | 3300048910 | Bacteria | 1709 |
| 662 | Ga0496107_0303311 | 3300048910 | Bacteria | 1189 |
| 663 | Ga0496108_0020695 | 3300048911 | Bacteria | 5407 |
| 664 | Ga0496108_0223803 | 3300048911 | Bacteria | 1635 |
| 665 | Ga0496108_0317286 | 3300048911 | Bacteria | 1358 |
| 666 | Ga0496109_0068841 | 3300048912 | Bacteria | 3244 |
| 667 | Ga0496109_0148978 | 3300048912 | Bacteria | 2190 |
| 668 | Ga0496109_0191694 | 3300048912 | Bacteria | 1921 |
| 669 | Ga0496109_0356884 | 3300048912 | Bacteria | 1381 |
| 670 | Ga0496110_0594872 | 3300048913 | Bacteria | 1004 |
| 671 | Ga0496111_0064881 | 3300048914 | Bacteria | 2649 |
| 672 | Ga0496112_0025162 | 3300048915 | Bacteria | 5713 |
| 673 | Ga0496112_0155646 | 3300048915 | Bacteria | 2252 |
| 674 | Ga0496113_0021851 | 3300048916 | Bacteria | 4517 |
| 675 | Ga0496113_0068084 | 3300048916 | Bacteria | 2701 |
| 676 | Ga0496113_0076333 | 3300048916 | Bacteria | 2560 |
| 677 | Ga0496113_0100972 | 3300048916 | Bacteria | 2236 |
| 678 | Ga0496114_0007709 | 3300048917 | Bacteria | 8516 |
| 679 | Ga0496114_0340300 | 3300048917 | Bacteria | 1326 |
| 680 | Ga0496114_0827485 | 3300048917 | Bacteria | 805 |
| 681 | Ga0496115_0731876 | 3300048918 | Bacteria | 775 |
| 682 | Ga0496116_0058897 | 3300048919 | Bacteria | 2501 |
| 683 | Ga0496116_0066718 | 3300048919 | Bacteria | 2301 |
| 684 | Ga0496116_0289995 | 3300048919 | Bacteria | 786 |
| 685 | Ga0496117_0000969 | 3300048920 | Bacteria | 43962 |
| 686 | Ga0496117_0002121 | 3300048920 | Bacteria | 25987 |
| 687 | Ga0496117_0023022 | 3300048920 | Bacteria | 4980 |
| 688 | Ga0496117_0402986 | 3300048920 | Bacteria | 689 |
| 689 | Ga0496118_0001996 | 3300048921 | Bacteria | 28924 |
| 690 | Ga0496118_0002316 | 3300048921 | Bacteria | 25860 |
| 691 | Ga0496118_0005003 | 3300048921 | Bacteria | 15313 |
| 692 | Ga0496118_0060601 | 3300048921 | Bacteria | 2809 |
| 693 | Ga0496118_0089461 | 3300048921 | Bacteria | 2125 |
| 694 | Ga0496118_0129579 | 3300048921 | Bacteria | 1623 |
| 695 | Ga0496119_0004382 | 3300048922 | Bacteria | 14084 |
| 696 | Ga0496120_0000561 | 3300048923 | Bacteria | 56621 |
| 697 | Ga0496121_0030360 | 3300048924 | Bacteria | 4964 |
| 698 | Ga0496122_0000874 | 3300048925 | Bacteria | 56703 |
| 699 | Ga0496122_0002722 | 3300048925 | Bacteria | 24525 |
| 700 | Ga0496122_0009475 | 3300048925 | Bacteria | 10254 |
| 701 | Ga0496122_0092719 | 3300048925 | Bacteria | 2051 |
| 702 | Ga0496122_0109315 | 3300048925 | Bacteria | 1820 |
| 703 | Ga0496122_0130175 | 3300048925 | Bacteria | 1601 |
| 704 | Ga0496123_0000461 | 3300048926 | Bacteria | 71380 |
| 705 | Ga0496123_0001781 | 3300048926 | Bacteria | 28388 |
| 706 | Ga0496123_0006266 | 3300048926 | Bacteria | 11587 |
| 707 | Ga0496123_0020794 | 3300048926 | Bacteria | 5122 |
| 708 | Ga0496123_0023746 | 3300048926 | Bacteria | 4684 |
| 709 | Ga0496124_0000218 | 3300048927 | Bacteria | 112156 |
| 710 | Ga0496124_0004852 | 3300048927 | Bacteria | 15470 |
| 711 | Ga0496124_0019543 | 3300048927 | Bacteria | 6297 |
| 712 | Ga0496124_0024328 | 3300048927 | Bacteria | 5510 |
| 713 | Ga0496124_0028777 | 3300048927 | Bacteria | 4963 |
| 714 | Ga0496124_0048300 | 3300048927 | Bacteria | 3638 |
| 715 | Ga0496124_0093221 | 3300048927 | Bacteria | 2451 |
| 716 | Ga0496124_0254395 | 3300048927 | Bacteria | 1296 |
| 717 | Ga0496124_0315746 | 3300048927 | Bacteria | 1121 |
| 718 | Ga0496124_0808982 | 3300048927 | Bacteria | 579 |
| 719 | Ga0496125_0010108 | 3300048928 | Bacteria | 9575 |
| 720 | Ga0496125_0048627 | 3300048928 | Bacteria | 3534 |
| 721 | Ga0496125_0124456 | 3300048928 | Bacteria | 1830 |
| 722 | Ga0496125_0268965 | 3300048928 | Bacteria | 1063 |
| 723 | Ga0496126_0050461 | 3300048929 | Bacteria | 3791 |
| 724 | Ga0496126_0078037 | 3300048929 | Bacteria | 2935 |
| 725 | Ga0496126_0210807 | 3300048929 | Bacteria | 1636 |
| 726 | Ga0495682_0183212 | 3300049460 | Bacteria | 744 |
| 727 | Ga0501032_0692723 | 3300049569 | Bacteria | 646 |
| 728 | Ga0501033_0001011 | 3300049570 | Bacteria | 25534 |
| 729 | Ga0501033_0659637 | 3300049570 | Bacteria | 714 |
| 730 | Ga0501034_0000661 | 3300049571 | Bacteria | 52643 |
| 731 | Ga0501034_0082208 | 3300049571 | Bacteria | 3223 |
| 732 | Ga0501034_0088323 | 3300049571 | Bacteria | 3098 |
| 733 | Ga0501034_0151746 | 3300049571 | Bacteria | 2292 |
| 734 | Ga0501034_0274837 | 3300049571 | Bacteria | 1625 |
| 735 | Ga0501034_0405140 | 3300049571 | Bacteria | 1286 |
| 736 | Ga0501034_1345936 | 3300049571 | Bacteria | 590 |
| 737 | Ga0501034_1627133 | 3300049571 | Bacteria | 519 |
| 738 | Ga0501036_0036186 | 3300049572 | Bacteria | 4177 |
| 739 | Ga0501037_0023281 | 3300049573 | Bacteria | 4581 |
| 740 | Ga0501037_0374180 | 3300049573 | Bacteria | 980 |
| 741 | Ga0501038_0310580 | 3300049574 | Bacteria | 1235 |
| 742 | Ga0501038_0900076 | 3300049574 | Bacteria | 653 |
| 743 | Ga0501039_0029638 | 3300049575 | Bacteria | 4215 |
| 744 | Ga0501042_0655950 | 3300049578 | Bacteria | 763 |
| 745 | Ga0501043_0040610 | 3300049579 | Bacteria | 3657 |
| 746 | Ga0501043_0073582 | 3300049579 | Bacteria | 2684 |
| 747 | Ga0501047_0000728 | 3300049581 | Bacteria | 34264 |
| 748 | Ga0501047_0021626 | 3300049581 | Bacteria | 6179 |
| 749 | Ga0501047_0384758 | 3300049581 | Bacteria | 1237 |
| 750 | Ga0501047_0409512 | 3300049581 | Bacteria | 1188 |
| 751 | Ga0501067_0365564 | 3300049583 | Bacteria | 804 |
| 752 | Ga0501069_0007517 | 3300049585 | Bacteria | 5720 |
| 753 | Ga0501069_0017890 | 3300049585 | Bacteria | 3821 |
| 754 | Ga0501069_0056881 | 3300049585 | Bacteria | 2179 |
| 755 | Ga0501070_0008134 | 3300049586 | Bacteria | 8873 |
| 756 | Ga0501070_0008656 | 3300049586 | Bacteria | 8602 |
| 757 | Ga0501070_0021684 | 3300049586 | Bacteria | 5386 |
| 758 | Ga0501070_0023424 | 3300049586 | Bacteria | 5172 |
| 759 | Ga0501070_0033935 | 3300049586 | Bacteria | 4269 |
| 760 | Ga0501070_0048588 | 3300049586 | Bacteria | 3523 |
| 761 | Ga0501070_0156520 | 3300049586 | Bacteria | 1879 |
| 762 | Ga0501070_0299749 | 3300049586 | Bacteria | 1309 |
| 763 | Ga0501070_0346447 | 3300049586 | Bacteria | 1206 |
| 764 | Ga0501070_0426705 | 3300049586 | Bacteria | 1070 |
| 765 | Ga0501071_0006669 | 3300049587 | Bacteria | 7502 |
| 766 | Ga0501071_0332858 | 3300049587 | Bacteria | 1154 |
| 767 | Ga0501072_0795831 | 3300049588 | Bacteria | 741 |
| 768 | Ga0501073_0003299 | 3300049589 | Bacteria | 12125 |
| 769 | Ga0501073_0067713 | 3300049589 | Bacteria | 2489 |
| 770 | Ga0501073_0075224 | 3300049589 | Bacteria | 2351 |
| 771 | Ga0501074_0004710 | 3300049590 | Bacteria | 9771 |
| 772 | Ga0501074_0006953 | 3300049590 | Bacteria | 8173 |
| 773 | Ga0501074_0054713 | 3300049590 | Bacteria | 2877 |
| 774 | Ga0501074_0190269 | 3300049590 | Bacteria | 1463 |
| 775 | Ga0501074_0963676 | 3300049590 | Bacteria | 600 |
| 776 | Ga0501077_0082040 | 3300049593 | Bacteria | 2043 |
| 777 | Ga0501202_227438 | 3300049652 | Bacteria | 518 |
| 778 | Ga0501216_049451 | 3300049660 | Bacteria | 824 |
| 779 | Ga0501217_113782 | 3300049661 | Bacteria | 780 |
| 780 | Ga0501223_036500 | 3300049663 | Bacteria | 955 |
| 781 | Ga0501223_121632 | 3300049663 | Bacteria | 552 |
| 782 | Ga0501233_262740 | 3300049668 | Bacteria | 522 |
| 783 | Ga0501235_069185 | 3300049669 | Bacteria | 834 |
| 784 | Ga0501240_040233 | 3300049673 | Bacteria | 775 |
| 785 | Ga0501251_037984 | 3300049681 | Bacteria | 717 |
| 786 | Ga0501253_020165 | 3300049683 | Bacteria | 1160 |
| 787 | Ga0501257_051900 | 3300049686 | Bacteria | 1024 |
| 788 | Ga0501259_110086 | 3300049688 | Bacteria | 643 |
| 789 | Ga0501225_0106014 | 3300049705 | Bacteria | 825 |
| 790 | Ga0501080_0000440 | 3300049742 | Bacteria | 32255 |
| 791 | Ga0501080_0017754 | 3300049742 | Bacteria | 6584 |
| 792 | Ga0501080_0156657 | 3300049742 | Bacteria | 2104 |
| 793 | Ga0501080_0238451 | 3300049742 | Bacteria | 1660 |
| 794 | Ga0501080_0326699 | 3300049742 | Bacteria | 1388 |
| 795 | Ga0501080_0414995 | 3300049742 | Bacteria | 1210 |
| 796 | Ga0501241_153024 | 3300049758 | Bacteria | 533 |
| 797 | Ga0501262_027977 | 3300049759 | Bacteria | 802 |
| 798 | Ga0501265_005317 | 3300049762 | Bacteria | 1481 |
| 799 | Ga0501266_033351 | 3300049763 | Bacteria | 743 |
| 800 | Ga0501272_073207 | 3300049769 | Bacteria | 504 |
| 801 | Ga0501275_000050 | 3300049772 | Bacteria | 11946 |
| 802 | Ga0501275_076993 | 3300049772 | Bacteria | 534 |
| 803 | Ga0501035_0002331 | 3300049822 | Bacteria | 18717 |
| 804 | Ga0501035_0119995 | 3300049822 | Bacteria | 2299 |
| 805 | Ga0501035_0579431 | 3300049822 | Bacteria | 916 |
| 806 | Ga0501044_0029925 | 3300049823 | Bacteria | 5741 |
| 807 | Ga0501044_0030543 | 3300049823 | Bacteria | 5677 |
| 808 | Ga0501044_0080505 | 3300049823 | Bacteria | 3299 |
| 809 | Ga0501044_0232244 | 3300049823 | Bacteria | 1791 |
| 810 | Ga0501044_0297241 | 3300049823 | Bacteria | 1544 |
| 811 | nmdc:mga03n38_134655_c1 | 3300050490 | Bacteria | 1228 |
| 812 | nmdc:mga00v17_1592_c1 | 3300050491 | Bacteria | 11848 |
| 813 | nmdc:mga00v17_19508_c1 | 3300050491 | Bacteria | 3872 |
| 814 | nmdc:mga00v17_375183_c1 | 3300050491 | Bacteria | 925 |
| 815 | nmdc:mga00v17_59114_c1 | 3300050491 | Bacteria | 2351 |
| 816 | nmdc:mga00v17_88852_c1 | 3300050491 | Bacteria | 1938 |
| 817 | nmdc:mga0yw44_605591_c1 | 3300050492 | Bacteria | 744 |
| 818 | nmdc:mga0n895_72875_c1 | 3300050512 | Bacteria | 3408 |
| 819 | nmdc:mga0rr50_219260_c1 | 3300050513 | Unclassified | 1570 |
| 820 | nmdc:mga0rr50_36153_c1 | 3300050513 | Bacteria | 3554 |
| 821 | nmdc:mga0a205_57768_c2 | 3300050515 | Bacteria | 1835 |
| 822 | Ga0500643_165800 | 3300053087 | Bacteria | 592 |
| 823 | Ga0500651_0000062 | 3300053093 | Bacteria | 71042 |
| 824 | Ga0500577_0196685 | 3300053142 | Bacteria | 869 |
| 825 | Ga0500634_0000107 | 3300053161 | Bacteria | 31282 |
| 826 | Ga0501084_0405305 | 3300054114 | Bacteria | 1152 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025911 | Ga0207654_10349681 | Ga0207654_103496812 | 106 |
| 2 | 3300049571 | Ga0501034_0082208 | Ga0501034_0082208_1007_1441 | 109 |
| 3 | 3300049572 | Ga0501036_0036186 | Ga0501036_0036186_2102_2536 | 109 |
| 4 | 3300049573 | Ga0501037_0023281 | Ga0501037_0023281_3855_4289 | 109 |
| 5 | 3300049575 | Ga0501039_0029638 | Ga0501039_0029638_2282_2716 | 109 |
| 6 | 3300049579 | Ga0501043_0073582 | Ga0501043_0073582_79_513 | 109 |
| 7 | 3300049586 | Ga0501070_0156520 | Ga0501070_0156520_1288_1722 | 109 |
| 8 | 3300049742 | Ga0501080_0156657 | Ga0501080_0156657_1522_1956 | 109 |
| 9 | 3300049823 | Ga0501044_0232244 | Ga0501044_0232244_1064_1498 | 109 |
| 10 | 3300003187 | JGI25151J46595_10000320 | JGI25151J46595_1000032027 | 115 |
| 11 | 3300005445 | Ga0070708_100902003 | Ga0070708_1009020032 | 115 |
| 12 | 3300005518 | Ga0070699_100678595 | Ga0070699_1006785952 | 115 |
| 13 | 3300006173 | Ga0070716_100115940 | Ga0070716_1001159401 | 115 |
| 14 | 3300006852 | Ga0075433_10489036 | Ga0075433_104890361 | 115 |
| 15 | 3300006871 | Ga0075434_100218354 | Ga0075434_1002183542 | 115 |
| 16 | 3300006914 | Ga0075436_100254856 | Ga0075436_1002548562 | 115 |
| 17 | 3300007076 | Ga0075435_100186782 | Ga0075435_1001867822 | 115 |
| 18 | 3300007076 | Ga0075435_100294581 | Ga0075435_1002945811 | 115 |
| 19 | 3300009147 | Ga0114129_12084456 | Ga0114129_120844561 | 115 |
| 20 | 3300014497 | Ga0182008_10085553 | Ga0182008_100855532 | 115 |
| 21 | 3300025910 | Ga0207684_10248801 | Ga0207684_102488012 | 115 |
| 22 | 3300025916 | Ga0207663_11114265 | Ga0207663_111142651 | 115 |
| 23 | 3300031548 | Ga0307408_100906971 | Ga0307408_1009069711 | 115 |
| 24 | 3300041407 | Ga0439447_000711 | Ga0439447_000711_6090_6485 | 115 |
| 25 | 3300042005 | Ga0439448_0245969 | Ga0439448_0245969_92_490 | 115 |
| 26 | 3300046512 | Ga0495610_0285691 | Ga0495610_0285691_77_472 | 115 |
| 27 | 3300046525 | Ga0495663_0181376 | Ga0495663_0181376_225_620 | 115 |
| 28 | 3300046615 | Ga0495656_0002280 | Ga0495656_0002280_784_1179 | 115 |
| 29 | 3300046616 | Ga0495668_0004061 | Ga0495668_0004061_1991_2386 | 115 |
| 30 | 3300049571 | Ga0501034_0274837 | Ga0501034_0274837_112_507 | 115 |
| 31 | 3300050512 | nmdc:mga0n895_72875_c1 | nmdc:mga0n895_72875_c1_277_660 | 115 |
| 32 | 3300050513 | nmdc:mga0rr50_219260_c1 | nmdc:mga0rr50_219260_c1_435_818 | 115 |
| 33 | 3300050513 | nmdc:mga0rr50_36153_c1 | nmdc:mga0rr50_36153_c1_2491_2874 | 115 |
| 34 | 3300050515 | nmdc:mga0a205_57768_c2 | nmdc:mga0a205_57768_c2_562_945 | 115 |
| 35 | 3300005355 | Ga0070671_100024686 | Ga0070671_1000246863 | 116 |
| 36 | 3300006948 | Ga0099826_10215890 | Ga0099826_102158902 | 116 |
| 37 | 3300025245 | Ga0207425_1008448 | Ga0207425_10084483 | 116 |
| 38 | 3300025294 | Ga0209025_1000023 | Ga0209025_1000023236 | 116 |
| 39 | 3300025297 | Ga0209758_1058317 | Ga0209758_10583172 | 116 |
| 40 | 3300037471 | Ga0395905_0051120 | Ga0395905_0051120_3061_3456 | 116 |
| 41 | 3300048927 | Ga0496124_0315746 | Ga0496124_0315746_305_700 | 116 |
| 42 | 3300003771 | Ga0055526_1000034 | Ga0055526_100003474 | 117 |
| 43 | 3300003773 | Ga0055537_1000256 | Ga0055537_100025610 | 117 |
| 44 | 3300003775 | Ga0055524_1000060 | Ga0055524_100006074 | 117 |
| 45 | 3300003784 | Ga0055534_1000021 | Ga0055534_100002174 | 117 |
| 46 | 3300003790 | Ga0055528_1000022 | Ga0055528_100002238 | 117 |
| 47 | 3300005616 | Ga0068852_102015717 | Ga0068852_1020157171 | 117 |
| 48 | 3300009174 | Ga0105241_10449228 | Ga0105241_104492282 | 117 |
| 49 | 3300025299 | Ga0209256_1073063 | Ga0209256_10730631 | 117 |
| 50 | 3300025913 | Ga0207695_10656368 | Ga0207695_106563682 | 117 |
| 51 | 3300025931 | Ga0207644_10010205 | Ga0207644_100102054 | 117 |
| 52 | 3300031548 | Ga0307408_100620549 | Ga0307408_1006205492 | 117 |
| 53 | 3300031901 | Ga0307406_10007080 | Ga0307406_100070804 | 117 |
| 54 | 3300037312 | Ga0395899_0038864 | Ga0395899_0038864_825_1220 | 117 |
| 55 | 3300037466 | Ga0395898_0590656 | Ga0395898_0590656_236_631 | 117 |
| 56 | 3300037471 | Ga0395905_0054100 | Ga0395905_0054100_3322_3717 | 117 |
| 57 | 3300038443 | Ga0395901_0716732 | Ga0395901_0716732_562_957 | 117 |
| 58 | 3300041404 | Ga0439436_0003186 | Ga0439436_0003186_1023_1418 | 117 |
| 59 | 3300041406 | Ga0439439_0000293 | Ga0439439_0000293_1061_1456 | 117 |
| 60 | 3300041407 | Ga0439447_102665 | Ga0439447_102665_215_610 | 117 |
| 61 | 3300042004 | Ga0439445_0016396 | Ga0439445_0016396_1134_1529 | 117 |
| 62 | 3300042014 | Ga0439457_023359 | Ga0439457_023359_412_807 | 117 |
| 63 | 3300042015 | Ga0439462_0111678 | Ga0439462_0111678_304_699 | 117 |
| 64 | 3300042138 | Ga0450903_058467 | Ga0450903_058467_63_458 | 117 |
| 65 | 3300044901 | Ga0466960_0834620 | Ga0466960_0834620_111_506 | 117 |
| 66 | 3300048903 | Ga0496100_0525923 | Ga0496100_0525923_169_564 | 117 |
| 67 | 3300048904 | Ga0496101_0467481 | Ga0496101_0467481_133_528 | 117 |
| 68 | 3300048907 | Ga0496104_1026115 | Ga0496104_1026115_91_486 | 117 |
| 69 | 3300048909 | Ga0496106_1206754 | Ga0496106_1206754_97_492 | 117 |
| 70 | 3300048910 | Ga0496107_0303311 | Ga0496107_0303311_700_1095 | 117 |
| 71 | 3300048911 | Ga0496108_0020695 | Ga0496108_0020695_3574_3969 | 117 |
| 72 | 3300048912 | Ga0496109_0148978 | Ga0496109_0148978_1661_2056 | 117 |
| 73 | 3300048912 | Ga0496109_0191694 | Ga0496109_0191694_668_1063 | 117 |
| 74 | 3300048913 | Ga0496110_0594872 | Ga0496110_0594872_101_496 | 117 |
| 75 | 3300048915 | Ga0496112_0025162 | Ga0496112_0025162_148_543 | 117 |
| 76 | 3300048916 | Ga0496113_0021851 | Ga0496113_0021851_390_785 | 117 |
| 77 | 3300054114 | Ga0501084_0405305 | Ga0501084_0405305_784_1137 | 117 |
| 78 | 3300005440 | Ga0070705_101373160 | Ga0070705_1013731601 | 118 |
| 79 | 3300005467 | Ga0070706_100078212 | Ga0070706_1000782124 | 118 |
| 80 | 3300005536 | Ga0070697_100042294 | Ga0070697_1000422944 | 118 |
| 81 | 3300015689 | Ga0183360_10001 | Ga0183360_10001171 | 118 |
| 82 | 3300025263 | Ga0209565_1000034 | Ga0209565_100003477 | 118 |
| 83 | 3300025273 | Ga0209673_1000039 | Ga0209673_100003977 | 118 |
| 84 | 3300025291 | Ga0209675_1000023 | Ga0209675_100002377 | 118 |
| 85 | 3300025295 | Ga0209564_1000066 | Ga0209564_1000066196 | 118 |
| 86 | 3300025299 | Ga0209256_1000048 | Ga0209256_100004877 | 118 |
| 87 | 3300025904 | Ga0207647_10307769 | Ga0207647_103077692 | 118 |
| 88 | 3300031901 | Ga0307406_10205361 | Ga0307406_102053612 | 118 |
| 89 | 3300031995 | Ga0307409_100357362 | Ga0307409_1003573622 | 118 |
| 90 | 3300032005 | Ga0307411_10095421 | Ga0307411_100954212 | 118 |
| 91 | 3300041413 | Ga0439465_0006378 | Ga0439465_0006378_380_775 | 118 |
| 92 | 3300041999 | Ga0439433_0147788 | Ga0439433_0147788_24_419 | 118 |
| 93 | 3300042007 | Ga0439449_0057610 | Ga0439449_0057610_722_1117 | 118 |
| 94 | 3300042134 | Ga0450898_007767 | Ga0450898_007767_276_671 | 118 |
| 95 | 3300009036 | Ga0105244_10045535 | Ga0105244_100455353 | 119 |
| 96 | 3300015262 | Ga0182007_10000026 | Ga0182007_1000002650 | 119 |
| 97 | 3300015265 | Ga0182005_1000473 | Ga0182005_100047310 | 119 |
| 98 | 3300030732 | Ga0316176_1170387 | Ga0316176_11703872 | 119 |
| 99 | 3300030733 | Ga0314311_1007241 | Ga0314311_10072412 | 119 |
| 100 | 3300030735 | Ga0316178_1063173 | Ga0316178_10631733 | 119 |
| 101 | 3300031901 | Ga0307406_10062508 | Ga0307406_100625081 | 119 |
| 102 | 3300041404 | Ga0439436_0097733 | Ga0439436_0097733_182_577 | 119 |
| 103 | 3300042006 | Ga0439432_027819 | Ga0439432_027819_1400_1795 | 119 |
| 104 | 3300042145 | Ga0450906_090101 | Ga0450906_090101_41_436 | 119 |
| 105 | 3300049762 | Ga0501265_005317 | Ga0501265_005317_1014_1409 | 119 |
| 106 | 3300049772 | Ga0501275_000050 | Ga0501275_000050_5726_6121 | 119 |
| 107 | 3300048911 | Ga0496108_0223803 | Ga0496108_0223803_592_987 | 120 |
| 108 | 3300048912 | Ga0496109_0356884 | Ga0496109_0356884_505_900 | 120 |
| 109 | 3300009098 | Ga0105245_12130762 | Ga0105245_121307622 | 121 |
| 110 | 3300015261 | Ga0182006_1074828 | Ga0182006_10748283 | 121 |
| 111 | 3300048920 | Ga0496117_0402986 | Ga0496117_0402986_20_388 | 121 |
| 112 | 3300013307 | Ga0157372_10507998 | Ga0157372_105079981 | 122 |
| 113 | 3300031824 | Ga0307413_10015371 | Ga0307413_100153715 | 122 |
| 114 | 3300048928 | Ga0496125_0010108 | Ga0496125_0010108_7943_8338 | 122 |
| 115 | 3300003371 | JGI26145J50221_1018987 | JGI26145J50221_10189871 | 123 |
| 116 | 3300005539 | Ga0068853_100927502 | Ga0068853_1009275022 | 123 |
| 117 | 3300009101 | Ga0105247_10228349 | Ga0105247_102283492 | 123 |
| 118 | 3300027876 | Ga0209974_10117745 | Ga0209974_101177452 | 123 |
| 119 | 3300031824 | Ga0307413_10680138 | Ga0307413_106801382 | 123 |
| 120 | 3300032004 | Ga0307414_10067758 | Ga0307414_100677583 | 123 |
| 121 | 3300032005 | Ga0307411_10364396 | Ga0307411_103643962 | 123 |
| 122 | 3300042876 | Ga0451577_0001996 | Ga0451577_0001996_10593_10988 | 123 |
| 123 | 3300044712 | Ga0453684_0289684 | Ga0453684_0289684_471_866 | 123 |
| 124 | 3300049571 | Ga0501034_0000661 | Ga0501034_0000661_9744_10139 | 123 |
| 125 | 3300049571 | Ga0501034_1345936 | Ga0501034_1345936_61_456 | 123 |
| 126 | 3300025728 | Ga0207655_1169972 | Ga0207655_11699722 | 124 |
| 127 | 3300026041 | Ga0207639_11197388 | Ga0207639_111973881 | 124 |
| 128 | 3300027252 | Ga0209973_1046092 | Ga0209973_10460921 | 124 |
| 129 | 3300027364 | Ga0209967_1030722 | Ga0209967_10307221 | 124 |
| 130 | 3300027424 | Ga0209984_1009783 | Ga0209984_10097831 | 124 |
| 131 | 3300027462 | Ga0210000_1016478 | Ga0210000_10164782 | 124 |
| 132 | 3300027471 | Ga0209995_1004303 | Ga0209995_10043032 | 124 |
| 133 | 3300027543 | Ga0209999_1000735 | Ga0209999_10007356 | 124 |
| 134 | 3300027552 | Ga0209982_1002436 | Ga0209982_10024361 | 124 |
| 135 | 3300027614 | Ga0209970_1024950 | Ga0209970_10249501 | 124 |
| 136 | 3300027682 | Ga0209971_1000229 | Ga0209971_10002299 | 124 |
| 137 | 3300027876 | Ga0209974_10047878 | Ga0209974_100478782 | 124 |
| 138 | 3300031911 | Ga0307412_10291663 | Ga0307412_102916632 | 124 |
| 139 | 3300048919 | Ga0496116_0066718 | Ga0496116_0066718_17_412 | 124 |
| 140 | iso_pu_bacteria | 8054357960 | 8054359315 | 125 |
| 141 | 3300005328 | Ga0070676_10688029 | Ga0070676_106880292 | 126 |
| 142 | 3300005329 | Ga0070683_100648415 | Ga0070683_1006484152 | 126 |
| 143 | 3300005331 | Ga0070670_100018944 | Ga0070670_1000189442 | 126 |
| 144 | 3300005354 | Ga0070675_100267033 | Ga0070675_1002670332 | 126 |
| 145 | 3300005355 | Ga0070671_100153658 | Ga0070671_1001536582 | 126 |
| 146 | 3300005543 | Ga0070672_100003498 | Ga0070672_10000349810 | 126 |
| 147 | 3300005616 | Ga0068852_101021342 | Ga0068852_1010213422 | 126 |
| 148 | 3300005844 | Ga0068862_101346797 | Ga0068862_1013467971 | 126 |
| 149 | 3300009176 | Ga0105242_10223817 | Ga0105242_102238172 | 126 |
| 150 | 3300013308 | Ga0157375_10045742 | Ga0157375_100457424 | 126 |
| 151 | 3300044683 | Ga0466965_0619936 | Ga0466965_0619936_53_433 | 126 |
| 152 | 3300044901 | Ga0466960_0002465 | Ga0466960_0002465_6466_6846 | 126 |
| 153 | iso_pu_bacteria | 2571042365 | 2572254485 | 127 |
| 154 | iso_pu_bacteria | 2576861471 | 2578457347 | 127 |
| 155 | iso_pu_bacteria | 2643221559 | 2643816668 | 127 |
| 156 | iso_pu_bacteria | 2643221573 | 2643880967 | 127 |
| 157 | iso_pu_bacteria | 2643221579 | 2643907103 | 127 |
| 158 | iso_pu_bacteria | 2643221581 | 2643913514 | 127 |
| 159 | iso_pu_bacteria | 2643221586 | 2643938652 | 127 |
| 160 | iso_pu_bacteria | 2643221612 | 2644077604 | 127 |
| 161 | iso_pu_bacteria | 2643221695 | 2644528359 | 127 |
| 162 | iso_pu_bacteria | 2643221720 | 2644661536 | 127 |
| 163 | iso_pu_bacteria | 2643221727 | 2644694081 | 127 |
| 164 | iso_pu_bacteria | 2643221728 | 2644699617 | 127 |
| 165 | iso_pu_bacteria | 2747842501 | 2748019575 | 127 |
| 166 | iso_pu_bacteria | 2765235840 | 2765580133 | 127 |
| 167 | iso_pu_bacteria | 2816332141 | 2816518828 | 127 |
| 168 | iso_pu_bacteria | 2818991457 | 2819660780 | 127 |
| 169 | iso_pu_bacteria | 2842391507 | 2842393926 | 127 |
| 170 | iso_pu_bacteria | 2842780639 | 2842783216 | 127 |
| 171 | iso_pu_bacteria | 2852649853 | 2852652462 | 127 |
| 172 | iso_pu_bacteria | 2852684882 | 2852686648 | 127 |
| 173 | iso_pu_bacteria | 2857442823 | 2857444845 | 127 |
| 174 | iso_pu_bacteria | 2919130084 | 2919132607 | 127 |
| 175 | iso_pu_bacteria | 2919513703 | 2919515387 | 127 |
| 176 | iso_pu_bacteria | 2919675420 | 2919675756 | 127 |
| 177 | iso_pu_bacteria | 2923516293 | 2923519438 | 127 |
| 178 | iso_pu_bacteria | 2929195423 | 2929196776 | 127 |
| 179 | iso_pu_bacteria | 2937610967 | 2937615139 | 127 |
| 180 | iso_pu_bacteria | 2939589442 | 2939589447 | 127 |
| 181 | iso_pu_bacteria | 2939622612 | 2939625877 | 127 |
| 182 | iso_pu_bacteria | 2941475908 | 2941479082 | 127 |
| 183 | iso_pu_bacteria | 2941489479 | 2941491746 | 127 |
| 184 | iso_pu_bacteria | 2961064222 | 2961066790 | 127 |
| 185 | iso_pu_bacteria | 2974307012 | 2974307980 | 127 |
| 186 | iso_pu_bacteria | 2977247770 | 2977248716 | 127 |
| 187 | iso_pu_bacteria | 2984514374 | 2984516815 | 127 |
| 188 | iso_pu_bacteria | 2987605356 | 2987608423 | 127 |
| 189 | iso_pu_bacteria | 2995948881 | 2995953045 | 127 |
| 190 | iso_pu_bacteria | 8002869464 | 8002869765 | 127 |
| 191 | iso_pu_bacteria | 8003014200 | 8003016828 | 127 |
| 192 | iso_pu_bacteria | 8021622325 | 8021623918 | 127 |
| 193 | iso_pu_bacteria | 8021626552 | 8021629542 | 127 |
| 194 | iso_pu_bacteria | 8021648035 | 8021648078 | 127 |
| 195 | 3300031548 | Ga0307408_100295314 | Ga0307408_1002953142 | 130 |
| 196 | 3300031731 | Ga0307405_10673935 | Ga0307405_106739351 | 130 |
| 197 | 3300031824 | Ga0307413_10706724 | Ga0307413_107067241 | 130 |
| 198 | 3300031852 | Ga0307410_10198454 | Ga0307410_101984542 | 130 |
| 199 | 3300031901 | Ga0307406_10505883 | Ga0307406_105058831 | 130 |
| 200 | 3300031903 | Ga0307407_10037545 | Ga0307407_100375453 | 130 |
| 201 | 3300031995 | Ga0307409_101474530 | Ga0307409_1014745301 | 130 |
| 202 | 3300032002 | Ga0307416_100368293 | Ga0307416_1003682932 | 130 |
| 203 | 3300032002 | Ga0307416_101013859 | Ga0307416_1010138592 | 130 |
| 204 | 3300032004 | Ga0307414_10476922 | Ga0307414_104769222 | 130 |
| 205 | 3300032005 | Ga0307411_10080092 | Ga0307411_100800922 | 130 |
| 206 | 3300032005 | Ga0307411_10673108 | Ga0307411_106731081 | 130 |
| 207 | 3300032126 | Ga0307415_100501713 | Ga0307415_1005017132 | 130 |
| 208 | 3300037471 | Ga0395905_0930696 | Ga0395905_0930696_75_467 | 130 |
| 209 | 3300049652 | Ga0501202_227438 | Ga0501202_227438_81_473 | 130 |
| 210 | 3300049660 | Ga0501216_049451 | Ga0501216_049451_363_755 | 130 |
| 211 | 3300049661 | Ga0501217_113782 | Ga0501217_113782_91_483 | 130 |
| 212 | 3300049663 | Ga0501223_121632 | Ga0501223_121632_55_447 | 130 |
| 213 | 3300049688 | Ga0501259_110086 | Ga0501259_110086_102_494 | 130 |
| 214 | 3300049763 | Ga0501266_033351 | Ga0501266_033351_91_483 | 130 |
| 215 | 2162886007 | SwRhRL2b_contig_1774666 | SwRhRL2b_0027.00008380 | 131 |
| 216 | 2162886007 | SwRhRL2b_contig_333196 | SwRhRL2b_0230.00003460 | 131 |
| 217 | 2162886007 | SwRhRL2b_contig_3538589 | SwRhRL2b_0356.00000230 | 131 |
| 218 | 3300001904 | JGI24736J21556_1047816 | JGI24736J21556_10478162 | 131 |
| 219 | 3300001915 | JGI24741J21665_1000917 | JGI24741J21665_10009178 | 131 |
| 220 | 3300001915 | JGI24741J21665_1002063 | JGI24741J21665_10020635 | 131 |
| 221 | 3300001915 | JGI24741J21665_1003645 | JGI24741J21665_10036453 | 131 |
| 222 | 3300001979 | JGI24740J21852_10006510 | JGI24740J21852_100065103 | 131 |
| 223 | 3300001979 | JGI24740J21852_10025119 | JGI24740J21852_100251191 | 131 |
| 224 | 3300001979 | JGI24740J21852_10061494 | JGI24740J21852_100614941 | 131 |
| 225 | 3300002773 | JGI25152J39213_1000126 | JGI25152J39213_100012611 | 131 |
| 226 | 3300002774 | JGI25150J39212_1000180 | JGI25150J39212_100018013 | 131 |
| 227 | 3300003187 | JGI25151J46595_10000177 | JGI25151J46595_1000017731 | 131 |
| 228 | 3300003187 | JGI25151J46595_10032534 | JGI25151J46595_100325344 | 131 |
| 229 | 3300003215 | JGI25153J46596_10000130 | JGI25153J46596_1000013034 | 131 |
| 230 | 3300003320 | rootH2_10002342 | rootH2_100023425 | 131 |
| 231 | 3300003771 | Ga0055526_1015942 | Ga0055526_10159422 | 131 |
| 232 | 3300003773 | Ga0055537_1000085 | Ga0055537_100008561 | 131 |
| 233 | 3300003775 | Ga0055524_1015646 | Ga0055524_10156464 | 131 |
| 234 | 3300003775 | Ga0055524_1021849 | Ga0055524_10218492 | 131 |
| 235 | 3300003781 | Ga0055536_1019715 | Ga0055536_10197152 | 131 |
| 236 | 3300003781 | Ga0055536_1020627 | Ga0055536_10206272 | 131 |
| 237 | 3300003784 | Ga0055534_1000113 | Ga0055534_100011328 | 131 |
| 238 | 3300003784 | Ga0055534_1024998 | Ga0055534_10249981 | 131 |
| 239 | 3300003784 | Ga0055534_1052392 | Ga0055534_10523921 | 131 |
| 240 | 3300003790 | Ga0055528_1002024 | Ga0055528_10020242 | 131 |
| 241 | 3300003791 | Ga0055530_10006864 | Ga0055530_100068644 | 131 |
| 242 | 3300003791 | Ga0055530_10101103 | Ga0055530_101011031 | 131 |
| 243 | 3300003792 | Ga0055540_1104255 | Ga0055540_11042551 | 131 |
| 244 | 3300003794 | Ga0055531_10008361 | Ga0055531_100083615 | 131 |
| 245 | 3300003794 | Ga0055531_10015106 | Ga0055531_100151061 | 131 |
| 246 | 3300003794 | Ga0055531_10017800 | Ga0055531_100178004 | 131 |
| 247 | 3300003794 | Ga0055531_10021856 | Ga0055531_100218562 | 131 |
| 248 | 3300003794 | Ga0055531_10025914 | Ga0055531_100259141 | 131 |
| 249 | 3300003794 | Ga0055531_10027930 | Ga0055531_100279302 | 131 |
| 250 | 3300003794 | Ga0055531_10046236 | Ga0055531_100462361 | 131 |
| 251 | 3300003856 | Ga0058692_1000015 | Ga0058692_1000015197 | 131 |
| 252 | 3300004799 | Ga0058863_11839322 | Ga0058863_118393221 | 131 |
| 253 | 3300004800 | Ga0058861_11774843 | Ga0058861_117748431 | 131 |
| 254 | 3300004803 | Ga0058862_12685554 | Ga0058862_126855541 | 131 |
| 255 | 3300005288 | Ga0065714_10266233 | Ga0065714_102662332 | 131 |
| 256 | 3300005289 | Ga0065704_10210458 | Ga0065704_102104582 | 131 |
| 257 | 3300005289 | Ga0065704_10217831 | Ga0065704_102178312 | 131 |
| 258 | 3300005289 | Ga0065704_10535473 | Ga0065704_105354731 | 131 |
| 259 | 3300005289 | Ga0065704_10549927 | Ga0065704_105499272 | 131 |
| 260 | 3300005327 | Ga0070658_10070426 | Ga0070658_100704263 | 131 |
| 261 | 3300005327 | Ga0070658_10156876 | Ga0070658_101568762 | 131 |
| 262 | 3300005327 | Ga0070658_10302993 | Ga0070658_103029932 | 131 |
| 263 | 3300005327 | Ga0070658_10466983 | Ga0070658_104669831 | 131 |
| 264 | 3300005329 | Ga0070683_100082432 | Ga0070683_1000824323 | 131 |
| 265 | 3300005329 | Ga0070683_100103830 | Ga0070683_1001038303 | 131 |
| 266 | 3300005331 | Ga0070670_100032457 | Ga0070670_1000324572 | 131 |
| 267 | 3300005336 | Ga0070680_100023558 | Ga0070680_1000235582 | 131 |
| 268 | 3300005336 | Ga0070680_100090118 | Ga0070680_1000901182 | 131 |
| 269 | 3300005336 | Ga0070680_100136585 | Ga0070680_1001365852 | 131 |
| 270 | 3300005336 | Ga0070680_100189157 | Ga0070680_1001891573 | 131 |
| 271 | 3300005336 | Ga0070680_100358991 | Ga0070680_1003589911 | 131 |
| 272 | 3300005337 | Ga0070682_100057814 | Ga0070682_1000578142 | 131 |
| 273 | 3300005337 | Ga0070682_100205047 | Ga0070682_1002050472 | 131 |
| 274 | 3300005337 | Ga0070682_100352239 | Ga0070682_1003522392 | 131 |
| 275 | 3300005339 | Ga0070660_100062259 | Ga0070660_1000622592 | 131 |
| 276 | 3300005339 | Ga0070660_100069720 | Ga0070660_1000697203 | 131 |
| 277 | 3300005339 | Ga0070660_100081074 | Ga0070660_1000810743 | 131 |
| 278 | 3300005341 | Ga0070691_10007471 | Ga0070691_100074715 | 131 |
| 279 | 3300005341 | Ga0070691_10161466 | Ga0070691_101614662 | 131 |
| 280 | 3300005341 | Ga0070691_10163341 | Ga0070691_101633412 | 131 |
| 281 | 3300005341 | Ga0070691_10254216 | Ga0070691_102542162 | 131 |
| 282 | 3300005344 | Ga0070661_100047164 | Ga0070661_1000471643 | 131 |
| 283 | 3300005344 | Ga0070661_100051713 | Ga0070661_1000517132 | 131 |
| 284 | 3300005344 | Ga0070661_100077859 | Ga0070661_1000778592 | 131 |
| 285 | 3300005344 | Ga0070661_100445642 | Ga0070661_1004456421 | 131 |
| 286 | 3300005345 | Ga0070692_10002504 | Ga0070692_100025042 | 131 |
| 287 | 3300005345 | Ga0070692_10020344 | Ga0070692_100203443 | 131 |
| 288 | 3300005345 | Ga0070692_10032916 | Ga0070692_100329162 | 131 |
| 289 | 3300005345 | Ga0070692_10178726 | Ga0070692_101787263 | 131 |
| 290 | 3300005345 | Ga0070692_10229695 | Ga0070692_102296952 | 131 |
| 291 | 3300005353 | Ga0070669_100256027 | Ga0070669_1002560272 | 131 |
| 292 | 3300005354 | Ga0070675_100770260 | Ga0070675_1007702601 | 131 |
| 293 | 3300005355 | Ga0070671_100016518 | Ga0070671_1000165185 | 131 |
| 294 | 3300005364 | Ga0070673_100275614 | Ga0070673_1002756141 | 131 |
| 295 | 3300005366 | Ga0070659_100113442 | Ga0070659_1001134423 | 131 |
| 296 | 3300005366 | Ga0070659_100220110 | Ga0070659_1002201103 | 131 |
| 297 | 3300005366 | Ga0070659_100301476 | Ga0070659_1003014762 | 131 |
| 298 | 3300005455 | Ga0070663_100183087 | Ga0070663_1001830872 | 131 |
| 299 | 3300005455 | Ga0070663_100218141 | Ga0070663_1002181412 | 131 |
| 300 | 3300005455 | Ga0070663_100664777 | Ga0070663_1006647772 | 131 |
| 301 | 3300005455 | Ga0070663_100927080 | Ga0070663_1009270801 | 131 |
| 302 | 3300005457 | Ga0070662_100061203 | Ga0070662_1000612032 | 131 |
| 303 | 3300005458 | Ga0070681_10000027 | Ga0070681_1000002766 | 131 |
| 304 | 3300005458 | Ga0070681_10007456 | Ga0070681_100074569 | 131 |
| 305 | 3300005458 | Ga0070681_10014781 | Ga0070681_100147817 | 131 |
| 306 | 3300005458 | Ga0070681_10317883 | Ga0070681_103178832 | 131 |
| 307 | 3300005458 | Ga0070681_11135920 | Ga0070681_111359202 | 131 |
| 308 | 3300005518 | Ga0070699_101023830 | Ga0070699_1010238301 | 131 |
| 309 | 3300005530 | Ga0070679_100004909 | Ga0070679_10000490911 | 131 |
| 310 | 3300005530 | Ga0070679_100102034 | Ga0070679_1001020343 | 131 |
| 311 | 3300005530 | Ga0070679_100340277 | Ga0070679_1003402772 | 131 |
| 312 | 3300005530 | Ga0070679_100452616 | Ga0070679_1004526162 | 131 |
| 313 | 3300005530 | Ga0070679_101488649 | Ga0070679_1014886491 | 131 |
| 314 | 3300005535 | Ga0070684_100078982 | Ga0070684_1000789823 | 131 |
| 315 | 3300005535 | Ga0070684_100079375 | Ga0070684_1000793752 | 131 |
| 316 | 3300005535 | Ga0070684_101403196 | Ga0070684_1014031961 | 131 |
| 317 | 3300005539 | Ga0068853_100059038 | Ga0068853_1000590383 | 131 |
| 318 | 3300005539 | Ga0068853_100198639 | Ga0068853_1001986392 | 131 |
| 319 | 3300005546 | Ga0070696_100053930 | Ga0070696_1000539303 | 131 |
| 320 | 3300005546 | Ga0070696_100314894 | Ga0070696_1003148942 | 131 |
| 321 | 3300005546 | Ga0070696_100362101 | Ga0070696_1003621012 | 131 |
| 322 | 3300005546 | Ga0070696_101794067 | Ga0070696_1017940671 | 131 |
| 323 | 3300005548 | Ga0070665_100075637 | Ga0070665_1000756375 | 131 |
| 324 | 3300005563 | Ga0068855_100028237 | Ga0068855_1000282377 | 131 |
| 325 | 3300005563 | Ga0068855_100194420 | Ga0068855_1001944203 | 131 |
| 326 | 3300005563 | Ga0068855_100356439 | Ga0068855_1003564391 | 131 |
| 327 | 3300005563 | Ga0068855_100424734 | Ga0068855_1004247342 | 131 |
| 328 | 3300005564 | Ga0070664_100097123 | Ga0070664_1000971233 | 131 |
| 329 | 3300005564 | Ga0070664_100164350 | Ga0070664_1001643502 | 131 |
| 330 | 3300005564 | Ga0070664_100481998 | Ga0070664_1004819982 | 131 |
| 331 | 3300005577 | Ga0068857_100094399 | Ga0068857_1000943993 | 131 |
| 332 | 3300005577 | Ga0068857_100108070 | Ga0068857_1001080701 | 131 |
| 333 | 3300005578 | Ga0068854_100095202 | Ga0068854_1000952022 | 131 |
| 334 | 3300005578 | Ga0068854_100104350 | Ga0068854_1001043503 | 131 |
| 335 | 3300005578 | Ga0068854_100136302 | Ga0068854_1001363022 | 131 |
| 336 | 3300005578 | Ga0068854_100286783 | Ga0068854_1002867832 | 131 |
| 337 | 3300005578 | Ga0068854_102049236 | Ga0068854_1020492361 | 131 |
| 338 | 3300005614 | Ga0068856_100121850 | Ga0068856_1001218503 | 131 |
| 339 | 3300005614 | Ga0068856_100221951 | Ga0068856_1002219512 | 131 |
| 340 | 3300005614 | Ga0068856_100495610 | Ga0068856_1004956102 | 131 |
| 341 | 3300005614 | Ga0068856_100762675 | Ga0068856_1007626751 | 131 |
| 342 | 3300005616 | Ga0068852_100009788 | Ga0068852_1000097883 | 131 |
| 343 | 3300005616 | Ga0068852_100176655 | Ga0068852_1001766553 | 131 |
| 344 | 3300005616 | Ga0068852_100373234 | Ga0068852_1003732342 | 131 |
| 345 | 3300005616 | Ga0068852_100517960 | Ga0068852_1005179602 | 131 |
| 346 | 3300005616 | Ga0068852_102353591 | Ga0068852_1023535911 | 131 |
| 347 | 3300005617 | Ga0068859_100314770 | Ga0068859_1003147702 | 131 |
| 348 | 3300005618 | Ga0068864_100101070 | Ga0068864_1001010704 | 131 |
| 349 | 3300005834 | Ga0068851_10036708 | Ga0068851_100367082 | 131 |
| 350 | 3300005844 | Ga0068862_100228992 | Ga0068862_1002289921 | 131 |
| 351 | 3300005985 | Ga0081539_10035642 | Ga0081539_100356423 | 131 |
| 352 | 3300006038 | Ga0075365_10485594 | Ga0075365_104855942 | 131 |
| 353 | 3300006048 | Ga0075363_100267851 | Ga0075363_1002678512 | 131 |
| 354 | 3300006051 | Ga0075364_10001892 | Ga0075364_100018923 | 131 |
| 355 | 3300006051 | Ga0075364_10021796 | Ga0075364_100217964 | 131 |
| 356 | 3300006051 | Ga0075364_10026689 | Ga0075364_100266893 | 131 |
| 357 | 3300006051 | Ga0075364_10089800 | Ga0075364_100898001 | 131 |
| 358 | 3300006051 | Ga0075364_10119740 | Ga0075364_101197402 | 131 |
| 359 | 3300006051 | Ga0075364_10832548 | Ga0075364_108325481 | 131 |
| 360 | 3300006844 | Ga0075428_101428252 | Ga0075428_1014282521 | 131 |
| 361 | 3300006931 | Ga0097620_100314793 | Ga0097620_1003147932 | 131 |
| 362 | 3300009011 | Ga0105251_10001735 | Ga0105251_1000173510 | 131 |
| 363 | 3300009093 | Ga0105240_10120222 | Ga0105240_101202223 | 131 |
| 364 | 3300009093 | Ga0105240_10132397 | Ga0105240_101323973 | 131 |
| 365 | 3300009093 | Ga0105240_10190935 | Ga0105240_101909353 | 131 |
| 366 | 3300009093 | Ga0105240_10450202 | Ga0105240_104502022 | 131 |
| 367 | 3300009093 | Ga0105240_11024366 | Ga0105240_110243662 | 131 |
| 368 | 3300009148 | Ga0105243_10010067 | Ga0105243_100100675 | 131 |
| 369 | 3300009174 | Ga0105241_10060367 | Ga0105241_100603672 | 131 |
| 370 | 3300009177 | Ga0105248_10123306 | Ga0105248_101233062 | 131 |
| 371 | 3300009545 | Ga0105237_10225334 | Ga0105237_102253342 | 131 |
| 372 | 3300009545 | Ga0105237_10417511 | Ga0105237_104175113 | 131 |
| 373 | 3300009545 | Ga0105237_10596612 | Ga0105237_105966122 | 131 |
| 374 | 3300009551 | Ga0105238_10113729 | Ga0105238_101137292 | 131 |
| 375 | 3300009979 | Ga0105032_104842 | Ga0105032_1048422 | 131 |
| 376 | 3300009993 | Ga0105028_136500 | Ga0105028_1365001 | 131 |
| 377 | 3300011119 | Ga0105246_11164916 | Ga0105246_111649161 | 131 |
| 378 | 3300012478 | Ga0157328_1001614 | Ga0157328_10016141 | 131 |
| 379 | 3300012482 | Ga0157318_1000351 | Ga0157318_10003511 | 131 |
| 380 | 3300012508 | Ga0157315_1009297 | Ga0157315_10092971 | 131 |
| 381 | 3300012512 | Ga0157327_1000101 | Ga0157327_10001014 | 131 |
| 382 | 3300013100 | Ga0157373_10039717 | Ga0157373_100397173 | 131 |
| 383 | 3300013100 | Ga0157373_10047580 | Ga0157373_100475803 | 131 |
| 384 | 3300013100 | Ga0157373_10094975 | Ga0157373_100949752 | 131 |
| 385 | 3300013100 | Ga0157373_10169918 | Ga0157373_101699182 | 131 |
| 386 | 3300013100 | Ga0157373_10204956 | Ga0157373_102049561 | 131 |
| 387 | 3300013100 | Ga0157373_10255402 | Ga0157373_102554021 | 131 |
| 388 | 3300013102 | Ga0157371_10001197 | Ga0157371_1000119717 | 131 |
| 389 | 3300013102 | Ga0157371_10049348 | Ga0157371_100493483 | 131 |
| 390 | 3300013102 | Ga0157371_10063005 | Ga0157371_100630052 | 131 |
| 391 | 3300013102 | Ga0157371_10072437 | Ga0157371_100724374 | 131 |
| 392 | 3300013102 | Ga0157371_10107616 | Ga0157371_101076162 | 131 |
| 393 | 3300013102 | Ga0157371_10499915 | Ga0157371_104999151 | 131 |
| 394 | 3300013102 | Ga0157371_11345814 | Ga0157371_113458141 | 131 |
| 395 | 3300013104 | Ga0157370_10005494 | Ga0157370_100054943 | 131 |
| 396 | 3300013104 | Ga0157370_10014388 | Ga0157370_100143883 | 131 |
| 397 | 3300013104 | Ga0157370_10243533 | Ga0157370_102435333 | 131 |
| 398 | 3300013104 | Ga0157370_10319621 | Ga0157370_103196212 | 131 |
| 399 | 3300013104 | Ga0157370_10513745 | Ga0157370_105137453 | 131 |
| 400 | 3300013104 | Ga0157370_10817540 | Ga0157370_108175402 | 131 |
| 401 | 3300013105 | Ga0157369_10095088 | Ga0157369_100950883 | 131 |
| 402 | 3300013105 | Ga0157369_10101943 | Ga0157369_101019433 | 131 |
| 403 | 3300013105 | Ga0157369_10106109 | Ga0157369_101061093 | 131 |
| 404 | 3300013105 | Ga0157369_10256664 | Ga0157369_102566641 | 131 |
| 405 | 3300013306 | Ga0163162_10163399 | Ga0163162_101633994 | 131 |
| 406 | 3300013306 | Ga0163162_11248124 | Ga0163162_112481241 | 131 |
| 407 | 3300013307 | Ga0157372_10010126 | Ga0157372_100101262 | 131 |
| 408 | 3300013307 | Ga0157372_10116846 | Ga0157372_101168463 | 131 |
| 409 | 3300013307 | Ga0157372_10154423 | Ga0157372_101544232 | 131 |
| 410 | 3300013307 | Ga0157372_10278019 | Ga0157372_102780192 | 131 |
| 411 | 3300013307 | Ga0157372_10388961 | Ga0157372_103889613 | 131 |
| 412 | 3300013308 | Ga0157375_10874447 | Ga0157375_108744472 | 131 |
| 413 | 3300013874 | Ga0157514_121698 | Ga0157514_1216981 | 131 |
| 414 | 3300014326 | Ga0157380_10096605 | Ga0157380_100966054 | 131 |
| 415 | 3300014497 | Ga0182008_10000640 | Ga0182008_100006408 | 131 |
| 416 | 3300014497 | Ga0182008_10029807 | Ga0182008_100298074 | 131 |
| 417 | 3300015261 | Ga0182006_1029462 | Ga0182006_10294621 | 131 |
| 418 | 3300015261 | Ga0182006_1044394 | Ga0182006_10443942 | 131 |
| 419 | 3300015265 | Ga0182005_1007526 | Ga0182005_10075263 | 131 |
| 420 | 3300017792 | Ga0163161_10005585 | Ga0163161_100055859 | 131 |
| 421 | 3300017792 | Ga0163161_11025912 | Ga0163161_110259121 | 131 |
| 422 | 3300020069 | Ga0197907_10010081 | Ga0197907_100100812 | 131 |
| 423 | 3300020069 | Ga0197907_10910264 | Ga0197907_109102642 | 131 |
| 424 | 3300020070 | Ga0206356_10191945 | Ga0206356_101919453 | 131 |
| 425 | 3300020070 | Ga0206356_11621496 | Ga0206356_116214964 | 131 |
| 426 | 3300020076 | Ga0206355_1661501 | Ga0206355_16615011 | 131 |
| 427 | 3300020077 | Ga0206351_10365865 | Ga0206351_103658652 | 131 |
| 428 | 3300020077 | Ga0206351_10599785 | Ga0206351_105997852 | 131 |
| 429 | 3300020078 | Ga0206352_10032047 | Ga0206352_100320472 | 131 |
| 430 | 3300020078 | Ga0206352_11104993 | Ga0206352_111049931 | 131 |
| 431 | 3300020080 | Ga0206350_10893779 | Ga0206350_108937792 | 131 |
| 432 | 3300020080 | Ga0206350_11143801 | Ga0206350_111438011 | 131 |
| 433 | 3300020081 | Ga0206354_10062392 | Ga0206354_100623924 | 131 |
| 434 | 3300020081 | Ga0206354_11127055 | Ga0206354_111270552 | 131 |
| 435 | 3300020082 | Ga0206353_10282153 | Ga0206353_102821533 | 131 |
| 436 | 3300020082 | Ga0206353_10476976 | Ga0206353_104769762 | 131 |
| 437 | 3300020610 | Ga0154015_1147847 | Ga0154015_11478471 | 131 |
| 438 | 3300020610 | Ga0154015_1306398 | Ga0154015_13063983 | 131 |
| 439 | 3300020610 | Ga0154015_1459418 | Ga0154015_14594181 | 131 |
| 440 | 3300020610 | Ga0154015_1472900 | Ga0154015_14729001 | 131 |
| 441 | 3300022467 | Ga0224712_10027926 | Ga0224712_100279262 | 131 |
| 442 | 3300022467 | Ga0224712_10333768 | Ga0224712_103337681 | 131 |
| 443 | 3300025245 | Ga0207425_1000066 | Ga0207425_100006678 | 131 |
| 444 | 3300025258 | Ga0209129_1000135 | Ga0209129_100013537 | 131 |
| 445 | 3300025263 | Ga0209565_1000023 | Ga0209565_1000023240 | 131 |
| 446 | 3300025273 | Ga0209673_1000116 | Ga0209673_100011650 | 131 |
| 447 | 3300025273 | Ga0209673_1004235 | Ga0209673_10042357 | 131 |
| 448 | 3300025284 | Ga0209130_1010488 | Ga0209130_10104882 | 131 |
| 449 | 3300025291 | Ga0209675_1000154 | Ga0209675_100015464 | 131 |
| 450 | 3300025291 | Ga0209675_1042358 | Ga0209675_10423581 | 131 |
| 451 | 3300025292 | Ga0209676_1011135 | Ga0209676_10111355 | 131 |
| 452 | 3300025294 | Ga0209025_1000013 | Ga0209025_1000013361 | 131 |
| 453 | 3300025294 | Ga0209025_1004258 | Ga0209025_10042582 | 131 |
| 454 | 3300025294 | Ga0209025_1059359 | Ga0209025_10593591 | 131 |
| 455 | 3300025295 | Ga0209564_1000106 | Ga0209564_100010639 | 131 |
| 456 | 3300025295 | Ga0209564_1014368 | Ga0209564_10143681 | 131 |
| 457 | 3300025297 | Ga0209758_1000014 | Ga0209758_1000014361 | 131 |
| 458 | 3300025297 | Ga0209758_1026770 | Ga0209758_10267703 | 131 |
| 459 | 3300025297 | Ga0209758_1084955 | Ga0209758_10849551 | 131 |
| 460 | 3300025298 | Ga0209050_1001331 | Ga0209050_100133124 | 131 |
| 461 | 3300025298 | Ga0209050_1033477 | Ga0209050_10334771 | 131 |
| 462 | 3300025298 | Ga0209050_1046790 | Ga0209050_10467902 | 131 |
| 463 | 3300025298 | Ga0209050_1088452 | Ga0209050_10884521 | 131 |
| 464 | 3300025299 | Ga0209256_1002361 | Ga0209256_10023612 | 131 |
| 465 | 3300025299 | Ga0209256_1003532 | Ga0209256_100353210 | 131 |
| 466 | 3300025299 | Ga0209256_1005289 | Ga0209256_10052897 | 131 |
| 467 | 3300025303 | Ga0209051_1009475 | Ga0209051_10094753 | 131 |
| 468 | 3300025304 | Ga0209257_1000270 | Ga0209257_100027024 | 131 |
| 469 | 3300025304 | Ga0209257_1000310 | Ga0209257_100031045 | 131 |
| 470 | 3300025304 | Ga0209257_1000378 | Ga0209257_100037814 | 131 |
| 471 | 3300025304 | Ga0209257_1023300 | Ga0209257_10233002 | 131 |
| 472 | 3300025321 | Ga0207656_10053631 | Ga0207656_100536312 | 131 |
| 473 | 3300025735 | Ga0207713_1000324 | Ga0207713_100032439 | 131 |
| 474 | 3300025904 | Ga0207647_10010962 | Ga0207647_100109626 | 131 |
| 475 | 3300025904 | Ga0207647_10048229 | Ga0207647_100482292 | 131 |
| 476 | 3300025904 | Ga0207647_10131667 | Ga0207647_101316673 | 131 |
| 477 | 3300025907 | Ga0207645_10232264 | Ga0207645_102322642 | 131 |
| 478 | 3300025909 | Ga0207705_10000527 | Ga0207705_100005278 | 131 |
| 479 | 3300025909 | Ga0207705_10002485 | Ga0207705_1000248511 | 131 |
| 480 | 3300025909 | Ga0207705_10002907 | Ga0207705_100029073 | 131 |
| 481 | 3300025909 | Ga0207705_10019921 | Ga0207705_100199212 | 131 |
| 482 | 3300025909 | Ga0207705_10413415 | Ga0207705_104134151 | 131 |
| 483 | 3300025911 | Ga0207654_10205018 | Ga0207654_102050181 | 131 |
| 484 | 3300025912 | Ga0207707_10000039 | Ga0207707_1000003936 | 131 |
| 485 | 3300025912 | Ga0207707_10000061 | Ga0207707_1000006147 | 131 |
| 486 | 3300025912 | Ga0207707_10000095 | Ga0207707_1000009512 | 131 |
| 487 | 3300025912 | Ga0207707_10000854 | Ga0207707_1000085414 | 131 |
| 488 | 3300025912 | Ga0207707_10000930 | Ga0207707_1000093023 | 131 |
| 489 | 3300025912 | Ga0207707_10001518 | Ga0207707_100015186 | 131 |
| 490 | 3300025912 | Ga0207707_10008753 | Ga0207707_100087537 | 131 |
| 491 | 3300025913 | Ga0207695_10001815 | Ga0207695_1000181519 | 131 |
| 492 | 3300025913 | Ga0207695_10010700 | Ga0207695_100107003 | 131 |
| 493 | 3300025913 | Ga0207695_10011157 | Ga0207695_100111573 | 131 |
| 494 | 3300025913 | Ga0207695_10198068 | Ga0207695_101980681 | 131 |
| 495 | 3300025917 | Ga0207660_10001101 | Ga0207660_100011012 | 131 |
| 496 | 3300025917 | Ga0207660_10003239 | Ga0207660_100032391 | 131 |
| 497 | 3300025917 | Ga0207660_10006078 | Ga0207660_100060787 | 131 |
| 498 | 3300025917 | Ga0207660_10045054 | Ga0207660_100450543 | 131 |
| 499 | 3300025917 | Ga0207660_10046286 | Ga0207660_100462862 | 131 |
| 500 | 3300025917 | Ga0207660_10079597 | Ga0207660_100795973 | 131 |
| 501 | 3300025919 | Ga0207657_10066686 | Ga0207657_100666863 | 131 |
| 502 | 3300025919 | Ga0207657_10068618 | Ga0207657_100686183 | 131 |
| 503 | 3300025919 | Ga0207657_10071330 | Ga0207657_100713303 | 131 |
| 504 | 3300025919 | Ga0207657_10085229 | Ga0207657_100852292 | 131 |
| 505 | 3300025919 | Ga0207657_11393869 | Ga0207657_113938691 | 131 |
| 506 | 3300025920 | Ga0207649_10012334 | Ga0207649_100123342 | 131 |
| 507 | 3300025920 | Ga0207649_10018343 | Ga0207649_100183434 | 131 |
| 508 | 3300025920 | Ga0207649_10085865 | Ga0207649_100858652 | 131 |
| 509 | 3300025920 | Ga0207649_10146690 | Ga0207649_101466902 | 131 |
| 510 | 3300025920 | Ga0207649_10226953 | Ga0207649_102269532 | 131 |
| 511 | 3300025920 | Ga0207649_10423423 | Ga0207649_104234232 | 131 |
| 512 | 3300025921 | Ga0207652_10000376 | Ga0207652_1000037632 | 131 |
| 513 | 3300025921 | Ga0207652_10000534 | Ga0207652_1000053418 | 131 |
| 514 | 3300025921 | Ga0207652_10000855 | Ga0207652_1000085523 | 131 |
| 515 | 3300025921 | Ga0207652_10003739 | Ga0207652_100037392 | 131 |
| 516 | 3300025921 | Ga0207652_10004248 | Ga0207652_100042483 | 131 |
| 517 | 3300025921 | Ga0207652_10059147 | Ga0207652_100591473 | 131 |
| 518 | 3300025921 | Ga0207652_10947911 | Ga0207652_109479111 | 131 |
| 519 | 3300025923 | Ga0207681_10346353 | Ga0207681_103463532 | 131 |
| 520 | 3300025923 | Ga0207681_10499277 | Ga0207681_104992771 | 131 |
| 521 | 3300025924 | Ga0207694_10346855 | Ga0207694_103468552 | 131 |
| 522 | 3300025925 | Ga0207650_10032905 | Ga0207650_100329054 | 131 |
| 523 | 3300025925 | Ga0207650_10140463 | Ga0207650_101404632 | 131 |
| 524 | 3300025926 | Ga0207659_10345814 | Ga0207659_103458142 | 131 |
| 525 | 3300025931 | Ga0207644_10252271 | Ga0207644_102522712 | 131 |
| 526 | 3300025931 | Ga0207644_10334671 | Ga0207644_103346711 | 131 |
| 527 | 3300025932 | Ga0207690_10001346 | Ga0207690_100013469 | 131 |
| 528 | 3300025932 | Ga0207690_10005785 | Ga0207690_100057852 | 131 |
| 529 | 3300025933 | Ga0207706_10052564 | Ga0207706_100525642 | 131 |
| 530 | 3300025940 | Ga0207691_10002069 | Ga0207691_1000206913 | 131 |
| 531 | 3300025940 | Ga0207691_10754647 | Ga0207691_107546472 | 131 |
| 532 | 3300025941 | Ga0207711_10053878 | Ga0207711_100538784 | 131 |
| 533 | 3300025944 | Ga0207661_10001167 | Ga0207661_1000116715 | 131 |
| 534 | 3300025944 | Ga0207661_10006758 | Ga0207661_100067586 | 131 |
| 535 | 3300025944 | Ga0207661_10010189 | Ga0207661_100101897 | 131 |
| 536 | 3300025944 | Ga0207661_10989891 | Ga0207661_109898911 | 131 |
| 537 | 3300025944 | Ga0207661_11027124 | Ga0207661_110271242 | 131 |
| 538 | 3300025945 | Ga0207679_10093100 | Ga0207679_100931003 | 131 |
| 539 | 3300025945 | Ga0207679_10124200 | Ga0207679_101242002 | 131 |
| 540 | 3300025945 | Ga0207679_10223437 | Ga0207679_102234373 | 131 |
| 541 | 3300025945 | Ga0207679_10278865 | Ga0207679_102788652 | 131 |
| 542 | 3300025945 | Ga0207679_10420122 | Ga0207679_104201222 | 131 |
| 543 | 3300025945 | Ga0207679_10427332 | Ga0207679_104273322 | 131 |
| 544 | 3300025949 | Ga0207667_10004910 | Ga0207667_100049109 | 131 |
| 545 | 3300025949 | Ga0207667_10015525 | Ga0207667_100155257 | 131 |
| 546 | 3300025949 | Ga0207667_10103144 | Ga0207667_101031442 | 131 |
| 547 | 3300025949 | Ga0207667_10328640 | Ga0207667_103286402 | 131 |
| 548 | 3300025949 | Ga0207667_10927960 | Ga0207667_109279602 | 131 |
| 549 | 3300025960 | Ga0207651_10238000 | Ga0207651_102380002 | 131 |
| 550 | 3300025960 | Ga0207651_10527760 | Ga0207651_105277602 | 131 |
| 551 | 3300025972 | Ga0207668_10117785 | Ga0207668_101177852 | 131 |
| 552 | 3300025981 | Ga0207640_10001438 | Ga0207640_1000143811 | 131 |
| 553 | 3300025981 | Ga0207640_10004474 | Ga0207640_100044743 | 131 |
| 554 | 3300025981 | Ga0207640_10005294 | Ga0207640_100052947 | 131 |
| 555 | 3300025981 | Ga0207640_10138392 | Ga0207640_101383921 | 131 |
| 556 | 3300025981 | Ga0207640_10171662 | Ga0207640_101716621 | 131 |
| 557 | 3300025981 | Ga0207640_10558107 | Ga0207640_105581071 | 131 |
| 558 | 3300026041 | Ga0207639_10029977 | Ga0207639_100299774 | 131 |
| 559 | 3300026041 | Ga0207639_10086642 | Ga0207639_100866423 | 131 |
| 560 | 3300026041 | Ga0207639_10507160 | Ga0207639_105071601 | 131 |
| 561 | 3300026041 | Ga0207639_10829938 | Ga0207639_108299382 | 131 |
| 562 | 3300026067 | Ga0207678_10067891 | Ga0207678_100678913 | 131 |
| 563 | 3300026067 | Ga0207678_10073079 | Ga0207678_100730793 | 131 |
| 564 | 3300026067 | Ga0207678_10076340 | Ga0207678_100763403 | 131 |
| 565 | 3300026067 | Ga0207678_10078976 | Ga0207678_100789763 | 131 |
| 566 | 3300026067 | Ga0207678_10088496 | Ga0207678_100884962 | 131 |
| 567 | 3300026078 | Ga0207702_10003173 | Ga0207702_100031733 | 131 |
| 568 | 3300026078 | Ga0207702_10007007 | Ga0207702_1000700710 | 131 |
| 569 | 3300026078 | Ga0207702_10069240 | Ga0207702_100692403 | 131 |
| 570 | 3300026078 | Ga0207702_10458160 | Ga0207702_104581602 | 131 |
| 571 | 3300026088 | Ga0207641_10099869 | Ga0207641_100998691 | 131 |
| 572 | 3300026089 | Ga0207648_10243875 | Ga0207648_102438752 | 131 |
| 573 | 3300026095 | Ga0207676_10061110 | Ga0207676_100611103 | 131 |
| 574 | 3300026116 | Ga0207674_10046641 | Ga0207674_100466415 | 131 |
| 575 | 3300026116 | Ga0207674_10097114 | Ga0207674_100971143 | 131 |
| 576 | 3300026116 | Ga0207674_10116204 | Ga0207674_101162042 | 131 |
| 577 | 3300026116 | Ga0207674_10415018 | Ga0207674_104150181 | 131 |
| 578 | 3300026142 | Ga0207698_10007061 | Ga0207698_100070612 | 131 |
| 579 | 3300026142 | Ga0207698_10021294 | Ga0207698_100212944 | 131 |
| 580 | 3300026142 | Ga0207698_10054226 | Ga0207698_100542263 | 131 |
| 581 | 3300026142 | Ga0207698_10099821 | Ga0207698_100998212 | 131 |
| 582 | 3300026142 | Ga0207698_10534430 | Ga0207698_105344301 | 131 |
| 583 | 3300026142 | Ga0207698_10926761 | Ga0207698_109267612 | 131 |
| 584 | 3300027312 | Ga0209371_1000011 | Ga0209371_1000011680 | 131 |
| 585 | 3300028379 | Ga0268266_10553401 | Ga0268266_105534011 | 131 |
| 586 | 3300028380 | Ga0268265_10117678 | Ga0268265_101176782 | 131 |
| 587 | 3300028380 | Ga0268265_10170692 | Ga0268265_101706921 | 131 |
| 588 | 3300028380 | Ga0268265_11209668 | Ga0268265_112096681 | 131 |
| 589 | 3300028794 | Ga0307515_10187071 | Ga0307515_101870712 | 131 |
| 590 | 3300030500 | Ga0268256_1000011 | Ga0268256_1000011680 | 131 |
| 591 | 3300030732 | Ga0316176_1026051 | Ga0316176_10260512 | 131 |
| 592 | 3300031456 | Ga0307513_10009118 | Ga0307513_1000911810 | 131 |
| 593 | 3300031456 | Ga0307513_10213724 | Ga0307513_102137242 | 131 |
| 594 | 3300031456 | Ga0307513_10450665 | Ga0307513_104506651 | 131 |
| 595 | 3300031507 | Ga0307509_10109058 | Ga0307509_101090582 | 131 |
| 596 | 3300031548 | Ga0307408_100286979 | Ga0307408_1002869793 | 131 |
| 597 | 3300031548 | Ga0307408_100694579 | Ga0307408_1006945792 | 131 |
| 598 | 3300031731 | Ga0307405_10257143 | Ga0307405_102571433 | 131 |
| 599 | 3300031731 | Ga0307405_10367277 | Ga0307405_103672771 | 131 |
| 600 | 3300031731 | Ga0307405_10830132 | Ga0307405_108301321 | 131 |
| 601 | 3300031731 | Ga0307405_11767922 | Ga0307405_117679221 | 131 |
| 602 | 3300031824 | Ga0307413_10061033 | Ga0307413_100610332 | 131 |
| 603 | 3300031824 | Ga0307413_10153450 | Ga0307413_101534502 | 131 |
| 604 | 3300031824 | Ga0307413_10451704 | Ga0307413_104517041 | 131 |
| 605 | 3300031824 | Ga0307413_10629269 | Ga0307413_106292692 | 131 |
| 606 | 3300031852 | Ga0307410_10081704 | Ga0307410_100817041 | 131 |
| 607 | 3300031852 | Ga0307410_10320143 | Ga0307410_103201431 | 131 |
| 608 | 3300031901 | Ga0307406_10133204 | Ga0307406_101332042 | 131 |
| 609 | 3300031911 | Ga0307412_10036110 | Ga0307412_100361103 | 131 |
| 610 | 3300031911 | Ga0307412_10274329 | Ga0307412_102743292 | 131 |
| 611 | 3300031911 | Ga0307412_10426948 | Ga0307412_104269482 | 131 |
| 612 | 3300031911 | Ga0307412_10433466 | Ga0307412_104334662 | 131 |
| 613 | 3300031911 | Ga0307412_10813076 | Ga0307412_108130762 | 131 |
| 614 | 3300032002 | Ga0307416_103153062 | Ga0307416_1031530621 | 131 |
| 615 | 3300032004 | Ga0307414_10008768 | Ga0307414_100087685 | 131 |
| 616 | 3300032004 | Ga0307414_10030087 | Ga0307414_100300874 | 131 |
| 617 | 3300032004 | Ga0307414_10044393 | Ga0307414_100443934 | 131 |
| 618 | 3300032004 | Ga0307414_10050488 | Ga0307414_100504882 | 131 |
| 619 | 3300032004 | Ga0307414_10078327 | Ga0307414_100783272 | 131 |
| 620 | 3300032004 | Ga0307414_10284362 | Ga0307414_102843622 | 131 |
| 621 | 3300032004 | Ga0307414_10400047 | Ga0307414_104000472 | 131 |
| 622 | 3300032004 | Ga0307414_10503125 | Ga0307414_105031251 | 131 |
| 623 | 3300032004 | Ga0307414_10951008 | Ga0307414_109510082 | 131 |
| 624 | 3300032004 | Ga0307414_11210703 | Ga0307414_112107032 | 131 |
| 625 | 3300032005 | Ga0307411_10023704 | Ga0307411_100237042 | 131 |
| 626 | 3300032005 | Ga0307411_10227489 | Ga0307411_102274892 | 131 |
| 627 | 3300032005 | Ga0307411_10261852 | Ga0307411_102618521 | 131 |
| 628 | 3300032005 | Ga0307411_10364794 | Ga0307411_103647941 | 131 |
| 629 | 3300032168 | Ga0316593_10104724 | Ga0316593_101047242 | 131 |
| 630 | 3300033179 | Ga0307507_10056649 | Ga0307507_100566492 | 131 |
| 631 | 3300037312 | Ga0395899_0034387 | Ga0395899_0034387_411_806 | 131 |
| 632 | 3300037312 | Ga0395899_0166668 | Ga0395899_0166668_599_994 | 131 |
| 633 | 3300037312 | Ga0395899_0236422 | Ga0395899_0236422_566_961 | 131 |
| 634 | 3300037418 | Ga0395900_0075723 | Ga0395900_0075723_444_839 | 131 |
| 635 | 3300037418 | Ga0395900_0290324 | Ga0395900_0290324_1158_1553 | 131 |
| 636 | 3300037418 | Ga0395900_1673767 | Ga0395900_1673767_69_464 | 131 |
| 637 | 3300037466 | Ga0395898_0048152 | Ga0395898_0048152_2831_3226 | 131 |
| 638 | 3300037466 | Ga0395898_0089564 | Ga0395898_0089564_2004_2399 | 131 |
| 639 | 3300037466 | Ga0395898_0154552 | Ga0395898_0154552_305_700 | 131 |
| 640 | 3300037471 | Ga0395905_0763019 | Ga0395905_0763019_311_706 | 131 |
| 641 | 3300038443 | Ga0395901_0012189 | Ga0395901_0012189_7773_8168 | 131 |
| 642 | 3300038443 | Ga0395901_0796243 | Ga0395901_0796243_103_498 | 131 |
| 643 | 3300038705 | Ga0237819_00312 | Ga0237819_00312_3104_3499 | 131 |
| 644 | 3300038705 | Ga0237819_03105 | Ga0237819_03105_332_727 | 131 |
| 645 | 3300039145 | Ga0237816_00049 | Ga0237816_00049_6040_6435 | 131 |
| 646 | 3300041404 | Ga0439436_0033247 | Ga0439436_0033247_670_1065 | 131 |
| 647 | 3300041404 | Ga0439436_0075426 | Ga0439436_0075426_456_851 | 131 |
| 648 | 3300041406 | Ga0439439_0111301 | Ga0439439_0111301_273_668 | 131 |
| 649 | 3300041410 | Ga0439461_0011441 | Ga0439461_0011441_263_658 | 131 |
| 650 | 3300041411 | Ga0439466_0145003 | Ga0439466_0145003_122_517 | 131 |
| 651 | 3300041411 | Ga0439466_0174451 | Ga0439466_0174451_31_426 | 131 |
| 652 | 3300041413 | Ga0439465_0022790 | Ga0439465_0022790_687_1082 | 131 |
| 653 | 3300041413 | Ga0439465_0024164 | Ga0439465_0024164_531_926 | 131 |
| 654 | 3300041413 | Ga0439465_0187764 | Ga0439465_0187764_203_598 | 131 |
| 655 | 3300041443 | Ga0451789_0567113 | Ga0451789_0567113_222_617 | 131 |
| 656 | 3300041443 | Ga0451789_0603815 | Ga0451789_0603815_240_635 | 131 |
| 657 | 3300041443 | Ga0451789_1127422 | Ga0451789_1127422_91_486 | 131 |
| 658 | 3300041451 | Ga0451791_1504983 | Ga0451791_1504983_291_686 | 131 |
| 659 | 3300041452 | Ga0451793_1421440 | Ga0451793_1421440_184_579 | 131 |
| 660 | 3300041453 | Ga0451797_0011554 | Ga0451797_0011554_30_428 | 131 |
| 661 | 3300041453 | Ga0451797_0179888 | Ga0451797_0179888_493_888 | 131 |
| 662 | 3300041453 | Ga0451797_0418348 | Ga0451797_0418348_218_613 | 131 |
| 663 | 3300041453 | Ga0451797_1447018 | Ga0451797_1447018_110_505 | 131 |
| 664 | 3300041456 | Ga0451795_1389936 | Ga0451795_1389936_282_677 | 131 |
| 665 | 3300041459 | Ga0451800_0436854 | Ga0451800_0436854_100_495 | 131 |
| 666 | 3300041460 | Ga0451802_0515276 | Ga0451802_0515276_208_603 | 131 |
| 667 | 3300041460 | Ga0451802_0889714 | Ga0451802_0889714_462_857 | 131 |
| 668 | 3300041460 | Ga0451802_1853850 | Ga0451802_1853850_1133_1528 | 131 |
| 669 | 3300041462 | Ga0451806_430966 | Ga0451806_430966_100_495 | 131 |
| 670 | 3300041486 | Ga0451807_0537170 | Ga0451807_0537170_543_938 | 131 |
| 671 | 3300041486 | Ga0451807_1702852 | Ga0451807_1702852_1031_1426 | 131 |
| 672 | 3300041486 | Ga0451807_2013840 | Ga0451807_2013840_348_743 | 131 |
| 673 | 3300041486 | Ga0451807_2723370 | Ga0451807_2723370_2214_2609 | 131 |
| 674 | 3300041491 | Ga0451833_1106277 | Ga0451833_1106277_404_799 | 131 |
| 675 | 3300041494 | Ga0451837_0339579 | Ga0451837_0339579_191_586 | 131 |
| 676 | 3300041494 | Ga0451837_0799066 | Ga0451837_0799066_182_577 | 131 |
| 677 | 3300041494 | Ga0451837_0894832 | Ga0451837_0894832_88_483 | 131 |
| 678 | 3300041494 | Ga0451837_1309318 | Ga0451837_1309318_19_414 | 131 |
| 679 | 3300041494 | Ga0451837_1419138 | Ga0451837_1419138_22_417 | 131 |
| 680 | 3300041494 | Ga0451837_1679811 | Ga0451837_1679811_212_607 | 131 |
| 681 | 3300041501 | Ga0451845_0148626 | Ga0451845_0148626_35_430 | 131 |
| 682 | 3300041505 | Ga0451849_0874557 | Ga0451849_0874557_79_474 | 131 |
| 683 | 3300041509 | Ga0451843_0413118 | Ga0451843_0413118_902_1297 | 131 |
| 684 | 3300041509 | Ga0451843_0437456 | Ga0451843_0437456_329_724 | 131 |
| 685 | 3300041512 | Ga0451853_3084322 | Ga0451853_3084322_199_597 | 131 |
| 686 | 3300041512 | Ga0451853_3955464 | Ga0451853_3955464_79_474 | 131 |
| 687 | 3300041999 | Ga0439433_0049804 | Ga0439433_0049804_564_959 | 131 |
| 688 | 3300041999 | Ga0439433_0180417 | Ga0439433_0180417_70_465 | 131 |
| 689 | 3300042006 | Ga0439432_004957 | Ga0439432_004957_4384_4779 | 131 |
| 690 | 3300042006 | Ga0439432_016995 | Ga0439432_016995_900_1295 | 131 |
| 691 | 3300042006 | Ga0439432_077986 | Ga0439432_077986_405_800 | 131 |
| 692 | 3300042006 | Ga0439432_229646 | Ga0439432_229646_64_459 | 131 |
| 693 | 3300042007 | Ga0439449_0004380 | Ga0439449_0004380_4339_4734 | 131 |
| 694 | 3300042007 | Ga0439449_0012155 | Ga0439449_0012155_1495_1890 | 131 |
| 695 | 3300042007 | Ga0439449_0014456 | Ga0439449_0014456_1359_1754 | 131 |
| 696 | 3300042007 | Ga0439449_0017729 | Ga0439449_0017729_716_1111 | 131 |
| 697 | 3300042007 | Ga0439449_0069480 | Ga0439449_0069480_680_1075 | 131 |
| 698 | 3300042007 | Ga0439449_0086846 | Ga0439449_0086846_472_867 | 131 |
| 699 | 3300042007 | Ga0439449_0204400 | Ga0439449_0204400_227_622 | 131 |
| 700 | 3300042010 | Ga0439452_010318 | Ga0439452_010318_795_1190 | 131 |
| 701 | 3300042015 | Ga0439462_0014720 | Ga0439462_0014720_317_712 | 131 |
| 702 | 3300042134 | Ga0450898_081837 | Ga0450898_081837_132_527 | 131 |
| 703 | 3300042184 | Ga0450908_094951 | Ga0450908_094951_60_455 | 131 |
| 704 | 3300042435 | Ga0439434_0020366 | Ga0439434_0020366_652_1047 | 131 |
| 705 | 3300042435 | Ga0439434_0190627 | Ga0439434_0190627_87_482 | 131 |
| 706 | 3300045976 | Ga0466967_1831532 | Ga0466967_1831532_14_409 | 131 |
| 707 | 3300046453 | Ga0495627_072343 | Ga0495627_072343_145_540 | 131 |
| 708 | 3300046460 | Ga0495638_0003232 | Ga0495638_0003232_1656_2051 | 131 |
| 709 | 3300046460 | Ga0495638_0126553 | Ga0495638_0126553_916_1311 | 131 |
| 710 | 3300046474 | Ga0495605_0090099 | Ga0495605_0090099_347_742 | 131 |
| 711 | 3300046501 | Ga0495607_0126486 | Ga0495607_0126486_528_923 | 131 |
| 712 | 3300046507 | Ga0495606_0019707 | Ga0495606_0019707_3325_3720 | 131 |
| 713 | 3300046525 | Ga0495663_0002950 | Ga0495663_0002950_618_1013 | 131 |
| 714 | 3300046525 | Ga0495663_0007675 | Ga0495663_0007675_2252_2647 | 131 |
| 715 | 3300046525 | Ga0495663_0292147 | Ga0495663_0292147_156_551 | 131 |
| 716 | 3300046525 | Ga0495663_0399936 | Ga0495663_0399936_76_471 | 131 |
| 717 | 3300046537 | Ga0495598_0001245 | Ga0495598_0001245_510_905 | 131 |
| 718 | 3300046538 | Ga0495609_0240568 | Ga0495609_0240568_72_467 | 131 |
| 719 | 3300046539 | Ga0495621_0044521 | Ga0495621_0044521_814_1209 | 131 |
| 720 | 3300046557 | Ga0495622_0504485 | Ga0495622_0504485_51_446 | 131 |
| 721 | 3300046558 | Ga0495633_0003001 | Ga0495633_0003001_6576_6971 | 131 |
| 722 | 3300046558 | Ga0495633_0030964 | Ga0495633_0030964_446_841 | 131 |
| 723 | 3300046558 | Ga0495633_0122642 | Ga0495633_0122642_71_466 | 131 |
| 724 | 3300046558 | Ga0495633_0138203 | Ga0495633_0138203_172_567 | 131 |
| 725 | 3300046615 | Ga0495656_0000506 | Ga0495656_0000506_1578_1973 | 131 |
| 726 | 3300046615 | Ga0495656_0130046 | Ga0495656_0130046_25_420 | 131 |
| 727 | 3300046660 | Ga0495625_0137962 | Ga0495625_0137962_26_421 | 131 |
| 728 | 3300046664 | Ga0495659_0013928 | Ga0495659_0013928_1975_2370 | 131 |
| 729 | 3300046664 | Ga0495659_0494975 | Ga0495659_0494975_85_480 | 131 |
| 730 | 3300046691 | Ga0495670_0582812 | Ga0495670_0582812_159_554 | 131 |
| 731 | 3300046692 | Ga0495671_0095899 | Ga0495671_0095899_1036_1431 | 131 |
| 732 | 3300046810 | Ga0495660_0262869 | Ga0495660_0262869_39_434 | 131 |
| 733 | 3300047318 | Ga0495636_0034397 | Ga0495636_0034397_763_1158 | 131 |
| 734 | 3300047320 | Ga0495672_0021447 | Ga0495672_0021447_1705_2100 | 131 |
| 735 | 3300047470 | Ga0495681_0376174 | Ga0495681_0376174_57_452 | 131 |
| 736 | 3300047472 | Ga0495686_0026366 | Ga0495686_0026366_3311_3706 | 131 |
| 737 | 3300048905 | Ga0496102_0178340 | Ga0496102_0178340_1272_1667 | 131 |
| 738 | 3300048906 | Ga0496103_0041894 | Ga0496103_0041894_636_1031 | 131 |
| 739 | 3300048908 | Ga0496105_0488082 | Ga0496105_0488082_517_912 | 131 |
| 740 | 3300048909 | Ga0496106_0025055 | Ga0496106_0025055_3269_3664 | 131 |
| 741 | 3300048910 | Ga0496107_0152561 | Ga0496107_0152561_619_1014 | 131 |
| 742 | 3300048911 | Ga0496108_0317286 | Ga0496108_0317286_882_1277 | 131 |
| 743 | 3300048912 | Ga0496109_0068841 | Ga0496109_0068841_1255_1650 | 131 |
| 744 | 3300048914 | Ga0496111_0064881 | Ga0496111_0064881_1945_2340 | 131 |
| 745 | 3300048915 | Ga0496112_0155646 | Ga0496112_0155646_453_848 | 131 |
| 746 | 3300048916 | Ga0496113_0068084 | Ga0496113_0068084_1668_2063 | 131 |
| 747 | 3300048916 | Ga0496113_0076333 | Ga0496113_0076333_1646_2041 | 131 |
| 748 | 3300048916 | Ga0496113_0100972 | Ga0496113_0100972_1710_2105 | 131 |
| 749 | 3300048917 | Ga0496114_0007709 | Ga0496114_0007709_1117_1512 | 131 |
| 750 | 3300048917 | Ga0496114_0340300 | Ga0496114_0340300_309_704 | 131 |
| 751 | 3300048917 | Ga0496114_0827485 | Ga0496114_0827485_351_746 | 131 |
| 752 | 3300048918 | Ga0496115_0731876 | Ga0496115_0731876_16_411 | 131 |
| 753 | 3300048919 | Ga0496116_0058897 | Ga0496116_0058897_1790_2185 | 131 |
| 754 | 3300048919 | Ga0496116_0289995 | Ga0496116_0289995_292_687 | 131 |
| 755 | 3300048920 | Ga0496117_0000969 | Ga0496117_0000969_14430_14825 | 131 |
| 756 | 3300048920 | Ga0496117_0002121 | Ga0496117_0002121_6872_7267 | 131 |
| 757 | 3300048920 | Ga0496117_0023022 | Ga0496117_0023022_4547_4942 | 131 |
| 758 | 3300048921 | Ga0496118_0001996 | Ga0496118_0001996_8162_8557 | 131 |
| 759 | 3300048921 | Ga0496118_0002316 | Ga0496118_0002316_17242_17637 | 131 |
| 760 | 3300048921 | Ga0496118_0005003 | Ga0496118_0005003_8072_8467 | 131 |
| 761 | 3300048921 | Ga0496118_0060601 | Ga0496118_0060601_1597_1992 | 131 |
| 762 | 3300048921 | Ga0496118_0089461 | Ga0496118_0089461_355_750 | 131 |
| 763 | 3300048921 | Ga0496118_0129579 | Ga0496118_0129579_638_1033 | 131 |
| 764 | 3300048922 | Ga0496119_0004382 | Ga0496119_0004382_11087_11482 | 131 |
| 765 | 3300048923 | Ga0496120_0000561 | Ga0496120_0000561_41745_42140 | 131 |
| 766 | 3300048924 | Ga0496121_0030360 | Ga0496121_0030360_2258_2653 | 131 |
| 767 | 3300048925 | Ga0496122_0000874 | Ga0496122_0000874_41688_42083 | 131 |
| 768 | 3300048925 | Ga0496122_0002722 | Ga0496122_0002722_16035_16430 | 131 |
| 769 | 3300048925 | Ga0496122_0009475 | Ga0496122_0009475_7658_8053 | 131 |
| 770 | 3300048925 | Ga0496122_0092719 | Ga0496122_0092719_102_497 | 131 |
| 771 | 3300048925 | Ga0496122_0109315 | Ga0496122_0109315_1288_1683 | 131 |
| 772 | 3300048925 | Ga0496122_0130175 | Ga0496122_0130175_683_1078 | 131 |
| 773 | 3300048926 | Ga0496123_0000461 | Ga0496123_0000461_56395_56790 | 131 |
| 774 | 3300048926 | Ga0496123_0001781 | Ga0496123_0001781_19850_20245 | 131 |
| 775 | 3300048926 | Ga0496123_0006266 | Ga0496123_0006266_3119_3514 | 131 |
| 776 | 3300048926 | Ga0496123_0020794 | Ga0496123_0020794_1843_2238 | 131 |
| 777 | 3300048926 | Ga0496123_0023746 | Ga0496123_0023746_2242_2637 | 131 |
| 778 | 3300048927 | Ga0496124_0000218 | Ga0496124_0000218_27386_27781 | 131 |
| 779 | 3300048927 | Ga0496124_0004852 | Ga0496124_0004852_11994_12389 | 131 |
| 780 | 3300048927 | Ga0496124_0019543 | Ga0496124_0019543_5476_5871 | 131 |
| 781 | 3300048927 | Ga0496124_0024328 | Ga0496124_0024328_2736_3131 | 131 |
| 782 | 3300048927 | Ga0496124_0028777 | Ga0496124_0028777_2209_2604 | 131 |
| 783 | 3300048927 | Ga0496124_0048300 | Ga0496124_0048300_2260_2655 | 131 |
| 784 | 3300048927 | Ga0496124_0093221 | Ga0496124_0093221_647_1042 | 131 |
| 785 | 3300048927 | Ga0496124_0254395 | Ga0496124_0254395_217_612 | 131 |
| 786 | 3300048927 | Ga0496124_0808982 | Ga0496124_0808982_82_477 | 131 |
| 787 | 3300048928 | Ga0496125_0048627 | Ga0496125_0048627_1763_2158 | 131 |
| 788 | 3300048928 | Ga0496125_0124456 | Ga0496125_0124456_1091_1486 | 131 |
| 789 | 3300048928 | Ga0496125_0268965 | Ga0496125_0268965_170_565 | 131 |
| 790 | 3300048929 | Ga0496126_0050461 | Ga0496126_0050461_3360_3755 | 131 |
| 791 | 3300048929 | Ga0496126_0078037 | Ga0496126_0078037_2137_2532 | 131 |
| 792 | 3300048929 | Ga0496126_0210807 | Ga0496126_0210807_395_790 | 131 |
| 793 | 3300049460 | Ga0495682_0183212 | Ga0495682_0183212_273_668 | 131 |
| 794 | 3300049569 | Ga0501032_0692723 | Ga0501032_0692723_160_555 | 131 |
| 795 | 3300049570 | Ga0501033_0001011 | Ga0501033_0001011_11511_11906 | 131 |
| 796 | 3300049570 | Ga0501033_0659637 | Ga0501033_0659637_204_599 | 131 |
| 797 | 3300049571 | Ga0501034_0088323 | Ga0501034_0088323_578_973 | 131 |
| 798 | 3300049571 | Ga0501034_0151746 | Ga0501034_0151746_888_1283 | 131 |
| 799 | 3300049571 | Ga0501034_0405140 | Ga0501034_0405140_531_926 | 131 |
| 800 | 3300049571 | Ga0501034_1627133 | Ga0501034_1627133_108_503 | 131 |
| 801 | 3300049573 | Ga0501037_0374180 | Ga0501037_0374180_323_718 | 131 |
| 802 | 3300049574 | Ga0501038_0310580 | Ga0501038_0310580_431_826 | 131 |
| 803 | 3300049574 | Ga0501038_0900076 | Ga0501038_0900076_228_623 | 131 |
| 804 | 3300049578 | Ga0501042_0655950 | Ga0501042_0655950_121_516 | 131 |
| 805 | 3300049579 | Ga0501043_0040610 | Ga0501043_0040610_421_816 | 131 |
| 806 | 3300049581 | Ga0501047_0000728 | Ga0501047_0000728_29429_29824 | 131 |
| 807 | 3300049581 | Ga0501047_0021626 | Ga0501047_0021626_2092_2487 | 131 |
| 808 | 3300049581 | Ga0501047_0384758 | Ga0501047_0384758_494_889 | 131 |
| 809 | 3300049581 | Ga0501047_0409512 | Ga0501047_0409512_686_1081 | 131 |
| 810 | 3300049583 | Ga0501067_0365564 | Ga0501067_0365564_20_415 | 131 |
| 811 | 3300049585 | Ga0501069_0007517 | Ga0501069_0007517_4649_5044 | 131 |
| 812 | 3300049585 | Ga0501069_0017890 | Ga0501069_0017890_57_452 | 131 |
| 813 | 3300049585 | Ga0501069_0056881 | Ga0501069_0056881_1672_2067 | 131 |
| 814 | 3300049586 | Ga0501070_0008134 | Ga0501070_0008134_538_933 | 131 |
| 815 | 3300049586 | Ga0501070_0008656 | Ga0501070_0008656_5461_5856 | 131 |
| 816 | 3300049586 | Ga0501070_0021684 | Ga0501070_0021684_1000_1395 | 131 |
| 817 | 3300049586 | Ga0501070_0023424 | Ga0501070_0023424_1074_1469 | 131 |
| 818 | 3300049586 | Ga0501070_0033935 | Ga0501070_0033935_29_424 | 131 |
| 819 | 3300049586 | Ga0501070_0048588 | Ga0501070_0048588_2492_2887 | 131 |
| 820 | 3300049586 | Ga0501070_0299749 | Ga0501070_0299749_509_904 | 131 |
| 821 | 3300049586 | Ga0501070_0346447 | Ga0501070_0346447_494_889 | 131 |
| 822 | 3300049586 | Ga0501070_0426705 | Ga0501070_0426705_136_531 | 131 |
| 823 | 3300049587 | Ga0501071_0006669 | Ga0501071_0006669_5427_5822 | 131 |
| 824 | 3300049587 | Ga0501071_0332858 | Ga0501071_0332858_220_615 | 131 |
| 825 | 3300049588 | Ga0501072_0795831 | Ga0501072_0795831_63_458 | 131 |
| 826 | 3300049589 | Ga0501073_0003299 | Ga0501073_0003299_3753_4148 | 131 |
| 827 | 3300049589 | Ga0501073_0067713 | Ga0501073_0067713_1690_2085 | 131 |
| 828 | 3300049589 | Ga0501073_0075224 | Ga0501073_0075224_31_426 | 131 |
| 829 | 3300049590 | Ga0501074_0004710 | Ga0501074_0004710_5696_6091 | 131 |
| 830 | 3300049590 | Ga0501074_0006953 | Ga0501074_0006953_662_1057 | 131 |
| 831 | 3300049590 | Ga0501074_0054713 | Ga0501074_0054713_716_1111 | 131 |
| 832 | 3300049590 | Ga0501074_0190269 | Ga0501074_0190269_890_1285 | 131 |
| 833 | 3300049590 | Ga0501074_0963676 | Ga0501074_0963676_19_414 | 131 |
| 834 | 3300049593 | Ga0501077_0082040 | Ga0501077_0082040_185_580 | 131 |
| 835 | 3300049663 | Ga0501223_036500 | Ga0501223_036500_498_893 | 131 |
| 836 | 3300049668 | Ga0501233_262740 | Ga0501233_262740_109_504 | 131 |
| 837 | 3300049669 | Ga0501235_069185 | Ga0501235_069185_50_445 | 131 |
| 838 | 3300049673 | Ga0501240_040233 | Ga0501240_040233_197_592 | 131 |
| 839 | 3300049681 | Ga0501251_037984 | Ga0501251_037984_281_676 | 131 |
| 840 | 3300049683 | Ga0501253_020165 | Ga0501253_020165_155_550 | 131 |
| 841 | 3300049686 | Ga0501257_051900 | Ga0501257_051900_579_974 | 131 |
| 842 | 3300049705 | Ga0501225_0106014 | Ga0501225_0106014_106_501 | 131 |
| 843 | 3300049742 | Ga0501080_0000440 | Ga0501080_0000440_31296_31691 | 131 |
| 844 | 3300049742 | Ga0501080_0017754 | Ga0501080_0017754_513_908 | 131 |
| 845 | 3300049742 | Ga0501080_0238451 | Ga0501080_0238451_669_1064 | 131 |
| 846 | 3300049742 | Ga0501080_0326699 | Ga0501080_0326699_560_955 | 131 |
| 847 | 3300049742 | Ga0501080_0414995 | Ga0501080_0414995_426_821 | 131 |
| 848 | 3300049758 | Ga0501241_153024 | Ga0501241_153024_55_450 | 131 |
| 849 | 3300049759 | Ga0501262_027977 | Ga0501262_027977_54_449 | 131 |
| 850 | 3300049769 | Ga0501272_073207 | Ga0501272_073207_27_422 | 131 |
| 851 | 3300049772 | Ga0501275_076993 | Ga0501275_076993_84_479 | 131 |
| 852 | 3300049822 | Ga0501035_0002331 | Ga0501035_0002331_735_1130 | 131 |
| 853 | 3300049822 | Ga0501035_0119995 | Ga0501035_0119995_581_976 | 131 |
| 854 | 3300049822 | Ga0501035_0579431 | Ga0501035_0579431_282_677 | 131 |
| 855 | 3300049823 | Ga0501044_0029925 | Ga0501044_0029925_5278_5673 | 131 |
| 856 | 3300049823 | Ga0501044_0030543 | Ga0501044_0030543_211_606 | 131 |
| 857 | 3300049823 | Ga0501044_0080505 | Ga0501044_0080505_443_838 | 131 |
| 858 | 3300049823 | Ga0501044_0297241 | Ga0501044_0297241_688_1083 | 131 |
| 859 | 3300050490 | nmdc:mga03n38_134655_c1 | nmdc:mga03n38_134655_c1_43_438 | 131 |
| 860 | 3300050491 | nmdc:mga00v17_1592_c1 | nmdc:mga00v17_1592_c1_9907_10302 | 131 |
| 861 | 3300050491 | nmdc:mga00v17_19508_c1 | nmdc:mga00v17_19508_c1_1439_1834 | 131 |
| 862 | 3300050491 | nmdc:mga00v17_375183_c1 | nmdc:mga00v17_375183_c1_30_425 | 131 |
| 863 | 3300050491 | nmdc:mga00v17_59114_c1 | nmdc:mga00v17_59114_c1_218_613 | 131 |
| 864 | 3300050491 | nmdc:mga00v17_88852_c1 | nmdc:mga00v17_88852_c1_76_471 | 131 |
| 865 | 3300050492 | nmdc:mga0yw44_605591_c1 | nmdc:mga0yw44_605591_c1_250_645 | 131 |
| 866 | 3300053087 | Ga0500643_165800 | Ga0500643_165800_110_505 | 131 |
| 867 | 3300053093 | Ga0500651_0000062 | Ga0500651_0000062_21219_21614 | 131 |
| 868 | 3300053142 | Ga0500577_0196685 | Ga0500577_0196685_446_841 | 131 |
| 869 | 3300053161 | Ga0500634_0000107 | Ga0500634_0000107_8407_8802 | 131 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3wdn-assembly1.cif.gz_A | high-resolution x-ray crystal structure of bovine h-protein using a high-pressure cryocooling method | 0.9802 | 8 | 131 |
| 1htp-assembly1.cif.gz_A | refined structures at 2 angstroms and 2.2 angstroms of the two forms of the h-protein, a lipoamide-containing protein of the glycine decarboxylase complex | 0.9763 | 2 | 130 |
| 1onl-assembly3.cif.gz_C | crystal structure of thermus thermophilus hb8 h-protein of the glycine cleavage system | 0.9737 | 3 | 129 |
| 3a7a-assembly1.cif.gz_B | crystal structure of e. coli lipoate-protein ligase a in complex with octyl-amp and apoh-protein | 0.9675 | 3 | 128 |
| 2ka7-assembly1.cif.gz_A | nmr solution structure of tm0212 at 40 c | 0.9612 | 8 | 128 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3wdnA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9804 | 8 | 131 | 2.40.50.100 |
| 3a8jE00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9615 | 4 | 127 | 2.40.50.100 |
| af_Q54JU3_2_142_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.961 | 8 | 126 | 2.40.50.100 |
| 3wdnA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9574 | 8 | 131 | 2.40.50.100 |
| af_Q20634_6_139_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9558 | 2 | 125 | 2.40.50.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A382L4N7-F1-model_v4 | Lipoyl-binding domain-containing protein | 0.9953 | 11 | 127 |
GO:0005829
GO:0005960 GO:0019464 |
| AF-A0A3B9QRA2-F1-model_v4 | Glycine cleavage system H protein | 0.9938 | 3 | 129 |
GO:0005829
GO:0005960 GO:0019464 |
| AF-A0A836UBC1-F1-model_v4 | Glycine cleavage system H protein | 0.9935 | 1 | 128 |
GO:0005829
GO:0005960 GO:0019464 |
| AF-A0A7K1ISG1-F1-model_v4 | Glycine cleavage system H protein | 0.9927 | 6 | 128 |
GO:0005737
GO:0005960 GO:0019464 |
| AF-A0A2G6CJF0-F1-model_v4 | Glycine cleavage system H protein | 0.9927 | 24 | 124 |
GO:0005829
GO:0005960 GO:0019464 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar