F484111

General Info

Members Datasets Scaffolds Average Seq Length
869 396 826 129

Family's Representative Sequence

Representative Sequence 3300005366|Ga0070659_100301476|Ga0070659_1003014762
Length 142
Sequence MGFPAPSKDTNMSEIPGDLKFQKSHEWARVEDAGQVRIGISDHAQGLLGDLVYVELPNVGDRVEAGTGCAVVESVKAASDVYAPVSGEVVAVNEMLADKPETINEDAYGDGWLLLVKADNAEEMDALLGPDDYAELIENDES

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
3 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
4 2643221559 Lysobacter sp. Root559 Isolate Unclassified
5 2643221573 Lysobacter sp. Root604 Isolate Unclassified
6 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
7 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
8 2643221586 Lysobacter sp. Root667 Isolate Unclassified
9 2643221612 Lysobacter sp. Root76 Isolate Unclassified
10 2643221695 Lysobacter sp. Root494 Isolate Unclassified
11 2643221720 Lysobacter sp. Root916 Isolate Unclassified
12 2643221727 Lysobacter sp. Root96 Isolate Unclassified
13 2643221728 Lysobacter sp. Root983 Isolate Unclassified
14 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
15 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
16 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
17 2818991457 Xanthomonas translucens 569 Isolate Unclassified
18 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
19 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
20 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
21 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
22 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
23 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
24 2919513703 Luteimonas sp. 3794 Isolate Unclassified
25 2919675420 Luteimonas terrae 4099 Isolate Unclassified
26 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
27 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
28 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
29 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
30 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
31 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
32 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
33 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
34 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
35 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
36 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
37 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
38 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
39 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
40 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
41 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
42 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
43 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
44 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
45 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
46 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
47 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
48 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
49 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
50 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
51 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
52 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
53 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
54 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
55 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
56 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
57 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
58 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
59 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
60 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
61 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
62 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
63 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
64 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
65 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
66 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
67 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
68 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
69 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
70 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
71 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
72 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
73 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
74 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
75 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
76 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
77 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
78 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
79 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
80 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
81 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
82 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
83 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
84 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
85 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
86 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
87 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
88 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
89 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
90 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
91 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
92 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
93 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
94 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
95 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
96 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
97 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
98 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
99 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
100 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
101 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
102 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
103 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
104 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
105 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
106 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
107 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
108 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
109 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
110 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
111 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
112 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
113 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
114 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
115 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
116 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
117 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
118 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
119 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
120 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
121 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
122 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
123 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
124 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
125 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
126 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
127 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
128 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
129 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
130 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
131 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
132 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
133 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
134 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
135 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
136 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
137 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
138 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
139 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
140 3300013874 Rhizosphere microbial communities from switchgrass harvested rhizosphere in Austin, TX, USA - RS_213 Metagenome Rhizosphere
141 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
142 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
143 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
144 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
145 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
146 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
147 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
148 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
149 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
150 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
151 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
152 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
153 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
154 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
155 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
156 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
158 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
159 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
160 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
161 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
163 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
164 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
166 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
167 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
168 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
170 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
224 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
225 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
226 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
227 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
228 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
229 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
230 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
231 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
232 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
233 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
234 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
235 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
236 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
237 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
238 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
239 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
240 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
241 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
242 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
244 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
245 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
246 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
247 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
248 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
249 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
250 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
251 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
252 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
253 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
254 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
255 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
256 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
257 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
258 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
259 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
260 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
261 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
262 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
263 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
264 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
265 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
266 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
267 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
268 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
269 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
270 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
271 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
272 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
273 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
274 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
275 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
276 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
277 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
278 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
279 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
280 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
281 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
282 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
283 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
284 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
285 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
286 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
287 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
288 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
289 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
290 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
291 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
292 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
293 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
294 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
295 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
296 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
297 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
298 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
299 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
300 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
301 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
302 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
303 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
304 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
305 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
306 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
307 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
308 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
309 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
310 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
311 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
312 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
313 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
314 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
315 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
316 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
317 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
318 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
319 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
320 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
321 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
322 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
323 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
324 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
325 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
326 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
327 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
328 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
329 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
330 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
331 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
332 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
333 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
334 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
335 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
336 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
337 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
338 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
339 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
340 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
341 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
348 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
352 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
353 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
354 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
355 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
356 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
357 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
358 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
359 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
360 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
361 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
362 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
363 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
364 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
365 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
366 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
367 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
368 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
369 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
370 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
371 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
372 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
373 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
374 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
375 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
376 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
377 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
378 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
379 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
380 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
381 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
382 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
383 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
384 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
385 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
386 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
387 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
388 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
389 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
390 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
391 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
392 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
393 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
394 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
395 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere
396 8054357960 Idiomarina rhizosphaerae M1R2S28 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.17
Metatranscriptomes 2.88
Isolates 4.95

Biome Distribution

Category Percentage (%)
Aerial Root 0.12
Bulb 0
Endosphere 10.13
Nodule 0.23
Rhizoplane 5.52
Rhizosphere 73.3
Stem 0
Stem Tuber 0
Unclassified 10.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1774666 2162886007 Bacteria 1025
2 SwRhRL2b_contig_333196 2162886007 Bacteria 2197
3 SwRhRL2b_contig_3538589 2162886007 Bacteria 3738
4 JGI24736J21556_1047816 3300001904 Bacteria 658
5 JGI24741J21665_1000917 3300001915 Bacteria 8902
6 JGI24741J21665_1002063 3300001915 Bacteria 5381
7 JGI24741J21665_1003645 3300001915 Bacteria 3609
8 JGI24740J21852_10006510 3300001979 Bacteria 4828
9 JGI24740J21852_10025119 3300001979 Bacteria 2012
10 JGI24740J21852_10061494 3300001979 Bacteria 1034
11 JGI25152J39213_1000126 3300002773 Bacteria 52109
12 JGI25150J39212_1000180 3300002774 Bacteria 35477
13 JGI25151J46595_10000177 3300003187 Bacteria 81432
14 JGI25151J46595_10000320 3300003187 Bacteria 52025
15 JGI25151J46595_10032534 3300003187 Bacteria 2020
16 JGI25153J46596_10000130 3300003215 Bacteria 81432
17 rootH2_10002342 3300003320 Bacteria 9955
18 JGI26145J50221_1018987 3300003371 Bacteria 655
19 Ga0055526_1000034 3300003771 Bacteria 136991
20 Ga0055526_1015942 3300003771 Bacteria 2981
21 Ga0055537_1000085 3300003773 Bacteria 67908
22 Ga0055537_1000256 3300003773 Bacteria 38830
23 Ga0055524_1000060 3300003775 Bacteria 136991
24 Ga0055524_1015646 3300003775 Bacteria 2755
25 Ga0055524_1021849 3300003775 Bacteria 2107
26 Ga0055536_1019715 3300003781 Bacteria 2110
27 Ga0055536_1020627 3300003781 Bacteria 2028
28 Ga0055534_1000021 3300003784 Bacteria 137167
29 Ga0055534_1000113 3300003784 Bacteria 59704
30 Ga0055534_1024998 3300003784 Bacteria 963
31 Ga0055534_1052392 3300003784 Bacteria 578
32 Ga0055528_1000022 3300003790 Bacteria 137042
33 Ga0055528_1002024 3300003790 Bacteria 11355
34 Ga0055530_10006864 3300003791 Bacteria 4939
35 Ga0055530_10101103 3300003791 Bacteria 579
36 Ga0055540_1104255 3300003792 Bacteria 527
37 Ga0055531_10008361 3300003794 Bacteria 5472
38 Ga0055531_10015106 3300003794 Bacteria 3426
39 Ga0055531_10017800 3300003794 Bacteria 2975
40 Ga0055531_10021856 3300003794 Bacteria 2463
41 Ga0055531_10025914 3300003794 Bacteria 2110
42 Ga0055531_10027930 3300003794 Bacteria 1961
43 Ga0055531_10046236 3300003794 Bacteria 1198
44 Ga0058692_1000015 3300003856 Bacteria 295729
45 Ga0058863_11839322 3300004799 Bacteria 737
46 Ga0058861_11774843 3300004800 Bacteria 650
47 Ga0058862_12685554 3300004803 Bacteria 639
48 Ga0065714_10266233 3300005288 Bacteria 747
49 Ga0065704_10210458 3300005289 Bacteria 1111
50 Ga0065704_10217831 3300005289 Bacteria 1085
51 Ga0065704_10535473 3300005289 Bacteria 644
52 Ga0065704_10549927 3300005289 Bacteria 635
53 Ga0070658_10070426 3300005327 Bacteria 2863
54 Ga0070658_10156876 3300005327 Bacteria 1908
55 Ga0070658_10302993 3300005327 Bacteria 1363
56 Ga0070658_10466983 3300005327 Bacteria 1088
57 Ga0070676_10688029 3300005328 Bacteria 746
58 Ga0070683_100082432 3300005329 Bacteria 3012
59 Ga0070683_100103830 3300005329 Bacteria 2679
60 Ga0070683_100648415 3300005329 Bacteria 1011
61 Ga0070670_100018944 3300005331 Bacteria 5903
62 Ga0070670_100032457 3300005331 Bacteria 4498
63 Ga0070680_100023558 3300005336 Bacteria 4911
64 Ga0070680_100090118 3300005336 Bacteria 2538
65 Ga0070680_100136585 3300005336 Bacteria 2054
66 Ga0070680_100189157 3300005336 Bacteria 1734
67 Ga0070680_100358991 3300005336 Bacteria 1239
68 Ga0070682_100057814 3300005337 Bacteria 2444
69 Ga0070682_100205047 3300005337 Bacteria 1393
70 Ga0070682_100352239 3300005337 Bacteria 1098
71 Ga0070660_100062259 3300005339 Bacteria 2898
72 Ga0070660_100069720 3300005339 Bacteria 2742
73 Ga0070660_100081074 3300005339 Bacteria 2547
74 Ga0070691_10007471 3300005341 Bacteria 5011
75 Ga0070691_10161466 3300005341 Bacteria 1155
76 Ga0070691_10163341 3300005341 Bacteria 1149
77 Ga0070691_10254216 3300005341 Bacteria 943
78 Ga0070661_100047164 3300005344 Bacteria 3153
79 Ga0070661_100051713 3300005344 Bacteria 3007
80 Ga0070661_100077859 3300005344 Bacteria 2445
81 Ga0070661_100445642 3300005344 Bacteria 1029
82 Ga0070692_10002504 3300005345 Bacteria 7151
83 Ga0070692_10020344 3300005345 Bacteria 3217
84 Ga0070692_10032916 3300005345 Bacteria 2610
85 Ga0070692_10178726 3300005345 Bacteria 1228
86 Ga0070692_10229695 3300005345 Bacteria 1101
87 Ga0070669_100256027 3300005353 Bacteria 1395
88 Ga0070675_100267033 3300005354 Bacteria 1501
89 Ga0070675_100770260 3300005354 Bacteria 879
90 Ga0070671_100016518 3300005355 Bacteria 5966
91 Ga0070671_100024686 3300005355 Bacteria 4924
92 Ga0070671_100153658 3300005355 Bacteria 1944
93 Ga0070673_100275614 3300005364 Bacteria 1474
94 Ga0070659_100113442 3300005366 Bacteria 2189
95 Ga0070659_100220110 3300005366 Bacteria 1566
96 Ga0070659_100301476 3300005366 Bacteria 1336
97 Ga0070705_101373160 3300005440 Unclassified 588
98 Ga0070708_100902003 3300005445 Unclassified 830
99 Ga0070663_100183087 3300005455 Bacteria 1626
100 Ga0070663_100218141 3300005455 Bacteria 1496
101 Ga0070663_100664777 3300005455 Bacteria 882
102 Ga0070663_100927080 3300005455 Bacteria 754
103 Ga0070662_100061203 3300005457 Bacteria 2748
104 Ga0070681_10000027 3300005458 Bacteria 104953
105 Ga0070681_10007456 3300005458 Bacteria 10692
106 Ga0070681_10014781 3300005458 Bacteria 7762
107 Ga0070681_10317883 3300005458 Bacteria 1466
108 Ga0070681_11135920 3300005458 Bacteria 702
109 Ga0070706_100078212 3300005467 Bacteria 3062
110 Ga0070699_100678595 3300005518 Unclassified 941
111 Ga0070699_101023830 3300005518 Bacteria 757
112 Ga0070679_100004909 3300005530 Bacteria 12337
113 Ga0070679_100102034 3300005530 Bacteria 2855
114 Ga0070679_100340277 3300005530 Bacteria 1448
115 Ga0070679_100452616 3300005530 Bacteria 1228
116 Ga0070679_101488649 3300005530 Bacteria 624
117 Ga0070684_100078982 3300005535 Bacteria 2908
118 Ga0070684_100079375 3300005535 Bacteria 2901
119 Ga0070684_101403196 3300005535 Bacteria 658
120 Ga0070697_100042294 3300005536 Bacteria 3687
121 Ga0068853_100059038 3300005539 Bacteria 3313
122 Ga0068853_100198639 3300005539 Bacteria 1824
123 Ga0068853_100927502 3300005539 Bacteria 837
124 Ga0070672_100003498 3300005543 Bacteria 10179
125 Ga0070696_100053930 3300005546 Bacteria 2800
126 Ga0070696_100314894 3300005546 Bacteria 1202
127 Ga0070696_100362101 3300005546 Bacteria 1126
128 Ga0070696_101794067 3300005546 Bacteria 530
129 Ga0070665_100075637 3300005548 Bacteria 3374
130 Ga0068855_100028237 3300005563 Bacteria 6710
131 Ga0068855_100194420 3300005563 Bacteria 2286
132 Ga0068855_100356439 3300005563 Bacteria 1610
133 Ga0068855_100424734 3300005563 Bacteria 1453
134 Ga0070664_100097123 3300005564 Bacteria 2557
135 Ga0070664_100164350 3300005564 Bacteria 1966
136 Ga0070664_100481998 3300005564 Bacteria 1141
137 Ga0068857_100094399 3300005577 Bacteria 2679
138 Ga0068857_100108070 3300005577 Bacteria 2499
139 Ga0068854_100095202 3300005578 Bacteria 2222
140 Ga0068854_100104350 3300005578 Bacteria 2129
141 Ga0068854_100136302 3300005578 Bacteria 1879
142 Ga0068854_100286783 3300005578 Bacteria 1327
143 Ga0068854_102049236 3300005578 Bacteria 528
144 Ga0068856_100121850 3300005614 Bacteria 2610
145 Ga0068856_100221951 3300005614 Bacteria 1905
146 Ga0068856_100495610 3300005614 Bacteria 1242
147 Ga0068856_100762675 3300005614 Bacteria 987
148 Ga0068852_100009788 3300005616 Bacteria 7126
149 Ga0068852_100176655 3300005616 Bacteria 2005
150 Ga0068852_100373234 3300005616 Bacteria 1398
151 Ga0068852_100517960 3300005616 Bacteria 1190
152 Ga0068852_101021342 3300005616 Bacteria 846
153 Ga0068852_102015717 3300005616 Bacteria 599
154 Ga0068852_102353591 3300005616 Bacteria 553
155 Ga0068859_100314770 3300005617 Bacteria 1659
156 Ga0068864_100101070 3300005618 Bacteria 2557
157 Ga0068851_10036708 3300005834 Bacteria 2454
158 Ga0068862_100228992 3300005844 Bacteria 1685
159 Ga0068862_101346797 3300005844 Bacteria 716
160 Ga0081539_10035642 3300005985 Bacteria 2986
161 Ga0075365_10485594 3300006038 Bacteria 873
162 Ga0075363_100267851 3300006048 Bacteria 986
163 Ga0075364_10001892 3300006051 Bacteria 11624
164 Ga0075364_10021796 3300006051 Bacteria 4039
165 Ga0075364_10026689 3300006051 Bacteria 3686
166 Ga0075364_10089800 3300006051 Bacteria 2038
167 Ga0075364_10119740 3300006051 Bacteria 1762
168 Ga0075364_10832548 3300006051 Bacteria 629
169 Ga0070716_100115940 3300006173 Bacteria 1668
170 Ga0075428_101428252 3300006844 Bacteria 726
171 Ga0075433_10489036 3300006852 Bacteria 1084
172 Ga0075434_100218354 3300006871 Bacteria 1926
173 Ga0075436_100254856 3300006914 Bacteria 1250
174 Ga0097620_100314793 3300006931 Bacteria 1659
175 Ga0099826_10215890 3300006948 Bacteria 1037
176 Ga0075435_100186782 3300007076 Bacteria 1753
177 Ga0075435_100294581 3300007076 Unclassified 1387
178 Ga0105251_10001735 3300009011 Bacteria 18197
179 Ga0105244_10045535 3300009036 Bacteria 2256
180 Ga0105240_10120222 3300009093 Bacteria 3164
181 Ga0105240_10132397 3300009093 Bacteria 2990
182 Ga0105240_10190935 3300009093 Bacteria 2409
183 Ga0105240_10450202 3300009093 Bacteria 1441
184 Ga0105240_11024366 3300009093 Bacteria 882
185 Ga0105245_12130762 3300009098 Bacteria 614
186 Ga0105247_10228349 3300009101 Bacteria 1263
187 Ga0114129_12084456 3300009147 Unclassified 684
188 Ga0105243_10010067 3300009148 Bacteria 7189
189 Ga0105241_10060367 3300009174 Bacteria 2917
190 Ga0105241_10449228 3300009174 Bacteria 1140
191 Ga0105242_10223817 3300009176 Bacteria 1683
192 Ga0105248_10123306 3300009177 Bacteria 2923
193 Ga0105237_10225334 3300009545 Bacteria 1875
194 Ga0105237_10417511 3300009545 Bacteria 1347
195 Ga0105237_10596612 3300009545 Bacteria 1111
196 Ga0105238_10113729 3300009551 Bacteria 2686
197 Ga0105032_104842 3300009979 Bacteria 1141
198 Ga0105028_136500 3300009993 Bacteria 552
199 Ga0105246_11164916 3300011119 Bacteria 707
200 Ga0157328_1001614 3300012478 Bacteria 990
201 Ga0157318_1000351 3300012482 Bacteria 1883
202 Ga0157315_1009297 3300012508 Bacteria 842
203 Ga0157327_1000101 3300012512 Bacteria 3797
204 Ga0157373_10039717 3300013100 Bacteria 3368
205 Ga0157373_10047580 3300013100 Bacteria 3059
206 Ga0157373_10094975 3300013100 Bacteria 2099
207 Ga0157373_10169918 3300013100 Bacteria 1534
208 Ga0157373_10204956 3300013100 Bacteria 1391
209 Ga0157373_10255402 3300013100 Bacteria 1240
210 Ga0157371_10001197 3300013102 Bacteria 27801
211 Ga0157371_10049348 3300013102 Bacteria 2990
212 Ga0157371_10063005 3300013102 Bacteria 2628
213 Ga0157371_10072437 3300013102 Bacteria 2440
214 Ga0157371_10107616 3300013102 Bacteria 1979
215 Ga0157371_10499915 3300013102 Bacteria 898
216 Ga0157371_11345814 3300013102 Bacteria 553
217 Ga0157370_10005494 3300013104 Bacteria 14213
218 Ga0157370_10014388 3300013104 Bacteria 8091
219 Ga0157370_10243533 3300013104 Bacteria 1664
220 Ga0157370_10319621 3300013104 Bacteria 1432
221 Ga0157370_10513745 3300013104 Bacteria 1100
222 Ga0157370_10817540 3300013104 Bacteria 848
223 Ga0157369_10095088 3300013105 Bacteria 3180
224 Ga0157369_10101943 3300013105 Bacteria 3059
225 Ga0157369_10106109 3300013105 Bacteria 2990
226 Ga0157369_10256664 3300013105 Bacteria 1824
227 Ga0163162_10163399 3300013306 Bacteria 2349
228 Ga0163162_11248124 3300013306 Bacteria 844
229 Ga0157372_10010126 3300013307 Bacteria 10015
230 Ga0157372_10116846 3300013307 Bacteria 3059
231 Ga0157372_10154423 3300013307 Bacteria 2651
232 Ga0157372_10278019 3300013307 Bacteria 1946
233 Ga0157372_10388961 3300013307 Bacteria 1625
234 Ga0157372_10507998 3300013307 Bacteria 1405
235 Ga0157375_10045742 3300013308 Bacteria 4261
236 Ga0157375_10874447 3300013308 Bacteria 1044
237 Ga0157514_121698 3300013874 Bacteria 506
238 Ga0157380_10096605 3300014326 Bacteria 2450
239 Ga0182008_10000640 3300014497 Bacteria 25569
240 Ga0182008_10029807 3300014497 Bacteria 2755
241 Ga0182008_10085553 3300014497 Bacteria 1553
242 Ga0182006_1029462 3300015261 Bacteria 2223
243 Ga0182006_1044394 3300015261 Bacteria 1733
244 Ga0182006_1074828 3300015261 Bacteria 1247
245 Ga0182007_10000026 3300015262 Bacteria 168694
246 Ga0182005_1000473 3300015265 Bacteria 20871
247 Ga0182005_1007526 3300015265 Bacteria 3261
248 Ga0183360_10001 3300015689 Bacteria 3943671
249 Ga0163161_10005585 3300017792 Bacteria 8719
250 Ga0163161_11025912 3300017792 Bacteria 705
251 Ga0197907_10010081 3300020069 Bacteria 769
252 Ga0197907_10910264 3300020069 Bacteria 1740
253 Ga0206356_10191945 3300020070 Bacteria 1877
254 Ga0206356_11621496 3300020070 Bacteria 4264
255 Ga0206355_1661501 3300020076 Bacteria 599
256 Ga0206351_10365865 3300020077 Bacteria 2286
257 Ga0206351_10599785 3300020077 Bacteria 1307
258 Ga0206352_10032047 3300020078 Bacteria 754
259 Ga0206352_11104993 3300020078 Bacteria 685
260 Ga0206350_10893779 3300020080 Bacteria 2436
261 Ga0206350_11143801 3300020080 Bacteria 806
262 Ga0206354_10062392 3300020081 Bacteria 4060
263 Ga0206354_11127055 3300020081 Bacteria 2054
264 Ga0206353_10282153 3300020082 Bacteria 1219
265 Ga0206353_10476976 3300020082 Bacteria 1823
266 Ga0154015_1147847 3300020610 Bacteria 585
267 Ga0154015_1306398 3300020610 Bacteria 7189
268 Ga0154015_1459418 3300020610 Bacteria 964
269 Ga0154015_1472900 3300020610 Bacteria 2489
270 Ga0224712_10027926 3300022467 Bacteria 2012
271 Ga0224712_10333768 3300022467 Bacteria 714
272 Ga0207425_1000066 3300025245 Bacteria 125463
273 Ga0207425_1008448 3300025245 Bacteria 2634
274 Ga0209129_1000135 3300025258 Bacteria 125520
275 Ga0209565_1000023 3300025263 Bacteria 388244
276 Ga0209565_1000034 3300025263 Bacteria 312950
277 Ga0209673_1000039 3300025273 Bacteria 312950
278 Ga0209673_1000116 3300025273 Bacteria 175933
279 Ga0209673_1004235 3300025273 Bacteria 7809
280 Ga0209130_1010488 3300025284 Bacteria 2547
281 Ga0209675_1000023 3300025291 Bacteria 312950
282 Ga0209675_1000154 3300025291 Bacteria 89426
283 Ga0209675_1042358 3300025291 Bacteria 987
284 Ga0209676_1011135 3300025292 Bacteria 3661
285 Ga0209025_1000013 3300025294 Bacteria 871757
286 Ga0209025_1000023 3300025294 Bacteria 541307
287 Ga0209025_1004258 3300025294 Bacteria 12583
288 Ga0209025_1059359 3300025294 Bacteria 1444
289 Ga0209564_1000066 3300025295 Bacteria 312899
290 Ga0209564_1000106 3300025295 Bacteria 216131
291 Ga0209564_1014368 3300025295 Bacteria 3299
292 Ga0209758_1000014 3300025297 Bacteria 871757
293 Ga0209758_1026770 3300025297 Bacteria 2485
294 Ga0209758_1058317 3300025297 Bacteria 1292
295 Ga0209758_1084955 3300025297 Bacteria 944
296 Ga0209050_1001331 3300025298 Bacteria 27512
297 Ga0209050_1033477 3300025298 Bacteria 1557
298 Ga0209050_1046790 3300025298 Bacteria 1133
299 Ga0209050_1088452 3300025298 Bacteria 640
300 Ga0209256_1000048 3300025299 Bacteria 312899
301 Ga0209256_1002361 3300025299 Bacteria 15660
302 Ga0209256_1003532 3300025299 Bacteria 10868
303 Ga0209256_1005289 3300025299 Bacteria 7520
304 Ga0209256_1073063 3300025299 Bacteria 766
305 Ga0209051_1009475 3300025303 Bacteria 5015
306 Ga0209257_1000270 3300025304 Bacteria 119394
307 Ga0209257_1000310 3300025304 Bacteria 103568
308 Ga0209257_1000378 3300025304 Bacteria 88945
309 Ga0209257_1023300 3300025304 Bacteria 2180
310 Ga0207656_10053631 3300025321 Bacteria 1750
311 Ga0207655_1169972 3300025728 Bacteria 674
312 Ga0207713_1000324 3300025735 Bacteria 53955
313 Ga0207647_10010962 3300025904 Bacteria 6376
314 Ga0207647_10048229 3300025904 Bacteria 2646
315 Ga0207647_10131667 3300025904 Bacteria 1470
316 Ga0207647_10307769 3300025904 Bacteria 901
317 Ga0207645_10232264 3300025907 Bacteria 1218
318 Ga0207705_10000527 3300025909 Bacteria 32402
319 Ga0207705_10002485 3300025909 Bacteria 14203
320 Ga0207705_10002907 3300025909 Bacteria 13100
321 Ga0207705_10019921 3300025909 Bacteria 4799
322 Ga0207705_10413415 3300025909 Bacteria 1044
323 Ga0207684_10248801 3300025910 Unclassified 1534
324 Ga0207654_10205018 3300025911 Bacteria 1301
325 Ga0207654_10349681 3300025911 Bacteria 1017
326 Ga0207707_10000039 3300025912 Bacteria 138817
327 Ga0207707_10000061 3300025912 Bacteria 108292
328 Ga0207707_10000095 3300025912 Bacteria 89126
329 Ga0207707_10000854 3300025912 Bacteria 29717
330 Ga0207707_10000930 3300025912 Bacteria 28392
331 Ga0207707_10001518 3300025912 Bacteria 21417
332 Ga0207707_10008753 3300025912 Bacteria 8784
333 Ga0207695_10001815 3300025913 Bacteria 33615
334 Ga0207695_10010700 3300025913 Bacteria 11202
335 Ga0207695_10011157 3300025913 Bacteria 10905
336 Ga0207695_10198068 3300025913 Bacteria 1924
337 Ga0207695_10656368 3300025913 Bacteria 930
338 Ga0207663_11114265 3300025916 Unclassified 635
339 Ga0207660_10001101 3300025917 Bacteria 18049
340 Ga0207660_10003239 3300025917 Bacteria 10656
341 Ga0207660_10006078 3300025917 Bacteria 7836
342 Ga0207660_10045054 3300025917 Bacteria 3106
343 Ga0207660_10046286 3300025917 Bacteria 3069
344 Ga0207660_10079597 3300025917 Bacteria 2404
345 Ga0207657_10066686 3300025919 Bacteria 3063
346 Ga0207657_10068618 3300025919 Bacteria 3011
347 Ga0207657_10071330 3300025919 Bacteria 2942
348 Ga0207657_10085229 3300025919 Bacteria 2647
349 Ga0207657_11393869 3300025919 Bacteria 527
350 Ga0207649_10012334 3300025920 Bacteria 4739
351 Ga0207649_10018343 3300025920 Bacteria 3977
352 Ga0207649_10085865 3300025920 Bacteria 2049
353 Ga0207649_10146690 3300025920 Bacteria 1620
354 Ga0207649_10226953 3300025920 Bacteria 1333
355 Ga0207649_10423423 3300025920 Bacteria 1000
356 Ga0207652_10000376 3300025921 Bacteria 46290
357 Ga0207652_10000534 3300025921 Bacteria 38545
358 Ga0207652_10000855 3300025921 Bacteria 28951
359 Ga0207652_10003739 3300025921 Bacteria 12489
360 Ga0207652_10004248 3300025921 Bacteria 11691
361 Ga0207652_10059147 3300025921 Bacteria 3303
362 Ga0207652_10947911 3300025921 Bacteria 758
363 Ga0207681_10346353 3300025923 Bacteria 1188
364 Ga0207681_10499277 3300025923 Bacteria 996
365 Ga0207694_10346855 3300025924 Bacteria 1228
366 Ga0207650_10032905 3300025925 Bacteria 3753
367 Ga0207650_10140463 3300025925 Bacteria 1898
368 Ga0207659_10345814 3300025926 Bacteria 1233
369 Ga0207644_10010205 3300025931 Bacteria 6188
370 Ga0207644_10252271 3300025931 Bacteria 1408
371 Ga0207644_10334671 3300025931 Bacteria 1226
372 Ga0207690_10001346 3300025932 Bacteria 15446
373 Ga0207690_10005785 3300025932 Bacteria 7314
374 Ga0207706_10052564 3300025933 Bacteria 3596
375 Ga0207691_10002069 3300025940 Bacteria 19572
376 Ga0207691_10754647 3300025940 Bacteria 819
377 Ga0207711_10053878 3300025941 Bacteria 3450
378 Ga0207661_10001167 3300025944 Bacteria 17544
379 Ga0207661_10006758 3300025944 Bacteria 8121
380 Ga0207661_10010189 3300025944 Bacteria 6759
381 Ga0207661_10989891 3300025944 Bacteria 774
382 Ga0207661_11027124 3300025944 Bacteria 759
383 Ga0207679_10093100 3300025945 Bacteria 2336
384 Ga0207679_10124200 3300025945 Bacteria 2060
385 Ga0207679_10223437 3300025945 Bacteria 1586
386 Ga0207679_10278865 3300025945 Bacteria 1433
387 Ga0207679_10420122 3300025945 Bacteria 1180
388 Ga0207679_10427332 3300025945 Bacteria 1170
389 Ga0207667_10004910 3300025949 Bacteria 16333
390 Ga0207667_10015525 3300025949 Bacteria 8644
391 Ga0207667_10103144 3300025949 Bacteria 2942
392 Ga0207667_10328640 3300025949 Bacteria 1561
393 Ga0207667_10927960 3300025949 Bacteria 861
394 Ga0207651_10238000 3300025960 Bacteria 1482
395 Ga0207651_10527760 3300025960 Bacteria 1024
396 Ga0207668_10117785 3300025972 Bacteria 2005
397 Ga0207640_10001438 3300025981 Bacteria 12889
398 Ga0207640_10004474 3300025981 Bacteria 7578
399 Ga0207640_10005294 3300025981 Bacteria 7029
400 Ga0207640_10138392 3300025981 Bacteria 1771
401 Ga0207640_10171662 3300025981 Bacteria 1617
402 Ga0207640_10558107 3300025981 Bacteria 963
403 Ga0207639_10029977 3300026041 Bacteria 3987
404 Ga0207639_10086642 3300026041 Bacteria 2494
405 Ga0207639_10507160 3300026041 Bacteria 1103
406 Ga0207639_10829938 3300026041 Bacteria 862
407 Ga0207639_11197388 3300026041 Bacteria 713
408 Ga0207678_10067891 3300026067 Bacteria 3060
409 Ga0207678_10073079 3300026067 Bacteria 2939
410 Ga0207678_10076340 3300026067 Bacteria 2870
411 Ga0207678_10078976 3300026067 Bacteria 2818
412 Ga0207678_10088496 3300026067 Bacteria 2646
413 Ga0207702_10003173 3300026078 Bacteria 15207
414 Ga0207702_10007007 3300026078 Bacteria 9643
415 Ga0207702_10069240 3300026078 Bacteria 3033
416 Ga0207702_10458160 3300026078 Bacteria 1238
417 Ga0207641_10099869 3300026088 Bacteria 2555
418 Ga0207648_10243875 3300026089 Bacteria 1600
419 Ga0207676_10061110 3300026095 Bacteria 2982
420 Ga0207674_10046641 3300026116 Bacteria 4448
421 Ga0207674_10097114 3300026116 Bacteria 2930
422 Ga0207674_10116204 3300026116 Bacteria 2647
423 Ga0207674_10415018 3300026116 Bacteria 1301
424 Ga0207698_10007061 3300026142 Bacteria 7035
425 Ga0207698_10021294 3300026142 Bacteria 4480
426 Ga0207698_10054226 3300026142 Bacteria 3083
427 Ga0207698_10099821 3300026142 Bacteria 2402
428 Ga0207698_10534430 3300026142 Bacteria 1146
429 Ga0207698_10926761 3300026142 Bacteria 879
430 Ga0209973_1046092 3300027252 Bacteria 649
431 Ga0209371_1000011 3300027312 Bacteria 848456
432 Ga0209967_1030722 3300027364 Bacteria 803
433 Ga0209984_1009783 3300027424 Bacteria 1222
434 Ga0210000_1016478 3300027462 Bacteria 1116
435 Ga0209995_1004303 3300027471 Bacteria 2275
436 Ga0209999_1000735 3300027543 Bacteria 5330
437 Ga0209982_1002436 3300027552 Bacteria 2612
438 Ga0209970_1024950 3300027614 Bacteria 1023
439 Ga0209971_1000229 3300027682 Bacteria 16278
440 Ga0209974_10047878 3300027876 Bacteria 1432
441 Ga0209974_10117745 3300027876 Bacteria 939
442 Ga0268266_10553401 3300028379 Bacteria 1102
443 Ga0268265_10117678 3300028380 Bacteria 2183
444 Ga0268265_10170692 3300028380 Bacteria 1859
445 Ga0268265_11209668 3300028380 Bacteria 753
446 Ga0307515_10187071 3300028794 Bacteria 1996
447 Ga0268256_1000011 3300030500 Bacteria 848625
448 Ga0316176_1026051 3300030732 Bacteria 2557
449 Ga0316176_1170387 3300030732 Bacteria 551
450 Ga0314311_1007241 3300030733 Bacteria 2544
451 Ga0316178_1063173 3300030735 Bacteria 1534
452 Ga0307513_10009118 3300031456 Bacteria 12569
453 Ga0307513_10213724 3300031456 Bacteria 1757
454 Ga0307513_10450665 3300031456 Bacteria 1011
455 Ga0307509_10109058 3300031507 Bacteria 2780
456 Ga0307408_100286979 3300031548 Bacteria 1373
457 Ga0307408_100295314 3300031548 Bacteria 1355
458 Ga0307408_100620549 3300031548 Bacteria 963
459 Ga0307408_100694579 3300031548 Bacteria 914
460 Ga0307408_100906971 3300031548 Bacteria 807
461 Ga0307405_10257143 3300031731 Bacteria 1302
462 Ga0307405_10367277 3300031731 Bacteria 1116
463 Ga0307405_10673935 3300031731 Bacteria 853
464 Ga0307405_10830132 3300031731 Bacteria 776
465 Ga0307405_11767922 3300031731 Bacteria 549
466 Ga0307413_10015371 3300031824 Bacteria 3920
467 Ga0307413_10061033 3300031824 Bacteria 2324
468 Ga0307413_10153450 3300031824 Bacteria 1608
469 Ga0307413_10451704 3300031824 Bacteria 1020
470 Ga0307413_10629269 3300031824 Bacteria 882
471 Ga0307413_10680138 3300031824 Bacteria 852
472 Ga0307413_10706724 3300031824 Bacteria 838
473 Ga0307410_10081704 3300031852 Bacteria 2271
474 Ga0307410_10198454 3300031852 Bacteria 1530
475 Ga0307410_10320143 3300031852 Bacteria 1230
476 Ga0307406_10007080 3300031901 Bacteria 6210
477 Ga0307406_10062508 3300031901 Bacteria 2409
478 Ga0307406_10133204 3300031901 Bacteria 1748
479 Ga0307406_10205361 3300031901 Bacteria 1454
480 Ga0307406_10505883 3300031901 Bacteria 980
481 Ga0307407_10037545 3300031903 Bacteria 2677
482 Ga0307412_10036110 3300031911 Bacteria 3163
483 Ga0307412_10274329 3300031911 Bacteria 1321
484 Ga0307412_10291663 3300031911 Bacteria 1285
485 Ga0307412_10426948 3300031911 Bacteria 1085
486 Ga0307412_10433466 3300031911 Bacteria 1078
487 Ga0307412_10813076 3300031911 Bacteria 812
488 Ga0307409_100357362 3300031995 Bacteria 1381
489 Ga0307409_101474530 3300031995 Bacteria 707
490 Ga0307416_100368293 3300032002 Bacteria 1462
491 Ga0307416_101013859 3300032002 Bacteria 933
492 Ga0307416_103153062 3300032002 Bacteria 552
493 Ga0307414_10008768 3300032004 Bacteria 5765
494 Ga0307414_10030087 3300032004 Bacteria 3543
495 Ga0307414_10044393 3300032004 Bacteria 3035
496 Ga0307414_10050488 3300032004 Bacteria 2881
497 Ga0307414_10067758 3300032004 Bacteria 2558
498 Ga0307414_10078327 3300032004 Bacteria 2409
499 Ga0307414_10284362 3300032004 Bacteria 1391
500 Ga0307414_10400047 3300032004 Bacteria 1193
501 Ga0307414_10476922 3300032004 Bacteria 1099
502 Ga0307414_10503125 3300032004 Bacteria 1072
503 Ga0307414_10951008 3300032004 Bacteria 789
504 Ga0307414_11210703 3300032004 Bacteria 699
505 Ga0307411_10023704 3300032005 Bacteria 3641
506 Ga0307411_10080092 3300032005 Bacteria 2244
507 Ga0307411_10095421 3300032005 Bacteria 2088
508 Ga0307411_10227489 3300032005 Bacteria 1451
509 Ga0307411_10261852 3300032005 Bacteria 1366
510 Ga0307411_10364396 3300032005 Bacteria 1183
511 Ga0307411_10364794 3300032005 Bacteria 1182
512 Ga0307411_10673108 3300032005 Bacteria 898
513 Ga0307415_100501713 3300032126 Bacteria 1061
514 Ga0316593_10104724 3300032168 Bacteria 1006
515 Ga0307507_10056649 3300033179 Bacteria 3701
516 Ga0395899_0034387 3300037312 Bacteria 3805
517 Ga0395899_0038864 3300037312 Bacteria 3563
518 Ga0395899_0166668 3300037312 Bacteria 1554
519 Ga0395899_0236422 3300037312 Bacteria 1259
520 Ga0395900_0075723 3300037418 Bacteria 3459
521 Ga0395900_0290324 3300037418 Bacteria 1624
522 Ga0395900_1673767 3300037418 Bacteria 547
523 Ga0395898_0048152 3300037466 Bacteria 4181
524 Ga0395898_0089564 3300037466 Bacteria 2961
525 Ga0395898_0154552 3300037466 Bacteria 2195
526 Ga0395898_0590656 3300037466 Bacteria 1053
527 Ga0395905_0051120 3300037471 Bacteria 3870
528 Ga0395905_0054100 3300037471 Bacteria 3756
529 Ga0395905_0763019 3300037471 Bacteria 870
530 Ga0395905_0930696 3300037471 Bacteria 772
531 Ga0395901_0012189 3300038443 Bacteria 8724
532 Ga0395901_0716732 3300038443 Bacteria 996
533 Ga0395901_0796243 3300038443 Bacteria 934
534 Ga0237819_00312 3300038705 Bacteria 17856
535 Ga0237819_03105 3300038705 Bacteria 3045
536 Ga0237816_00049 3300039145 Bacteria 7742
537 Ga0439436_0003186 3300041404 Bacteria 4974
538 Ga0439436_0033247 3300041404 Bacteria 1493
539 Ga0439436_0075426 3300041404 Bacteria 939
540 Ga0439436_0097733 3300041404 Bacteria 818
541 Ga0439439_0000293 3300041406 Bacteria 7979
542 Ga0439439_0111301 3300041406 Bacteria 759
543 Ga0439447_000711 3300041407 Bacteria 12310
544 Ga0439447_102665 3300041407 Bacteria 656
545 Ga0439461_0011441 3300041410 Bacteria 1647
546 Ga0439466_0145003 3300041411 Bacteria 728
547 Ga0439466_0174451 3300041411 Bacteria 656
548 Ga0439465_0006378 3300041413 Bacteria 3746
549 Ga0439465_0022790 3300041413 Bacteria 1968
550 Ga0439465_0024164 3300041413 Bacteria 1915
551 Ga0439465_0187764 3300041413 Bacteria 750
552 Ga0451789_0567113 3300041443 Bacteria 1173
553 Ga0451789_0603815 3300041443 Bacteria 805
554 Ga0451789_1127422 3300041443 Bacteria 905
555 Ga0451791_1504983 3300041451 Bacteria 894
556 Ga0451793_1421440 3300041452 Bacteria 1128
557 Ga0451797_0011554 3300041453 Bacteria 716
558 Ga0451797_0179888 3300041453 Bacteria 1362
559 Ga0451797_0418348 3300041453 Bacteria 878
560 Ga0451797_1447018 3300041453 Bacteria 838
561 Ga0451795_1389936 3300041456 Bacteria 2621
562 Ga0451800_0436854 3300041459 Bacteria 554
563 Ga0451802_0515276 3300041460 Bacteria 936
564 Ga0451802_0889714 3300041460 Bacteria 1435
565 Ga0451802_1853850 3300041460 Bacteria 1870
566 Ga0451806_430966 3300041462 Bacteria 555
567 Ga0451807_0537170 3300041486 Bacteria 1391
568 Ga0451807_1702852 3300041486 Bacteria 1987
569 Ga0451807_2013840 3300041486 Bacteria 1320
570 Ga0451807_2723370 3300041486 Bacteria 2888
571 Ga0451833_1106277 3300041491 Bacteria 1498
572 Ga0451837_0339579 3300041494 Bacteria 925
573 Ga0451837_0799066 3300041494 Bacteria 821
574 Ga0451837_0894832 3300041494 Bacteria 579
575 Ga0451837_1309318 3300041494 Bacteria 1152
576 Ga0451837_1419138 3300041494 Bacteria 727
577 Ga0451837_1679811 3300041494 Bacteria 1790
578 Ga0451845_0148626 3300041501 Bacteria 540
579 Ga0451849_0874557 3300041505 Bacteria 617
580 Ga0451843_0413118 3300041509 Bacteria 1935
581 Ga0451843_0437456 3300041509 Bacteria 1267
582 Ga0451853_3084322 3300041512 Bacteria 878
583 Ga0451853_3955464 3300041512 Bacteria 580
584 Ga0439433_0049804 3300041999 Bacteria 986
585 Ga0439433_0147788 3300041999 Bacteria 604
586 Ga0439433_0180417 3300041999 Bacteria 552
587 Ga0439445_0016396 3300042004 Bacteria 1822
588 Ga0439448_0245969 3300042005 Bacteria 631
589 Ga0439432_004957 3300042006 Bacteria 4821
590 Ga0439432_016995 3300042006 Bacteria 2444
591 Ga0439432_027819 3300042006 Bacteria 1844
592 Ga0439432_077986 3300042006 Bacteria 1005
593 Ga0439432_229646 3300042006 Bacteria 534
594 Ga0439449_0004380 3300042007 Bacteria 5446
595 Ga0439449_0012155 3300042007 Bacteria 3236
596 Ga0439449_0014456 3300042007 Bacteria 2968
597 Ga0439449_0017729 3300042007 Bacteria 2673
598 Ga0439449_0057610 3300042007 Bacteria 1434
599 Ga0439449_0069480 3300042007 Bacteria 1298
600 Ga0439449_0086846 3300042007 Bacteria 1154
601 Ga0439449_0204400 3300042007 Bacteria 739
602 Ga0439452_010318 3300042010 Bacteria 2722
603 Ga0439457_023359 3300042014 Bacteria 1368
604 Ga0439462_0014720 3300042015 Bacteria 2012
605 Ga0439462_0111678 3300042015 Bacteria 757
606 Ga0450898_007767 3300042134 Bacteria 1677
607 Ga0450898_081837 3300042134 Bacteria 657
608 Ga0450903_058467 3300042138 Bacteria 560
609 Ga0450906_090101 3300042145 Bacteria 556
610 Ga0450908_094951 3300042184 Bacteria 543
611 Ga0439434_0020366 3300042435 Bacteria 1991
612 Ga0439434_0190627 3300042435 Bacteria 689
613 Ga0451577_0001996 3300042876 Bacteria 25432
614 Ga0466965_0619936 3300044683 Bacteria 616
615 Ga0453684_0289684 3300044712 Bacteria 1865
616 Ga0466960_0002465 3300044901 Bacteria 6961
617 Ga0466960_0834620 3300044901 Bacteria 559
618 Ga0466967_1831532 3300045976 Bacteria 604
619 Ga0495627_072343 3300046453 Bacteria 1006
620 Ga0495638_0003232 3300046460 Bacteria 12884
621 Ga0495638_0126553 3300046460 Bacteria 1505
622 Ga0495605_0090099 3300046474 Bacteria 1423
623 Ga0495607_0126486 3300046501 Bacteria 1335
624 Ga0495606_0019707 3300046507 Bacteria 5004
625 Ga0495610_0285691 3300046512 Bacteria 641
626 Ga0495663_0002950 3300046525 Bacteria 5003
627 Ga0495663_0007675 3300046525 Bacteria 2983
628 Ga0495663_0181376 3300046525 Bacteria 729
629 Ga0495663_0292147 3300046525 Bacteria 585
630 Ga0495663_0399936 3300046525 Bacteria 505
631 Ga0495598_0001245 3300046537 Bacteria 4954
632 Ga0495609_0240568 3300046538 Bacteria 747
633 Ga0495621_0044521 3300046539 Bacteria 1569
634 Ga0495622_0504485 3300046557 Bacteria 517
635 Ga0495633_0003001 3300046558 Bacteria 11522
636 Ga0495633_0030964 3300046558 Bacteria 2597
637 Ga0495633_0122642 3300046558 Bacteria 1204
638 Ga0495633_0138203 3300046558 Bacteria 1127
639 Ga0495656_0000506 3300046615 Bacteria 12780
640 Ga0495656_0002280 3300046615 Bacteria 6332
641 Ga0495656_0130046 3300046615 Bacteria 1197
642 Ga0495668_0004061 3300046616 Bacteria 10627
643 Ga0495625_0137962 3300046660 Bacteria 1647
644 Ga0495659_0013928 3300046664 Bacteria 2624
645 Ga0495659_0494975 3300046664 Bacteria 535
646 Ga0495670_0582812 3300046691 Bacteria 609
647 Ga0495671_0095899 3300046692 Bacteria 1451
648 Ga0495660_0262869 3300046810 Bacteria 796
649 Ga0495636_0034397 3300047318 Bacteria 2085
650 Ga0495672_0021447 3300047320 Bacteria 4214
651 Ga0495681_0376174 3300047470 Bacteria 535
652 Ga0495686_0026366 3300047472 Bacteria 3802
653 Ga0496100_0525923 3300048903 Bacteria 913
654 Ga0496101_0467481 3300048904 Bacteria 995
655 Ga0496102_0178340 3300048905 Bacteria 2001
656 Ga0496103_0041894 3300048906 Bacteria 2816
657 Ga0496104_1026115 3300048907 Bacteria 729
658 Ga0496105_0488082 3300048908 Bacteria 968
659 Ga0496106_0025055 3300048909 Bacteria 4438
660 Ga0496106_1206754 3300048909 Bacteria 590
661 Ga0496107_0152561 3300048910 Bacteria 1709
662 Ga0496107_0303311 3300048910 Bacteria 1189
663 Ga0496108_0020695 3300048911 Bacteria 5407
664 Ga0496108_0223803 3300048911 Bacteria 1635
665 Ga0496108_0317286 3300048911 Bacteria 1358
666 Ga0496109_0068841 3300048912 Bacteria 3244
667 Ga0496109_0148978 3300048912 Bacteria 2190
668 Ga0496109_0191694 3300048912 Bacteria 1921
669 Ga0496109_0356884 3300048912 Bacteria 1381
670 Ga0496110_0594872 3300048913 Bacteria 1004
671 Ga0496111_0064881 3300048914 Bacteria 2649
672 Ga0496112_0025162 3300048915 Bacteria 5713
673 Ga0496112_0155646 3300048915 Bacteria 2252
674 Ga0496113_0021851 3300048916 Bacteria 4517
675 Ga0496113_0068084 3300048916 Bacteria 2701
676 Ga0496113_0076333 3300048916 Bacteria 2560
677 Ga0496113_0100972 3300048916 Bacteria 2236
678 Ga0496114_0007709 3300048917 Bacteria 8516
679 Ga0496114_0340300 3300048917 Bacteria 1326
680 Ga0496114_0827485 3300048917 Bacteria 805
681 Ga0496115_0731876 3300048918 Bacteria 775
682 Ga0496116_0058897 3300048919 Bacteria 2501
683 Ga0496116_0066718 3300048919 Bacteria 2301
684 Ga0496116_0289995 3300048919 Bacteria 786
685 Ga0496117_0000969 3300048920 Bacteria 43962
686 Ga0496117_0002121 3300048920 Bacteria 25987
687 Ga0496117_0023022 3300048920 Bacteria 4980
688 Ga0496117_0402986 3300048920 Bacteria 689
689 Ga0496118_0001996 3300048921 Bacteria 28924
690 Ga0496118_0002316 3300048921 Bacteria 25860
691 Ga0496118_0005003 3300048921 Bacteria 15313
692 Ga0496118_0060601 3300048921 Bacteria 2809
693 Ga0496118_0089461 3300048921 Bacteria 2125
694 Ga0496118_0129579 3300048921 Bacteria 1623
695 Ga0496119_0004382 3300048922 Bacteria 14084
696 Ga0496120_0000561 3300048923 Bacteria 56621
697 Ga0496121_0030360 3300048924 Bacteria 4964
698 Ga0496122_0000874 3300048925 Bacteria 56703
699 Ga0496122_0002722 3300048925 Bacteria 24525
700 Ga0496122_0009475 3300048925 Bacteria 10254
701 Ga0496122_0092719 3300048925 Bacteria 2051
702 Ga0496122_0109315 3300048925 Bacteria 1820
703 Ga0496122_0130175 3300048925 Bacteria 1601
704 Ga0496123_0000461 3300048926 Bacteria 71380
705 Ga0496123_0001781 3300048926 Bacteria 28388
706 Ga0496123_0006266 3300048926 Bacteria 11587
707 Ga0496123_0020794 3300048926 Bacteria 5122
708 Ga0496123_0023746 3300048926 Bacteria 4684
709 Ga0496124_0000218 3300048927 Bacteria 112156
710 Ga0496124_0004852 3300048927 Bacteria 15470
711 Ga0496124_0019543 3300048927 Bacteria 6297
712 Ga0496124_0024328 3300048927 Bacteria 5510
713 Ga0496124_0028777 3300048927 Bacteria 4963
714 Ga0496124_0048300 3300048927 Bacteria 3638
715 Ga0496124_0093221 3300048927 Bacteria 2451
716 Ga0496124_0254395 3300048927 Bacteria 1296
717 Ga0496124_0315746 3300048927 Bacteria 1121
718 Ga0496124_0808982 3300048927 Bacteria 579
719 Ga0496125_0010108 3300048928 Bacteria 9575
720 Ga0496125_0048627 3300048928 Bacteria 3534
721 Ga0496125_0124456 3300048928 Bacteria 1830
722 Ga0496125_0268965 3300048928 Bacteria 1063
723 Ga0496126_0050461 3300048929 Bacteria 3791
724 Ga0496126_0078037 3300048929 Bacteria 2935
725 Ga0496126_0210807 3300048929 Bacteria 1636
726 Ga0495682_0183212 3300049460 Bacteria 744
727 Ga0501032_0692723 3300049569 Bacteria 646
728 Ga0501033_0001011 3300049570 Bacteria 25534
729 Ga0501033_0659637 3300049570 Bacteria 714
730 Ga0501034_0000661 3300049571 Bacteria 52643
731 Ga0501034_0082208 3300049571 Bacteria 3223
732 Ga0501034_0088323 3300049571 Bacteria 3098
733 Ga0501034_0151746 3300049571 Bacteria 2292
734 Ga0501034_0274837 3300049571 Bacteria 1625
735 Ga0501034_0405140 3300049571 Bacteria 1286
736 Ga0501034_1345936 3300049571 Bacteria 590
737 Ga0501034_1627133 3300049571 Bacteria 519
738 Ga0501036_0036186 3300049572 Bacteria 4177
739 Ga0501037_0023281 3300049573 Bacteria 4581
740 Ga0501037_0374180 3300049573 Bacteria 980
741 Ga0501038_0310580 3300049574 Bacteria 1235
742 Ga0501038_0900076 3300049574 Bacteria 653
743 Ga0501039_0029638 3300049575 Bacteria 4215
744 Ga0501042_0655950 3300049578 Bacteria 763
745 Ga0501043_0040610 3300049579 Bacteria 3657
746 Ga0501043_0073582 3300049579 Bacteria 2684
747 Ga0501047_0000728 3300049581 Bacteria 34264
748 Ga0501047_0021626 3300049581 Bacteria 6179
749 Ga0501047_0384758 3300049581 Bacteria 1237
750 Ga0501047_0409512 3300049581 Bacteria 1188
751 Ga0501067_0365564 3300049583 Bacteria 804
752 Ga0501069_0007517 3300049585 Bacteria 5720
753 Ga0501069_0017890 3300049585 Bacteria 3821
754 Ga0501069_0056881 3300049585 Bacteria 2179
755 Ga0501070_0008134 3300049586 Bacteria 8873
756 Ga0501070_0008656 3300049586 Bacteria 8602
757 Ga0501070_0021684 3300049586 Bacteria 5386
758 Ga0501070_0023424 3300049586 Bacteria 5172
759 Ga0501070_0033935 3300049586 Bacteria 4269
760 Ga0501070_0048588 3300049586 Bacteria 3523
761 Ga0501070_0156520 3300049586 Bacteria 1879
762 Ga0501070_0299749 3300049586 Bacteria 1309
763 Ga0501070_0346447 3300049586 Bacteria 1206
764 Ga0501070_0426705 3300049586 Bacteria 1070
765 Ga0501071_0006669 3300049587 Bacteria 7502
766 Ga0501071_0332858 3300049587 Bacteria 1154
767 Ga0501072_0795831 3300049588 Bacteria 741
768 Ga0501073_0003299 3300049589 Bacteria 12125
769 Ga0501073_0067713 3300049589 Bacteria 2489
770 Ga0501073_0075224 3300049589 Bacteria 2351
771 Ga0501074_0004710 3300049590 Bacteria 9771
772 Ga0501074_0006953 3300049590 Bacteria 8173
773 Ga0501074_0054713 3300049590 Bacteria 2877
774 Ga0501074_0190269 3300049590 Bacteria 1463
775 Ga0501074_0963676 3300049590 Bacteria 600
776 Ga0501077_0082040 3300049593 Bacteria 2043
777 Ga0501202_227438 3300049652 Bacteria 518
778 Ga0501216_049451 3300049660 Bacteria 824
779 Ga0501217_113782 3300049661 Bacteria 780
780 Ga0501223_036500 3300049663 Bacteria 955
781 Ga0501223_121632 3300049663 Bacteria 552
782 Ga0501233_262740 3300049668 Bacteria 522
783 Ga0501235_069185 3300049669 Bacteria 834
784 Ga0501240_040233 3300049673 Bacteria 775
785 Ga0501251_037984 3300049681 Bacteria 717
786 Ga0501253_020165 3300049683 Bacteria 1160
787 Ga0501257_051900 3300049686 Bacteria 1024
788 Ga0501259_110086 3300049688 Bacteria 643
789 Ga0501225_0106014 3300049705 Bacteria 825
790 Ga0501080_0000440 3300049742 Bacteria 32255
791 Ga0501080_0017754 3300049742 Bacteria 6584
792 Ga0501080_0156657 3300049742 Bacteria 2104
793 Ga0501080_0238451 3300049742 Bacteria 1660
794 Ga0501080_0326699 3300049742 Bacteria 1388
795 Ga0501080_0414995 3300049742 Bacteria 1210
796 Ga0501241_153024 3300049758 Bacteria 533
797 Ga0501262_027977 3300049759 Bacteria 802
798 Ga0501265_005317 3300049762 Bacteria 1481
799 Ga0501266_033351 3300049763 Bacteria 743
800 Ga0501272_073207 3300049769 Bacteria 504
801 Ga0501275_000050 3300049772 Bacteria 11946
802 Ga0501275_076993 3300049772 Bacteria 534
803 Ga0501035_0002331 3300049822 Bacteria 18717
804 Ga0501035_0119995 3300049822 Bacteria 2299
805 Ga0501035_0579431 3300049822 Bacteria 916
806 Ga0501044_0029925 3300049823 Bacteria 5741
807 Ga0501044_0030543 3300049823 Bacteria 5677
808 Ga0501044_0080505 3300049823 Bacteria 3299
809 Ga0501044_0232244 3300049823 Bacteria 1791
810 Ga0501044_0297241 3300049823 Bacteria 1544
811 nmdc:mga03n38_134655_c1 3300050490 Bacteria 1228
812 nmdc:mga00v17_1592_c1 3300050491 Bacteria 11848
813 nmdc:mga00v17_19508_c1 3300050491 Bacteria 3872
814 nmdc:mga00v17_375183_c1 3300050491 Bacteria 925
815 nmdc:mga00v17_59114_c1 3300050491 Bacteria 2351
816 nmdc:mga00v17_88852_c1 3300050491 Bacteria 1938
817 nmdc:mga0yw44_605591_c1 3300050492 Bacteria 744
818 nmdc:mga0n895_72875_c1 3300050512 Bacteria 3408
819 nmdc:mga0rr50_219260_c1 3300050513 Unclassified 1570
820 nmdc:mga0rr50_36153_c1 3300050513 Bacteria 3554
821 nmdc:mga0a205_57768_c2 3300050515 Bacteria 1835
822 Ga0500643_165800 3300053087 Bacteria 592
823 Ga0500651_0000062 3300053093 Bacteria 71042
824 Ga0500577_0196685 3300053142 Bacteria 869
825 Ga0500634_0000107 3300053161 Bacteria 31282
826 Ga0501084_0405305 3300054114 Bacteria 1152

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025911 Ga0207654_10349681 Ga0207654_103496812 106
2 3300049571 Ga0501034_0082208 Ga0501034_0082208_1007_1441 109
3 3300049572 Ga0501036_0036186 Ga0501036_0036186_2102_2536 109
4 3300049573 Ga0501037_0023281 Ga0501037_0023281_3855_4289 109
5 3300049575 Ga0501039_0029638 Ga0501039_0029638_2282_2716 109
6 3300049579 Ga0501043_0073582 Ga0501043_0073582_79_513 109
7 3300049586 Ga0501070_0156520 Ga0501070_0156520_1288_1722 109
8 3300049742 Ga0501080_0156657 Ga0501080_0156657_1522_1956 109
9 3300049823 Ga0501044_0232244 Ga0501044_0232244_1064_1498 109
10 3300003187 JGI25151J46595_10000320 JGI25151J46595_1000032027 115
11 3300005445 Ga0070708_100902003 Ga0070708_1009020032 115
12 3300005518 Ga0070699_100678595 Ga0070699_1006785952 115
13 3300006173 Ga0070716_100115940 Ga0070716_1001159401 115
14 3300006852 Ga0075433_10489036 Ga0075433_104890361 115
15 3300006871 Ga0075434_100218354 Ga0075434_1002183542 115
16 3300006914 Ga0075436_100254856 Ga0075436_1002548562 115
17 3300007076 Ga0075435_100186782 Ga0075435_1001867822 115
18 3300007076 Ga0075435_100294581 Ga0075435_1002945811 115
19 3300009147 Ga0114129_12084456 Ga0114129_120844561 115
20 3300014497 Ga0182008_10085553 Ga0182008_100855532 115
21 3300025910 Ga0207684_10248801 Ga0207684_102488012 115
22 3300025916 Ga0207663_11114265 Ga0207663_111142651 115
23 3300031548 Ga0307408_100906971 Ga0307408_1009069711 115
24 3300041407 Ga0439447_000711 Ga0439447_000711_6090_6485 115
25 3300042005 Ga0439448_0245969 Ga0439448_0245969_92_490 115
26 3300046512 Ga0495610_0285691 Ga0495610_0285691_77_472 115
27 3300046525 Ga0495663_0181376 Ga0495663_0181376_225_620 115
28 3300046615 Ga0495656_0002280 Ga0495656_0002280_784_1179 115
29 3300046616 Ga0495668_0004061 Ga0495668_0004061_1991_2386 115
30 3300049571 Ga0501034_0274837 Ga0501034_0274837_112_507 115
31 3300050512 nmdc:mga0n895_72875_c1 nmdc:mga0n895_72875_c1_277_660 115
32 3300050513 nmdc:mga0rr50_219260_c1 nmdc:mga0rr50_219260_c1_435_818 115
33 3300050513 nmdc:mga0rr50_36153_c1 nmdc:mga0rr50_36153_c1_2491_2874 115
34 3300050515 nmdc:mga0a205_57768_c2 nmdc:mga0a205_57768_c2_562_945 115
35 3300005355 Ga0070671_100024686 Ga0070671_1000246863 116
36 3300006948 Ga0099826_10215890 Ga0099826_102158902 116
37 3300025245 Ga0207425_1008448 Ga0207425_10084483 116
38 3300025294 Ga0209025_1000023 Ga0209025_1000023236 116
39 3300025297 Ga0209758_1058317 Ga0209758_10583172 116
40 3300037471 Ga0395905_0051120 Ga0395905_0051120_3061_3456 116
41 3300048927 Ga0496124_0315746 Ga0496124_0315746_305_700 116
42 3300003771 Ga0055526_1000034 Ga0055526_100003474 117
43 3300003773 Ga0055537_1000256 Ga0055537_100025610 117
44 3300003775 Ga0055524_1000060 Ga0055524_100006074 117
45 3300003784 Ga0055534_1000021 Ga0055534_100002174 117
46 3300003790 Ga0055528_1000022 Ga0055528_100002238 117
47 3300005616 Ga0068852_102015717 Ga0068852_1020157171 117
48 3300009174 Ga0105241_10449228 Ga0105241_104492282 117
49 3300025299 Ga0209256_1073063 Ga0209256_10730631 117
50 3300025913 Ga0207695_10656368 Ga0207695_106563682 117
51 3300025931 Ga0207644_10010205 Ga0207644_100102054 117
52 3300031548 Ga0307408_100620549 Ga0307408_1006205492 117
53 3300031901 Ga0307406_10007080 Ga0307406_100070804 117
54 3300037312 Ga0395899_0038864 Ga0395899_0038864_825_1220 117
55 3300037466 Ga0395898_0590656 Ga0395898_0590656_236_631 117
56 3300037471 Ga0395905_0054100 Ga0395905_0054100_3322_3717 117
57 3300038443 Ga0395901_0716732 Ga0395901_0716732_562_957 117
58 3300041404 Ga0439436_0003186 Ga0439436_0003186_1023_1418 117
59 3300041406 Ga0439439_0000293 Ga0439439_0000293_1061_1456 117
60 3300041407 Ga0439447_102665 Ga0439447_102665_215_610 117
61 3300042004 Ga0439445_0016396 Ga0439445_0016396_1134_1529 117
62 3300042014 Ga0439457_023359 Ga0439457_023359_412_807 117
63 3300042015 Ga0439462_0111678 Ga0439462_0111678_304_699 117
64 3300042138 Ga0450903_058467 Ga0450903_058467_63_458 117
65 3300044901 Ga0466960_0834620 Ga0466960_0834620_111_506 117
66 3300048903 Ga0496100_0525923 Ga0496100_0525923_169_564 117
67 3300048904 Ga0496101_0467481 Ga0496101_0467481_133_528 117
68 3300048907 Ga0496104_1026115 Ga0496104_1026115_91_486 117
69 3300048909 Ga0496106_1206754 Ga0496106_1206754_97_492 117
70 3300048910 Ga0496107_0303311 Ga0496107_0303311_700_1095 117
71 3300048911 Ga0496108_0020695 Ga0496108_0020695_3574_3969 117
72 3300048912 Ga0496109_0148978 Ga0496109_0148978_1661_2056 117
73 3300048912 Ga0496109_0191694 Ga0496109_0191694_668_1063 117
74 3300048913 Ga0496110_0594872 Ga0496110_0594872_101_496 117
75 3300048915 Ga0496112_0025162 Ga0496112_0025162_148_543 117
76 3300048916 Ga0496113_0021851 Ga0496113_0021851_390_785 117
77 3300054114 Ga0501084_0405305 Ga0501084_0405305_784_1137 117
78 3300005440 Ga0070705_101373160 Ga0070705_1013731601 118
79 3300005467 Ga0070706_100078212 Ga0070706_1000782124 118
80 3300005536 Ga0070697_100042294 Ga0070697_1000422944 118
81 3300015689 Ga0183360_10001 Ga0183360_10001171 118
82 3300025263 Ga0209565_1000034 Ga0209565_100003477 118
83 3300025273 Ga0209673_1000039 Ga0209673_100003977 118
84 3300025291 Ga0209675_1000023 Ga0209675_100002377 118
85 3300025295 Ga0209564_1000066 Ga0209564_1000066196 118
86 3300025299 Ga0209256_1000048 Ga0209256_100004877 118
87 3300025904 Ga0207647_10307769 Ga0207647_103077692 118
88 3300031901 Ga0307406_10205361 Ga0307406_102053612 118
89 3300031995 Ga0307409_100357362 Ga0307409_1003573622 118
90 3300032005 Ga0307411_10095421 Ga0307411_100954212 118
91 3300041413 Ga0439465_0006378 Ga0439465_0006378_380_775 118
92 3300041999 Ga0439433_0147788 Ga0439433_0147788_24_419 118
93 3300042007 Ga0439449_0057610 Ga0439449_0057610_722_1117 118
94 3300042134 Ga0450898_007767 Ga0450898_007767_276_671 118
95 3300009036 Ga0105244_10045535 Ga0105244_100455353 119
96 3300015262 Ga0182007_10000026 Ga0182007_1000002650 119
97 3300015265 Ga0182005_1000473 Ga0182005_100047310 119
98 3300030732 Ga0316176_1170387 Ga0316176_11703872 119
99 3300030733 Ga0314311_1007241 Ga0314311_10072412 119
100 3300030735 Ga0316178_1063173 Ga0316178_10631733 119
101 3300031901 Ga0307406_10062508 Ga0307406_100625081 119
102 3300041404 Ga0439436_0097733 Ga0439436_0097733_182_577 119
103 3300042006 Ga0439432_027819 Ga0439432_027819_1400_1795 119
104 3300042145 Ga0450906_090101 Ga0450906_090101_41_436 119
105 3300049762 Ga0501265_005317 Ga0501265_005317_1014_1409 119
106 3300049772 Ga0501275_000050 Ga0501275_000050_5726_6121 119
107 3300048911 Ga0496108_0223803 Ga0496108_0223803_592_987 120
108 3300048912 Ga0496109_0356884 Ga0496109_0356884_505_900 120
109 3300009098 Ga0105245_12130762 Ga0105245_121307622 121
110 3300015261 Ga0182006_1074828 Ga0182006_10748283 121
111 3300048920 Ga0496117_0402986 Ga0496117_0402986_20_388 121
112 3300013307 Ga0157372_10507998 Ga0157372_105079981 122
113 3300031824 Ga0307413_10015371 Ga0307413_100153715 122
114 3300048928 Ga0496125_0010108 Ga0496125_0010108_7943_8338 122
115 3300003371 JGI26145J50221_1018987 JGI26145J50221_10189871 123
116 3300005539 Ga0068853_100927502 Ga0068853_1009275022 123
117 3300009101 Ga0105247_10228349 Ga0105247_102283492 123
118 3300027876 Ga0209974_10117745 Ga0209974_101177452 123
119 3300031824 Ga0307413_10680138 Ga0307413_106801382 123
120 3300032004 Ga0307414_10067758 Ga0307414_100677583 123
121 3300032005 Ga0307411_10364396 Ga0307411_103643962 123
122 3300042876 Ga0451577_0001996 Ga0451577_0001996_10593_10988 123
123 3300044712 Ga0453684_0289684 Ga0453684_0289684_471_866 123
124 3300049571 Ga0501034_0000661 Ga0501034_0000661_9744_10139 123
125 3300049571 Ga0501034_1345936 Ga0501034_1345936_61_456 123
126 3300025728 Ga0207655_1169972 Ga0207655_11699722 124
127 3300026041 Ga0207639_11197388 Ga0207639_111973881 124
128 3300027252 Ga0209973_1046092 Ga0209973_10460921 124
129 3300027364 Ga0209967_1030722 Ga0209967_10307221 124
130 3300027424 Ga0209984_1009783 Ga0209984_10097831 124
131 3300027462 Ga0210000_1016478 Ga0210000_10164782 124
132 3300027471 Ga0209995_1004303 Ga0209995_10043032 124
133 3300027543 Ga0209999_1000735 Ga0209999_10007356 124
134 3300027552 Ga0209982_1002436 Ga0209982_10024361 124
135 3300027614 Ga0209970_1024950 Ga0209970_10249501 124
136 3300027682 Ga0209971_1000229 Ga0209971_10002299 124
137 3300027876 Ga0209974_10047878 Ga0209974_100478782 124
138 3300031911 Ga0307412_10291663 Ga0307412_102916632 124
139 3300048919 Ga0496116_0066718 Ga0496116_0066718_17_412 124
140 iso_pu_bacteria 8054357960 8054359315 125
141 3300005328 Ga0070676_10688029 Ga0070676_106880292 126
142 3300005329 Ga0070683_100648415 Ga0070683_1006484152 126
143 3300005331 Ga0070670_100018944 Ga0070670_1000189442 126
144 3300005354 Ga0070675_100267033 Ga0070675_1002670332 126
145 3300005355 Ga0070671_100153658 Ga0070671_1001536582 126
146 3300005543 Ga0070672_100003498 Ga0070672_10000349810 126
147 3300005616 Ga0068852_101021342 Ga0068852_1010213422 126
148 3300005844 Ga0068862_101346797 Ga0068862_1013467971 126
149 3300009176 Ga0105242_10223817 Ga0105242_102238172 126
150 3300013308 Ga0157375_10045742 Ga0157375_100457424 126
151 3300044683 Ga0466965_0619936 Ga0466965_0619936_53_433 126
152 3300044901 Ga0466960_0002465 Ga0466960_0002465_6466_6846 126
153 iso_pu_bacteria 2571042365 2572254485 127
154 iso_pu_bacteria 2576861471 2578457347 127
155 iso_pu_bacteria 2643221559 2643816668 127
156 iso_pu_bacteria 2643221573 2643880967 127
157 iso_pu_bacteria 2643221579 2643907103 127
158 iso_pu_bacteria 2643221581 2643913514 127
159 iso_pu_bacteria 2643221586 2643938652 127
160 iso_pu_bacteria 2643221612 2644077604 127
161 iso_pu_bacteria 2643221695 2644528359 127
162 iso_pu_bacteria 2643221720 2644661536 127
163 iso_pu_bacteria 2643221727 2644694081 127
164 iso_pu_bacteria 2643221728 2644699617 127
165 iso_pu_bacteria 2747842501 2748019575 127
166 iso_pu_bacteria 2765235840 2765580133 127
167 iso_pu_bacteria 2816332141 2816518828 127
168 iso_pu_bacteria 2818991457 2819660780 127
169 iso_pu_bacteria 2842391507 2842393926 127
170 iso_pu_bacteria 2842780639 2842783216 127
171 iso_pu_bacteria 2852649853 2852652462 127
172 iso_pu_bacteria 2852684882 2852686648 127
173 iso_pu_bacteria 2857442823 2857444845 127
174 iso_pu_bacteria 2919130084 2919132607 127
175 iso_pu_bacteria 2919513703 2919515387 127
176 iso_pu_bacteria 2919675420 2919675756 127
177 iso_pu_bacteria 2923516293 2923519438 127
178 iso_pu_bacteria 2929195423 2929196776 127
179 iso_pu_bacteria 2937610967 2937615139 127
180 iso_pu_bacteria 2939589442 2939589447 127
181 iso_pu_bacteria 2939622612 2939625877 127
182 iso_pu_bacteria 2941475908 2941479082 127
183 iso_pu_bacteria 2941489479 2941491746 127
184 iso_pu_bacteria 2961064222 2961066790 127
185 iso_pu_bacteria 2974307012 2974307980 127
186 iso_pu_bacteria 2977247770 2977248716 127
187 iso_pu_bacteria 2984514374 2984516815 127
188 iso_pu_bacteria 2987605356 2987608423 127
189 iso_pu_bacteria 2995948881 2995953045 127
190 iso_pu_bacteria 8002869464 8002869765 127
191 iso_pu_bacteria 8003014200 8003016828 127
192 iso_pu_bacteria 8021622325 8021623918 127
193 iso_pu_bacteria 8021626552 8021629542 127
194 iso_pu_bacteria 8021648035 8021648078 127
195 3300031548 Ga0307408_100295314 Ga0307408_1002953142 130
196 3300031731 Ga0307405_10673935 Ga0307405_106739351 130
197 3300031824 Ga0307413_10706724 Ga0307413_107067241 130
198 3300031852 Ga0307410_10198454 Ga0307410_101984542 130
199 3300031901 Ga0307406_10505883 Ga0307406_105058831 130
200 3300031903 Ga0307407_10037545 Ga0307407_100375453 130
201 3300031995 Ga0307409_101474530 Ga0307409_1014745301 130
202 3300032002 Ga0307416_100368293 Ga0307416_1003682932 130
203 3300032002 Ga0307416_101013859 Ga0307416_1010138592 130
204 3300032004 Ga0307414_10476922 Ga0307414_104769222 130
205 3300032005 Ga0307411_10080092 Ga0307411_100800922 130
206 3300032005 Ga0307411_10673108 Ga0307411_106731081 130
207 3300032126 Ga0307415_100501713 Ga0307415_1005017132 130
208 3300037471 Ga0395905_0930696 Ga0395905_0930696_75_467 130
209 3300049652 Ga0501202_227438 Ga0501202_227438_81_473 130
210 3300049660 Ga0501216_049451 Ga0501216_049451_363_755 130
211 3300049661 Ga0501217_113782 Ga0501217_113782_91_483 130
212 3300049663 Ga0501223_121632 Ga0501223_121632_55_447 130
213 3300049688 Ga0501259_110086 Ga0501259_110086_102_494 130
214 3300049763 Ga0501266_033351 Ga0501266_033351_91_483 130
215 2162886007 SwRhRL2b_contig_1774666 SwRhRL2b_0027.00008380 131
216 2162886007 SwRhRL2b_contig_333196 SwRhRL2b_0230.00003460 131
217 2162886007 SwRhRL2b_contig_3538589 SwRhRL2b_0356.00000230 131
218 3300001904 JGI24736J21556_1047816 JGI24736J21556_10478162 131
219 3300001915 JGI24741J21665_1000917 JGI24741J21665_10009178 131
220 3300001915 JGI24741J21665_1002063 JGI24741J21665_10020635 131
221 3300001915 JGI24741J21665_1003645 JGI24741J21665_10036453 131
222 3300001979 JGI24740J21852_10006510 JGI24740J21852_100065103 131
223 3300001979 JGI24740J21852_10025119 JGI24740J21852_100251191 131
224 3300001979 JGI24740J21852_10061494 JGI24740J21852_100614941 131
225 3300002773 JGI25152J39213_1000126 JGI25152J39213_100012611 131
226 3300002774 JGI25150J39212_1000180 JGI25150J39212_100018013 131
227 3300003187 JGI25151J46595_10000177 JGI25151J46595_1000017731 131
228 3300003187 JGI25151J46595_10032534 JGI25151J46595_100325344 131
229 3300003215 JGI25153J46596_10000130 JGI25153J46596_1000013034 131
230 3300003320 rootH2_10002342 rootH2_100023425 131
231 3300003771 Ga0055526_1015942 Ga0055526_10159422 131
232 3300003773 Ga0055537_1000085 Ga0055537_100008561 131
233 3300003775 Ga0055524_1015646 Ga0055524_10156464 131
234 3300003775 Ga0055524_1021849 Ga0055524_10218492 131
235 3300003781 Ga0055536_1019715 Ga0055536_10197152 131
236 3300003781 Ga0055536_1020627 Ga0055536_10206272 131
237 3300003784 Ga0055534_1000113 Ga0055534_100011328 131
238 3300003784 Ga0055534_1024998 Ga0055534_10249981 131
239 3300003784 Ga0055534_1052392 Ga0055534_10523921 131
240 3300003790 Ga0055528_1002024 Ga0055528_10020242 131
241 3300003791 Ga0055530_10006864 Ga0055530_100068644 131
242 3300003791 Ga0055530_10101103 Ga0055530_101011031 131
243 3300003792 Ga0055540_1104255 Ga0055540_11042551 131
244 3300003794 Ga0055531_10008361 Ga0055531_100083615 131
245 3300003794 Ga0055531_10015106 Ga0055531_100151061 131
246 3300003794 Ga0055531_10017800 Ga0055531_100178004 131
247 3300003794 Ga0055531_10021856 Ga0055531_100218562 131
248 3300003794 Ga0055531_10025914 Ga0055531_100259141 131
249 3300003794 Ga0055531_10027930 Ga0055531_100279302 131
250 3300003794 Ga0055531_10046236 Ga0055531_100462361 131
251 3300003856 Ga0058692_1000015 Ga0058692_1000015197 131
252 3300004799 Ga0058863_11839322 Ga0058863_118393221 131
253 3300004800 Ga0058861_11774843 Ga0058861_117748431 131
254 3300004803 Ga0058862_12685554 Ga0058862_126855541 131
255 3300005288 Ga0065714_10266233 Ga0065714_102662332 131
256 3300005289 Ga0065704_10210458 Ga0065704_102104582 131
257 3300005289 Ga0065704_10217831 Ga0065704_102178312 131
258 3300005289 Ga0065704_10535473 Ga0065704_105354731 131
259 3300005289 Ga0065704_10549927 Ga0065704_105499272 131
260 3300005327 Ga0070658_10070426 Ga0070658_100704263 131
261 3300005327 Ga0070658_10156876 Ga0070658_101568762 131
262 3300005327 Ga0070658_10302993 Ga0070658_103029932 131
263 3300005327 Ga0070658_10466983 Ga0070658_104669831 131
264 3300005329 Ga0070683_100082432 Ga0070683_1000824323 131
265 3300005329 Ga0070683_100103830 Ga0070683_1001038303 131
266 3300005331 Ga0070670_100032457 Ga0070670_1000324572 131
267 3300005336 Ga0070680_100023558 Ga0070680_1000235582 131
268 3300005336 Ga0070680_100090118 Ga0070680_1000901182 131
269 3300005336 Ga0070680_100136585 Ga0070680_1001365852 131
270 3300005336 Ga0070680_100189157 Ga0070680_1001891573 131
271 3300005336 Ga0070680_100358991 Ga0070680_1003589911 131
272 3300005337 Ga0070682_100057814 Ga0070682_1000578142 131
273 3300005337 Ga0070682_100205047 Ga0070682_1002050472 131
274 3300005337 Ga0070682_100352239 Ga0070682_1003522392 131
275 3300005339 Ga0070660_100062259 Ga0070660_1000622592 131
276 3300005339 Ga0070660_100069720 Ga0070660_1000697203 131
277 3300005339 Ga0070660_100081074 Ga0070660_1000810743 131
278 3300005341 Ga0070691_10007471 Ga0070691_100074715 131
279 3300005341 Ga0070691_10161466 Ga0070691_101614662 131
280 3300005341 Ga0070691_10163341 Ga0070691_101633412 131
281 3300005341 Ga0070691_10254216 Ga0070691_102542162 131
282 3300005344 Ga0070661_100047164 Ga0070661_1000471643 131
283 3300005344 Ga0070661_100051713 Ga0070661_1000517132 131
284 3300005344 Ga0070661_100077859 Ga0070661_1000778592 131
285 3300005344 Ga0070661_100445642 Ga0070661_1004456421 131
286 3300005345 Ga0070692_10002504 Ga0070692_100025042 131
287 3300005345 Ga0070692_10020344 Ga0070692_100203443 131
288 3300005345 Ga0070692_10032916 Ga0070692_100329162 131
289 3300005345 Ga0070692_10178726 Ga0070692_101787263 131
290 3300005345 Ga0070692_10229695 Ga0070692_102296952 131
291 3300005353 Ga0070669_100256027 Ga0070669_1002560272 131
292 3300005354 Ga0070675_100770260 Ga0070675_1007702601 131
293 3300005355 Ga0070671_100016518 Ga0070671_1000165185 131
294 3300005364 Ga0070673_100275614 Ga0070673_1002756141 131
295 3300005366 Ga0070659_100113442 Ga0070659_1001134423 131
296 3300005366 Ga0070659_100220110 Ga0070659_1002201103 131
297 3300005366 Ga0070659_100301476 Ga0070659_1003014762 131
298 3300005455 Ga0070663_100183087 Ga0070663_1001830872 131
299 3300005455 Ga0070663_100218141 Ga0070663_1002181412 131
300 3300005455 Ga0070663_100664777 Ga0070663_1006647772 131
301 3300005455 Ga0070663_100927080 Ga0070663_1009270801 131
302 3300005457 Ga0070662_100061203 Ga0070662_1000612032 131
303 3300005458 Ga0070681_10000027 Ga0070681_1000002766 131
304 3300005458 Ga0070681_10007456 Ga0070681_100074569 131
305 3300005458 Ga0070681_10014781 Ga0070681_100147817 131
306 3300005458 Ga0070681_10317883 Ga0070681_103178832 131
307 3300005458 Ga0070681_11135920 Ga0070681_111359202 131
308 3300005518 Ga0070699_101023830 Ga0070699_1010238301 131
309 3300005530 Ga0070679_100004909 Ga0070679_10000490911 131
310 3300005530 Ga0070679_100102034 Ga0070679_1001020343 131
311 3300005530 Ga0070679_100340277 Ga0070679_1003402772 131
312 3300005530 Ga0070679_100452616 Ga0070679_1004526162 131
313 3300005530 Ga0070679_101488649 Ga0070679_1014886491 131
314 3300005535 Ga0070684_100078982 Ga0070684_1000789823 131
315 3300005535 Ga0070684_100079375 Ga0070684_1000793752 131
316 3300005535 Ga0070684_101403196 Ga0070684_1014031961 131
317 3300005539 Ga0068853_100059038 Ga0068853_1000590383 131
318 3300005539 Ga0068853_100198639 Ga0068853_1001986392 131
319 3300005546 Ga0070696_100053930 Ga0070696_1000539303 131
320 3300005546 Ga0070696_100314894 Ga0070696_1003148942 131
321 3300005546 Ga0070696_100362101 Ga0070696_1003621012 131
322 3300005546 Ga0070696_101794067 Ga0070696_1017940671 131
323 3300005548 Ga0070665_100075637 Ga0070665_1000756375 131
324 3300005563 Ga0068855_100028237 Ga0068855_1000282377 131
325 3300005563 Ga0068855_100194420 Ga0068855_1001944203 131
326 3300005563 Ga0068855_100356439 Ga0068855_1003564391 131
327 3300005563 Ga0068855_100424734 Ga0068855_1004247342 131
328 3300005564 Ga0070664_100097123 Ga0070664_1000971233 131
329 3300005564 Ga0070664_100164350 Ga0070664_1001643502 131
330 3300005564 Ga0070664_100481998 Ga0070664_1004819982 131
331 3300005577 Ga0068857_100094399 Ga0068857_1000943993 131
332 3300005577 Ga0068857_100108070 Ga0068857_1001080701 131
333 3300005578 Ga0068854_100095202 Ga0068854_1000952022 131
334 3300005578 Ga0068854_100104350 Ga0068854_1001043503 131
335 3300005578 Ga0068854_100136302 Ga0068854_1001363022 131
336 3300005578 Ga0068854_100286783 Ga0068854_1002867832 131
337 3300005578 Ga0068854_102049236 Ga0068854_1020492361 131
338 3300005614 Ga0068856_100121850 Ga0068856_1001218503 131
339 3300005614 Ga0068856_100221951 Ga0068856_1002219512 131
340 3300005614 Ga0068856_100495610 Ga0068856_1004956102 131
341 3300005614 Ga0068856_100762675 Ga0068856_1007626751 131
342 3300005616 Ga0068852_100009788 Ga0068852_1000097883 131
343 3300005616 Ga0068852_100176655 Ga0068852_1001766553 131
344 3300005616 Ga0068852_100373234 Ga0068852_1003732342 131
345 3300005616 Ga0068852_100517960 Ga0068852_1005179602 131
346 3300005616 Ga0068852_102353591 Ga0068852_1023535911 131
347 3300005617 Ga0068859_100314770 Ga0068859_1003147702 131
348 3300005618 Ga0068864_100101070 Ga0068864_1001010704 131
349 3300005834 Ga0068851_10036708 Ga0068851_100367082 131
350 3300005844 Ga0068862_100228992 Ga0068862_1002289921 131
351 3300005985 Ga0081539_10035642 Ga0081539_100356423 131
352 3300006038 Ga0075365_10485594 Ga0075365_104855942 131
353 3300006048 Ga0075363_100267851 Ga0075363_1002678512 131
354 3300006051 Ga0075364_10001892 Ga0075364_100018923 131
355 3300006051 Ga0075364_10021796 Ga0075364_100217964 131
356 3300006051 Ga0075364_10026689 Ga0075364_100266893 131
357 3300006051 Ga0075364_10089800 Ga0075364_100898001 131
358 3300006051 Ga0075364_10119740 Ga0075364_101197402 131
359 3300006051 Ga0075364_10832548 Ga0075364_108325481 131
360 3300006844 Ga0075428_101428252 Ga0075428_1014282521 131
361 3300006931 Ga0097620_100314793 Ga0097620_1003147932 131
362 3300009011 Ga0105251_10001735 Ga0105251_1000173510 131
363 3300009093 Ga0105240_10120222 Ga0105240_101202223 131
364 3300009093 Ga0105240_10132397 Ga0105240_101323973 131
365 3300009093 Ga0105240_10190935 Ga0105240_101909353 131
366 3300009093 Ga0105240_10450202 Ga0105240_104502022 131
367 3300009093 Ga0105240_11024366 Ga0105240_110243662 131
368 3300009148 Ga0105243_10010067 Ga0105243_100100675 131
369 3300009174 Ga0105241_10060367 Ga0105241_100603672 131
370 3300009177 Ga0105248_10123306 Ga0105248_101233062 131
371 3300009545 Ga0105237_10225334 Ga0105237_102253342 131
372 3300009545 Ga0105237_10417511 Ga0105237_104175113 131
373 3300009545 Ga0105237_10596612 Ga0105237_105966122 131
374 3300009551 Ga0105238_10113729 Ga0105238_101137292 131
375 3300009979 Ga0105032_104842 Ga0105032_1048422 131
376 3300009993 Ga0105028_136500 Ga0105028_1365001 131
377 3300011119 Ga0105246_11164916 Ga0105246_111649161 131
378 3300012478 Ga0157328_1001614 Ga0157328_10016141 131
379 3300012482 Ga0157318_1000351 Ga0157318_10003511 131
380 3300012508 Ga0157315_1009297 Ga0157315_10092971 131
381 3300012512 Ga0157327_1000101 Ga0157327_10001014 131
382 3300013100 Ga0157373_10039717 Ga0157373_100397173 131
383 3300013100 Ga0157373_10047580 Ga0157373_100475803 131
384 3300013100 Ga0157373_10094975 Ga0157373_100949752 131
385 3300013100 Ga0157373_10169918 Ga0157373_101699182 131
386 3300013100 Ga0157373_10204956 Ga0157373_102049561 131
387 3300013100 Ga0157373_10255402 Ga0157373_102554021 131
388 3300013102 Ga0157371_10001197 Ga0157371_1000119717 131
389 3300013102 Ga0157371_10049348 Ga0157371_100493483 131
390 3300013102 Ga0157371_10063005 Ga0157371_100630052 131
391 3300013102 Ga0157371_10072437 Ga0157371_100724374 131
392 3300013102 Ga0157371_10107616 Ga0157371_101076162 131
393 3300013102 Ga0157371_10499915 Ga0157371_104999151 131
394 3300013102 Ga0157371_11345814 Ga0157371_113458141 131
395 3300013104 Ga0157370_10005494 Ga0157370_100054943 131
396 3300013104 Ga0157370_10014388 Ga0157370_100143883 131
397 3300013104 Ga0157370_10243533 Ga0157370_102435333 131
398 3300013104 Ga0157370_10319621 Ga0157370_103196212 131
399 3300013104 Ga0157370_10513745 Ga0157370_105137453 131
400 3300013104 Ga0157370_10817540 Ga0157370_108175402 131
401 3300013105 Ga0157369_10095088 Ga0157369_100950883 131
402 3300013105 Ga0157369_10101943 Ga0157369_101019433 131
403 3300013105 Ga0157369_10106109 Ga0157369_101061093 131
404 3300013105 Ga0157369_10256664 Ga0157369_102566641 131
405 3300013306 Ga0163162_10163399 Ga0163162_101633994 131
406 3300013306 Ga0163162_11248124 Ga0163162_112481241 131
407 3300013307 Ga0157372_10010126 Ga0157372_100101262 131
408 3300013307 Ga0157372_10116846 Ga0157372_101168463 131
409 3300013307 Ga0157372_10154423 Ga0157372_101544232 131
410 3300013307 Ga0157372_10278019 Ga0157372_102780192 131
411 3300013307 Ga0157372_10388961 Ga0157372_103889613 131
412 3300013308 Ga0157375_10874447 Ga0157375_108744472 131
413 3300013874 Ga0157514_121698 Ga0157514_1216981 131
414 3300014326 Ga0157380_10096605 Ga0157380_100966054 131
415 3300014497 Ga0182008_10000640 Ga0182008_100006408 131
416 3300014497 Ga0182008_10029807 Ga0182008_100298074 131
417 3300015261 Ga0182006_1029462 Ga0182006_10294621 131
418 3300015261 Ga0182006_1044394 Ga0182006_10443942 131
419 3300015265 Ga0182005_1007526 Ga0182005_10075263 131
420 3300017792 Ga0163161_10005585 Ga0163161_100055859 131
421 3300017792 Ga0163161_11025912 Ga0163161_110259121 131
422 3300020069 Ga0197907_10010081 Ga0197907_100100812 131
423 3300020069 Ga0197907_10910264 Ga0197907_109102642 131
424 3300020070 Ga0206356_10191945 Ga0206356_101919453 131
425 3300020070 Ga0206356_11621496 Ga0206356_116214964 131
426 3300020076 Ga0206355_1661501 Ga0206355_16615011 131
427 3300020077 Ga0206351_10365865 Ga0206351_103658652 131
428 3300020077 Ga0206351_10599785 Ga0206351_105997852 131
429 3300020078 Ga0206352_10032047 Ga0206352_100320472 131
430 3300020078 Ga0206352_11104993 Ga0206352_111049931 131
431 3300020080 Ga0206350_10893779 Ga0206350_108937792 131
432 3300020080 Ga0206350_11143801 Ga0206350_111438011 131
433 3300020081 Ga0206354_10062392 Ga0206354_100623924 131
434 3300020081 Ga0206354_11127055 Ga0206354_111270552 131
435 3300020082 Ga0206353_10282153 Ga0206353_102821533 131
436 3300020082 Ga0206353_10476976 Ga0206353_104769762 131
437 3300020610 Ga0154015_1147847 Ga0154015_11478471 131
438 3300020610 Ga0154015_1306398 Ga0154015_13063983 131
439 3300020610 Ga0154015_1459418 Ga0154015_14594181 131
440 3300020610 Ga0154015_1472900 Ga0154015_14729001 131
441 3300022467 Ga0224712_10027926 Ga0224712_100279262 131
442 3300022467 Ga0224712_10333768 Ga0224712_103337681 131
443 3300025245 Ga0207425_1000066 Ga0207425_100006678 131
444 3300025258 Ga0209129_1000135 Ga0209129_100013537 131
445 3300025263 Ga0209565_1000023 Ga0209565_1000023240 131
446 3300025273 Ga0209673_1000116 Ga0209673_100011650 131
447 3300025273 Ga0209673_1004235 Ga0209673_10042357 131
448 3300025284 Ga0209130_1010488 Ga0209130_10104882 131
449 3300025291 Ga0209675_1000154 Ga0209675_100015464 131
450 3300025291 Ga0209675_1042358 Ga0209675_10423581 131
451 3300025292 Ga0209676_1011135 Ga0209676_10111355 131
452 3300025294 Ga0209025_1000013 Ga0209025_1000013361 131
453 3300025294 Ga0209025_1004258 Ga0209025_10042582 131
454 3300025294 Ga0209025_1059359 Ga0209025_10593591 131
455 3300025295 Ga0209564_1000106 Ga0209564_100010639 131
456 3300025295 Ga0209564_1014368 Ga0209564_10143681 131
457 3300025297 Ga0209758_1000014 Ga0209758_1000014361 131
458 3300025297 Ga0209758_1026770 Ga0209758_10267703 131
459 3300025297 Ga0209758_1084955 Ga0209758_10849551 131
460 3300025298 Ga0209050_1001331 Ga0209050_100133124 131
461 3300025298 Ga0209050_1033477 Ga0209050_10334771 131
462 3300025298 Ga0209050_1046790 Ga0209050_10467902 131
463 3300025298 Ga0209050_1088452 Ga0209050_10884521 131
464 3300025299 Ga0209256_1002361 Ga0209256_10023612 131
465 3300025299 Ga0209256_1003532 Ga0209256_100353210 131
466 3300025299 Ga0209256_1005289 Ga0209256_10052897 131
467 3300025303 Ga0209051_1009475 Ga0209051_10094753 131
468 3300025304 Ga0209257_1000270 Ga0209257_100027024 131
469 3300025304 Ga0209257_1000310 Ga0209257_100031045 131
470 3300025304 Ga0209257_1000378 Ga0209257_100037814 131
471 3300025304 Ga0209257_1023300 Ga0209257_10233002 131
472 3300025321 Ga0207656_10053631 Ga0207656_100536312 131
473 3300025735 Ga0207713_1000324 Ga0207713_100032439 131
474 3300025904 Ga0207647_10010962 Ga0207647_100109626 131
475 3300025904 Ga0207647_10048229 Ga0207647_100482292 131
476 3300025904 Ga0207647_10131667 Ga0207647_101316673 131
477 3300025907 Ga0207645_10232264 Ga0207645_102322642 131
478 3300025909 Ga0207705_10000527 Ga0207705_100005278 131
479 3300025909 Ga0207705_10002485 Ga0207705_1000248511 131
480 3300025909 Ga0207705_10002907 Ga0207705_100029073 131
481 3300025909 Ga0207705_10019921 Ga0207705_100199212 131
482 3300025909 Ga0207705_10413415 Ga0207705_104134151 131
483 3300025911 Ga0207654_10205018 Ga0207654_102050181 131
484 3300025912 Ga0207707_10000039 Ga0207707_1000003936 131
485 3300025912 Ga0207707_10000061 Ga0207707_1000006147 131
486 3300025912 Ga0207707_10000095 Ga0207707_1000009512 131
487 3300025912 Ga0207707_10000854 Ga0207707_1000085414 131
488 3300025912 Ga0207707_10000930 Ga0207707_1000093023 131
489 3300025912 Ga0207707_10001518 Ga0207707_100015186 131
490 3300025912 Ga0207707_10008753 Ga0207707_100087537 131
491 3300025913 Ga0207695_10001815 Ga0207695_1000181519 131
492 3300025913 Ga0207695_10010700 Ga0207695_100107003 131
493 3300025913 Ga0207695_10011157 Ga0207695_100111573 131
494 3300025913 Ga0207695_10198068 Ga0207695_101980681 131
495 3300025917 Ga0207660_10001101 Ga0207660_100011012 131
496 3300025917 Ga0207660_10003239 Ga0207660_100032391 131
497 3300025917 Ga0207660_10006078 Ga0207660_100060787 131
498 3300025917 Ga0207660_10045054 Ga0207660_100450543 131
499 3300025917 Ga0207660_10046286 Ga0207660_100462862 131
500 3300025917 Ga0207660_10079597 Ga0207660_100795973 131
501 3300025919 Ga0207657_10066686 Ga0207657_100666863 131
502 3300025919 Ga0207657_10068618 Ga0207657_100686183 131
503 3300025919 Ga0207657_10071330 Ga0207657_100713303 131
504 3300025919 Ga0207657_10085229 Ga0207657_100852292 131
505 3300025919 Ga0207657_11393869 Ga0207657_113938691 131
506 3300025920 Ga0207649_10012334 Ga0207649_100123342 131
507 3300025920 Ga0207649_10018343 Ga0207649_100183434 131
508 3300025920 Ga0207649_10085865 Ga0207649_100858652 131
509 3300025920 Ga0207649_10146690 Ga0207649_101466902 131
510 3300025920 Ga0207649_10226953 Ga0207649_102269532 131
511 3300025920 Ga0207649_10423423 Ga0207649_104234232 131
512 3300025921 Ga0207652_10000376 Ga0207652_1000037632 131
513 3300025921 Ga0207652_10000534 Ga0207652_1000053418 131
514 3300025921 Ga0207652_10000855 Ga0207652_1000085523 131
515 3300025921 Ga0207652_10003739 Ga0207652_100037392 131
516 3300025921 Ga0207652_10004248 Ga0207652_100042483 131
517 3300025921 Ga0207652_10059147 Ga0207652_100591473 131
518 3300025921 Ga0207652_10947911 Ga0207652_109479111 131
519 3300025923 Ga0207681_10346353 Ga0207681_103463532 131
520 3300025923 Ga0207681_10499277 Ga0207681_104992771 131
521 3300025924 Ga0207694_10346855 Ga0207694_103468552 131
522 3300025925 Ga0207650_10032905 Ga0207650_100329054 131
523 3300025925 Ga0207650_10140463 Ga0207650_101404632 131
524 3300025926 Ga0207659_10345814 Ga0207659_103458142 131
525 3300025931 Ga0207644_10252271 Ga0207644_102522712 131
526 3300025931 Ga0207644_10334671 Ga0207644_103346711 131
527 3300025932 Ga0207690_10001346 Ga0207690_100013469 131
528 3300025932 Ga0207690_10005785 Ga0207690_100057852 131
529 3300025933 Ga0207706_10052564 Ga0207706_100525642 131
530 3300025940 Ga0207691_10002069 Ga0207691_1000206913 131
531 3300025940 Ga0207691_10754647 Ga0207691_107546472 131
532 3300025941 Ga0207711_10053878 Ga0207711_100538784 131
533 3300025944 Ga0207661_10001167 Ga0207661_1000116715 131
534 3300025944 Ga0207661_10006758 Ga0207661_100067586 131
535 3300025944 Ga0207661_10010189 Ga0207661_100101897 131
536 3300025944 Ga0207661_10989891 Ga0207661_109898911 131
537 3300025944 Ga0207661_11027124 Ga0207661_110271242 131
538 3300025945 Ga0207679_10093100 Ga0207679_100931003 131
539 3300025945 Ga0207679_10124200 Ga0207679_101242002 131
540 3300025945 Ga0207679_10223437 Ga0207679_102234373 131
541 3300025945 Ga0207679_10278865 Ga0207679_102788652 131
542 3300025945 Ga0207679_10420122 Ga0207679_104201222 131
543 3300025945 Ga0207679_10427332 Ga0207679_104273322 131
544 3300025949 Ga0207667_10004910 Ga0207667_100049109 131
545 3300025949 Ga0207667_10015525 Ga0207667_100155257 131
546 3300025949 Ga0207667_10103144 Ga0207667_101031442 131
547 3300025949 Ga0207667_10328640 Ga0207667_103286402 131
548 3300025949 Ga0207667_10927960 Ga0207667_109279602 131
549 3300025960 Ga0207651_10238000 Ga0207651_102380002 131
550 3300025960 Ga0207651_10527760 Ga0207651_105277602 131
551 3300025972 Ga0207668_10117785 Ga0207668_101177852 131
552 3300025981 Ga0207640_10001438 Ga0207640_1000143811 131
553 3300025981 Ga0207640_10004474 Ga0207640_100044743 131
554 3300025981 Ga0207640_10005294 Ga0207640_100052947 131
555 3300025981 Ga0207640_10138392 Ga0207640_101383921 131
556 3300025981 Ga0207640_10171662 Ga0207640_101716621 131
557 3300025981 Ga0207640_10558107 Ga0207640_105581071 131
558 3300026041 Ga0207639_10029977 Ga0207639_100299774 131
559 3300026041 Ga0207639_10086642 Ga0207639_100866423 131
560 3300026041 Ga0207639_10507160 Ga0207639_105071601 131
561 3300026041 Ga0207639_10829938 Ga0207639_108299382 131
562 3300026067 Ga0207678_10067891 Ga0207678_100678913 131
563 3300026067 Ga0207678_10073079 Ga0207678_100730793 131
564 3300026067 Ga0207678_10076340 Ga0207678_100763403 131
565 3300026067 Ga0207678_10078976 Ga0207678_100789763 131
566 3300026067 Ga0207678_10088496 Ga0207678_100884962 131
567 3300026078 Ga0207702_10003173 Ga0207702_100031733 131
568 3300026078 Ga0207702_10007007 Ga0207702_1000700710 131
569 3300026078 Ga0207702_10069240 Ga0207702_100692403 131
570 3300026078 Ga0207702_10458160 Ga0207702_104581602 131
571 3300026088 Ga0207641_10099869 Ga0207641_100998691 131
572 3300026089 Ga0207648_10243875 Ga0207648_102438752 131
573 3300026095 Ga0207676_10061110 Ga0207676_100611103 131
574 3300026116 Ga0207674_10046641 Ga0207674_100466415 131
575 3300026116 Ga0207674_10097114 Ga0207674_100971143 131
576 3300026116 Ga0207674_10116204 Ga0207674_101162042 131
577 3300026116 Ga0207674_10415018 Ga0207674_104150181 131
578 3300026142 Ga0207698_10007061 Ga0207698_100070612 131
579 3300026142 Ga0207698_10021294 Ga0207698_100212944 131
580 3300026142 Ga0207698_10054226 Ga0207698_100542263 131
581 3300026142 Ga0207698_10099821 Ga0207698_100998212 131
582 3300026142 Ga0207698_10534430 Ga0207698_105344301 131
583 3300026142 Ga0207698_10926761 Ga0207698_109267612 131
584 3300027312 Ga0209371_1000011 Ga0209371_1000011680 131
585 3300028379 Ga0268266_10553401 Ga0268266_105534011 131
586 3300028380 Ga0268265_10117678 Ga0268265_101176782 131
587 3300028380 Ga0268265_10170692 Ga0268265_101706921 131
588 3300028380 Ga0268265_11209668 Ga0268265_112096681 131
589 3300028794 Ga0307515_10187071 Ga0307515_101870712 131
590 3300030500 Ga0268256_1000011 Ga0268256_1000011680 131
591 3300030732 Ga0316176_1026051 Ga0316176_10260512 131
592 3300031456 Ga0307513_10009118 Ga0307513_1000911810 131
593 3300031456 Ga0307513_10213724 Ga0307513_102137242 131
594 3300031456 Ga0307513_10450665 Ga0307513_104506651 131
595 3300031507 Ga0307509_10109058 Ga0307509_101090582 131
596 3300031548 Ga0307408_100286979 Ga0307408_1002869793 131
597 3300031548 Ga0307408_100694579 Ga0307408_1006945792 131
598 3300031731 Ga0307405_10257143 Ga0307405_102571433 131
599 3300031731 Ga0307405_10367277 Ga0307405_103672771 131
600 3300031731 Ga0307405_10830132 Ga0307405_108301321 131
601 3300031731 Ga0307405_11767922 Ga0307405_117679221 131
602 3300031824 Ga0307413_10061033 Ga0307413_100610332 131
603 3300031824 Ga0307413_10153450 Ga0307413_101534502 131
604 3300031824 Ga0307413_10451704 Ga0307413_104517041 131
605 3300031824 Ga0307413_10629269 Ga0307413_106292692 131
606 3300031852 Ga0307410_10081704 Ga0307410_100817041 131
607 3300031852 Ga0307410_10320143 Ga0307410_103201431 131
608 3300031901 Ga0307406_10133204 Ga0307406_101332042 131
609 3300031911 Ga0307412_10036110 Ga0307412_100361103 131
610 3300031911 Ga0307412_10274329 Ga0307412_102743292 131
611 3300031911 Ga0307412_10426948 Ga0307412_104269482 131
612 3300031911 Ga0307412_10433466 Ga0307412_104334662 131
613 3300031911 Ga0307412_10813076 Ga0307412_108130762 131
614 3300032002 Ga0307416_103153062 Ga0307416_1031530621 131
615 3300032004 Ga0307414_10008768 Ga0307414_100087685 131
616 3300032004 Ga0307414_10030087 Ga0307414_100300874 131
617 3300032004 Ga0307414_10044393 Ga0307414_100443934 131
618 3300032004 Ga0307414_10050488 Ga0307414_100504882 131
619 3300032004 Ga0307414_10078327 Ga0307414_100783272 131
620 3300032004 Ga0307414_10284362 Ga0307414_102843622 131
621 3300032004 Ga0307414_10400047 Ga0307414_104000472 131
622 3300032004 Ga0307414_10503125 Ga0307414_105031251 131
623 3300032004 Ga0307414_10951008 Ga0307414_109510082 131
624 3300032004 Ga0307414_11210703 Ga0307414_112107032 131
625 3300032005 Ga0307411_10023704 Ga0307411_100237042 131
626 3300032005 Ga0307411_10227489 Ga0307411_102274892 131
627 3300032005 Ga0307411_10261852 Ga0307411_102618521 131
628 3300032005 Ga0307411_10364794 Ga0307411_103647941 131
629 3300032168 Ga0316593_10104724 Ga0316593_101047242 131
630 3300033179 Ga0307507_10056649 Ga0307507_100566492 131
631 3300037312 Ga0395899_0034387 Ga0395899_0034387_411_806 131
632 3300037312 Ga0395899_0166668 Ga0395899_0166668_599_994 131
633 3300037312 Ga0395899_0236422 Ga0395899_0236422_566_961 131
634 3300037418 Ga0395900_0075723 Ga0395900_0075723_444_839 131
635 3300037418 Ga0395900_0290324 Ga0395900_0290324_1158_1553 131
636 3300037418 Ga0395900_1673767 Ga0395900_1673767_69_464 131
637 3300037466 Ga0395898_0048152 Ga0395898_0048152_2831_3226 131
638 3300037466 Ga0395898_0089564 Ga0395898_0089564_2004_2399 131
639 3300037466 Ga0395898_0154552 Ga0395898_0154552_305_700 131
640 3300037471 Ga0395905_0763019 Ga0395905_0763019_311_706 131
641 3300038443 Ga0395901_0012189 Ga0395901_0012189_7773_8168 131
642 3300038443 Ga0395901_0796243 Ga0395901_0796243_103_498 131
643 3300038705 Ga0237819_00312 Ga0237819_00312_3104_3499 131
644 3300038705 Ga0237819_03105 Ga0237819_03105_332_727 131
645 3300039145 Ga0237816_00049 Ga0237816_00049_6040_6435 131
646 3300041404 Ga0439436_0033247 Ga0439436_0033247_670_1065 131
647 3300041404 Ga0439436_0075426 Ga0439436_0075426_456_851 131
648 3300041406 Ga0439439_0111301 Ga0439439_0111301_273_668 131
649 3300041410 Ga0439461_0011441 Ga0439461_0011441_263_658 131
650 3300041411 Ga0439466_0145003 Ga0439466_0145003_122_517 131
651 3300041411 Ga0439466_0174451 Ga0439466_0174451_31_426 131
652 3300041413 Ga0439465_0022790 Ga0439465_0022790_687_1082 131
653 3300041413 Ga0439465_0024164 Ga0439465_0024164_531_926 131
654 3300041413 Ga0439465_0187764 Ga0439465_0187764_203_598 131
655 3300041443 Ga0451789_0567113 Ga0451789_0567113_222_617 131
656 3300041443 Ga0451789_0603815 Ga0451789_0603815_240_635 131
657 3300041443 Ga0451789_1127422 Ga0451789_1127422_91_486 131
658 3300041451 Ga0451791_1504983 Ga0451791_1504983_291_686 131
659 3300041452 Ga0451793_1421440 Ga0451793_1421440_184_579 131
660 3300041453 Ga0451797_0011554 Ga0451797_0011554_30_428 131
661 3300041453 Ga0451797_0179888 Ga0451797_0179888_493_888 131
662 3300041453 Ga0451797_0418348 Ga0451797_0418348_218_613 131
663 3300041453 Ga0451797_1447018 Ga0451797_1447018_110_505 131
664 3300041456 Ga0451795_1389936 Ga0451795_1389936_282_677 131
665 3300041459 Ga0451800_0436854 Ga0451800_0436854_100_495 131
666 3300041460 Ga0451802_0515276 Ga0451802_0515276_208_603 131
667 3300041460 Ga0451802_0889714 Ga0451802_0889714_462_857 131
668 3300041460 Ga0451802_1853850 Ga0451802_1853850_1133_1528 131
669 3300041462 Ga0451806_430966 Ga0451806_430966_100_495 131
670 3300041486 Ga0451807_0537170 Ga0451807_0537170_543_938 131
671 3300041486 Ga0451807_1702852 Ga0451807_1702852_1031_1426 131
672 3300041486 Ga0451807_2013840 Ga0451807_2013840_348_743 131
673 3300041486 Ga0451807_2723370 Ga0451807_2723370_2214_2609 131
674 3300041491 Ga0451833_1106277 Ga0451833_1106277_404_799 131
675 3300041494 Ga0451837_0339579 Ga0451837_0339579_191_586 131
676 3300041494 Ga0451837_0799066 Ga0451837_0799066_182_577 131
677 3300041494 Ga0451837_0894832 Ga0451837_0894832_88_483 131
678 3300041494 Ga0451837_1309318 Ga0451837_1309318_19_414 131
679 3300041494 Ga0451837_1419138 Ga0451837_1419138_22_417 131
680 3300041494 Ga0451837_1679811 Ga0451837_1679811_212_607 131
681 3300041501 Ga0451845_0148626 Ga0451845_0148626_35_430 131
682 3300041505 Ga0451849_0874557 Ga0451849_0874557_79_474 131
683 3300041509 Ga0451843_0413118 Ga0451843_0413118_902_1297 131
684 3300041509 Ga0451843_0437456 Ga0451843_0437456_329_724 131
685 3300041512 Ga0451853_3084322 Ga0451853_3084322_199_597 131
686 3300041512 Ga0451853_3955464 Ga0451853_3955464_79_474 131
687 3300041999 Ga0439433_0049804 Ga0439433_0049804_564_959 131
688 3300041999 Ga0439433_0180417 Ga0439433_0180417_70_465 131
689 3300042006 Ga0439432_004957 Ga0439432_004957_4384_4779 131
690 3300042006 Ga0439432_016995 Ga0439432_016995_900_1295 131
691 3300042006 Ga0439432_077986 Ga0439432_077986_405_800 131
692 3300042006 Ga0439432_229646 Ga0439432_229646_64_459 131
693 3300042007 Ga0439449_0004380 Ga0439449_0004380_4339_4734 131
694 3300042007 Ga0439449_0012155 Ga0439449_0012155_1495_1890 131
695 3300042007 Ga0439449_0014456 Ga0439449_0014456_1359_1754 131
696 3300042007 Ga0439449_0017729 Ga0439449_0017729_716_1111 131
697 3300042007 Ga0439449_0069480 Ga0439449_0069480_680_1075 131
698 3300042007 Ga0439449_0086846 Ga0439449_0086846_472_867 131
699 3300042007 Ga0439449_0204400 Ga0439449_0204400_227_622 131
700 3300042010 Ga0439452_010318 Ga0439452_010318_795_1190 131
701 3300042015 Ga0439462_0014720 Ga0439462_0014720_317_712 131
702 3300042134 Ga0450898_081837 Ga0450898_081837_132_527 131
703 3300042184 Ga0450908_094951 Ga0450908_094951_60_455 131
704 3300042435 Ga0439434_0020366 Ga0439434_0020366_652_1047 131
705 3300042435 Ga0439434_0190627 Ga0439434_0190627_87_482 131
706 3300045976 Ga0466967_1831532 Ga0466967_1831532_14_409 131
707 3300046453 Ga0495627_072343 Ga0495627_072343_145_540 131
708 3300046460 Ga0495638_0003232 Ga0495638_0003232_1656_2051 131
709 3300046460 Ga0495638_0126553 Ga0495638_0126553_916_1311 131
710 3300046474 Ga0495605_0090099 Ga0495605_0090099_347_742 131
711 3300046501 Ga0495607_0126486 Ga0495607_0126486_528_923 131
712 3300046507 Ga0495606_0019707 Ga0495606_0019707_3325_3720 131
713 3300046525 Ga0495663_0002950 Ga0495663_0002950_618_1013 131
714 3300046525 Ga0495663_0007675 Ga0495663_0007675_2252_2647 131
715 3300046525 Ga0495663_0292147 Ga0495663_0292147_156_551 131
716 3300046525 Ga0495663_0399936 Ga0495663_0399936_76_471 131
717 3300046537 Ga0495598_0001245 Ga0495598_0001245_510_905 131
718 3300046538 Ga0495609_0240568 Ga0495609_0240568_72_467 131
719 3300046539 Ga0495621_0044521 Ga0495621_0044521_814_1209 131
720 3300046557 Ga0495622_0504485 Ga0495622_0504485_51_446 131
721 3300046558 Ga0495633_0003001 Ga0495633_0003001_6576_6971 131
722 3300046558 Ga0495633_0030964 Ga0495633_0030964_446_841 131
723 3300046558 Ga0495633_0122642 Ga0495633_0122642_71_466 131
724 3300046558 Ga0495633_0138203 Ga0495633_0138203_172_567 131
725 3300046615 Ga0495656_0000506 Ga0495656_0000506_1578_1973 131
726 3300046615 Ga0495656_0130046 Ga0495656_0130046_25_420 131
727 3300046660 Ga0495625_0137962 Ga0495625_0137962_26_421 131
728 3300046664 Ga0495659_0013928 Ga0495659_0013928_1975_2370 131
729 3300046664 Ga0495659_0494975 Ga0495659_0494975_85_480 131
730 3300046691 Ga0495670_0582812 Ga0495670_0582812_159_554 131
731 3300046692 Ga0495671_0095899 Ga0495671_0095899_1036_1431 131
732 3300046810 Ga0495660_0262869 Ga0495660_0262869_39_434 131
733 3300047318 Ga0495636_0034397 Ga0495636_0034397_763_1158 131
734 3300047320 Ga0495672_0021447 Ga0495672_0021447_1705_2100 131
735 3300047470 Ga0495681_0376174 Ga0495681_0376174_57_452 131
736 3300047472 Ga0495686_0026366 Ga0495686_0026366_3311_3706 131
737 3300048905 Ga0496102_0178340 Ga0496102_0178340_1272_1667 131
738 3300048906 Ga0496103_0041894 Ga0496103_0041894_636_1031 131
739 3300048908 Ga0496105_0488082 Ga0496105_0488082_517_912 131
740 3300048909 Ga0496106_0025055 Ga0496106_0025055_3269_3664 131
741 3300048910 Ga0496107_0152561 Ga0496107_0152561_619_1014 131
742 3300048911 Ga0496108_0317286 Ga0496108_0317286_882_1277 131
743 3300048912 Ga0496109_0068841 Ga0496109_0068841_1255_1650 131
744 3300048914 Ga0496111_0064881 Ga0496111_0064881_1945_2340 131
745 3300048915 Ga0496112_0155646 Ga0496112_0155646_453_848 131
746 3300048916 Ga0496113_0068084 Ga0496113_0068084_1668_2063 131
747 3300048916 Ga0496113_0076333 Ga0496113_0076333_1646_2041 131
748 3300048916 Ga0496113_0100972 Ga0496113_0100972_1710_2105 131
749 3300048917 Ga0496114_0007709 Ga0496114_0007709_1117_1512 131
750 3300048917 Ga0496114_0340300 Ga0496114_0340300_309_704 131
751 3300048917 Ga0496114_0827485 Ga0496114_0827485_351_746 131
752 3300048918 Ga0496115_0731876 Ga0496115_0731876_16_411 131
753 3300048919 Ga0496116_0058897 Ga0496116_0058897_1790_2185 131
754 3300048919 Ga0496116_0289995 Ga0496116_0289995_292_687 131
755 3300048920 Ga0496117_0000969 Ga0496117_0000969_14430_14825 131
756 3300048920 Ga0496117_0002121 Ga0496117_0002121_6872_7267 131
757 3300048920 Ga0496117_0023022 Ga0496117_0023022_4547_4942 131
758 3300048921 Ga0496118_0001996 Ga0496118_0001996_8162_8557 131
759 3300048921 Ga0496118_0002316 Ga0496118_0002316_17242_17637 131
760 3300048921 Ga0496118_0005003 Ga0496118_0005003_8072_8467 131
761 3300048921 Ga0496118_0060601 Ga0496118_0060601_1597_1992 131
762 3300048921 Ga0496118_0089461 Ga0496118_0089461_355_750 131
763 3300048921 Ga0496118_0129579 Ga0496118_0129579_638_1033 131
764 3300048922 Ga0496119_0004382 Ga0496119_0004382_11087_11482 131
765 3300048923 Ga0496120_0000561 Ga0496120_0000561_41745_42140 131
766 3300048924 Ga0496121_0030360 Ga0496121_0030360_2258_2653 131
767 3300048925 Ga0496122_0000874 Ga0496122_0000874_41688_42083 131
768 3300048925 Ga0496122_0002722 Ga0496122_0002722_16035_16430 131
769 3300048925 Ga0496122_0009475 Ga0496122_0009475_7658_8053 131
770 3300048925 Ga0496122_0092719 Ga0496122_0092719_102_497 131
771 3300048925 Ga0496122_0109315 Ga0496122_0109315_1288_1683 131
772 3300048925 Ga0496122_0130175 Ga0496122_0130175_683_1078 131
773 3300048926 Ga0496123_0000461 Ga0496123_0000461_56395_56790 131
774 3300048926 Ga0496123_0001781 Ga0496123_0001781_19850_20245 131
775 3300048926 Ga0496123_0006266 Ga0496123_0006266_3119_3514 131
776 3300048926 Ga0496123_0020794 Ga0496123_0020794_1843_2238 131
777 3300048926 Ga0496123_0023746 Ga0496123_0023746_2242_2637 131
778 3300048927 Ga0496124_0000218 Ga0496124_0000218_27386_27781 131
779 3300048927 Ga0496124_0004852 Ga0496124_0004852_11994_12389 131
780 3300048927 Ga0496124_0019543 Ga0496124_0019543_5476_5871 131
781 3300048927 Ga0496124_0024328 Ga0496124_0024328_2736_3131 131
782 3300048927 Ga0496124_0028777 Ga0496124_0028777_2209_2604 131
783 3300048927 Ga0496124_0048300 Ga0496124_0048300_2260_2655 131
784 3300048927 Ga0496124_0093221 Ga0496124_0093221_647_1042 131
785 3300048927 Ga0496124_0254395 Ga0496124_0254395_217_612 131
786 3300048927 Ga0496124_0808982 Ga0496124_0808982_82_477 131
787 3300048928 Ga0496125_0048627 Ga0496125_0048627_1763_2158 131
788 3300048928 Ga0496125_0124456 Ga0496125_0124456_1091_1486 131
789 3300048928 Ga0496125_0268965 Ga0496125_0268965_170_565 131
790 3300048929 Ga0496126_0050461 Ga0496126_0050461_3360_3755 131
791 3300048929 Ga0496126_0078037 Ga0496126_0078037_2137_2532 131
792 3300048929 Ga0496126_0210807 Ga0496126_0210807_395_790 131
793 3300049460 Ga0495682_0183212 Ga0495682_0183212_273_668 131
794 3300049569 Ga0501032_0692723 Ga0501032_0692723_160_555 131
795 3300049570 Ga0501033_0001011 Ga0501033_0001011_11511_11906 131
796 3300049570 Ga0501033_0659637 Ga0501033_0659637_204_599 131
797 3300049571 Ga0501034_0088323 Ga0501034_0088323_578_973 131
798 3300049571 Ga0501034_0151746 Ga0501034_0151746_888_1283 131
799 3300049571 Ga0501034_0405140 Ga0501034_0405140_531_926 131
800 3300049571 Ga0501034_1627133 Ga0501034_1627133_108_503 131
801 3300049573 Ga0501037_0374180 Ga0501037_0374180_323_718 131
802 3300049574 Ga0501038_0310580 Ga0501038_0310580_431_826 131
803 3300049574 Ga0501038_0900076 Ga0501038_0900076_228_623 131
804 3300049578 Ga0501042_0655950 Ga0501042_0655950_121_516 131
805 3300049579 Ga0501043_0040610 Ga0501043_0040610_421_816 131
806 3300049581 Ga0501047_0000728 Ga0501047_0000728_29429_29824 131
807 3300049581 Ga0501047_0021626 Ga0501047_0021626_2092_2487 131
808 3300049581 Ga0501047_0384758 Ga0501047_0384758_494_889 131
809 3300049581 Ga0501047_0409512 Ga0501047_0409512_686_1081 131
810 3300049583 Ga0501067_0365564 Ga0501067_0365564_20_415 131
811 3300049585 Ga0501069_0007517 Ga0501069_0007517_4649_5044 131
812 3300049585 Ga0501069_0017890 Ga0501069_0017890_57_452 131
813 3300049585 Ga0501069_0056881 Ga0501069_0056881_1672_2067 131
814 3300049586 Ga0501070_0008134 Ga0501070_0008134_538_933 131
815 3300049586 Ga0501070_0008656 Ga0501070_0008656_5461_5856 131
816 3300049586 Ga0501070_0021684 Ga0501070_0021684_1000_1395 131
817 3300049586 Ga0501070_0023424 Ga0501070_0023424_1074_1469 131
818 3300049586 Ga0501070_0033935 Ga0501070_0033935_29_424 131
819 3300049586 Ga0501070_0048588 Ga0501070_0048588_2492_2887 131
820 3300049586 Ga0501070_0299749 Ga0501070_0299749_509_904 131
821 3300049586 Ga0501070_0346447 Ga0501070_0346447_494_889 131
822 3300049586 Ga0501070_0426705 Ga0501070_0426705_136_531 131
823 3300049587 Ga0501071_0006669 Ga0501071_0006669_5427_5822 131
824 3300049587 Ga0501071_0332858 Ga0501071_0332858_220_615 131
825 3300049588 Ga0501072_0795831 Ga0501072_0795831_63_458 131
826 3300049589 Ga0501073_0003299 Ga0501073_0003299_3753_4148 131
827 3300049589 Ga0501073_0067713 Ga0501073_0067713_1690_2085 131
828 3300049589 Ga0501073_0075224 Ga0501073_0075224_31_426 131
829 3300049590 Ga0501074_0004710 Ga0501074_0004710_5696_6091 131
830 3300049590 Ga0501074_0006953 Ga0501074_0006953_662_1057 131
831 3300049590 Ga0501074_0054713 Ga0501074_0054713_716_1111 131
832 3300049590 Ga0501074_0190269 Ga0501074_0190269_890_1285 131
833 3300049590 Ga0501074_0963676 Ga0501074_0963676_19_414 131
834 3300049593 Ga0501077_0082040 Ga0501077_0082040_185_580 131
835 3300049663 Ga0501223_036500 Ga0501223_036500_498_893 131
836 3300049668 Ga0501233_262740 Ga0501233_262740_109_504 131
837 3300049669 Ga0501235_069185 Ga0501235_069185_50_445 131
838 3300049673 Ga0501240_040233 Ga0501240_040233_197_592 131
839 3300049681 Ga0501251_037984 Ga0501251_037984_281_676 131
840 3300049683 Ga0501253_020165 Ga0501253_020165_155_550 131
841 3300049686 Ga0501257_051900 Ga0501257_051900_579_974 131
842 3300049705 Ga0501225_0106014 Ga0501225_0106014_106_501 131
843 3300049742 Ga0501080_0000440 Ga0501080_0000440_31296_31691 131
844 3300049742 Ga0501080_0017754 Ga0501080_0017754_513_908 131
845 3300049742 Ga0501080_0238451 Ga0501080_0238451_669_1064 131
846 3300049742 Ga0501080_0326699 Ga0501080_0326699_560_955 131
847 3300049742 Ga0501080_0414995 Ga0501080_0414995_426_821 131
848 3300049758 Ga0501241_153024 Ga0501241_153024_55_450 131
849 3300049759 Ga0501262_027977 Ga0501262_027977_54_449 131
850 3300049769 Ga0501272_073207 Ga0501272_073207_27_422 131
851 3300049772 Ga0501275_076993 Ga0501275_076993_84_479 131
852 3300049822 Ga0501035_0002331 Ga0501035_0002331_735_1130 131
853 3300049822 Ga0501035_0119995 Ga0501035_0119995_581_976 131
854 3300049822 Ga0501035_0579431 Ga0501035_0579431_282_677 131
855 3300049823 Ga0501044_0029925 Ga0501044_0029925_5278_5673 131
856 3300049823 Ga0501044_0030543 Ga0501044_0030543_211_606 131
857 3300049823 Ga0501044_0080505 Ga0501044_0080505_443_838 131
858 3300049823 Ga0501044_0297241 Ga0501044_0297241_688_1083 131
859 3300050490 nmdc:mga03n38_134655_c1 nmdc:mga03n38_134655_c1_43_438 131
860 3300050491 nmdc:mga00v17_1592_c1 nmdc:mga00v17_1592_c1_9907_10302 131
861 3300050491 nmdc:mga00v17_19508_c1 nmdc:mga00v17_19508_c1_1439_1834 131
862 3300050491 nmdc:mga00v17_375183_c1 nmdc:mga00v17_375183_c1_30_425 131
863 3300050491 nmdc:mga00v17_59114_c1 nmdc:mga00v17_59114_c1_218_613 131
864 3300050491 nmdc:mga00v17_88852_c1 nmdc:mga00v17_88852_c1_76_471 131
865 3300050492 nmdc:mga0yw44_605591_c1 nmdc:mga0yw44_605591_c1_250_645 131
866 3300053087 Ga0500643_165800 Ga0500643_165800_110_505 131
867 3300053093 Ga0500651_0000062 Ga0500651_0000062_21219_21614 131
868 3300053142 Ga0500577_0196685 Ga0500577_0196685_446_841 131
869 3300053161 Ga0500634_0000107 Ga0500634_0000107_8407_8802 131

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01597

GCV_H

Glycine cleavage H-protein

19

140

0.98

PF00364

Biotin_lipoyl

Biotin-requiring enzyme

49

106

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3wdn-assembly1.cif.gz_A high-resolution x-ray crystal structure of bovine h-protein using a high-pressure cryocooling method 0.9802 8 131
1htp-assembly1.cif.gz_A refined structures at 2 angstroms and 2.2 angstroms of the two forms of the h-protein, a lipoamide-containing protein of the glycine decarboxylase complex 0.9763 2 130
1onl-assembly3.cif.gz_C crystal structure of thermus thermophilus hb8 h-protein of the glycine cleavage system 0.9737 3 129
3a7a-assembly1.cif.gz_B crystal structure of e. coli lipoate-protein ligase a in complex with octyl-amp and apoh-protein 0.9675 3 128
2ka7-assembly1.cif.gz_A nmr solution structure of tm0212 at 40 c 0.9612 8 128
ID Description Score Start End Superfamily
3wdnA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9804 8 131 2.40.50.100
3a8jE00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9615 4 127 2.40.50.100
af_Q54JU3_2_142_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.961 8 126 2.40.50.100
3wdnA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9574 8 131 2.40.50.100
af_Q20634_6_139_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9558 2 125 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A382L4N7-F1-model_v4 Lipoyl-binding domain-containing protein 0.9953 11 127 GO:0005829
GO:0005960
GO:0019464
AF-A0A3B9QRA2-F1-model_v4 Glycine cleavage system H protein 0.9938 3 129 GO:0005829
GO:0005960
GO:0019464
AF-A0A836UBC1-F1-model_v4 Glycine cleavage system H protein 0.9935 1 128 GO:0005829
GO:0005960
GO:0019464
AF-A0A7K1ISG1-F1-model_v4 Glycine cleavage system H protein 0.9927 6 128 GO:0005737
GO:0005960
GO:0019464
AF-A0A2G6CJF0-F1-model_v4 Glycine cleavage system H protein 0.9927 24 124 GO:0005829
GO:0005960
GO:0019464

Feature Viewer

pLDDT pTM Quality
95.89 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map