F483941
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 864 | 382 | 857 | 187 |
Family's Representative Sequence
| Representative Sequence | 3300005536|Ga0070697_100227796|Ga0070697_1002277962 |
| Length | 218 |
| Sequence | MPKLIVFNQVSLDGYFTGDNGDLSWAHTRNAQDPEWHSFVKENAKGGGVLVFGRVTYDMMAGYWPTPAAQKNDPVVAEQMNALPKIVFSRSLDHAEWKNTRLVKGDPAAEMRKMKQAPGQDMVIMGSGTIVSQLAQAGLIDEYQLVVIPVALGKGKTMFEGITKTLPMKPTRSRTFHNGNVLLCYEPGDQEGEADGSAARSDQRGQRTPEPAEASHRS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 4 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 5 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 6 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 7 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 8 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 9 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 10 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 11 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 12 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 13 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 14 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 15 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 55 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 64 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 72 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 74 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 75 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 76 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 78 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 79 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 80 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 81 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 82 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 83 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 84 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 85 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 86 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 87 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 89 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 90 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 91 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 92 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 96 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 97 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 98 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 100 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 101 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 102 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 103 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 104 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 105 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 106 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 107 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 108 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 109 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 111 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 112 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 113 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 126 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 143 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 198 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 201 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 202 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 203 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 204 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 205 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 206 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 207 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 208 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 209 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 210 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 211 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 212 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 213 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 214 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 215 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 216 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 217 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 218 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 219 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 220 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 221 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 222 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 223 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 224 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 225 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 226 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 227 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 228 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 229 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 230 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 231 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 232 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 233 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 234 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 235 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 236 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 237 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 238 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 239 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 240 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 241 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 242 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 243 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 244 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 245 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 246 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 247 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 248 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 249 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 250 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 251 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 252 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 253 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 254 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 255 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 256 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 257 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 258 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 293 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 294 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 295 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 296 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 297 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 298 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 299 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 300 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 301 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 302 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 303 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 304 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 305 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 306 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 307 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 308 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 330 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 331 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 332 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 339 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 340 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 341 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 342 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 343 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 344 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 345 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 355 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 358 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 359 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 360 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 361 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 362 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 363 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 364 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 365 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 366 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 367 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 368 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 369 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 370 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 371 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 372 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 373 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 374 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 375 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 376 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 377 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 378 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 379 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 381 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.84 |
| Metatranscriptomes | 0.35 |
| Isolates | 0.81 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.18 |
| Nodule | 0.23 |
| Rhizoplane | 2.55 |
| Rhizosphere | 87.27 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.78 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1498326 | 2162886007 | Bacteria | 186627 |
| 2 | MRS1b_contig_1457758 | 2162886011 | Unclassified | 990 |
| 3 | MBSR1b_contig_3044804 | 2162886012 | Bacteria | 1610 |
| 4 | JGI24740J21852_10005322 | 3300001979 | Bacteria | 5458 |
| 5 | JGI24740J21852_10067119 | 3300001979 | Bacteria | 971 |
| 6 | JGI25154J39366_1000002 | 3300002738 | Bacteria | 466942 |
| 7 | rootL2_10296761 | 3300003322 | Bacteria | 2208 |
| 8 | Ga0058860_11931095 | 3300004801 | Unclassified | 791 |
| 9 | Ga0065704_10070132 | 3300005289 | Bacteria | 1955461 |
| 10 | Ga0065704_10237945 | 3300005289 | Bacteria | 1024 |
| 11 | Ga0065715_10102710 | 3300005293 | Bacteria | 3091 |
| 12 | Ga0065715_10139316 | 3300005293 | Bacteria | 1878 |
| 13 | Ga0065715_10535115 | 3300005293 | Unclassified | 752 |
| 14 | Ga0065707_10002593 | 3300005295 | Bacteria | 5316 |
| 15 | Ga0065707_10085153 | 3300005295 | Bacteria | 6403 |
| 16 | Ga0065707_10098721 | 3300005295 | Bacteria | 3063 |
| 17 | Ga0070676_10424359 | 3300005328 | Bacteria | 930 |
| 18 | Ga0070676_10622773 | 3300005328 | Bacteria | 780 |
| 19 | Ga0070683_100009138 | 3300005329 | Bacteria | 8459 |
| 20 | Ga0070683_101315910 | 3300005329 | Bacteria | 694 |
| 21 | Ga0070690_100044822 | 3300005330 | Bacteria | 2808 |
| 22 | Ga0070690_100087543 | 3300005330 | Bacteria | 2046 |
| 23 | Ga0070690_100345247 | 3300005330 | Bacteria | 1079 |
| 24 | Ga0070677_10045036 | 3300005333 | Bacteria | 1758 |
| 25 | Ga0068869_100004191 | 3300005334 | Bacteria | 8946 |
| 26 | Ga0068869_100034587 | 3300005334 | Bacteria | 3575 |
| 27 | Ga0068869_100058187 | 3300005334 | Bacteria | 2825 |
| 28 | Ga0068869_100065811 | 3300005334 | Bacteria | 2669 |
| 29 | Ga0068869_100567355 | 3300005334 | Bacteria | 955 |
| 30 | Ga0068869_100786774 | 3300005334 | Bacteria | 817 |
| 31 | Ga0070680_100004972 | 3300005336 | Bacteria | 10013 |
| 32 | Ga0070680_100066004 | 3300005336 | Bacteria | 2967 |
| 33 | Ga0070680_100148885 | 3300005336 | Bacteria | 1965 |
| 34 | Ga0070680_100159804 | 3300005336 | Unclassified | 1893 |
| 35 | Ga0070680_100238817 | 3300005336 | Bacteria | 1536 |
| 36 | Ga0070680_100463223 | 3300005336 | Bacteria | 1083 |
| 37 | Ga0070682_100194929 | 3300005337 | Bacteria | 1425 |
| 38 | Ga0068868_100007011 | 3300005338 | Bacteria | 8011 |
| 39 | Ga0068868_100037370 | 3300005338 | Bacteria | 3764 |
| 40 | Ga0068868_100430259 | 3300005338 | Bacteria | 1144 |
| 41 | Ga0070660_100146524 | 3300005339 | Bacteria | 1897 |
| 42 | Ga0070689_100013281 | 3300005340 | Bacteria | 5956 |
| 43 | Ga0070689_100014255 | 3300005340 | Bacteria | 5771 |
| 44 | Ga0070689_100066066 | 3300005340 | Bacteria | 2818 |
| 45 | Ga0070689_100782599 | 3300005340 | Bacteria | 838 |
| 46 | Ga0070687_100023879 | 3300005343 | Bacteria | 2911 |
| 47 | Ga0070687_100361891 | 3300005343 | Unclassified | 939 |
| 48 | Ga0070687_100399135 | 3300005343 | Unclassified | 901 |
| 49 | Ga0070687_100559702 | 3300005343 | Bacteria | 779 |
| 50 | Ga0070661_100063225 | 3300005344 | Bacteria | 2718 |
| 51 | Ga0070661_100222342 | 3300005344 | Unclassified | 1449 |
| 52 | Ga0070668_100120975 | 3300005347 | Bacteria | 2092 |
| 53 | Ga0070669_100008417 | 3300005353 | Bacteria | 7363 |
| 54 | Ga0070669_100756203 | 3300005353 | Bacteria | 824 |
| 55 | Ga0070675_100045392 | 3300005354 | Bacteria | 3596 |
| 56 | Ga0070675_100261089 | 3300005354 | Bacteria | 1518 |
| 57 | Ga0070675_100747262 | 3300005354 | Bacteria | 892 |
| 58 | Ga0070675_100768187 | 3300005354 | Bacteria | 880 |
| 59 | Ga0070675_101170015 | 3300005354 | Bacteria | 708 |
| 60 | Ga0070671_100091747 | 3300005355 | Bacteria | 2545 |
| 61 | Ga0070671_100130150 | 3300005355 | Bacteria | 2119 |
| 62 | Ga0070674_100016743 | 3300005356 | Bacteria | 4599 |
| 63 | Ga0070673_100026710 | 3300005364 | Bacteria | 4269 |
| 64 | Ga0070673_100058928 | 3300005364 | Bacteria | 3038 |
| 65 | Ga0070688_100026143 | 3300005365 | Bacteria | 3465 |
| 66 | Ga0070688_100354772 | 3300005365 | Bacteria | 1075 |
| 67 | Ga0070688_100689858 | 3300005365 | Bacteria | 790 |
| 68 | Ga0070659_100085296 | 3300005366 | Unclassified | 2526 |
| 69 | Ga0070659_100154355 | 3300005366 | Bacteria | 1874 |
| 70 | Ga0070667_100460308 | 3300005367 | Bacteria | 1163 |
| 71 | Ga0070703_10038315 | 3300005406 | Bacteria | 1481 |
| 72 | Ga0070709_10048099 | 3300005434 | Bacteria | 2660 |
| 73 | Ga0070709_10058639 | 3300005434 | Unclassified | 2442 |
| 74 | Ga0070709_10279951 | 3300005434 | Unclassified | 1212 |
| 75 | Ga0070714_100002872 | 3300005435 | Bacteria | 12745 |
| 76 | Ga0070714_100800072 | 3300005435 | Bacteria | 913 |
| 77 | Ga0070713_100034050 | 3300005436 | Bacteria | 4088 |
| 78 | Ga0070713_100214177 | 3300005436 | Unclassified | 1745 |
| 79 | Ga0070713_100442732 | 3300005436 | Bacteria | 1219 |
| 80 | Ga0070710_10008415 | 3300005437 | Bacteria | 5022 |
| 81 | Ga0070710_10221536 | 3300005437 | Bacteria | 1204 |
| 82 | Ga0070710_10583425 | 3300005437 | Bacteria | 776 |
| 83 | Ga0070701_10004414 | 3300005438 | Bacteria | 5693 |
| 84 | Ga0070701_10033535 | 3300005438 | Bacteria | 2566 |
| 85 | Ga0070711_100037487 | 3300005439 | Unclassified | 3253 |
| 86 | Ga0070711_100669151 | 3300005439 | Bacteria | 872 |
| 87 | Ga0070705_100011137 | 3300005440 | Bacteria | 4526 |
| 88 | Ga0070705_100210433 | 3300005440 | Unclassified | 1340 |
| 89 | Ga0070705_100624481 | 3300005440 | Unclassified | 837 |
| 90 | Ga0070700_100004458 | 3300005441 | Bacteria | 7313 |
| 91 | Ga0070700_100086926 | 3300005441 | Bacteria | 2031 |
| 92 | Ga0070694_100001335 | 3300005444 | Bacteria | 14395 |
| 93 | Ga0070694_100059208 | 3300005444 | Bacteria | 2608 |
| 94 | Ga0070694_100387644 | 3300005444 | Bacteria | 1091 |
| 95 | Ga0070708_100000951 | 3300005445 | Bacteria | 21957 |
| 96 | Ga0070708_100520621 | 3300005445 | Bacteria | 1122 |
| 97 | Ga0070663_100045123 | 3300005455 | Bacteria | 3112 |
| 98 | Ga0070678_100825390 | 3300005456 | Bacteria | 843 |
| 99 | Ga0070662_100115953 | 3300005457 | Bacteria | 2047 |
| 100 | Ga0070662_100925767 | 3300005457 | Unclassified | 744 |
| 101 | Ga0070681_10006425 | 3300005458 | Bacteria | 11440 |
| 102 | Ga0070681_10006494 | 3300005458 | Bacteria | 11378 |
| 103 | Ga0070681_10015651 | 3300005458 | Bacteria | 7555 |
| 104 | Ga0070681_10015673 | 3300005458 | Bacteria | 7551 |
| 105 | Ga0070681_10046173 | 3300005458 | Bacteria | 4356 |
| 106 | Ga0070681_10314381 | 3300005458 | Unclassified | 1476 |
| 107 | Ga0068867_100000114 | 3300005459 | Bacteria | 51011 |
| 108 | Ga0068867_100053038 | 3300005459 | Bacteria | 2994 |
| 109 | Ga0068867_100826408 | 3300005459 | Bacteria | 828 |
| 110 | Ga0068867_101128114 | 3300005459 | Unclassified | 717 |
| 111 | Ga0070685_10010931 | 3300005466 | Unclassified | 4733 |
| 112 | Ga0070685_10097452 | 3300005466 | Bacteria | 1790 |
| 113 | Ga0070685_10196190 | 3300005466 | Bacteria | 1309 |
| 114 | Ga0070685_10587666 | 3300005466 | Unclassified | 800 |
| 115 | Ga0070706_100544990 | 3300005467 | Unclassified | 1079 |
| 116 | Ga0070706_101109142 | 3300005467 | Bacteria | 728 |
| 117 | Ga0070707_100169578 | 3300005468 | Bacteria | 2127 |
| 118 | Ga0070707_100644683 | 3300005468 | Unclassified | 1022 |
| 119 | Ga0070698_100064580 | 3300005471 | Bacteria | 3687 |
| 120 | Ga0070698_100073836 | 3300005471 | Bacteria | 3416 |
| 121 | Ga0070698_100438136 | 3300005471 | Bacteria | 1242 |
| 122 | Ga0070699_100000102 | 3300005518 | Bacteria | 80731 |
| 123 | Ga0070699_100000130 | 3300005518 | Bacteria | 69436 |
| 124 | Ga0070679_100002404 | 3300005530 | Bacteria | 16972 |
| 125 | Ga0070679_100023383 | 3300005530 | Bacteria | 6049 |
| 126 | Ga0070679_100029436 | 3300005530 | Bacteria | 5418 |
| 127 | Ga0070679_100095719 | 3300005530 | Bacteria | 2957 |
| 128 | Ga0070684_100404805 | 3300005535 | Bacteria | 1258 |
| 129 | Ga0070684_100825687 | 3300005535 | Unclassified | 867 |
| 130 | Ga0070697_100016863 | 3300005536 | Bacteria | 5743 |
| 131 | Ga0070697_100227796 | 3300005536 | Unclassified | 1589 |
| 132 | Ga0068853_100020681 | 3300005539 | Bacteria | 5474 |
| 133 | Ga0068853_100041079 | 3300005539 | Bacteria | 3949 |
| 134 | Ga0068853_100081779 | 3300005539 | Bacteria | 2828 |
| 135 | Ga0068853_100467037 | 3300005539 | Bacteria | 1188 |
| 136 | Ga0068853_100501739 | 3300005539 | Bacteria | 1146 |
| 137 | Ga0068853_100589117 | 3300005539 | Bacteria | 1055 |
| 138 | Ga0068853_100623741 | 3300005539 | Bacteria | 1025 |
| 139 | Ga0070672_100290187 | 3300005543 | Bacteria | 1385 |
| 140 | Ga0070672_100525547 | 3300005543 | Unclassified | 1025 |
| 141 | Ga0070672_100637722 | 3300005543 | Bacteria | 930 |
| 142 | Ga0070686_100020224 | 3300005544 | Bacteria | 3936 |
| 143 | Ga0070686_100023906 | 3300005544 | Bacteria | 3658 |
| 144 | Ga0070686_100070115 | 3300005544 | Bacteria | 2291 |
| 145 | Ga0070686_100159154 | 3300005544 | Unclassified | 1589 |
| 146 | Ga0070695_100024050 | 3300005545 | Bacteria | 3751 |
| 147 | Ga0070695_100143627 | 3300005545 | Bacteria | 1658 |
| 148 | Ga0070695_100249454 | 3300005545 | Bacteria | 1291 |
| 149 | Ga0070695_100361274 | 3300005545 | Unclassified | 1091 |
| 150 | Ga0070695_100593796 | 3300005545 | Bacteria | 868 |
| 151 | Ga0070695_100959447 | 3300005545 | Unclassified | 693 |
| 152 | Ga0070696_100000006 | 3300005546 | Bacteria | 109170 |
| 153 | Ga0070696_100003610 | 3300005546 | Bacteria | 10300 |
| 154 | Ga0070696_100032695 | 3300005546 | Unclassified | 3570 |
| 155 | Ga0070696_100041264 | 3300005546 | Bacteria | 3188 |
| 156 | Ga0070696_100163955 | 3300005546 | Bacteria | 1639 |
| 157 | Ga0070693_100025833 | 3300005547 | Unclassified | 3163 |
| 158 | Ga0070693_100047393 | 3300005547 | Bacteria | 2445 |
| 159 | Ga0070693_100336860 | 3300005547 | Unclassified | 1028 |
| 160 | Ga0070693_100909727 | 3300005547 | Bacteria | 660 |
| 161 | Ga0070665_100927906 | 3300005548 | Bacteria | 883 |
| 162 | Ga0070665_101214153 | 3300005548 | Archaea | 765 |
| 163 | Ga0070704_100036617 | 3300005549 | Bacteria | 3345 |
| 164 | Ga0070704_100072347 | 3300005549 | Unclassified | 2508 |
| 165 | Ga0070704_100226743 | 3300005549 | Bacteria | 1522 |
| 166 | Ga0070704_100311582 | 3300005549 | Bacteria | 1315 |
| 167 | Ga0068855_100033773 | 3300005563 | Archaea | 6103 |
| 168 | Ga0068855_100065135 | 3300005563 | Bacteria | 4248 |
| 169 | Ga0068855_100216748 | 3300005563 | Unclassified | 2148 |
| 170 | Ga0068855_100367506 | 3300005563 | Archaea | 1582 |
| 171 | Ga0070664_100079666 | 3300005564 | Unclassified | 2820 |
| 172 | Ga0070664_101044808 | 3300005564 | Unclassified | 768 |
| 173 | Ga0068857_100094474 | 3300005577 | Bacteria | 2678 |
| 174 | Ga0068857_100203850 | 3300005577 | Unclassified | 1803 |
| 175 | Ga0068857_100459325 | 3300005577 | Bacteria | 1191 |
| 176 | Ga0068857_100475697 | 3300005577 | Bacteria | 1170 |
| 177 | Ga0068857_100487508 | 3300005577 | Bacteria | 1156 |
| 178 | Ga0068857_100808111 | 3300005577 | Bacteria | 896 |
| 179 | Ga0068857_100996426 | 3300005577 | Bacteria | 806 |
| 180 | Ga0068854_100243930 | 3300005578 | Bacteria | 1432 |
| 181 | Ga0068856_100234971 | 3300005614 | Bacteria | 1848 |
| 182 | Ga0068856_100888201 | 3300005614 | Archaea | 910 |
| 183 | Ga0068856_100925705 | 3300005614 | Unclassified | 890 |
| 184 | Ga0068856_100979151 | 3300005614 | Bacteria | 864 |
| 185 | Ga0070702_100003115 | 3300005615 | Bacteria | 7347 |
| 186 | Ga0068852_100082275 | 3300005616 | Bacteria | 2861 |
| 187 | Ga0068852_100442994 | 3300005616 | Unclassified | 1285 |
| 188 | Ga0068852_100918849 | 3300005616 | Bacteria | 892 |
| 189 | Ga0068859_100010567 | 3300005617 | Bacteria | 9294 |
| 190 | Ga0068859_100025922 | 3300005617 | Bacteria | 5881 |
| 191 | Ga0068859_100087090 | 3300005617 | Bacteria | 3170 |
| 192 | Ga0068859_100108729 | 3300005617 | Bacteria | 2834 |
| 193 | Ga0068859_100340688 | 3300005617 | Bacteria | 1594 |
| 194 | Ga0068859_100505304 | 3300005617 | Bacteria | 1304 |
| 195 | Ga0068859_100539606 | 3300005617 | Bacteria | 1261 |
| 196 | Ga0068864_100120927 | 3300005618 | Bacteria | 2341 |
| 197 | Ga0068864_100166319 | 3300005618 | Bacteria | 2008 |
| 198 | Ga0068864_100270917 | 3300005618 | Unclassified | 1582 |
| 199 | Ga0068861_100052540 | 3300005719 | Bacteria | 3097 |
| 200 | Ga0068861_100057010 | 3300005719 | Bacteria | 2983 |
| 201 | Ga0068861_100059661 | 3300005719 | Archaea | 2922 |
| 202 | Ga0068861_100149715 | 3300005719 | Bacteria | 1914 |
| 203 | Ga0068861_100453965 | 3300005719 | Bacteria | 1149 |
| 204 | Ga0068861_100624753 | 3300005719 | Unclassified | 992 |
| 205 | Ga0068870_10141504 | 3300005840 | Bacteria | 1408 |
| 206 | Ga0068863_100025634 | 3300005841 | Bacteria | 5622 |
| 207 | Ga0068863_100083618 | 3300005841 | Bacteria | 3025 |
| 208 | Ga0068858_100005323 | 3300005842 | Bacteria | 12620 |
| 209 | Ga0068858_100190404 | 3300005842 | Bacteria | 1938 |
| 210 | Ga0068858_100214554 | 3300005842 | Bacteria | 1822 |
| 211 | Ga0068860_100042231 | 3300005843 | Bacteria | 4356 |
| 212 | Ga0068860_100344486 | 3300005843 | Bacteria | 1466 |
| 213 | Ga0068860_101188173 | 3300005843 | Unclassified | 783 |
| 214 | Ga0068862_100019134 | 3300005844 | Bacteria | 5711 |
| 215 | Ga0068862_100225180 | 3300005844 | Bacteria | 1699 |
| 216 | Ga0068862_100270282 | 3300005844 | Bacteria | 1554 |
| 217 | Ga0068862_100974861 | 3300005844 | Bacteria | 837 |
| 218 | Ga0081455_10052558 | 3300005937 | Bacteria | 3486 |
| 219 | Ga0081455_10063362 | 3300005937 | Bacteria | 3102 |
| 220 | Ga0081455_10221824 | 3300005937 | Unclassified | 1400 |
| 221 | Ga0070717_10002431 | 3300006028 | Bacteria | 13144 |
| 222 | Ga0075365_10049622 | 3300006038 | Bacteria | 2765 |
| 223 | Ga0075368_10033062 | 3300006042 | Bacteria | 2011 |
| 224 | Ga0075368_10123184 | 3300006042 | Bacteria | 1075 |
| 225 | Ga0075368_10141447 | 3300006042 | Bacteria | 1003 |
| 226 | Ga0075363_100154023 | 3300006048 | Bacteria | 1298 |
| 227 | Ga0075364_10196838 | 3300006051 | Bacteria | 1365 |
| 228 | Ga0070715_10002390 | 3300006163 | Bacteria | 5749 |
| 229 | Ga0070715_10015014 | 3300006163 | Bacteria | 2881 |
| 230 | Ga0070715_10097134 | 3300006163 | Bacteria | 1367 |
| 231 | Ga0070716_100000050 | 3300006173 | Bacteria | 45407 |
| 232 | Ga0070716_100050088 | 3300006173 | Bacteria | 2369 |
| 233 | Ga0070712_100005798 | 3300006175 | Bacteria | 7634 |
| 234 | Ga0075362_10121034 | 3300006177 | Bacteria | 1239 |
| 235 | Ga0075367_10008892 | 3300006178 | Bacteria | 5226 |
| 236 | Ga0075367_10097229 | 3300006178 | Bacteria | 1796 |
| 237 | Ga0075366_10000836 | 3300006195 | Bacteria | 14794 |
| 238 | Ga0075366_10020978 | 3300006195 | Bacteria | 3796 |
| 239 | Ga0075366_10028692 | 3300006195 | Bacteria | 3267 |
| 240 | Ga0075366_10062559 | 3300006195 | Bacteria | 2212 |
| 241 | Ga0075366_10076286 | 3300006195 | Bacteria | 2000 |
| 242 | Ga0097621_100353586 | 3300006237 | Bacteria | 1307 |
| 243 | Ga0097621_100440970 | 3300006237 | Bacteria | 1172 |
| 244 | Ga0097621_100462691 | 3300006237 | Bacteria | 1144 |
| 245 | Ga0075370_10024452 | 3300006353 | Bacteria | 3337 |
| 246 | Ga0068871_100668206 | 3300006358 | Unclassified | 950 |
| 247 | Ga0075428_100004062 | 3300006844 | Bacteria | 16086 |
| 248 | Ga0075428_100010676 | 3300006844 | Bacteria | 10210 |
| 249 | Ga0075428_100020430 | 3300006844 | Bacteria | 7330 |
| 250 | Ga0075428_100137915 | 3300006844 | Bacteria | 2652 |
| 251 | Ga0075428_100160866 | 3300006844 | Bacteria | 2437 |
| 252 | Ga0075430_100045092 | 3300006846 | Bacteria | 3726 |
| 253 | Ga0075430_100063554 | 3300006846 | Bacteria | 3100 |
| 254 | Ga0075430_100258209 | 3300006846 | Unclassified | 1443 |
| 255 | Ga0075430_100294353 | 3300006846 | Bacteria | 1343 |
| 256 | Ga0075430_100824955 | 3300006846 | Bacteria | 764 |
| 257 | Ga0075431_100001840 | 3300006847 | Bacteria | 20074 |
| 258 | Ga0075431_100005633 | 3300006847 | Bacteria | 12371 |
| 259 | Ga0075431_100589381 | 3300006847 | Unclassified | 1096 |
| 260 | Ga0075433_10043130 | 3300006852 | Bacteria | 3915 |
| 261 | Ga0075433_10049158 | 3300006852 | Bacteria | 3669 |
| 262 | Ga0075433_10307498 | 3300006852 | Unclassified | 1403 |
| 263 | Ga0075433_10874300 | 3300006852 | Unclassified | 784 |
| 264 | Ga0075433_10952368 | 3300006852 | Unclassified | 748 |
| 265 | Ga0075434_100012547 | 3300006871 | Bacteria | 8036 |
| 266 | Ga0075434_100060267 | 3300006871 | Bacteria | 3774 |
| 267 | Ga0075434_100095942 | 3300006871 | Bacteria | 2970 |
| 268 | Ga0075434_100138359 | 3300006871 | Bacteria | 2454 |
| 269 | Ga0075429_100009961 | 3300006880 | Bacteria | 8236 |
| 270 | Ga0075429_100077418 | 3300006880 | Bacteria | 2898 |
| 271 | Ga0075429_100080733 | 3300006880 | Bacteria | 2836 |
| 272 | Ga0075429_100159128 | 3300006880 | Bacteria | 1978 |
| 273 | Ga0075429_100205693 | 3300006880 | Bacteria | 1725 |
| 274 | Ga0075429_100228423 | 3300006880 | Bacteria | 1630 |
| 275 | Ga0068865_100036003 | 3300006881 | Bacteria | 3334 |
| 276 | Ga0075436_100016913 | 3300006914 | Bacteria | 4991 |
| 277 | Ga0075436_100028074 | 3300006914 | Bacteria | 3873 |
| 278 | Ga0097620_100010568 | 3300006931 | Bacteria | 9294 |
| 279 | Ga0097620_100025922 | 3300006931 | Bacteria | 5881 |
| 280 | Ga0097620_100087090 | 3300006931 | Bacteria | 3170 |
| 281 | Ga0097620_100108725 | 3300006931 | Bacteria | 2834 |
| 282 | Ga0097620_100340689 | 3300006931 | Bacteria | 1594 |
| 283 | Ga0097620_100505320 | 3300006931 | Bacteria | 1304 |
| 284 | Ga0097620_100539502 | 3300006931 | Bacteria | 1261 |
| 285 | Ga0097620_101000804 | 3300006931 | Bacteria | 918 |
| 286 | Ga0075435_100002704 | 3300007076 | Bacteria | 11832 |
| 287 | Ga0075435_100209216 | 3300007076 | Bacteria | 1654 |
| 288 | Ga0075435_100253936 | 3300007076 | Unclassified | 1497 |
| 289 | Ga0099794_10002520 | 3300007265 | Bacteria | 6768 |
| 290 | Ga0099795_10011963 | 3300007788 | Bacteria | 2615 |
| 291 | Ga0105240_10018029 | 3300009093 | Bacteria | 9495 |
| 292 | Ga0105240_10259156 | 3300009093 | Bacteria | 2007 |
| 293 | Ga0105240_10934728 | 3300009093 | Unclassified | 931 |
| 294 | Ga0111539_10001106 | 3300009094 | Bacteria | 35560 |
| 295 | Ga0111539_10006798 | 3300009094 | Bacteria | 14713 |
| 296 | Ga0111539_10015937 | 3300009094 | Bacteria | 9338 |
| 297 | Ga0111539_10055371 | 3300009094 | Bacteria | 4714 |
| 298 | Ga0111539_10225630 | 3300009094 | Bacteria | 2182 |
| 299 | Ga0111539_10345720 | 3300009094 | Bacteria | 1731 |
| 300 | Ga0105245_10140817 | 3300009098 | Unclassified | 2271 |
| 301 | Ga0105245_10813838 | 3300009098 | Bacteria | 973 |
| 302 | Ga0105245_10838736 | 3300009098 | Unclassified | 959 |
| 303 | Ga0105245_10853180 | 3300009098 | Bacteria | 951 |
| 304 | Ga0105245_11079299 | 3300009098 | Bacteria | 849 |
| 305 | Ga0105247_10136707 | 3300009101 | Bacteria | 1602 |
| 306 | Ga0105247_10168770 | 3300009101 | Bacteria | 1454 |
| 307 | Ga0105247_10385639 | 3300009101 | Archaea | 995 |
| 308 | Ga0105247_10766834 | 3300009101 | Unclassified | 733 |
| 309 | Ga0114129_10022328 | 3300009147 | Bacteria | 8982 |
| 310 | Ga0114129_10033620 | 3300009147 | Bacteria | 7245 |
| 311 | Ga0114129_10038702 | 3300009147 | Bacteria | 6725 |
| 312 | Ga0114129_10056972 | 3300009147 | Bacteria | 5471 |
| 313 | Ga0114129_10745361 | 3300009147 | Bacteria | 1254 |
| 314 | Ga0114129_10819886 | 3300009147 | Bacteria | 1185 |
| 315 | Ga0105243_10002335 | 3300009148 | Bacteria | 15884 |
| 316 | Ga0105243_10032181 | 3300009148 | Bacteria | 4050 |
| 317 | Ga0105243_10321217 | 3300009148 | Bacteria | 1411 |
| 318 | Ga0105243_10901333 | 3300009148 | Unclassified | 880 |
| 319 | Ga0105241_10042510 | 3300009174 | Bacteria | 3438 |
| 320 | Ga0105241_10082704 | 3300009174 | Bacteria | 2517 |
| 321 | Ga0105241_10171289 | 3300009174 | Bacteria | 1793 |
| 322 | Ga0105242_10842159 | 3300009176 | Bacteria | 912 |
| 323 | Ga0105242_11033056 | 3300009176 | Bacteria | 832 |
| 324 | Ga0105248_10026278 | 3300009177 | Bacteria | 6477 |
| 325 | Ga0105248_10059487 | 3300009177 | Bacteria | 4292 |
| 326 | Ga0105248_10059823 | 3300009177 | Bacteria | 4279 |
| 327 | Ga0105248_10079788 | 3300009177 | Bacteria | 3678 |
| 328 | Ga0105248_10097715 | 3300009177 | Bacteria | 3308 |
| 329 | Ga0105248_10160862 | 3300009177 | Bacteria | 2533 |
| 330 | Ga0105248_10194562 | 3300009177 | Bacteria | 2285 |
| 331 | Ga0105248_10500947 | 3300009177 | Unclassified | 1369 |
| 332 | Ga0105248_11230859 | 3300009177 | Unclassified | 847 |
| 333 | Ga0105248_11463628 | 3300009177 | Bacteria | 773 |
| 334 | Ga0105237_10001721 | 3300009545 | Bacteria | 28293 |
| 335 | Ga0105237_10008802 | 3300009545 | Bacteria | 10886 |
| 336 | Ga0105237_10014774 | 3300009545 | Bacteria | 8149 |
| 337 | Ga0105237_10087229 | 3300009545 | Bacteria | 3110 |
| 338 | Ga0105237_10135980 | 3300009545 | Bacteria | 2452 |
| 339 | Ga0105237_10259716 | 3300009545 | Bacteria | 1740 |
| 340 | Ga0105237_10508024 | 3300009545 | Bacteria | 1212 |
| 341 | Ga0105237_10630434 | 3300009545 | Bacteria | 1079 |
| 342 | Ga0105237_11075172 | 3300009545 | Bacteria | 811 |
| 343 | Ga0105238_10001033 | 3300009551 | Bacteria | 28272 |
| 344 | Ga0105238_10919791 | 3300009551 | Bacteria | 894 |
| 345 | Ga0105249_10096507 | 3300009553 | Bacteria | 2774 |
| 346 | Ga0105249_10235327 | 3300009553 | Bacteria | 1808 |
| 347 | Ga0105249_10264288 | 3300009553 | Bacteria | 1711 |
| 348 | Ga0105249_11935162 | 3300009553 | Unclassified | 662 |
| 349 | Ga0099796_10021539 | 3300010159 | Bacteria | 1986 |
| 350 | Ga0105239_10009580 | 3300010375 | Bacteria | 10897 |
| 351 | Ga0105239_10053633 | 3300010375 | Bacteria | 4422 |
| 352 | Ga0105239_10164712 | 3300010375 | Unclassified | 2479 |
| 353 | Ga0105239_10597350 | 3300010375 | Bacteria | 1259 |
| 354 | Ga0105239_11550835 | 3300010375 | Unclassified | 766 |
| 355 | Ga0105239_11777807 | 3300010375 | Unclassified | 714 |
| 356 | Ga0157373_10053968 | 3300013100 | Bacteria | 2857 |
| 357 | Ga0157373_10531255 | 3300013100 | Unclassified | 852 |
| 358 | Ga0157370_10069454 | 3300013104 | Bacteria | 3327 |
| 359 | Ga0157369_10304643 | 3300013105 | Bacteria | 1657 |
| 360 | Ga0157374_10001392 | 3300013296 | Bacteria | 20515 |
| 361 | Ga0157374_11428631 | 3300013296 | Unclassified | 715 |
| 362 | Ga0157378_10158261 | 3300013297 | Bacteria | 2116 |
| 363 | Ga0163162_10083053 | 3300013306 | Bacteria | 3276 |
| 364 | Ga0163162_10319826 | 3300013306 | Bacteria | 1684 |
| 365 | Ga0163162_10837848 | 3300013306 | Bacteria | 1035 |
| 366 | Ga0163162_11976172 | 3300013306 | Unclassified | 668 |
| 367 | Ga0157372_10054725 | 3300013307 | Bacteria | 4453 |
| 368 | Ga0157372_11088963 | 3300013307 | Unclassified | 924 |
| 369 | Ga0157372_11137886 | 3300013307 | Bacteria | 903 |
| 370 | Ga0157375_10028446 | 3300013308 | Bacteria | 5239 |
| 371 | Ga0157375_10037395 | 3300013308 | Bacteria | 4651 |
| 372 | Ga0157375_10156346 | 3300013308 | Bacteria | 2419 |
| 373 | Ga0157375_10330970 | 3300013308 | Bacteria | 1688 |
| 374 | Ga0157375_10446839 | 3300013308 | Bacteria | 1458 |
| 375 | Ga0163163_10033211 | 3300014325 | Bacteria | 4990 |
| 376 | Ga0163163_10204742 | 3300014325 | Unclassified | 2022 |
| 377 | Ga0163163_10213352 | 3300014325 | Bacteria | 1979 |
| 378 | Ga0163163_10515085 | 3300014325 | Bacteria | 1258 |
| 379 | Ga0157380_10068228 | 3300014326 | Unclassified | 2866 |
| 380 | Ga0157380_10090627 | 3300014326 | Bacteria | 2523 |
| 381 | Ga0157380_10217130 | 3300014326 | Unclassified | 1708 |
| 382 | Ga0157380_10408380 | 3300014326 | Bacteria | 1291 |
| 383 | Ga0157377_10000016 | 3300014745 | Bacteria | 190613 |
| 384 | Ga0157377_10018617 | 3300014745 | Unclassified | 3612 |
| 385 | Ga0157377_10059263 | 3300014745 | Bacteria | 2182 |
| 386 | Ga0157379_10001159 | 3300014968 | Bacteria | 21489 |
| 387 | Ga0157379_10037015 | 3300014968 | Bacteria | 4350 |
| 388 | Ga0157379_10079832 | 3300014968 | Unclassified | 2930 |
| 389 | Ga0157379_10199455 | 3300014968 | Bacteria | 1809 |
| 390 | Ga0157379_10225971 | 3300014968 | Bacteria | 1696 |
| 391 | Ga0157379_10522715 | 3300014968 | Unclassified | 1102 |
| 392 | Ga0157379_10585998 | 3300014968 | Bacteria | 1040 |
| 393 | Ga0157376_10033179 | 3300014969 | Bacteria | 4153 |
| 394 | Ga0157376_10307673 | 3300014969 | Bacteria | 1502 |
| 395 | Ga0163161_10387651 | 3300017792 | Bacteria | 1118 |
| 396 | Ga0206350_10772802 | 3300020080 | Bacteria | 1019 |
| 397 | Ga0224712_10218062 | 3300022467 | Bacteria | 872 |
| 398 | Ga0207692_10020756 | 3300025898 | Unclassified | 2994 |
| 399 | Ga0207710_10078113 | 3300025900 | Bacteria | 1530 |
| 400 | Ga0207710_10117218 | 3300025900 | Bacteria | 1269 |
| 401 | Ga0207688_10099005 | 3300025901 | Archaea | 1682 |
| 402 | Ga0207647_10001594 | 3300025904 | Bacteria | 17417 |
| 403 | Ga0207685_10002906 | 3300025905 | Unclassified | 4045 |
| 404 | Ga0207685_10294213 | 3300025905 | Bacteria | 801 |
| 405 | Ga0207699_10026434 | 3300025906 | Unclassified | 3200 |
| 406 | Ga0207699_10047879 | 3300025906 | Unclassified | 2509 |
| 407 | Ga0207643_10018379 | 3300025908 | Bacteria | 3828 |
| 408 | Ga0207684_10708161 | 3300025910 | Bacteria | 855 |
| 409 | Ga0207684_11258556 | 3300025910 | Unclassified | 611 |
| 410 | Ga0207654_10131880 | 3300025911 | Bacteria | 1582 |
| 411 | Ga0207654_10162029 | 3300025911 | Unclassified | 1446 |
| 412 | Ga0207707_10002368 | 3300025912 | Bacteria | 16983 |
| 413 | Ga0207707_10009442 | 3300025912 | Bacteria | 8461 |
| 414 | Ga0207707_10071683 | 3300025912 | Bacteria | 3019 |
| 415 | Ga0207707_10112755 | 3300025912 | Bacteria | 2377 |
| 416 | Ga0207707_10664879 | 3300025912 | Unclassified | 877 |
| 417 | Ga0207695_10346039 | 3300025913 | Bacteria | 1374 |
| 418 | Ga0207695_10615702 | 3300025913 | Bacteria | 967 |
| 419 | Ga0207671_10001900 | 3300025914 | Bacteria | 23233 |
| 420 | Ga0207671_10053773 | 3300025914 | Bacteria | 2984 |
| 421 | Ga0207671_10092749 | 3300025914 | Bacteria | 2277 |
| 422 | Ga0207671_10226224 | 3300025914 | Bacteria | 1467 |
| 423 | Ga0207693_10005991 | 3300025915 | Bacteria | 10081 |
| 424 | Ga0207693_10007609 | 3300025915 | Bacteria | 8899 |
| 425 | Ga0207663_10003380 | 3300025916 | Bacteria | 7796 |
| 426 | Ga0207663_10240558 | 3300025916 | Bacteria | 1327 |
| 427 | Ga0207660_10004660 | 3300025917 | Bacteria | 8936 |
| 428 | Ga0207660_10195764 | 3300025917 | Bacteria | 1576 |
| 429 | Ga0207660_10209111 | 3300025917 | Unclassified | 1527 |
| 430 | Ga0207660_10357902 | 3300025917 | Bacteria | 1171 |
| 431 | Ga0207662_10002056 | 3300025918 | Bacteria | 9967 |
| 432 | Ga0207662_10052620 | 3300025918 | Bacteria | 2423 |
| 433 | Ga0207662_10143240 | 3300025918 | Bacteria | 1515 |
| 434 | Ga0207662_10313284 | 3300025918 | Unclassified | 1046 |
| 435 | Ga0207662_10319220 | 3300025918 | Bacteria | 1037 |
| 436 | Ga0207649_10059601 | 3300025920 | Unclassified | 2396 |
| 437 | Ga0207649_10230885 | 3300025920 | Unclassified | 1323 |
| 438 | Ga0207652_10002131 | 3300025921 | Bacteria | 16979 |
| 439 | Ga0207652_10716258 | 3300025921 | Bacteria | 892 |
| 440 | Ga0207646_10062119 | 3300025922 | Bacteria | 3335 |
| 441 | Ga0207646_10079619 | 3300025922 | Bacteria | 2929 |
| 442 | Ga0207646_10320225 | 3300025922 | Bacteria | 1401 |
| 443 | Ga0207694_10006772 | 3300025924 | Bacteria | 8701 |
| 444 | Ga0207659_10503974 | 3300025926 | Bacteria | 1025 |
| 445 | Ga0207659_10860970 | 3300025926 | Bacteria | 779 |
| 446 | Ga0207700_10050625 | 3300025928 | Bacteria | 3096 |
| 447 | Ga0207700_10157862 | 3300025928 | Bacteria | 1881 |
| 448 | Ga0207700_10394453 | 3300025928 | Bacteria | 1212 |
| 449 | Ga0207644_10019146 | 3300025931 | Bacteria | 4641 |
| 450 | Ga0207644_10101093 | 3300025931 | Bacteria | 2166 |
| 451 | Ga0207644_10413684 | 3300025931 | Bacteria | 1104 |
| 452 | Ga0207690_10336154 | 3300025932 | Bacteria | 1191 |
| 453 | Ga0207706_10021936 | 3300025933 | Bacteria | 5732 |
| 454 | Ga0207706_10383604 | 3300025933 | Bacteria | 1219 |
| 455 | Ga0207706_10446972 | 3300025933 | Bacteria | 1118 |
| 456 | Ga0207709_10059523 | 3300025935 | Bacteria | 2378 |
| 457 | Ga0207709_10135906 | 3300025935 | Unclassified | 1683 |
| 458 | Ga0207670_10301660 | 3300025936 | Bacteria | 1254 |
| 459 | Ga0207670_10451227 | 3300025936 | Bacteria | 1037 |
| 460 | Ga0207670_10886905 | 3300025936 | Bacteria | 746 |
| 461 | Ga0207704_10012737 | 3300025938 | Bacteria | 4180 |
| 462 | Ga0207704_10037378 | 3300025938 | Bacteria | 2804 |
| 463 | Ga0207665_10000152 | 3300025939 | Bacteria | 46840 |
| 464 | Ga0207665_10034350 | 3300025939 | Bacteria | 3364 |
| 465 | Ga0207665_10258940 | 3300025939 | Bacteria | 1288 |
| 466 | Ga0207665_10351977 | 3300025939 | Bacteria | 1112 |
| 467 | Ga0207691_10012672 | 3300025940 | Bacteria | 8076 |
| 468 | Ga0207711_10145855 | 3300025941 | Bacteria | 2132 |
| 469 | Ga0207711_10168238 | 3300025941 | Bacteria | 1988 |
| 470 | Ga0207711_10384869 | 3300025941 | Unclassified | 1302 |
| 471 | Ga0207711_10429799 | 3300025941 | Unclassified | 1229 |
| 472 | Ga0207689_10000714 | 3300025942 | Bacteria | 31774 |
| 473 | Ga0207689_10011996 | 3300025942 | Bacteria | 7427 |
| 474 | Ga0207689_10035742 | 3300025942 | Bacteria | 4125 |
| 475 | Ga0207689_10039547 | 3300025942 | Bacteria | 3904 |
| 476 | Ga0207689_10153316 | 3300025942 | Bacteria | 1899 |
| 477 | Ga0207689_10260168 | 3300025942 | Bacteria | 1435 |
| 478 | Ga0207689_10373176 | 3300025942 | Bacteria | 1187 |
| 479 | Ga0207689_10785132 | 3300025942 | Unclassified | 804 |
| 480 | Ga0207661_10220853 | 3300025944 | Unclassified | 1675 |
| 481 | Ga0207679_10093635 | 3300025945 | Unclassified | 2331 |
| 482 | Ga0207667_10014052 | 3300025949 | Bacteria | 9139 |
| 483 | Ga0207667_10189220 | 3300025949 | Bacteria | 2112 |
| 484 | Ga0207667_10955404 | 3300025949 | Unclassified | 846 |
| 485 | Ga0207651_10086667 | 3300025960 | Bacteria | 2277 |
| 486 | Ga0207651_10152099 | 3300025960 | Bacteria | 1803 |
| 487 | Ga0207651_11451213 | 3300025960 | Unclassified | 618 |
| 488 | Ga0207712_10226210 | 3300025961 | Bacteria | 1499 |
| 489 | Ga0207712_10643979 | 3300025961 | Bacteria | 920 |
| 490 | Ga0207640_10527925 | 3300025981 | Bacteria | 988 |
| 491 | Ga0207658_10318455 | 3300025986 | Unclassified | 1346 |
| 492 | Ga0207677_10026673 | 3300026023 | Bacteria | 3628 |
| 493 | Ga0207703_10031981 | 3300026035 | Viruses | 4162 |
| 494 | Ga0207703_10038495 | 3300026035 | Unclassified | 3817 |
| 495 | Ga0207703_10081574 | 3300026035 | Bacteria | 2697 |
| 496 | Ga0207703_10093141 | 3300026035 | Bacteria | 2537 |
| 497 | Ga0207703_10106248 | 3300026035 | Bacteria | 2387 |
| 498 | Ga0207639_10012886 | 3300026041 | Bacteria | 5834 |
| 499 | Ga0207639_10120883 | 3300026041 | Bacteria | 2151 |
| 500 | Ga0207639_10134472 | 3300026041 | Unclassified | 2051 |
| 501 | Ga0207639_10404437 | 3300026041 | Unclassified | 1230 |
| 502 | Ga0207639_10558588 | 3300026041 | Unclassified | 1051 |
| 503 | Ga0207678_10053430 | 3300026067 | Bacteria | 3481 |
| 504 | Ga0207678_10442456 | 3300026067 | Unclassified | 1129 |
| 505 | Ga0207708_10039135 | 3300026075 | Bacteria | 3612 |
| 506 | Ga0207708_10073706 | 3300026075 | Bacteria | 2617 |
| 507 | Ga0207708_10810798 | 3300026075 | Unclassified | 806 |
| 508 | Ga0207702_10128798 | 3300026078 | Bacteria | 2275 |
| 509 | Ga0207702_10212614 | 3300026078 | Unclassified | 1799 |
| 510 | Ga0207702_10935296 | 3300026078 | Unclassified | 859 |
| 511 | Ga0207702_11054546 | 3300026078 | Unclassified | 807 |
| 512 | Ga0207702_11171935 | 3300026078 | Bacteria | 763 |
| 513 | Ga0207641_10064366 | 3300026088 | Unclassified | 3134 |
| 514 | Ga0207641_10093744 | 3300026088 | Bacteria | 2632 |
| 515 | Ga0207641_10189127 | 3300026088 | Bacteria | 1891 |
| 516 | Ga0207648_10000343 | 3300026089 | Bacteria | 51081 |
| 517 | Ga0207648_10026411 | 3300026089 | Bacteria | 5160 |
| 518 | Ga0207648_10232089 | 3300026089 | Bacteria | 1641 |
| 519 | Ga0207648_10279704 | 3300026089 | Unclassified | 1492 |
| 520 | Ga0207676_10376477 | 3300026095 | Unclassified | 1320 |
| 521 | Ga0207676_11535485 | 3300026095 | Unclassified | 663 |
| 522 | Ga0207674_10093844 | 3300026116 | Bacteria | 2989 |
| 523 | Ga0207674_10111698 | 3300026116 | Unclassified | 2707 |
| 524 | Ga0207674_10173162 | 3300026116 | Unclassified | 2111 |
| 525 | Ga0207674_10236182 | 3300026116 | Bacteria | 1775 |
| 526 | Ga0207674_10314588 | 3300026116 | Bacteria | 1515 |
| 527 | Ga0207674_10479225 | 3300026116 | Bacteria | 1203 |
| 528 | Ga0207674_11225739 | 3300026116 | Bacteria | 720 |
| 529 | Ga0207675_100004242 | 3300026118 | Bacteria | 13862 |
| 530 | Ga0207675_100011414 | 3300026118 | Bacteria | 8313 |
| 531 | Ga0207675_100236365 | 3300026118 | Bacteria | 1764 |
| 532 | Ga0207675_100263506 | 3300026118 | Bacteria | 1671 |
| 533 | Ga0207675_100302501 | 3300026118 | Unclassified | 1558 |
| 534 | Ga0207675_100421248 | 3300026118 | Bacteria | 1319 |
| 535 | Ga0207683_10090582 | 3300026121 | Bacteria | 2724 |
| 536 | Ga0207683_10718697 | 3300026121 | Bacteria | 926 |
| 537 | Ga0207698_10169642 | 3300026142 | Unclassified | 1920 |
| 538 | Ga0207698_10183760 | 3300026142 | Bacteria | 1855 |
| 539 | Ga0207698_10351329 | 3300026142 | Unclassified | 1393 |
| 540 | Ga0209813_10124682 | 3300027866 | Bacteria | 900 |
| 541 | Ga0209813_10274063 | 3300027866 | Unclassified | 648 |
| 542 | Ga0209974_10012502 | 3300027876 | Bacteria | 2838 |
| 543 | Ga0207428_10000633 | 3300027907 | Bacteria | 41339 |
| 544 | Ga0207428_10018443 | 3300027907 | Bacteria | 5961 |
| 545 | Ga0207428_10030638 | 3300027907 | Bacteria | 4445 |
| 546 | Ga0207428_10047259 | 3300027907 | Bacteria | 3456 |
| 547 | Ga0268265_10114994 | 3300028380 | Bacteria | 2204 |
| 548 | Ga0268265_10286315 | 3300028380 | Bacteria | 1477 |
| 549 | Ga0268265_10291801 | 3300028380 | Bacteria | 1464 |
| 550 | Ga0268265_10414052 | 3300028380 | Bacteria | 1249 |
| 551 | Ga0268265_11026149 | 3300028380 | Bacteria | 816 |
| 552 | Ga0268264_10000051 | 3300028381 | Bacteria | 321565 |
| 553 | Ga0268264_10078054 | 3300028381 | Unclassified | 2822 |
| 554 | Ga0268264_10162352 | 3300028381 | Unclassified | 2014 |
| 555 | Ga0268264_10196321 | 3300028381 | Bacteria | 1843 |
| 556 | Ga0265337_1005772 | 3300028556 | Bacteria | 4859 |
| 557 | Ga0265326_10100657 | 3300028558 | Bacteria | 819 |
| 558 | Ga0307515_10030972 | 3300028794 | Bacteria | 8950 |
| 559 | Ga0265338_10037653 | 3300028800 | Bacteria | 4598 |
| 560 | Ga0265320_10000141 | 3300031240 | Bacteria | 61166 |
| 561 | Ga0265340_10009210 | 3300031247 | Bacteria | 5306 |
| 562 | Ga0265339_10138922 | 3300031249 | Bacteria | 1237 |
| 563 | Ga0265331_10195679 | 3300031250 | Bacteria | 911 |
| 564 | Ga0265327_10000010 | 3300031251 | Bacteria | 566817 |
| 565 | Ga0265316_10000552 | 3300031344 | Bacteria | 42074 |
| 566 | Ga0265316_10139818 | 3300031344 | Bacteria | 1819 |
| 567 | Ga0307513_10055061 | 3300031456 | Bacteria | 4259 |
| 568 | Ga0307509_10066136 | 3300031507 | Bacteria | 3794 |
| 569 | Ga0307509_10080563 | 3300031507 | Bacteria | 3366 |
| 570 | Ga0307509_10134566 | 3300031507 | Bacteria | 2420 |
| 571 | Ga0307509_10632058 | 3300031507 | Bacteria | 740 |
| 572 | Ga0307508_10028223 | 3300031616 | Bacteria | 5075 |
| 573 | Ga0307508_10101106 | 3300031616 | Bacteria | 2479 |
| 574 | Ga0316575_10000971 | 3300031665 | Bacteria | 8844 |
| 575 | Ga0265314_10001011 | 3300031711 | Bacteria | 32906 |
| 576 | Ga0265314_10240058 | 3300031711 | Bacteria | 1046 |
| 577 | Ga0265342_10006483 | 3300031712 | Bacteria | 8714 |
| 578 | Ga0307516_10002069 | 3300031730 | Bacteria | 27319 |
| 579 | Ga0307516_10351299 | 3300031730 | Bacteria | 1140 |
| 580 | Ga0307405_10005702 | 3300031731 | Bacteria | 6042 |
| 581 | Ga0307416_100038314 | 3300032002 | Bacteria | 3698 |
| 582 | Ga0307416_101603016 | 3300032002 | Unclassified | 756 |
| 583 | Ga0316583_10001913 | 3300032133 | Bacteria | 7108 |
| 584 | Ga0307507_10033111 | 3300033179 | Bacteria | 5374 |
| 585 | Ga0307507_10333502 | 3300033179 | Bacteria | 904 |
| 586 | Ga0307510_10080098 | 3300033180 | Bacteria | 3178 |
| 587 | Ga0373948_0043097 | 3300034817 | Bacteria | 950 |
| 588 | Ga0373938_0019463 | 3300034957 | Bacteria | 1358 |
| 589 | Ga0373934_0014118 | 3300035086 | Bacteria | 3024 |
| 590 | Ga0373934_0074528 | 3300035086 | Bacteria | 1360 |
| 591 | Ga0373951_0048717 | 3300035091 | Unclassified | 1038 |
| 592 | Ga0373954_0004315 | 3300035118 | Bacteria | 6111 |
| 593 | Ga0373956_0004155 | 3300035119 | Bacteria | 5806 |
| 594 | Ga0373943_0082552 | 3300035170 | Bacteria | 1650 |
| 595 | Ga0373955_0003273 | 3300035172 | Bacteria | 7101 |
| 596 | Ga0373955_0079239 | 3300035172 | Bacteria | 1853 |
| 597 | Ga0373961_0153734 | 3300035241 | Bacteria | 786 |
| 598 | Ga0373962_0014399 | 3300035242 | Unclassified | 2016 |
| 599 | Ga0316574_0002419 | 3300035398 | Bacteria | 9366 |
| 600 | Ga0373924_0091050 | 3300035410 | Unclassified | 1305 |
| 601 | Ga0373931_0870609 | 3300035691 | Bacteria | 604 |
| 602 | Ga0373935_0532092 | 3300035692 | Bacteria | 855 |
| 603 | Ga0373927_0018429 | 3300035695 | Bacteria | 4588 |
| 604 | Ga0373933_0000809 | 3300035724 | Bacteria | 19079 |
| 605 | Ga0373937_0023561 | 3300036401 | Bacteria | 5544 |
| 606 | Ga0373937_0744054 | 3300036401 | Bacteria | 928 |
| 607 | Ga0395900_0030020 | 3300037418 | Bacteria | 5580 |
| 608 | Ga0395898_0864815 | 3300037466 | Bacteria | 843 |
| 609 | Ga0395905_0196637 | 3300037471 | Bacteria | 1891 |
| 610 | Ga0395905_1025507 | 3300037471 | Bacteria | 728 |
| 611 | Ga0395901_0546109 | 3300038443 | Unclassified | 1175 |
| 612 | Ga0242420_001992 | 3300038996 | Unclassified | 2844 |
| 613 | Ga0439439_0041353 | 3300041406 | Bacteria | 1195 |
| 614 | Ga0451789_0643364 | 3300041443 | Bacteria | 1186 |
| 615 | Ga0451793_0666774 | 3300041452 | Bacteria | 851 |
| 616 | Ga0451853_2163079 | 3300041512 | Bacteria | 677 |
| 617 | Ga0439449_0010774 | 3300042007 | Bacteria | 3450 |
| 618 | Ga0439457_011054 | 3300042014 | Bacteria | 2061 |
| 619 | Ga0439435_0017308 | 3300042436 | Bacteria | 1820 |
| 620 | Ga0451577_0710649 | 3300042876 | Bacteria | 910 |
| 621 | Ga0466963_0004899 | 3300044694 | Bacteria | 7807 |
| 622 | Ga0453684_0775695 | 3300044712 | Bacteria | 1036 |
| 623 | Ga0453684_1154500 | 3300044712 | Unclassified | 815 |
| 624 | Ga0466957_0017882 | 3300044842 | Bacteria | 4159 |
| 625 | Ga0451576_0033779 | 3300045051 | Bacteria | 5435 |
| 626 | Ga0451576_0104032 | 3300045051 | Bacteria | 2953 |
| 627 | Ga0451576_0144528 | 3300045051 | Bacteria | 2480 |
| 628 | Ga0451576_1613762 | 3300045051 | Unclassified | 673 |
| 629 | Ga0466958_0037410 | 3300045836 | Bacteria | 2908 |
| 630 | Ga0466967_0041955 | 3300045976 | Unclassified | 3950 |
| 631 | Ga0495592_0367743 | 3300046454 | Bacteria | 918 |
| 632 | Ga0495629_0026281 | 3300046459 | Unclassified | 4137 |
| 633 | Ga0495629_0162836 | 3300046459 | Bacteria | 1549 |
| 634 | Ga0495651_0180420 | 3300046462 | Bacteria | 1495 |
| 635 | Ga0495651_0248175 | 3300046462 | Bacteria | 1217 |
| 636 | Ga0495651_0298298 | 3300046462 | Bacteria | 1082 |
| 637 | Ga0495580_0001866 | 3300046472 | Bacteria | 18532 |
| 638 | Ga0495580_0095254 | 3300046472 | Bacteria | 2071 |
| 639 | Ga0495580_0377530 | 3300046472 | Bacteria | 958 |
| 640 | Ga0495582_0001408 | 3300046473 | Bacteria | 13557 |
| 641 | Ga0495582_0063020 | 3300046473 | Bacteria | 2048 |
| 642 | Ga0495639_0030136 | 3300046475 | Bacteria | 2411 |
| 643 | Ga0495662_0034990 | 3300046476 | Bacteria | 2424 |
| 644 | Ga0495664_0246852 | 3300046477 | Bacteria | 1080 |
| 645 | Ga0495664_0478343 | 3300046477 | Bacteria | 745 |
| 646 | Ga0495594_0184499 | 3300046499 | Unclassified | 1188 |
| 647 | Ga0495608_0015603 | 3300046511 | Bacteria | 5263 |
| 648 | Ga0495618_0029851 | 3300046514 | Bacteria | 3403 |
| 649 | Ga0495630_0595865 | 3300046517 | Unclassified | 847 |
| 650 | Ga0495644_0043944 | 3300046523 | Bacteria | 1681 |
| 651 | Ga0495586_0041739 | 3300046535 | Bacteria | 2471 |
| 652 | Ga0495586_0047074 | 3300046535 | Bacteria | 2326 |
| 653 | Ga0495587_0023501 | 3300046536 | Bacteria | 3787 |
| 654 | Ga0495587_0563753 | 3300046536 | Unclassified | 628 |
| 655 | Ga0495598_0070098 | 3300046537 | Bacteria | 1102 |
| 656 | Ga0495645_0151926 | 3300046543 | Unclassified | 1608 |
| 657 | Ga0495668_0245441 | 3300046616 | Bacteria | 980 |
| 658 | Ga0495634_0192837 | 3300046642 | Unclassified | 1270 |
| 659 | Ga0495635_0033802 | 3300046663 | Bacteria | 3547 |
| 660 | Ga0495588_0368948 | 3300046674 | Bacteria | 754 |
| 661 | Ga0495657_0311656 | 3300046675 | Bacteria | 937 |
| 662 | Ga0495623_0345045 | 3300046679 | Unclassified | 812 |
| 663 | Ga0495613_0079002 | 3300046689 | Bacteria | 2393 |
| 664 | Ga0495613_0455208 | 3300046689 | Unclassified | 867 |
| 665 | Ga0495649_0268699 | 3300046694 | Bacteria | 873 |
| 666 | Ga0495600_0193172 | 3300046809 | Bacteria | 1308 |
| 667 | Ga0495581_0599848 | 3300047315 | Bacteria | 638 |
| 668 | Ga0495604_0177394 | 3300047317 | Bacteria | 1492 |
| 669 | Ga0495674_0015352 | 3300047319 | Bacteria | 7164 |
| 670 | Ga0495674_0240637 | 3300047319 | Bacteria | 1491 |
| 671 | Ga0495680_0150730 | 3300047322 | Unclassified | 1696 |
| 672 | Ga0495677_0149489 | 3300047445 | Unclassified | 899 |
| 673 | Ga0495684_0036290 | 3300047471 | Bacteria | 3780 |
| 674 | Ga0495602_0256016 | 3300048088 | Unclassified | 1301 |
| 675 | Ga0496101_0349801 | 3300048904 | Bacteria | 1161 |
| 676 | Ga0496102_0050697 | 3300048905 | Bacteria | 3780 |
| 677 | Ga0496102_0230850 | 3300048905 | Bacteria | 1745 |
| 678 | Ga0496102_0417831 | 3300048905 | Bacteria | 1260 |
| 679 | Ga0496103_0013067 | 3300048906 | Bacteria | 4923 |
| 680 | Ga0496104_0040484 | 3300048907 | Bacteria | 4367 |
| 681 | Ga0496105_0164950 | 3300048908 | Bacteria | 1818 |
| 682 | Ga0496106_0173155 | 3300048909 | Unclassified | 1712 |
| 683 | Ga0496107_0027625 | 3300048910 | Bacteria | 4029 |
| 684 | Ga0496107_0468620 | 3300048910 | Unclassified | 935 |
| 685 | Ga0496109_0025483 | 3300048912 | Bacteria | 5271 |
| 686 | Ga0496109_0812446 | 3300048912 | Unclassified | 873 |
| 687 | Ga0496110_0059697 | 3300048913 | Bacteria | 3362 |
| 688 | Ga0496111_0010111 | 3300048914 | Bacteria | 6316 |
| 689 | Ga0496112_0010806 | 3300048915 | Bacteria | 8304 |
| 690 | Ga0496112_0104179 | 3300048915 | Unclassified | 2807 |
| 691 | Ga0496113_0013516 | 3300048916 | Bacteria | 5535 |
| 692 | Ga0496114_0010721 | 3300048917 | Bacteria | 7295 |
| 693 | Ga0496114_0027017 | 3300048917 | Bacteria | 4701 |
| 694 | Ga0496115_0026703 | 3300048918 | Bacteria | 4509 |
| 695 | Ga0496117_0522459 | 3300048920 | Unclassified | 571 |
| 696 | Ga0496121_0157792 | 3300048924 | Bacteria | 1663 |
| 697 | Ga0496121_0201374 | 3300048924 | Bacteria | 1419 |
| 698 | Ga0496121_0301368 | 3300048924 | Bacteria | 1087 |
| 699 | Ga0496126_0078190 | 3300048929 | Bacteria | 2932 |
| 700 | Ga0501032_0001778 | 3300049569 | Bacteria | 17010 |
| 701 | Ga0501032_0163357 | 3300049569 | Bacteria | 1462 |
| 702 | Ga0501033_0006961 | 3300049570 | Bacteria | 8829 |
| 703 | Ga0501033_0021858 | 3300049570 | Bacteria | 4828 |
| 704 | Ga0501034_0017005 | 3300049571 | Bacteria | 7456 |
| 705 | Ga0501034_0022252 | 3300049571 | Bacteria | 6460 |
| 706 | Ga0501034_0037976 | 3300049571 | Bacteria | 4877 |
| 707 | Ga0501034_0265253 | 3300049571 | Unclassified | 1659 |
| 708 | Ga0501036_0001304 | 3300049572 | Bacteria | 19109 |
| 709 | Ga0501036_0074907 | 3300049572 | Bacteria | 2863 |
| 710 | Ga0501037_0000852 | 3300049573 | Bacteria | 22742 |
| 711 | Ga0501037_0299833 | 3300049573 | Unclassified | 1116 |
| 712 | Ga0501038_0003040 | 3300049574 | Bacteria | 15641 |
| 713 | Ga0501038_0356423 | 3300049574 | Bacteria | 1138 |
| 714 | Ga0501043_0008849 | 3300049579 | Bacteria | 7921 |
| 715 | Ga0501043_0303286 | 3300049579 | Bacteria | 1220 |
| 716 | Ga0501046_0002656 | 3300049580 | Bacteria | 16682 |
| 717 | Ga0501046_0049736 | 3300049580 | Bacteria | 3315 |
| 718 | Ga0501047_0007261 | 3300049581 | Bacteria | 10415 |
| 719 | Ga0501047_0024643 | 3300049581 | Bacteria | 5775 |
| 720 | Ga0501047_0062899 | 3300049581 | Bacteria | 3580 |
| 721 | Ga0501048_0004121 | 3300049582 | Bacteria | 11077 |
| 722 | Ga0501067_0001824 | 3300049583 | Bacteria | 11700 |
| 723 | Ga0501067_0168459 | 3300049583 | Unclassified | 1220 |
| 724 | Ga0501068_0000234 | 3300049584 | Bacteria | 26949 |
| 725 | Ga0501068_0216293 | 3300049584 | Unclassified | 1217 |
| 726 | Ga0501068_0284314 | 3300049584 | Bacteria | 1057 |
| 727 | Ga0501069_0003617 | 3300049585 | Bacteria | 7964 |
| 728 | Ga0501070_0000512 | 3300049586 | Bacteria | 35492 |
| 729 | Ga0501070_0005792 | 3300049586 | Bacteria | 10543 |
| 730 | Ga0501071_1004554 | 3300049587 | Bacteria | 644 |
| 731 | Ga0501071_1470691 | 3300049587 | Bacteria | 526 |
| 732 | Ga0501072_0002523 | 3300049588 | Bacteria | 13706 |
| 733 | Ga0501073_0000482 | 3300049589 | Bacteria | 27716 |
| 734 | Ga0501073_0000939 | 3300049589 | Bacteria | 20943 |
| 735 | Ga0501073_0004075 | 3300049589 | Bacteria | 10956 |
| 736 | Ga0501074_0011232 | 3300049590 | Bacteria | 6508 |
| 737 | Ga0501075_0514956 | 3300049591 | Bacteria | 913 |
| 738 | Ga0501076_0010528 | 3300049592 | Bacteria | 6864 |
| 739 | Ga0501076_0021485 | 3300049592 | Bacteria | 4952 |
| 740 | Ga0501076_0945888 | 3300049592 | Bacteria | 710 |
| 741 | Ga0501077_0036595 | 3300049593 | Bacteria | 3127 |
| 742 | Ga0501227_000344 | 3300049665 | Bacteria | 9808 |
| 743 | Ga0501233_004341 | 3300049668 | Bacteria | 2595 |
| 744 | Ga0501221_037828 | 3300049704 | Unclassified | 1040 |
| 745 | Ga0501079_0002938 | 3300049741 | Bacteria | 12452 |
| 746 | Ga0501079_0613949 | 3300049741 | Bacteria | 856 |
| 747 | Ga0501080_0001468 | 3300049742 | Bacteria | 19844 |
| 748 | Ga0501080_0006766 | 3300049742 | Bacteria | 10326 |
| 749 | Ga0501080_0615792 | 3300049742 | Bacteria | 963 |
| 750 | Ga0501081_0060404 | 3300049743 | Bacteria | 2626 |
| 751 | Ga0501081_0265180 | 3300049743 | Bacteria | 1256 |
| 752 | Ga0501081_0313634 | 3300049743 | Bacteria | 1152 |
| 753 | Ga0501083_0004962 | 3300049744 | Bacteria | 9428 |
| 754 | Ga0501083_0010679 | 3300049744 | Bacteria | 6460 |
| 755 | Ga0501035_0029424 | 3300049822 | Bacteria | 5008 |
| 756 | Ga0501035_0713565 | 3300049822 | Bacteria | 808 |
| 757 | Ga0501044_0011048 | 3300049823 | Bacteria | 9793 |
| 758 | Ga0501044_0017635 | 3300049823 | Bacteria | 7657 |
| 759 | Ga0501044_0023212 | 3300049823 | Bacteria | 6601 |
| 760 | nmdc:mga03683_139567_c1 | 3300050489 | Bacteria | 1089 |
| 761 | nmdc:mga03683_26201_c1 | 3300050489 | Bacteria | 2298 |
| 762 | nmdc:mga00v17_71326_c1 | 3300050491 | Bacteria | 2153 |
| 763 | nmdc:mga00v17_84765_c1 | 3300050491 | Bacteria | 1984 |
| 764 | nmdc:mga0yw44_40072_c1 | 3300050492 | Bacteria | 2781 |
| 765 | nmdc:mga0k408_1207_c1 | 3300050493 | Bacteria | 14149 |
| 766 | nmdc:mga0k408_152975_c1 | 3300050493 | Bacteria | 1374 |
| 767 | nmdc:mga0k408_15687_c1 | 3300050493 | Bacteria | 4194 |
| 768 | nmdc:mga0k408_204207_c1 | 3300050493 | Unclassified | 1180 |
| 769 | nmdc:mga06z11_338229_c1 | 3300050494 | Unclassified | 900 |
| 770 | nmdc:mga06z11_510447_c1 | 3300050494 | Unclassified | 729 |
| 771 | nmdc:mga06z11_5693_c1 | 3300050494 | Bacteria | 5019 |
| 772 | nmdc:mga04h51_111939_c1 | 3300050495 | Bacteria | 1007 |
| 773 | nmdc:mga04h51_151709_c1 | 3300050495 | Bacteria | 886 |
| 774 | nmdc:mga04h51_41577_c1 | 3300050495 | Bacteria | 1503 |
| 775 | nmdc:mga04h51_87458_c1 | 3300050495 | Bacteria | 1116 |
| 776 | nmdc:mga07m45_35738_c1 | 3300050496 | Bacteria | 2764 |
| 777 | nmdc:mga05p37_1072532_c1 | 3300050507 | Unclassified | 847 |
| 778 | nmdc:mga05p37_128315_c1 | 3300050507 | Bacteria | 3113 |
| 779 | nmdc:mga05p37_16430_c1 | 3300050507 | Bacteria | 8918 |
| 780 | nmdc:mga05p37_17427_c1 | 3300050507 | Bacteria | 8669 |
| 781 | nmdc:mga05p37_181361_c1 | 3300050507 | Bacteria | 2561 |
| 782 | nmdc:mga05p37_36945_c1 | 3300050507 | Bacteria | 5991 |
| 783 | nmdc:mga05p37_464681_c1 | 3300050507 | Bacteria | 1461 |
| 784 | nmdc:mga09592_116016_c1 | 3300050508 | Bacteria | 2298 |
| 785 | nmdc:mga09592_119729_c1 | 3300050508 | Bacteria | 2261 |
| 786 | nmdc:mga09592_193971_c1 | 3300050508 | Bacteria | 1758 |
| 787 | nmdc:mga09592_757283_c1 | 3300050508 | Bacteria | 824 |
| 788 | nmdc:mga0qj67_1060069_c1 | 3300050509 | Unclassified | 634 |
| 789 | nmdc:mga0qj67_66287_c1 | 3300050509 | Bacteria | 2876 |
| 790 | nmdc:mga0qj67_713713_c1 | 3300050509 | Bacteria | 797 |
| 791 | nmdc:mga0qj67_85972_c1 | 3300050509 | Bacteria | 2523 |
| 792 | nmdc:mga06r32_1484305_c1 | 3300050510 | Unclassified | 618 |
| 793 | nmdc:mga06r32_20627_c1 | 3300050510 | Bacteria | 6070 |
| 794 | nmdc:mga06r32_572_c1 | 3300050510 | Bacteria | 32014 |
| 795 | nmdc:mga06r32_578803_c1 | 3300050510 | Bacteria | 1095 |
| 796 | nmdc:mga06r32_604454_c1 | 3300050510 | Bacteria | 1067 |
| 797 | nmdc:mga08y16_114314_c1 | 3300050511 | Unclassified | 2810 |
| 798 | nmdc:mga08y16_117724_c1 | 3300050511 | Bacteria | 2765 |
| 799 | nmdc:mga08y16_1363715_c1 | 3300050511 | Unclassified | 674 |
| 800 | nmdc:mga08y16_4466_c1 | 3300050511 | Bacteria | 14618 |
| 801 | nmdc:mga08y16_576945_c1 | 3300050511 | Bacteria | 1136 |
| 802 | nmdc:mga08y16_6186_c1 | 3300050511 | Bacteria | 12561 |
| 803 | nmdc:mga0n895_23728_c1 | 3300050512 | Bacteria | 5770 |
| 804 | nmdc:mga0n895_441881_c1 | 3300050512 | Unclassified | 1314 |
| 805 | nmdc:mga0n895_696469_c1 | 3300050512 | Bacteria | 1012 |
| 806 | nmdc:mga0n895_710305_c1 | 3300050512 | Bacteria | 1001 |
| 807 | nmdc:mga0n895_784385_c1 | 3300050512 | Bacteria | 944 |
| 808 | nmdc:mga0n895_94016_c1 | 3300050512 | Bacteria | 3001 |
| 809 | nmdc:mga0rr50_365612_c1 | 3300050513 | Bacteria | 1215 |
| 810 | nmdc:mga0rr50_455605_c1 | 3300050513 | Bacteria | 1085 |
| 811 | nmdc:mga08x19_14234_c1 | 3300050514 | Unclassified | 4822 |
| 812 | nmdc:mga08x19_205403_c1 | 3300050514 | Unclassified | 1351 |
| 813 | nmdc:mga08x19_23637_c1 | 3300050514 | Unclassified | 3814 |
| 814 | nmdc:mga08x19_319717_c1 | 3300050514 | Unclassified | 1080 |
| 815 | nmdc:mga0a205_100493_c1 | 3300050515 | Bacteria | 2791 |
| 816 | nmdc:mga0a205_113170_c1 | 3300050515 | Bacteria | 2613 |
| 817 | nmdc:mga0a205_5039_c1 | 3300050515 | Bacteria | 11897 |
| 818 | nmdc:mga0a205_6643_c1 | 3300050515 | Bacteria | 6923 |
| 819 | Ga0500635_0005541 | 3300053080 | Bacteria | 3318 |
| 820 | Ga0495655_0041471 | 3300053083 | Bacteria | 1177 |
| 821 | Ga0495619_0182471 | 3300053085 | Unclassified | 1452 |
| 822 | Ga0500644_0000027 | 3300053088 | Bacteria | 92870 |
| 823 | Ga0500646_0030543 | 3300053090 | Bacteria | 1479 |
| 824 | Ga0500647_0157488 | 3300053091 | Bacteria | 1056 |
| 825 | Ga0500583_0046558 | 3300053092 | Bacteria | 1996 |
| 826 | Ga0500651_0254138 | 3300053093 | Bacteria | 1021 |
| 827 | Ga0500566_0064756 | 3300053094 | Bacteria | 2063 |
| 828 | Ga0500555_010682 | 3300053103 | Bacteria | 2635 |
| 829 | Ga0500562_000016 | 3300053108 | Bacteria | 131323 |
| 830 | Ga0500595_004150 | 3300053119 | Bacteria | 6568 |
| 831 | Ga0500595_019866 | 3300053119 | Bacteria | 2429 |
| 832 | Ga0500655_049980 | 3300053133 | Bacteria | 832 |
| 833 | Ga0500658_0002143 | 3300053134 | Bacteria | 7677 |
| 834 | Ga0500568_0013430 | 3300053139 | Bacteria | 3733 |
| 835 | Ga0500568_0189182 | 3300053139 | Bacteria | 756 |
| 836 | Ga0500573_0042324 | 3300053140 | Bacteria | 2630 |
| 837 | Ga0500590_000161 | 3300053148 | Bacteria | 19480 |
| 838 | Ga0500590_052882 | 3300053148 | Bacteria | 2060 |
| 839 | Ga0500603_005162 | 3300053150 | Bacteria | 2801 |
| 840 | Ga0500616_0013104 | 3300053153 | Unclassified | 4828 |
| 841 | Ga0500622_0139946 | 3300053156 | Unclassified | 1155 |
| 842 | Ga0500633_0000539 | 3300053160 | Bacteria | 6118 |
| 843 | Ga0500634_0131591 | 3300053161 | Bacteria | 1200 |
| 844 | Ga0500636_0064701 | 3300053177 | Bacteria | 2129 |
| 845 | Ga0500636_0076909 | 3300053177 | Bacteria | 1929 |
| 846 | Ga0500611_030026 | 3300053727 | Bacteria | 1117 |
| 847 | Ga0500596_022312 | 3300053735 | Bacteria | 956 |
| 848 | Ga0501084_0014970 | 3300054114 | Bacteria | 6430 |
| 849 | Ga0500661_004595 | 3300055283 | Bacteria | 2580 |
| 850 | Ga0501082_0004844 | 3300060353 | Bacteria | 11736 |
| 851 | Ga0501082_0005564 | 3300060353 | Bacteria | 10939 |
| 852 | Ga0501082_0020308 | 3300060353 | Bacteria | 5727 |
| 853 | Ga0501082_0260899 | 3300060353 | Bacteria | 1507 |
| 854 | Ga0501082_0342384 | 3300060353 | Bacteria | 1303 |
| 855 | Ga0501082_0376574 | 3300060353 | Unclassified | 1238 |
| 856 | Ga0501082_1340798 | 3300060353 | Bacteria | 625 |
| 857 | Ga0530510_0194767 | 3300061734 | Bacteria | 1505 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026118 | Ga0207675_100236365 | Ga0207675_1002363651 | 159 |
| 2 | 3300037471 | Ga0395905_1025507 | Ga0395905_1025507_63_554 | 160 |
| 3 | 3300044712 | Ga0453684_0775695 | Ga0453684_0775695_476_973 | 160 |
| 4 | 3300049592 | Ga0501076_0945888 | Ga0501076_0945888_209_700 | 160 |
| 5 | 3300050494 | nmdc:mga06z11_510447_c1 | nmdc:mga06z11_510447_c1_13_504 | 160 |
| 6 | 3300026089 | Ga0207648_10279704 | Ga0207648_102797041 | 161 |
| 7 | 3300035241 | Ga0373961_0153734 | Ga0373961_0153734_33_527 | 161 |
| 8 | 3300048904 | Ga0496101_0349801 | Ga0496101_0349801_644_1138 | 161 |
| 9 | 3300048920 | Ga0496117_0522459 | Ga0496117_0522459_58_552 | 161 |
| 10 | 3300049587 | Ga0501071_1470691 | Ga0501071_1470691_10_513 | 161 |
| 11 | 3300050509 | nmdc:mga0qj67_1060069_c1 | nmdc:mga0qj67_1060069_c1_121_621 | 161 |
| 12 | 3300050512 | nmdc:mga0n895_784385_c1 | nmdc:mga0n895_784385_c1_51_551 | 161 |
| 13 | 3300060353 | Ga0501082_1340798 | Ga0501082_1340798_11_514 | 161 |
| 14 | 3300014969 | Ga0157376_10307673 | Ga0157376_103076732 | 162 |
| 15 | 3300050511 | nmdc:mga08y16_576945_c1 | nmdc:mga08y16_576945_c1_614_1126 | 166 |
| 16 | 3300005330 | Ga0070690_100345247 | Ga0070690_1003452472 | 170 |
| 17 | iso_pu_bacteria | 2883068021 | 2883071284 | 172 |
| 18 | 3300005336 | Ga0070680_100238817 | Ga0070680_1002388172 | 173 |
| 19 | 3300005344 | Ga0070661_100063225 | Ga0070661_1000632251 | 173 |
| 20 | 3300005458 | Ga0070681_10015651 | Ga0070681_100156511 | 173 |
| 21 | 3300005530 | Ga0070679_100095719 | Ga0070679_1000957192 | 173 |
| 22 | 3300005539 | Ga0068853_100020681 | Ga0068853_1000206815 | 173 |
| 23 | 3300005577 | Ga0068857_100094474 | Ga0068857_1000944742 | 173 |
| 24 | 3300013307 | Ga0157372_10054725 | Ga0157372_100547252 | 173 |
| 25 | 3300025912 | Ga0207707_10112755 | Ga0207707_101127553 | 173 |
| 26 | 3300025920 | Ga0207649_10230885 | Ga0207649_102308851 | 173 |
| 27 | 3300025949 | Ga0207667_10955404 | Ga0207667_109554041 | 173 |
| 28 | 3300026041 | Ga0207639_10404437 | Ga0207639_104044372 | 173 |
| 29 | 3300026067 | Ga0207678_10442456 | Ga0207678_104424561 | 173 |
| 30 | 3300026116 | Ga0207674_10093844 | Ga0207674_100938442 | 173 |
| 31 | 3300050510 | nmdc:mga06r32_1484305_c1 | nmdc:mga06r32_1484305_c1_38_586 | 173 |
| 32 | 3300005435 | Ga0070714_100002872 | Ga0070714_1000028728 | 174 |
| 33 | 3300049572 | Ga0501036_0074907 | Ga0501036_0074907_791_1324 | 174 |
| 34 | 3300049579 | Ga0501043_0303286 | Ga0501043_0303286_26_553 | 174 |
| 35 | 3300049592 | Ga0501076_0021485 | Ga0501076_0021485_2095_2628 | 174 |
| 36 | 3300049742 | Ga0501080_0615792 | Ga0501080_0615792_96_629 | 174 |
| 37 | 3300049743 | Ga0501081_0060404 | Ga0501081_0060404_810_1343 | 174 |
| 38 | 3300049822 | Ga0501035_0713565 | Ga0501035_0713565_102_635 | 174 |
| 39 | 3300053094 | Ga0500566_0064756 | Ga0500566_0064756_1513_2046 | 174 |
| 40 | 3300053119 | Ga0500595_019866 | Ga0500595_019866_14_547 | 174 |
| 41 | 3300060353 | Ga0501082_0342384 | Ga0501082_0342384_295_828 | 174 |
| 42 | 3300006237 | Ga0097621_100353586 | Ga0097621_1003535862 | 175 |
| 43 | 3300007788 | Ga0099795_10011963 | Ga0099795_100119632 | 175 |
| 44 | 3300053119 | Ga0500595_004150 | Ga0500595_004150_119_661 | 175 |
| 45 | 3300048910 | Ga0496107_0468620 | Ga0496107_0468620_270_824 | 176 |
| 46 | 3300048917 | Ga0496114_0010721 | Ga0496114_0010721_3957_4511 | 176 |
| 47 | 3300014325 | Ga0163163_10033211 | Ga0163163_100332114 | 177 |
| 48 | 3300036401 | Ga0373937_0744054 | Ga0373937_0744054_227_784 | 177 |
| 49 | 3300049668 | Ga0501233_004341 | Ga0501233_004341_223_771 | 177 |
| 50 | 3300049704 | Ga0501221_037828 | Ga0501221_037828_245_793 | 177 |
| 51 | 3300009147 | Ga0114129_10033620 | Ga0114129_100336208 | 178 |
| 52 | 3300009174 | Ga0105241_10171289 | Ga0105241_101712893 | 178 |
| 53 | 3300050507 | nmdc:mga05p37_17427_c1 | nmdc:mga05p37_17427_c1_5383_5928 | 178 |
| 54 | 3300050509 | nmdc:mga0qj67_66287_c1 | nmdc:mga0qj67_66287_c1_1204_1749 | 178 |
| 55 | 3300050510 | nmdc:mga06r32_20627_c1 | nmdc:mga06r32_20627_c1_4585_5130 | 178 |
| 56 | 3300053156 | Ga0500622_0139946 | Ga0500622_0139946_218_769 | 178 |
| 57 | iso_pu_bacteria | 2513237351 | 2514587098 | 178 |
| 58 | 3300005616 | Ga0068852_100918849 | Ga0068852_1009188491 | 179 |
| 59 | 3300013100 | Ga0157373_10531255 | Ga0157373_105312552 | 179 |
| 60 | 3300013306 | Ga0163162_10083053 | Ga0163162_100830535 | 179 |
| 61 | 3300013307 | Ga0157372_11088963 | Ga0157372_110889632 | 179 |
| 62 | 3300050508 | nmdc:mga09592_119729_c1 | nmdc:mga09592_119729_c1_896_1444 | 179 |
| 63 | 3300053088 | Ga0500644_0000027 | Ga0500644_0000027_53891_54448 | 179 |
| 64 | 3300053139 | Ga0500568_0013430 | Ga0500568_0013430_2723_3277 | 179 |
| 65 | 3300053160 | Ga0500633_0000539 | Ga0500633_0000539_5007_5564 | 179 |
| 66 | 3300053161 | Ga0500634_0131591 | Ga0500634_0131591_470_1027 | 179 |
| 67 | 3300061734 | Ga0530510_0194767 | Ga0530510_0194767_736_1287 | 179 |
| 68 | iso_pu_bacteria | 2513237138 | 2513868904 | 179 |
| 69 | iso_pu_bacteria | 2923556063 | 2923557466 | 179 |
| 70 | 3300005293 | Ga0065715_10102710 | Ga0065715_101027102 | 180 |
| 71 | 3300005546 | Ga0070696_100041264 | Ga0070696_1000412642 | 180 |
| 72 | 3300009147 | Ga0114129_10745361 | Ga0114129_107453611 | 180 |
| 73 | 3300013308 | Ga0157375_10330970 | Ga0157375_103309703 | 180 |
| 74 | 3300025910 | Ga0207684_11258556 | Ga0207684_112585561 | 180 |
| 75 | 3300044712 | Ga0453684_1154500 | Ga0453684_1154500_254_805 | 180 |
| 76 | 3300053090 | Ga0500646_0030543 | Ga0500646_0030543_59_619 | 180 |
| 77 | 3300053092 | Ga0500583_0046558 | Ga0500583_0046558_110_670 | 180 |
| 78 | 3300053093 | Ga0500651_0254138 | Ga0500651_0254138_311_871 | 180 |
| 79 | 3300053134 | Ga0500658_0002143 | Ga0500658_0002143_2820_3380 | 180 |
| 80 | 3300053153 | Ga0500616_0013104 | Ga0500616_0013104_2019_2579 | 180 |
| 81 | iso_pu_bacteria | 2929921140 | 2929927826 | 180 |
| 82 | 3300005328 | Ga0070676_10622773 | Ga0070676_106227731 | 181 |
| 83 | 3300005329 | Ga0070683_101315910 | Ga0070683_1013159102 | 181 |
| 84 | 3300005334 | Ga0068869_100065811 | Ga0068869_1000658112 | 181 |
| 85 | 3300005343 | Ga0070687_100399135 | Ga0070687_1003991351 | 181 |
| 86 | 3300005354 | Ga0070675_100045392 | Ga0070675_1000453924 | 181 |
| 87 | 3300005365 | Ga0070688_100689858 | Ga0070688_1006898582 | 181 |
| 88 | 3300005437 | Ga0070710_10221536 | Ga0070710_102215361 | 181 |
| 89 | 3300005458 | Ga0070681_10006494 | Ga0070681_100064941 | 181 |
| 90 | 3300005471 | Ga0070698_100438136 | Ga0070698_1004381362 | 181 |
| 91 | 3300005530 | Ga0070679_100002404 | Ga0070679_10000240412 | 181 |
| 92 | 3300005545 | Ga0070695_100361274 | Ga0070695_1003612741 | 181 |
| 93 | 3300005545 | Ga0070695_100959447 | Ga0070695_1009594471 | 181 |
| 94 | 3300005614 | Ga0068856_100234971 | Ga0068856_1002349711 | 181 |
| 95 | 3300006852 | Ga0075433_10043130 | Ga0075433_100431304 | 181 |
| 96 | 3300006871 | Ga0075434_100012547 | Ga0075434_1000125472 | 181 |
| 97 | 3300007076 | Ga0075435_100253936 | Ga0075435_1002539363 | 181 |
| 98 | 3300009098 | Ga0105245_10140817 | Ga0105245_101408172 | 181 |
| 99 | 3300009098 | Ga0105245_10838736 | Ga0105245_108387361 | 181 |
| 100 | 3300009101 | Ga0105247_10766834 | Ga0105247_107668341 | 181 |
| 101 | 3300009147 | Ga0114129_10056972 | Ga0114129_100569724 | 181 |
| 102 | 3300009177 | Ga0105248_11230859 | Ga0105248_112308592 | 181 |
| 103 | 3300013297 | Ga0157378_10158261 | Ga0157378_101582612 | 181 |
| 104 | 3300025912 | Ga0207707_10002368 | Ga0207707_100023681 | 181 |
| 105 | 3300025917 | Ga0207660_10004660 | Ga0207660_100046601 | 181 |
| 106 | 3300025918 | Ga0207662_10143240 | Ga0207662_101432401 | 181 |
| 107 | 3300025921 | Ga0207652_10002131 | Ga0207652_100021311 | 181 |
| 108 | 3300025942 | Ga0207689_10035742 | Ga0207689_100357424 | 181 |
| 109 | 3300026041 | Ga0207639_10558588 | Ga0207639_105585882 | 181 |
| 110 | 3300026078 | Ga0207702_10128798 | Ga0207702_101287983 | 181 |
| 111 | 3300026078 | Ga0207702_11054546 | Ga0207702_110545461 | 181 |
| 112 | 3300028380 | Ga0268265_11026149 | Ga0268265_110261492 | 181 |
| 113 | 3300028381 | Ga0268264_10196321 | Ga0268264_101963212 | 181 |
| 114 | 3300031731 | Ga0307405_10005702 | Ga0307405_100057026 | 181 |
| 115 | 3300035086 | Ga0373934_0014118 | Ga0373934_0014118_2023_2577 | 181 |
| 116 | 3300035091 | Ga0373951_0048717 | Ga0373951_0048717_89_643 | 181 |
| 117 | 3300035118 | Ga0373954_0004315 | Ga0373954_0004315_5006_5560 | 181 |
| 118 | 3300035119 | Ga0373956_0004155 | Ga0373956_0004155_1916_2470 | 181 |
| 119 | 3300035172 | Ga0373955_0003273 | Ga0373955_0003273_6254_6808 | 181 |
| 120 | 3300035242 | Ga0373962_0014399 | Ga0373962_0014399_425_979 | 181 |
| 121 | 3300035724 | Ga0373933_0000809 | Ga0373933_0000809_2147_2701 | 181 |
| 122 | 3300036401 | Ga0373937_0023561 | Ga0373937_0023561_2843_3397 | 181 |
| 123 | 3300037471 | Ga0395905_0196637 | Ga0395905_0196637_271_831 | 181 |
| 124 | 3300038996 | Ga0242420_001992 | Ga0242420_001992_1450_2004 | 181 |
| 125 | 3300045976 | Ga0466967_0041955 | Ga0466967_0041955_3302_3898 | 181 |
| 126 | 3300046462 | Ga0495651_0248175 | Ga0495651_0248175_39_593 | 181 |
| 127 | 3300046511 | Ga0495608_0015603 | Ga0495608_0015603_4251_4805 | 181 |
| 128 | 3300046536 | Ga0495587_0023501 | Ga0495587_0023501_2022_2576 | 181 |
| 129 | 3300046679 | Ga0495623_0345045 | Ga0495623_0345045_242_796 | 181 |
| 130 | 3300047317 | Ga0495604_0177394 | Ga0495604_0177394_135_689 | 181 |
| 131 | 3300047471 | Ga0495684_0036290 | Ga0495684_0036290_2274_2828 | 181 |
| 132 | 3300048088 | Ga0495602_0256016 | Ga0495602_0256016_281_835 | 181 |
| 133 | 3300048909 | Ga0496106_0173155 | Ga0496106_0173155_32_589 | 181 |
| 134 | 3300048915 | Ga0496112_0104179 | Ga0496112_0104179_323_877 | 181 |
| 135 | 3300049665 | Ga0501227_000344 | Ga0501227_000344_2898_3458 | 181 |
| 136 | 3300050512 | nmdc:mga0n895_23728_c1 | nmdc:mga0n895_23728_c1_4641_5195 | 181 |
| 137 | 3300050512 | nmdc:mga0n895_441881_c1 | nmdc:mga0n895_441881_c1_82_675 | 181 |
| 138 | 3300050514 | nmdc:mga08x19_205403_c1 | nmdc:mga08x19_205403_c1_501_1055 | 181 |
| 139 | 3300050515 | nmdc:mga0a205_100493_c1 | nmdc:mga0a205_100493_c1_2029_2622 | 181 |
| 140 | 3300050515 | nmdc:mga0a205_5039_c1 | nmdc:mga0a205_5039_c1_10012_10566 | 181 |
| 141 | 3300053085 | Ga0495619_0182471 | Ga0495619_0182471_661_1215 | 181 |
| 142 | 2162886011 | MRS1b_contig_1457758 | MRS1b_0668.00001720 | 182 |
| 143 | 3300005293 | Ga0065715_10535115 | Ga0065715_105351152 | 182 |
| 144 | 3300005295 | Ga0065707_10085153 | Ga0065707_100851532 | 182 |
| 145 | 3300005334 | Ga0068869_100058187 | Ga0068869_1000581871 | 182 |
| 146 | 3300005336 | Ga0070680_100159804 | Ga0070680_1001598042 | 182 |
| 147 | 3300005338 | Ga0068868_100430259 | Ga0068868_1004302592 | 182 |
| 148 | 3300005339 | Ga0070660_100146524 | Ga0070660_1001465242 | 182 |
| 149 | 3300005340 | Ga0070689_100013281 | Ga0070689_1000132816 | 182 |
| 150 | 3300005340 | Ga0070689_100014255 | Ga0070689_1000142555 | 182 |
| 151 | 3300005340 | Ga0070689_100066066 | Ga0070689_1000660661 | 182 |
| 152 | 3300005343 | Ga0070687_100023879 | Ga0070687_1000238794 | 182 |
| 153 | 3300005344 | Ga0070661_100222342 | Ga0070661_1002223422 | 182 |
| 154 | 3300005353 | Ga0070669_100008417 | Ga0070669_1000084173 | 182 |
| 155 | 3300005354 | Ga0070675_100747262 | Ga0070675_1007472621 | 182 |
| 156 | 3300005354 | Ga0070675_100768187 | Ga0070675_1007681872 | 182 |
| 157 | 3300005355 | Ga0070671_100091747 | Ga0070671_1000917472 | 182 |
| 158 | 3300005364 | Ga0070673_100058928 | Ga0070673_1000589284 | 182 |
| 159 | 3300005365 | Ga0070688_100026143 | Ga0070688_1000261434 | 182 |
| 160 | 3300005366 | Ga0070659_100085296 | Ga0070659_1000852964 | 182 |
| 161 | 3300005434 | Ga0070709_10048099 | Ga0070709_100480992 | 182 |
| 162 | 3300005436 | Ga0070713_100214177 | Ga0070713_1002141772 | 182 |
| 163 | 3300005438 | Ga0070701_10033535 | Ga0070701_100335356 | 182 |
| 164 | 3300005441 | Ga0070700_100086926 | Ga0070700_1000869264 | 182 |
| 165 | 3300005444 | Ga0070694_100001335 | Ga0070694_10000133510 | 182 |
| 166 | 3300005445 | Ga0070708_100000951 | Ga0070708_1000009519 | 182 |
| 167 | 3300005457 | Ga0070662_100115953 | Ga0070662_1001159533 | 182 |
| 168 | 3300005458 | Ga0070681_10314381 | Ga0070681_103143812 | 182 |
| 169 | 3300005459 | Ga0068867_100053038 | Ga0068867_1000530382 | 182 |
| 170 | 3300005466 | Ga0070685_10587666 | Ga0070685_105876661 | 182 |
| 171 | 3300005468 | Ga0070707_100169578 | Ga0070707_1001695781 | 182 |
| 172 | 3300005468 | Ga0070707_100644683 | Ga0070707_1006446832 | 182 |
| 173 | 3300005539 | Ga0068853_100081779 | Ga0068853_1000817794 | 182 |
| 174 | 3300005539 | Ga0068853_100589117 | Ga0068853_1005891172 | 182 |
| 175 | 3300005544 | Ga0070686_100020224 | Ga0070686_1000202243 | 182 |
| 176 | 3300005544 | Ga0070686_100023906 | Ga0070686_1000239066 | 182 |
| 177 | 3300005545 | Ga0070695_100593796 | Ga0070695_1005937962 | 182 |
| 178 | 3300005546 | Ga0070696_100163955 | Ga0070696_1001639552 | 182 |
| 179 | 3300005547 | Ga0070693_100336860 | Ga0070693_1003368602 | 182 |
| 180 | 3300005547 | Ga0070693_100909727 | Ga0070693_1009097271 | 182 |
| 181 | 3300005563 | Ga0068855_100216748 | Ga0068855_1002167483 | 182 |
| 182 | 3300005564 | Ga0070664_100079666 | Ga0070664_1000796664 | 182 |
| 183 | 3300005577 | Ga0068857_100203850 | Ga0068857_1002038502 | 182 |
| 184 | 3300005577 | Ga0068857_100459325 | Ga0068857_1004593252 | 182 |
| 185 | 3300005577 | Ga0068857_100475697 | Ga0068857_1004756972 | 182 |
| 186 | 3300005617 | Ga0068859_100108729 | Ga0068859_1001087296 | 182 |
| 187 | 3300005618 | Ga0068864_100166319 | Ga0068864_1001663192 | 182 |
| 188 | 3300005618 | Ga0068864_100270917 | Ga0068864_1002709172 | 182 |
| 189 | 3300005719 | Ga0068861_100057010 | Ga0068861_1000570101 | 182 |
| 190 | 3300005843 | Ga0068860_101188173 | Ga0068860_1011881731 | 182 |
| 191 | 3300005937 | Ga0081455_10063362 | Ga0081455_100633623 | 182 |
| 192 | 3300006042 | Ga0075368_10033062 | Ga0075368_100330622 | 182 |
| 193 | 3300006042 | Ga0075368_10141447 | Ga0075368_101414471 | 182 |
| 194 | 3300006048 | Ga0075363_100154023 | Ga0075363_1001540232 | 182 |
| 195 | 3300006051 | Ga0075364_10196838 | Ga0075364_101968382 | 182 |
| 196 | 3300006177 | Ga0075362_10121034 | Ga0075362_101210342 | 182 |
| 197 | 3300006178 | Ga0075367_10097229 | Ga0075367_100972292 | 182 |
| 198 | 3300006195 | Ga0075366_10020978 | Ga0075366_100209784 | 182 |
| 199 | 3300006195 | Ga0075366_10028692 | Ga0075366_100286922 | 182 |
| 200 | 3300006195 | Ga0075366_10076286 | Ga0075366_100762862 | 182 |
| 201 | 3300006353 | Ga0075370_10024452 | Ga0075370_100244522 | 182 |
| 202 | 3300006844 | Ga0075428_100020430 | Ga0075428_1000204302 | 182 |
| 203 | 3300006844 | Ga0075428_100137915 | Ga0075428_1001379152 | 182 |
| 204 | 3300006846 | Ga0075430_100063554 | Ga0075430_1000635544 | 182 |
| 205 | 3300006847 | Ga0075431_100005633 | Ga0075431_1000056338 | 182 |
| 206 | 3300006852 | Ga0075433_10049158 | Ga0075433_100491585 | 182 |
| 207 | 3300006852 | Ga0075433_10307498 | Ga0075433_103074982 | 182 |
| 208 | 3300006852 | Ga0075433_10874300 | Ga0075433_108743001 | 182 |
| 209 | 3300006871 | Ga0075434_100095942 | Ga0075434_1000959422 | 182 |
| 210 | 3300006871 | Ga0075434_100138359 | Ga0075434_1001383592 | 182 |
| 211 | 3300006880 | Ga0075429_100080733 | Ga0075429_1000807334 | 182 |
| 212 | 3300006880 | Ga0075429_100159128 | Ga0075429_1001591283 | 182 |
| 213 | 3300006880 | Ga0075429_100205693 | Ga0075429_1002056931 | 182 |
| 214 | 3300006931 | Ga0097620_100108725 | Ga0097620_1001087252 | 182 |
| 215 | 3300007076 | Ga0075435_100002704 | Ga0075435_1000027049 | 182 |
| 216 | 3300009094 | Ga0111539_10225630 | Ga0111539_102256304 | 182 |
| 217 | 3300009147 | Ga0114129_10038702 | Ga0114129_100387024 | 182 |
| 218 | 3300009177 | Ga0105248_10026278 | Ga0105248_100262787 | 182 |
| 219 | 3300009177 | Ga0105248_10097715 | Ga0105248_100977152 | 182 |
| 220 | 3300009177 | Ga0105248_10500947 | Ga0105248_105009471 | 182 |
| 221 | 3300010375 | Ga0105239_11777807 | Ga0105239_117778071 | 182 |
| 222 | 3300013308 | Ga0157375_10446839 | Ga0157375_104468392 | 182 |
| 223 | 3300014325 | Ga0163163_10204742 | Ga0163163_102047423 | 182 |
| 224 | 3300014326 | Ga0157380_10408380 | Ga0157380_104083802 | 182 |
| 225 | 3300025906 | Ga0207699_10026434 | Ga0207699_100264344 | 182 |
| 226 | 3300025917 | Ga0207660_10209111 | Ga0207660_102091113 | 182 |
| 227 | 3300025918 | Ga0207662_10052620 | Ga0207662_100526202 | 182 |
| 228 | 3300025920 | Ga0207649_10059601 | Ga0207649_100596014 | 182 |
| 229 | 3300025922 | Ga0207646_10062119 | Ga0207646_100621192 | 182 |
| 230 | 3300025926 | Ga0207659_10503974 | Ga0207659_105039741 | 182 |
| 231 | 3300025928 | Ga0207700_10050625 | Ga0207700_100506252 | 182 |
| 232 | 3300025931 | Ga0207644_10019146 | Ga0207644_100191463 | 182 |
| 233 | 3300025932 | Ga0207690_10336154 | Ga0207690_103361542 | 182 |
| 234 | 3300025933 | Ga0207706_10021936 | Ga0207706_100219366 | 182 |
| 235 | 3300025936 | Ga0207670_10451227 | Ga0207670_104512272 | 182 |
| 236 | 3300025939 | Ga0207665_10034350 | Ga0207665_100343502 | 182 |
| 237 | 3300025941 | Ga0207711_10168238 | Ga0207711_101682382 | 182 |
| 238 | 3300025941 | Ga0207711_10384869 | Ga0207711_103848692 | 182 |
| 239 | 3300025941 | Ga0207711_10429799 | Ga0207711_104297991 | 182 |
| 240 | 3300025942 | Ga0207689_10039547 | Ga0207689_100395476 | 182 |
| 241 | 3300025942 | Ga0207689_10260168 | Ga0207689_102601682 | 182 |
| 242 | 3300025942 | Ga0207689_10785132 | Ga0207689_107851322 | 182 |
| 243 | 3300025945 | Ga0207679_10093635 | Ga0207679_100936353 | 182 |
| 244 | 3300025949 | Ga0207667_10189220 | Ga0207667_101892204 | 182 |
| 245 | 3300025960 | Ga0207651_10086667 | Ga0207651_100866671 | 182 |
| 246 | 3300026035 | Ga0207703_10093141 | Ga0207703_100931411 | 182 |
| 247 | 3300026041 | Ga0207639_10120883 | Ga0207639_101208832 | 182 |
| 248 | 3300026041 | Ga0207639_10134472 | Ga0207639_101344723 | 182 |
| 249 | 3300026075 | Ga0207708_10073706 | Ga0207708_100737062 | 182 |
| 250 | 3300026078 | Ga0207702_10212614 | Ga0207702_102126144 | 182 |
| 251 | 3300026088 | Ga0207641_10189127 | Ga0207641_101891272 | 182 |
| 252 | 3300026089 | Ga0207648_10232089 | Ga0207648_102320891 | 182 |
| 253 | 3300026095 | Ga0207676_10376477 | Ga0207676_103764772 | 182 |
| 254 | 3300026116 | Ga0207674_10173162 | Ga0207674_101731624 | 182 |
| 255 | 3300026116 | Ga0207674_10236182 | Ga0207674_102361823 | 182 |
| 256 | 3300026116 | Ga0207674_10479225 | Ga0207674_104792252 | 182 |
| 257 | 3300026116 | Ga0207674_11225739 | Ga0207674_112257391 | 182 |
| 258 | 3300026118 | Ga0207675_100011414 | Ga0207675_1000114141 | 182 |
| 259 | 3300026142 | Ga0207698_10169642 | Ga0207698_101696424 | 182 |
| 260 | 3300027866 | Ga0209813_10124682 | Ga0209813_101246822 | 182 |
| 261 | 3300027866 | Ga0209813_10274063 | Ga0209813_102740631 | 182 |
| 262 | 3300031507 | Ga0307509_10134566 | Ga0307509_101345662 | 182 |
| 263 | 3300031730 | Ga0307516_10351299 | Ga0307516_103512992 | 182 |
| 264 | 3300032002 | Ga0307416_101603016 | Ga0307416_1016030162 | 182 |
| 265 | 3300035086 | Ga0373934_0074528 | Ga0373934_0074528_316_879 | 182 |
| 266 | 3300035172 | Ga0373955_0079239 | Ga0373955_0079239_202_765 | 182 |
| 267 | 3300035410 | Ga0373924_0091050 | Ga0373924_0091050_74_637 | 182 |
| 268 | 3300037466 | Ga0395898_0864815 | Ga0395898_0864815_121_678 | 182 |
| 269 | 3300038443 | Ga0395901_0546109 | Ga0395901_0546109_404_967 | 182 |
| 270 | 3300041443 | Ga0451789_0643364 | Ga0451789_0643364_539_1096 | 182 |
| 271 | 3300041452 | Ga0451793_0666774 | Ga0451793_0666774_64_621 | 182 |
| 272 | 3300044694 | Ga0466963_0004899 | Ga0466963_0004899_7180_7776 | 182 |
| 273 | 3300044842 | Ga0466957_0017882 | Ga0466957_0017882_2187_2783 | 182 |
| 274 | 3300045051 | Ga0451576_0104032 | Ga0451576_0104032_1290_1859 | 182 |
| 275 | 3300045051 | Ga0451576_0144528 | Ga0451576_0144528_1361_1939 | 182 |
| 276 | 3300045836 | Ga0466958_0037410 | Ga0466958_0037410_1686_2285 | 182 |
| 277 | 3300046459 | Ga0495629_0026281 | Ga0495629_0026281_379_942 | 182 |
| 278 | 3300046472 | Ga0495580_0001866 | Ga0495580_0001866_12260_12817 | 182 |
| 279 | 3300046473 | Ga0495582_0001408 | Ga0495582_0001408_6322_6879 | 182 |
| 280 | 3300046473 | Ga0495582_0063020 | Ga0495582_0063020_994_1557 | 182 |
| 281 | 3300046475 | Ga0495639_0030136 | Ga0495639_0030136_197_760 | 182 |
| 282 | 3300046477 | Ga0495664_0246852 | Ga0495664_0246852_280_843 | 182 |
| 283 | 3300046517 | Ga0495630_0595865 | Ga0495630_0595865_136_699 | 182 |
| 284 | 3300046535 | Ga0495586_0041739 | Ga0495586_0041739_1387_1950 | 182 |
| 285 | 3300046536 | Ga0495587_0563753 | Ga0495587_0563753_53_616 | 182 |
| 286 | 3300046543 | Ga0495645_0151926 | Ga0495645_0151926_415_978 | 182 |
| 287 | 3300046689 | Ga0495613_0455208 | Ga0495613_0455208_151_714 | 182 |
| 288 | 3300047319 | Ga0495674_0015352 | Ga0495674_0015352_1338_1901 | 182 |
| 289 | 3300047322 | Ga0495680_0150730 | Ga0495680_0150730_378_941 | 182 |
| 290 | 3300049571 | Ga0501034_0017005 | Ga0501034_0017005_2957_3520 | 182 |
| 291 | 3300049573 | Ga0501037_0299833 | Ga0501037_0299833_78_641 | 182 |
| 292 | 3300049580 | Ga0501046_0049736 | Ga0501046_0049736_2499_3062 | 182 |
| 293 | 3300049581 | Ga0501047_0024643 | Ga0501047_0024643_631_1194 | 182 |
| 294 | 3300049583 | Ga0501067_0168459 | Ga0501067_0168459_122_685 | 182 |
| 295 | 3300049584 | Ga0501068_0216293 | Ga0501068_0216293_544_1107 | 182 |
| 296 | 3300049587 | Ga0501071_1004554 | Ga0501071_1004554_43_609 | 182 |
| 297 | 3300049589 | Ga0501073_0000939 | Ga0501073_0000939_13350_13913 | 182 |
| 298 | 3300049742 | Ga0501080_0006766 | Ga0501080_0006766_6497_7060 | 182 |
| 299 | 3300049743 | Ga0501081_0313634 | Ga0501081_0313634_361_918 | 182 |
| 300 | 3300049823 | Ga0501044_0023212 | Ga0501044_0023212_5638_6201 | 182 |
| 301 | 3300050491 | nmdc:mga00v17_71326_c1 | nmdc:mga00v17_71326_c1_192_749 | 182 |
| 302 | 3300050493 | nmdc:mga0k408_152975_c1 | nmdc:mga0k408_152975_c1_494_1051 | 182 |
| 303 | 3300050493 | nmdc:mga0k408_15687_c1 | nmdc:mga0k408_15687_c1_2186_2743 | 182 |
| 304 | 3300050493 | nmdc:mga0k408_204207_c1 | nmdc:mga0k408_204207_c1_329_886 | 182 |
| 305 | 3300050494 | nmdc:mga06z11_338229_c1 | nmdc:mga06z11_338229_c1_127_684 | 182 |
| 306 | 3300050495 | nmdc:mga04h51_111939_c1 | nmdc:mga04h51_111939_c1_250_807 | 182 |
| 307 | 3300050495 | nmdc:mga04h51_41577_c1 | nmdc:mga04h51_41577_c1_904_1461 | 182 |
| 308 | 3300050495 | nmdc:mga04h51_87458_c1 | nmdc:mga04h51_87458_c1_26_583 | 182 |
| 309 | 3300050496 | nmdc:mga07m45_35738_c1 | nmdc:mga07m45_35738_c1_771_1328 | 182 |
| 310 | 3300050507 | nmdc:mga05p37_128315_c1 | nmdc:mga05p37_128315_c1_286_846 | 182 |
| 311 | 3300050508 | nmdc:mga09592_757283_c1 | nmdc:mga09592_757283_c1_149_709 | 182 |
| 312 | 3300050510 | nmdc:mga06r32_604454_c1 | nmdc:mga06r32_604454_c1_413_973 | 182 |
| 313 | 3300050511 | nmdc:mga08y16_117724_c1 | nmdc:mga08y16_117724_c1_1123_1692 | 182 |
| 314 | 3300050512 | nmdc:mga0n895_696469_c1 | nmdc:mga0n895_696469_c1_120_683 | 182 |
| 315 | 3300050512 | nmdc:mga0n895_94016_c1 | nmdc:mga0n895_94016_c1_1533_2090 | 182 |
| 316 | 3300050513 | nmdc:mga0rr50_365612_c1 | nmdc:mga0rr50_365612_c1_465_1082 | 182 |
| 317 | 3300050514 | nmdc:mga08x19_14234_c1 | nmdc:mga08x19_14234_c1_990_1550 | 182 |
| 318 | 3300050515 | nmdc:mga0a205_113170_c1 | nmdc:mga0a205_113170_c1_960_1577 | 182 |
| 319 | 3300050515 | nmdc:mga0a205_6643_c1 | nmdc:mga0a205_6643_c1_363_923 | 182 |
| 320 | 3300053727 | Ga0500611_030026 | Ga0500611_030026_338_895 | 182 |
| 321 | 3300060353 | Ga0501082_0020308 | Ga0501082_0020308_5029_5595 | 182 |
| 322 | 3300060353 | Ga0501082_0376574 | Ga0501082_0376574_558_1121 | 182 |
| 323 | 2162886012 | MBSR1b_contig_3044804 | MBSR1b_0295.00000770 | 183 |
| 324 | 3300001979 | JGI24740J21852_10067119 | JGI24740J21852_100671192 | 183 |
| 325 | 3300004801 | Ga0058860_11931095 | Ga0058860_119310951 | 183 |
| 326 | 3300005289 | Ga0065704_10237945 | Ga0065704_102379452 | 183 |
| 327 | 3300005293 | Ga0065715_10139316 | Ga0065715_101393162 | 183 |
| 328 | 3300005295 | Ga0065707_10002593 | Ga0065707_100025938 | 183 |
| 329 | 3300005295 | Ga0065707_10098721 | Ga0065707_100987213 | 183 |
| 330 | 3300005328 | Ga0070676_10424359 | Ga0070676_104243592 | 183 |
| 331 | 3300005329 | Ga0070683_100009138 | Ga0070683_10000913811 | 183 |
| 332 | 3300005330 | Ga0070690_100044822 | Ga0070690_1000448223 | 183 |
| 333 | 3300005330 | Ga0070690_100087543 | Ga0070690_1000875432 | 183 |
| 334 | 3300005333 | Ga0070677_10045036 | Ga0070677_100450362 | 183 |
| 335 | 3300005334 | Ga0068869_100004191 | Ga0068869_1000041914 | 183 |
| 336 | 3300005334 | Ga0068869_100034587 | Ga0068869_1000345871 | 183 |
| 337 | 3300005334 | Ga0068869_100567355 | Ga0068869_1005673552 | 183 |
| 338 | 3300005334 | Ga0068869_100786774 | Ga0068869_1007867741 | 183 |
| 339 | 3300005336 | Ga0070680_100004972 | Ga0070680_1000049723 | 183 |
| 340 | 3300005336 | Ga0070680_100066004 | Ga0070680_1000660041 | 183 |
| 341 | 3300005336 | Ga0070680_100148885 | Ga0070680_1001488852 | 183 |
| 342 | 3300005336 | Ga0070680_100463223 | Ga0070680_1004632232 | 183 |
| 343 | 3300005337 | Ga0070682_100194929 | Ga0070682_1001949292 | 183 |
| 344 | 3300005338 | Ga0068868_100007011 | Ga0068868_1000070118 | 183 |
| 345 | 3300005338 | Ga0068868_100037370 | Ga0068868_1000373702 | 183 |
| 346 | 3300005340 | Ga0070689_100782599 | Ga0070689_1007825991 | 183 |
| 347 | 3300005343 | Ga0070687_100361891 | Ga0070687_1003618911 | 183 |
| 348 | 3300005343 | Ga0070687_100559702 | Ga0070687_1005597021 | 183 |
| 349 | 3300005347 | Ga0070668_100120975 | Ga0070668_1001209752 | 183 |
| 350 | 3300005353 | Ga0070669_100756203 | Ga0070669_1007562032 | 183 |
| 351 | 3300005354 | Ga0070675_100261089 | Ga0070675_1002610891 | 183 |
| 352 | 3300005354 | Ga0070675_101170015 | Ga0070675_1011700151 | 183 |
| 353 | 3300005355 | Ga0070671_100130150 | Ga0070671_1001301502 | 183 |
| 354 | 3300005356 | Ga0070674_100016743 | Ga0070674_1000167434 | 183 |
| 355 | 3300005364 | Ga0070673_100026710 | Ga0070673_1000267103 | 183 |
| 356 | 3300005365 | Ga0070688_100354772 | Ga0070688_1003547721 | 183 |
| 357 | 3300005366 | Ga0070659_100154355 | Ga0070659_1001543552 | 183 |
| 358 | 3300005367 | Ga0070667_100460308 | Ga0070667_1004603082 | 183 |
| 359 | 3300005406 | Ga0070703_10038315 | Ga0070703_100383152 | 183 |
| 360 | 3300005434 | Ga0070709_10058639 | Ga0070709_100586393 | 183 |
| 361 | 3300005434 | Ga0070709_10279951 | Ga0070709_102799512 | 183 |
| 362 | 3300005435 | Ga0070714_100800072 | Ga0070714_1008000722 | 183 |
| 363 | 3300005436 | Ga0070713_100034050 | Ga0070713_1000340506 | 183 |
| 364 | 3300005436 | Ga0070713_100442732 | Ga0070713_1004427322 | 183 |
| 365 | 3300005437 | Ga0070710_10008415 | Ga0070710_100084155 | 183 |
| 366 | 3300005437 | Ga0070710_10583425 | Ga0070710_105834252 | 183 |
| 367 | 3300005438 | Ga0070701_10004414 | Ga0070701_100044144 | 183 |
| 368 | 3300005439 | Ga0070711_100037487 | Ga0070711_1000374874 | 183 |
| 369 | 3300005439 | Ga0070711_100669151 | Ga0070711_1006691512 | 183 |
| 370 | 3300005440 | Ga0070705_100011137 | Ga0070705_1000111374 | 183 |
| 371 | 3300005440 | Ga0070705_100210433 | Ga0070705_1002104331 | 183 |
| 372 | 3300005440 | Ga0070705_100624481 | Ga0070705_1006244811 | 183 |
| 373 | 3300005441 | Ga0070700_100004458 | Ga0070700_1000044584 | 183 |
| 374 | 3300005444 | Ga0070694_100059208 | Ga0070694_1000592082 | 183 |
| 375 | 3300005444 | Ga0070694_100387644 | Ga0070694_1003876442 | 183 |
| 376 | 3300005445 | Ga0070708_100520621 | Ga0070708_1005206211 | 183 |
| 377 | 3300005455 | Ga0070663_100045123 | Ga0070663_1000451232 | 183 |
| 378 | 3300005456 | Ga0070678_100825390 | Ga0070678_1008253902 | 183 |
| 379 | 3300005457 | Ga0070662_100925767 | Ga0070662_1009257671 | 183 |
| 380 | 3300005458 | Ga0070681_10006425 | Ga0070681_100064253 | 183 |
| 381 | 3300005458 | Ga0070681_10015673 | Ga0070681_100156736 | 183 |
| 382 | 3300005458 | Ga0070681_10046173 | Ga0070681_100461733 | 183 |
| 383 | 3300005459 | Ga0068867_100000114 | Ga0068867_10000011434 | 183 |
| 384 | 3300005459 | Ga0068867_100826408 | Ga0068867_1008264081 | 183 |
| 385 | 3300005459 | Ga0068867_101128114 | Ga0068867_1011281141 | 183 |
| 386 | 3300005466 | Ga0070685_10010931 | Ga0070685_100109313 | 183 |
| 387 | 3300005466 | Ga0070685_10097452 | Ga0070685_100974522 | 183 |
| 388 | 3300005466 | Ga0070685_10196190 | Ga0070685_101961902 | 183 |
| 389 | 3300005467 | Ga0070706_100544990 | Ga0070706_1005449902 | 183 |
| 390 | 3300005467 | Ga0070706_101109142 | Ga0070706_1011091421 | 183 |
| 391 | 3300005471 | Ga0070698_100064580 | Ga0070698_1000645805 | 183 |
| 392 | 3300005471 | Ga0070698_100073836 | Ga0070698_1000738362 | 183 |
| 393 | 3300005518 | Ga0070699_100000102 | Ga0070699_10000010225 | 183 |
| 394 | 3300005518 | Ga0070699_100000130 | Ga0070699_10000013062 | 183 |
| 395 | 3300005530 | Ga0070679_100023383 | Ga0070679_1000233833 | 183 |
| 396 | 3300005530 | Ga0070679_100029436 | Ga0070679_1000294364 | 183 |
| 397 | 3300005535 | Ga0070684_100404805 | Ga0070684_1004048052 | 183 |
| 398 | 3300005535 | Ga0070684_100825687 | Ga0070684_1008256872 | 183 |
| 399 | 3300005536 | Ga0070697_100016863 | Ga0070697_1000168635 | 183 |
| 400 | 3300005536 | Ga0070697_100227796 | Ga0070697_1002277962 | 183 |
| 401 | 3300005539 | Ga0068853_100041079 | Ga0068853_1000410793 | 183 |
| 402 | 3300005539 | Ga0068853_100467037 | Ga0068853_1004670373 | 183 |
| 403 | 3300005539 | Ga0068853_100501739 | Ga0068853_1005017392 | 183 |
| 404 | 3300005539 | Ga0068853_100623741 | Ga0068853_1006237412 | 183 |
| 405 | 3300005543 | Ga0070672_100290187 | Ga0070672_1002901871 | 183 |
| 406 | 3300005543 | Ga0070672_100525547 | Ga0070672_1005255472 | 183 |
| 407 | 3300005543 | Ga0070672_100637722 | Ga0070672_1006377222 | 183 |
| 408 | 3300005544 | Ga0070686_100070115 | Ga0070686_1000701153 | 183 |
| 409 | 3300005544 | Ga0070686_100159154 | Ga0070686_1001591542 | 183 |
| 410 | 3300005545 | Ga0070695_100024050 | Ga0070695_1000240504 | 183 |
| 411 | 3300005545 | Ga0070695_100143627 | Ga0070695_1001436272 | 183 |
| 412 | 3300005545 | Ga0070695_100249454 | Ga0070695_1002494542 | 183 |
| 413 | 3300005546 | Ga0070696_100000006 | Ga0070696_10000000667 | 183 |
| 414 | 3300005546 | Ga0070696_100003610 | Ga0070696_10000361014 | 183 |
| 415 | 3300005546 | Ga0070696_100032695 | Ga0070696_1000326954 | 183 |
| 416 | 3300005547 | Ga0070693_100025833 | Ga0070693_1000258331 | 183 |
| 417 | 3300005547 | Ga0070693_100047393 | Ga0070693_1000473936 | 183 |
| 418 | 3300005548 | Ga0070665_100927906 | Ga0070665_1009279062 | 183 |
| 419 | 3300005548 | Ga0070665_101214153 | Ga0070665_1012141532 | 183 |
| 420 | 3300005549 | Ga0070704_100036617 | Ga0070704_1000366172 | 183 |
| 421 | 3300005549 | Ga0070704_100072347 | Ga0070704_1000723474 | 183 |
| 422 | 3300005549 | Ga0070704_100226743 | Ga0070704_1002267432 | 183 |
| 423 | 3300005549 | Ga0070704_100311582 | Ga0070704_1003115822 | 183 |
| 424 | 3300005563 | Ga0068855_100033773 | Ga0068855_1000337732 | 183 |
| 425 | 3300005563 | Ga0068855_100065135 | Ga0068855_1000651352 | 183 |
| 426 | 3300005563 | Ga0068855_100367506 | Ga0068855_1003675063 | 183 |
| 427 | 3300005564 | Ga0070664_101044808 | Ga0070664_1010448082 | 183 |
| 428 | 3300005577 | Ga0068857_100487508 | Ga0068857_1004875082 | 183 |
| 429 | 3300005577 | Ga0068857_100808111 | Ga0068857_1008081112 | 183 |
| 430 | 3300005577 | Ga0068857_100996426 | Ga0068857_1009964261 | 183 |
| 431 | 3300005578 | Ga0068854_100243930 | Ga0068854_1002439302 | 183 |
| 432 | 3300005614 | Ga0068856_100888201 | Ga0068856_1008882011 | 183 |
| 433 | 3300005614 | Ga0068856_100925705 | Ga0068856_1009257052 | 183 |
| 434 | 3300005614 | Ga0068856_100979151 | Ga0068856_1009791511 | 183 |
| 435 | 3300005615 | Ga0070702_100003115 | Ga0070702_1000031155 | 183 |
| 436 | 3300005616 | Ga0068852_100082275 | Ga0068852_1000822755 | 183 |
| 437 | 3300005616 | Ga0068852_100442994 | Ga0068852_1004429942 | 183 |
| 438 | 3300005617 | Ga0068859_100010567 | Ga0068859_10001056712 | 183 |
| 439 | 3300005617 | Ga0068859_100025922 | Ga0068859_1000259224 | 183 |
| 440 | 3300005617 | Ga0068859_100087090 | Ga0068859_1000870904 | 183 |
| 441 | 3300005617 | Ga0068859_100340688 | Ga0068859_1003406882 | 183 |
| 442 | 3300005617 | Ga0068859_100505304 | Ga0068859_1005053041 | 183 |
| 443 | 3300005617 | Ga0068859_100539606 | Ga0068859_1005396062 | 183 |
| 444 | 3300005618 | Ga0068864_100120927 | Ga0068864_1001209272 | 183 |
| 445 | 3300005719 | Ga0068861_100052540 | Ga0068861_1000525402 | 183 |
| 446 | 3300005719 | Ga0068861_100059661 | Ga0068861_1000596613 | 183 |
| 447 | 3300005719 | Ga0068861_100149715 | Ga0068861_1001497152 | 183 |
| 448 | 3300005719 | Ga0068861_100453965 | Ga0068861_1004539652 | 183 |
| 449 | 3300005719 | Ga0068861_100624753 | Ga0068861_1006247532 | 183 |
| 450 | 3300005840 | Ga0068870_10141504 | Ga0068870_101415042 | 183 |
| 451 | 3300005841 | Ga0068863_100025634 | Ga0068863_1000256343 | 183 |
| 452 | 3300005841 | Ga0068863_100083618 | Ga0068863_1000836182 | 183 |
| 453 | 3300005842 | Ga0068858_100005323 | Ga0068858_1000053235 | 183 |
| 454 | 3300005842 | Ga0068858_100190404 | Ga0068858_1001904042 | 183 |
| 455 | 3300005842 | Ga0068858_100214554 | Ga0068858_1002145542 | 183 |
| 456 | 3300005843 | Ga0068860_100042231 | Ga0068860_1000422316 | 183 |
| 457 | 3300005843 | Ga0068860_100344486 | Ga0068860_1003444861 | 183 |
| 458 | 3300005844 | Ga0068862_100019134 | Ga0068862_1000191343 | 183 |
| 459 | 3300005844 | Ga0068862_100225180 | Ga0068862_1002251802 | 183 |
| 460 | 3300005844 | Ga0068862_100270282 | Ga0068862_1002702822 | 183 |
| 461 | 3300005844 | Ga0068862_100974861 | Ga0068862_1009748612 | 183 |
| 462 | 3300005937 | Ga0081455_10052558 | Ga0081455_100525586 | 183 |
| 463 | 3300005937 | Ga0081455_10221824 | Ga0081455_102218243 | 183 |
| 464 | 3300006028 | Ga0070717_10002431 | Ga0070717_100024316 | 183 |
| 465 | 3300006038 | Ga0075365_10049622 | Ga0075365_100496222 | 183 |
| 466 | 3300006042 | Ga0075368_10123184 | Ga0075368_101231841 | 183 |
| 467 | 3300006163 | Ga0070715_10002390 | Ga0070715_100023901 | 183 |
| 468 | 3300006163 | Ga0070715_10015014 | Ga0070715_100150143 | 183 |
| 469 | 3300006163 | Ga0070715_10097134 | Ga0070715_100971342 | 183 |
| 470 | 3300006173 | Ga0070716_100000050 | Ga0070716_10000005033 | 183 |
| 471 | 3300006173 | Ga0070716_100050088 | Ga0070716_1000500884 | 183 |
| 472 | 3300006175 | Ga0070712_100005798 | Ga0070712_1000057985 | 183 |
| 473 | 3300006178 | Ga0075367_10008892 | Ga0075367_100088924 | 183 |
| 474 | 3300006195 | Ga0075366_10000836 | Ga0075366_100008363 | 183 |
| 475 | 3300006195 | Ga0075366_10062559 | Ga0075366_100625594 | 183 |
| 476 | 3300006237 | Ga0097621_100440970 | Ga0097621_1004409702 | 183 |
| 477 | 3300006237 | Ga0097621_100462691 | Ga0097621_1004626912 | 183 |
| 478 | 3300006358 | Ga0068871_100668206 | Ga0068871_1006682062 | 183 |
| 479 | 3300006844 | Ga0075428_100004062 | Ga0075428_10000406215 | 183 |
| 480 | 3300006844 | Ga0075428_100010676 | Ga0075428_1000106768 | 183 |
| 481 | 3300006844 | Ga0075428_100160866 | Ga0075428_1001608662 | 183 |
| 482 | 3300006846 | Ga0075430_100045092 | Ga0075430_1000450924 | 183 |
| 483 | 3300006846 | Ga0075430_100258209 | Ga0075430_1002582091 | 183 |
| 484 | 3300006846 | Ga0075430_100294353 | Ga0075430_1002943532 | 183 |
| 485 | 3300006846 | Ga0075430_100824955 | Ga0075430_1008249552 | 183 |
| 486 | 3300006847 | Ga0075431_100001840 | Ga0075431_1000018406 | 183 |
| 487 | 3300006847 | Ga0075431_100589381 | Ga0075431_1005893812 | 183 |
| 488 | 3300006852 | Ga0075433_10952368 | Ga0075433_109523681 | 183 |
| 489 | 3300006871 | Ga0075434_100060267 | Ga0075434_1000602673 | 183 |
| 490 | 3300006880 | Ga0075429_100009961 | Ga0075429_1000099616 | 183 |
| 491 | 3300006880 | Ga0075429_100077418 | Ga0075429_1000774183 | 183 |
| 492 | 3300006880 | Ga0075429_100228423 | Ga0075429_1002284231 | 183 |
| 493 | 3300006881 | Ga0068865_100036003 | Ga0068865_1000360033 | 183 |
| 494 | 3300006914 | Ga0075436_100016913 | Ga0075436_1000169132 | 183 |
| 495 | 3300006914 | Ga0075436_100028074 | Ga0075436_1000280742 | 183 |
| 496 | 3300006931 | Ga0097620_100010568 | Ga0097620_1000105682 | 183 |
| 497 | 3300006931 | Ga0097620_100025922 | Ga0097620_1000259224 | 183 |
| 498 | 3300006931 | Ga0097620_100087090 | Ga0097620_1000870903 | 183 |
| 499 | 3300006931 | Ga0097620_100340689 | Ga0097620_1003406892 | 183 |
| 500 | 3300006931 | Ga0097620_100505320 | Ga0097620_1005053201 | 183 |
| 501 | 3300006931 | Ga0097620_100539502 | Ga0097620_1005395022 | 183 |
| 502 | 3300006931 | Ga0097620_101000804 | Ga0097620_1010008042 | 183 |
| 503 | 3300007076 | Ga0075435_100209216 | Ga0075435_1002092162 | 183 |
| 504 | 3300007265 | Ga0099794_10002520 | Ga0099794_100025204 | 183 |
| 505 | 3300009093 | Ga0105240_10018029 | Ga0105240_100180296 | 183 |
| 506 | 3300009093 | Ga0105240_10259156 | Ga0105240_102591562 | 183 |
| 507 | 3300009093 | Ga0105240_10934728 | Ga0105240_109347282 | 183 |
| 508 | 3300009094 | Ga0111539_10001106 | Ga0111539_1000110615 | 183 |
| 509 | 3300009094 | Ga0111539_10006798 | Ga0111539_100067985 | 183 |
| 510 | 3300009094 | Ga0111539_10015937 | Ga0111539_100159376 | 183 |
| 511 | 3300009094 | Ga0111539_10055371 | Ga0111539_100553715 | 183 |
| 512 | 3300009094 | Ga0111539_10345720 | Ga0111539_103457201 | 183 |
| 513 | 3300009098 | Ga0105245_10813838 | Ga0105245_108138382 | 183 |
| 514 | 3300009098 | Ga0105245_10853180 | Ga0105245_108531801 | 183 |
| 515 | 3300009098 | Ga0105245_11079299 | Ga0105245_110792992 | 183 |
| 516 | 3300009101 | Ga0105247_10136707 | Ga0105247_101367072 | 183 |
| 517 | 3300009101 | Ga0105247_10168770 | Ga0105247_101687701 | 183 |
| 518 | 3300009101 | Ga0105247_10385639 | Ga0105247_103856391 | 183 |
| 519 | 3300009147 | Ga0114129_10022328 | Ga0114129_100223283 | 183 |
| 520 | 3300009147 | Ga0114129_10819886 | Ga0114129_108198862 | 183 |
| 521 | 3300009148 | Ga0105243_10002335 | Ga0105243_1000233515 | 183 |
| 522 | 3300009148 | Ga0105243_10032181 | Ga0105243_100321813 | 183 |
| 523 | 3300009148 | Ga0105243_10321217 | Ga0105243_103212173 | 183 |
| 524 | 3300009148 | Ga0105243_10901333 | Ga0105243_109013332 | 183 |
| 525 | 3300009174 | Ga0105241_10042510 | Ga0105241_100425102 | 183 |
| 526 | 3300009174 | Ga0105241_10082704 | Ga0105241_100827045 | 183 |
| 527 | 3300009176 | Ga0105242_10842159 | Ga0105242_108421591 | 183 |
| 528 | 3300009176 | Ga0105242_11033056 | Ga0105242_110330562 | 183 |
| 529 | 3300009177 | Ga0105248_10059487 | Ga0105248_100594875 | 183 |
| 530 | 3300009177 | Ga0105248_10059823 | Ga0105248_100598232 | 183 |
| 531 | 3300009177 | Ga0105248_10079788 | Ga0105248_100797882 | 183 |
| 532 | 3300009177 | Ga0105248_10160862 | Ga0105248_101608624 | 183 |
| 533 | 3300009177 | Ga0105248_10194562 | Ga0105248_101945622 | 183 |
| 534 | 3300009177 | Ga0105248_11463628 | Ga0105248_114636282 | 183 |
| 535 | 3300009545 | Ga0105237_10008802 | Ga0105237_100088022 | 183 |
| 536 | 3300009545 | Ga0105237_10014774 | Ga0105237_100147744 | 183 |
| 537 | 3300009545 | Ga0105237_10087229 | Ga0105237_100872291 | 183 |
| 538 | 3300009545 | Ga0105237_10135980 | Ga0105237_101359805 | 183 |
| 539 | 3300009545 | Ga0105237_10259716 | Ga0105237_102597163 | 183 |
| 540 | 3300009545 | Ga0105237_10508024 | Ga0105237_105080241 | 183 |
| 541 | 3300009545 | Ga0105237_10630434 | Ga0105237_106304342 | 183 |
| 542 | 3300009545 | Ga0105237_11075172 | Ga0105237_110751722 | 183 |
| 543 | 3300009551 | Ga0105238_10001033 | Ga0105238_1000103322 | 183 |
| 544 | 3300009551 | Ga0105238_10919791 | Ga0105238_109197912 | 183 |
| 545 | 3300009553 | Ga0105249_10096507 | Ga0105249_100965072 | 183 |
| 546 | 3300009553 | Ga0105249_10235327 | Ga0105249_102353272 | 183 |
| 547 | 3300009553 | Ga0105249_10264288 | Ga0105249_102642882 | 183 |
| 548 | 3300009553 | Ga0105249_11935162 | Ga0105249_119351621 | 183 |
| 549 | 3300010159 | Ga0099796_10021539 | Ga0099796_100215393 | 183 |
| 550 | 3300010375 | Ga0105239_10009580 | Ga0105239_100095803 | 183 |
| 551 | 3300010375 | Ga0105239_10053633 | Ga0105239_100536332 | 183 |
| 552 | 3300010375 | Ga0105239_10164712 | Ga0105239_101647122 | 183 |
| 553 | 3300010375 | Ga0105239_10597350 | Ga0105239_105973503 | 183 |
| 554 | 3300010375 | Ga0105239_11550835 | Ga0105239_115508351 | 183 |
| 555 | 3300013100 | Ga0157373_10053968 | Ga0157373_100539684 | 183 |
| 556 | 3300013104 | Ga0157370_10069454 | Ga0157370_100694546 | 183 |
| 557 | 3300013105 | Ga0157369_10304643 | Ga0157369_103046432 | 183 |
| 558 | 3300013296 | Ga0157374_10001392 | Ga0157374_100013925 | 183 |
| 559 | 3300013296 | Ga0157374_11428631 | Ga0157374_114286311 | 183 |
| 560 | 3300013306 | Ga0163162_10319826 | Ga0163162_103198262 | 183 |
| 561 | 3300013306 | Ga0163162_10837848 | Ga0163162_108378481 | 183 |
| 562 | 3300013306 | Ga0163162_11976172 | Ga0163162_119761721 | 183 |
| 563 | 3300013307 | Ga0157372_11137886 | Ga0157372_111378862 | 183 |
| 564 | 3300013308 | Ga0157375_10028446 | Ga0157375_100284462 | 183 |
| 565 | 3300013308 | Ga0157375_10037395 | Ga0157375_100373954 | 183 |
| 566 | 3300013308 | Ga0157375_10156346 | Ga0157375_101563462 | 183 |
| 567 | 3300014325 | Ga0163163_10213352 | Ga0163163_102133522 | 183 |
| 568 | 3300014325 | Ga0163163_10515085 | Ga0163163_105150852 | 183 |
| 569 | 3300014326 | Ga0157380_10068228 | Ga0157380_100682282 | 183 |
| 570 | 3300014326 | Ga0157380_10090627 | Ga0157380_100906272 | 183 |
| 571 | 3300014326 | Ga0157380_10217130 | Ga0157380_102171302 | 183 |
| 572 | 3300014745 | Ga0157377_10000016 | Ga0157377_10000016116 | 183 |
| 573 | 3300014745 | Ga0157377_10018617 | Ga0157377_100186174 | 183 |
| 574 | 3300014745 | Ga0157377_10059263 | Ga0157377_100592633 | 183 |
| 575 | 3300014968 | Ga0157379_10001159 | Ga0157379_100011598 | 183 |
| 576 | 3300014968 | Ga0157379_10037015 | Ga0157379_100370152 | 183 |
| 577 | 3300014968 | Ga0157379_10079832 | Ga0157379_100798322 | 183 |
| 578 | 3300014968 | Ga0157379_10199455 | Ga0157379_101994552 | 183 |
| 579 | 3300014968 | Ga0157379_10225971 | Ga0157379_102259712 | 183 |
| 580 | 3300014968 | Ga0157379_10522715 | Ga0157379_105227153 | 183 |
| 581 | 3300014968 | Ga0157379_10585998 | Ga0157379_105859982 | 183 |
| 582 | 3300014969 | Ga0157376_10033179 | Ga0157376_100331793 | 183 |
| 583 | 3300017792 | Ga0163161_10387651 | Ga0163161_103876512 | 183 |
| 584 | 3300020080 | Ga0206350_10772802 | Ga0206350_107728021 | 183 |
| 585 | 3300022467 | Ga0224712_10218062 | Ga0224712_102180622 | 183 |
| 586 | 3300025898 | Ga0207692_10020756 | Ga0207692_100207563 | 183 |
| 587 | 3300025900 | Ga0207710_10078113 | Ga0207710_100781132 | 183 |
| 588 | 3300025900 | Ga0207710_10117218 | Ga0207710_101172181 | 183 |
| 589 | 3300025901 | Ga0207688_10099005 | Ga0207688_100990053 | 183 |
| 590 | 3300025904 | Ga0207647_10001594 | Ga0207647_1000159411 | 183 |
| 591 | 3300025905 | Ga0207685_10002906 | Ga0207685_100029063 | 183 |
| 592 | 3300025905 | Ga0207685_10294213 | Ga0207685_102942131 | 183 |
| 593 | 3300025906 | Ga0207699_10047879 | Ga0207699_100478793 | 183 |
| 594 | 3300025908 | Ga0207643_10018379 | Ga0207643_100183793 | 183 |
| 595 | 3300025910 | Ga0207684_10708161 | Ga0207684_107081611 | 183 |
| 596 | 3300025911 | Ga0207654_10131880 | Ga0207654_101318803 | 183 |
| 597 | 3300025911 | Ga0207654_10162029 | Ga0207654_101620292 | 183 |
| 598 | 3300025912 | Ga0207707_10009442 | Ga0207707_100094422 | 183 |
| 599 | 3300025912 | Ga0207707_10071683 | Ga0207707_100716833 | 183 |
| 600 | 3300025912 | Ga0207707_10664879 | Ga0207707_106648792 | 183 |
| 601 | 3300025913 | Ga0207695_10346039 | Ga0207695_103460392 | 183 |
| 602 | 3300025913 | Ga0207695_10615702 | Ga0207695_106157022 | 183 |
| 603 | 3300025914 | Ga0207671_10053773 | Ga0207671_100537733 | 183 |
| 604 | 3300025914 | Ga0207671_10092749 | Ga0207671_100927492 | 183 |
| 605 | 3300025914 | Ga0207671_10226224 | Ga0207671_102262242 | 183 |
| 606 | 3300025915 | Ga0207693_10005991 | Ga0207693_1000599110 | 183 |
| 607 | 3300025915 | Ga0207693_10007609 | Ga0207693_100076094 | 183 |
| 608 | 3300025916 | Ga0207663_10003380 | Ga0207663_100033807 | 183 |
| 609 | 3300025916 | Ga0207663_10240558 | Ga0207663_102405582 | 183 |
| 610 | 3300025917 | Ga0207660_10195764 | Ga0207660_101957644 | 183 |
| 611 | 3300025917 | Ga0207660_10357902 | Ga0207660_103579022 | 183 |
| 612 | 3300025918 | Ga0207662_10002056 | Ga0207662_100020567 | 183 |
| 613 | 3300025918 | Ga0207662_10313284 | Ga0207662_103132842 | 183 |
| 614 | 3300025918 | Ga0207662_10319220 | Ga0207662_103192202 | 183 |
| 615 | 3300025921 | Ga0207652_10716258 | Ga0207652_107162582 | 183 |
| 616 | 3300025922 | Ga0207646_10079619 | Ga0207646_100796191 | 183 |
| 617 | 3300025922 | Ga0207646_10320225 | Ga0207646_103202253 | 183 |
| 618 | 3300025924 | Ga0207694_10006772 | Ga0207694_100067725 | 183 |
| 619 | 3300025926 | Ga0207659_10860970 | Ga0207659_108609702 | 183 |
| 620 | 3300025928 | Ga0207700_10157862 | Ga0207700_101578623 | 183 |
| 621 | 3300025928 | Ga0207700_10394453 | Ga0207700_103944531 | 183 |
| 622 | 3300025931 | Ga0207644_10101093 | Ga0207644_101010933 | 183 |
| 623 | 3300025931 | Ga0207644_10413684 | Ga0207644_104136842 | 183 |
| 624 | 3300025933 | Ga0207706_10383604 | Ga0207706_103836042 | 183 |
| 625 | 3300025933 | Ga0207706_10446972 | Ga0207706_104469722 | 183 |
| 626 | 3300025935 | Ga0207709_10059523 | Ga0207709_100595233 | 183 |
| 627 | 3300025935 | Ga0207709_10135906 | Ga0207709_101359062 | 183 |
| 628 | 3300025936 | Ga0207670_10301660 | Ga0207670_103016602 | 183 |
| 629 | 3300025936 | Ga0207670_10886905 | Ga0207670_108869051 | 183 |
| 630 | 3300025938 | Ga0207704_10012737 | Ga0207704_100127376 | 183 |
| 631 | 3300025938 | Ga0207704_10037378 | Ga0207704_100373784 | 183 |
| 632 | 3300025939 | Ga0207665_10000152 | Ga0207665_1000015213 | 183 |
| 633 | 3300025939 | Ga0207665_10258940 | Ga0207665_102589402 | 183 |
| 634 | 3300025939 | Ga0207665_10351977 | Ga0207665_103519772 | 183 |
| 635 | 3300025940 | Ga0207691_10012672 | Ga0207691_100126723 | 183 |
| 636 | 3300025941 | Ga0207711_10145855 | Ga0207711_101458553 | 183 |
| 637 | 3300025942 | Ga0207689_10000714 | Ga0207689_1000071415 | 183 |
| 638 | 3300025942 | Ga0207689_10011996 | Ga0207689_100119965 | 183 |
| 639 | 3300025942 | Ga0207689_10153316 | Ga0207689_101533163 | 183 |
| 640 | 3300025942 | Ga0207689_10373176 | Ga0207689_103731762 | 183 |
| 641 | 3300025944 | Ga0207661_10220853 | Ga0207661_102208533 | 183 |
| 642 | 3300025949 | Ga0207667_10014052 | Ga0207667_100140524 | 183 |
| 643 | 3300025960 | Ga0207651_10152099 | Ga0207651_101520992 | 183 |
| 644 | 3300025960 | Ga0207651_11451213 | Ga0207651_114512131 | 183 |
| 645 | 3300025961 | Ga0207712_10226210 | Ga0207712_102262102 | 183 |
| 646 | 3300025961 | Ga0207712_10643979 | Ga0207712_106439792 | 183 |
| 647 | 3300025981 | Ga0207640_10527925 | Ga0207640_105279251 | 183 |
| 648 | 3300025986 | Ga0207658_10318455 | Ga0207658_103184553 | 183 |
| 649 | 3300026023 | Ga0207677_10026673 | Ga0207677_100266733 | 183 |
| 650 | 3300026035 | Ga0207703_10031981 | Ga0207703_100319812 | 183 |
| 651 | 3300026035 | Ga0207703_10038495 | Ga0207703_100384957 | 183 |
| 652 | 3300026035 | Ga0207703_10081574 | Ga0207703_100815743 | 183 |
| 653 | 3300026035 | Ga0207703_10106248 | Ga0207703_101062482 | 183 |
| 654 | 3300026041 | Ga0207639_10012886 | Ga0207639_100128865 | 183 |
| 655 | 3300026067 | Ga0207678_10053430 | Ga0207678_100534303 | 183 |
| 656 | 3300026075 | Ga0207708_10039135 | Ga0207708_100391353 | 183 |
| 657 | 3300026075 | Ga0207708_10810798 | Ga0207708_108107982 | 183 |
| 658 | 3300026078 | Ga0207702_10935296 | Ga0207702_109352962 | 183 |
| 659 | 3300026078 | Ga0207702_11171935 | Ga0207702_111719352 | 183 |
| 660 | 3300026088 | Ga0207641_10064366 | Ga0207641_100643665 | 183 |
| 661 | 3300026088 | Ga0207641_10093744 | Ga0207641_100937442 | 183 |
| 662 | 3300026089 | Ga0207648_10000343 | Ga0207648_1000034335 | 183 |
| 663 | 3300026089 | Ga0207648_10026411 | Ga0207648_100264114 | 183 |
| 664 | 3300026095 | Ga0207676_11535485 | Ga0207676_115354851 | 183 |
| 665 | 3300026116 | Ga0207674_10111698 | Ga0207674_101116983 | 183 |
| 666 | 3300026116 | Ga0207674_10314588 | Ga0207674_103145883 | 183 |
| 667 | 3300026118 | Ga0207675_100004242 | Ga0207675_10000424214 | 183 |
| 668 | 3300026118 | Ga0207675_100263506 | Ga0207675_1002635063 | 183 |
| 669 | 3300026118 | Ga0207675_100302501 | Ga0207675_1003025012 | 183 |
| 670 | 3300026118 | Ga0207675_100421248 | Ga0207675_1004212481 | 183 |
| 671 | 3300026121 | Ga0207683_10090582 | Ga0207683_100905823 | 183 |
| 672 | 3300026121 | Ga0207683_10718697 | Ga0207683_107186971 | 183 |
| 673 | 3300026142 | Ga0207698_10183760 | Ga0207698_101837602 | 183 |
| 674 | 3300026142 | Ga0207698_10351329 | Ga0207698_103513292 | 183 |
| 675 | 3300027876 | Ga0209974_10012502 | Ga0209974_100125021 | 183 |
| 676 | 3300027907 | Ga0207428_10000633 | Ga0207428_1000063313 | 183 |
| 677 | 3300027907 | Ga0207428_10018443 | Ga0207428_100184437 | 183 |
| 678 | 3300027907 | Ga0207428_10030638 | Ga0207428_100306382 | 183 |
| 679 | 3300027907 | Ga0207428_10047259 | Ga0207428_100472592 | 183 |
| 680 | 3300028380 | Ga0268265_10114994 | Ga0268265_101149942 | 183 |
| 681 | 3300028380 | Ga0268265_10286315 | Ga0268265_102863152 | 183 |
| 682 | 3300028380 | Ga0268265_10291801 | Ga0268265_102918011 | 183 |
| 683 | 3300028380 | Ga0268265_10414052 | Ga0268265_104140522 | 183 |
| 684 | 3300028381 | Ga0268264_10000051 | Ga0268264_10000051133 | 183 |
| 685 | 3300028381 | Ga0268264_10078054 | Ga0268264_100780542 | 183 |
| 686 | 3300028381 | Ga0268264_10162352 | Ga0268264_101623523 | 183 |
| 687 | 3300028556 | Ga0265337_1005772 | Ga0265337_10057725 | 183 |
| 688 | 3300028558 | Ga0265326_10100657 | Ga0265326_101006572 | 183 |
| 689 | 3300028794 | Ga0307515_10030972 | Ga0307515_100309727 | 183 |
| 690 | 3300028800 | Ga0265338_10037653 | Ga0265338_100376532 | 183 |
| 691 | 3300031240 | Ga0265320_10000141 | Ga0265320_1000014111 | 183 |
| 692 | 3300031247 | Ga0265340_10009210 | Ga0265340_100092103 | 183 |
| 693 | 3300031249 | Ga0265339_10138922 | Ga0265339_101389222 | 183 |
| 694 | 3300031250 | Ga0265331_10195679 | Ga0265331_101956792 | 183 |
| 695 | 3300031344 | Ga0265316_10000552 | Ga0265316_1000055211 | 183 |
| 696 | 3300031344 | Ga0265316_10139818 | Ga0265316_101398182 | 183 |
| 697 | 3300031456 | Ga0307513_10055061 | Ga0307513_100550617 | 183 |
| 698 | 3300031507 | Ga0307509_10080563 | Ga0307509_100805634 | 183 |
| 699 | 3300031507 | Ga0307509_10632058 | Ga0307509_106320581 | 183 |
| 700 | 3300031616 | Ga0307508_10028223 | Ga0307508_100282231 | 183 |
| 701 | 3300031616 | Ga0307508_10101106 | Ga0307508_101011062 | 183 |
| 702 | 3300031665 | Ga0316575_10000971 | Ga0316575_100009715 | 183 |
| 703 | 3300031711 | Ga0265314_10001011 | Ga0265314_100010116 | 183 |
| 704 | 3300031711 | Ga0265314_10240058 | Ga0265314_102400582 | 183 |
| 705 | 3300031712 | Ga0265342_10006483 | Ga0265342_100064833 | 183 |
| 706 | 3300031730 | Ga0307516_10002069 | Ga0307516_100020696 | 183 |
| 707 | 3300032002 | Ga0307416_100038314 | Ga0307416_1000383145 | 183 |
| 708 | 3300032133 | Ga0316583_10001913 | Ga0316583_100019131 | 183 |
| 709 | 3300033179 | Ga0307507_10033111 | Ga0307507_100331112 | 183 |
| 710 | 3300033179 | Ga0307507_10333502 | Ga0307507_103335021 | 183 |
| 711 | 3300033180 | Ga0307510_10080098 | Ga0307510_100800985 | 183 |
| 712 | 3300034817 | Ga0373948_0043097 | Ga0373948_0043097_47_607 | 183 |
| 713 | 3300034957 | Ga0373938_0019463 | Ga0373938_0019463_687_1247 | 183 |
| 714 | 3300035170 | Ga0373943_0082552 | Ga0373943_0082552_411_977 | 183 |
| 715 | 3300035398 | Ga0316574_0002419 | Ga0316574_0002419_7554_8111 | 183 |
| 716 | 3300035691 | Ga0373931_0870609 | Ga0373931_0870609_25_588 | 183 |
| 717 | 3300035692 | Ga0373935_0532092 | Ga0373935_0532092_189_755 | 183 |
| 718 | 3300035695 | Ga0373927_0018429 | Ga0373927_0018429_3558_4124 | 183 |
| 719 | 3300037418 | Ga0395900_0030020 | Ga0395900_0030020_3238_3798 | 183 |
| 720 | 3300041406 | Ga0439439_0041353 | Ga0439439_0041353_609_1163 | 183 |
| 721 | 3300041512 | Ga0451853_2163079 | Ga0451853_2163079_21_587 | 183 |
| 722 | 3300042007 | Ga0439449_0010774 | Ga0439449_0010774_1674_2228 | 183 |
| 723 | 3300042014 | Ga0439457_011054 | Ga0439457_011054_131_685 | 183 |
| 724 | 3300042436 | Ga0439435_0017308 | Ga0439435_0017308_108_671 | 183 |
| 725 | 3300042876 | Ga0451577_0710649 | Ga0451577_0710649_124_684 | 183 |
| 726 | 3300045051 | Ga0451576_0033779 | Ga0451576_0033779_3663_4223 | 183 |
| 727 | 3300045051 | Ga0451576_1613762 | Ga0451576_1613762_57_620 | 183 |
| 728 | 3300046454 | Ga0495592_0367743 | Ga0495592_0367743_167_733 | 183 |
| 729 | 3300046459 | Ga0495629_0162836 | Ga0495629_0162836_684_1250 | 183 |
| 730 | 3300046462 | Ga0495651_0180420 | Ga0495651_0180420_668_1234 | 183 |
| 731 | 3300046462 | Ga0495651_0298298 | Ga0495651_0298298_386_952 | 183 |
| 732 | 3300046472 | Ga0495580_0095254 | Ga0495580_0095254_701_1264 | 183 |
| 733 | 3300046472 | Ga0495580_0377530 | Ga0495580_0377530_54_614 | 183 |
| 734 | 3300046476 | Ga0495662_0034990 | Ga0495662_0034990_1009_1575 | 183 |
| 735 | 3300046477 | Ga0495664_0478343 | Ga0495664_0478343_146_712 | 183 |
| 736 | 3300046499 | Ga0495594_0184499 | Ga0495594_0184499_356_916 | 183 |
| 737 | 3300046514 | Ga0495618_0029851 | Ga0495618_0029851_33_593 | 183 |
| 738 | 3300046523 | Ga0495644_0043944 | Ga0495644_0043944_55_621 | 183 |
| 739 | 3300046535 | Ga0495586_0047074 | Ga0495586_0047074_672_1232 | 183 |
| 740 | 3300046537 | Ga0495598_0070098 | Ga0495598_0070098_192_749 | 183 |
| 741 | 3300046616 | Ga0495668_0245441 | Ga0495668_0245441_193_753 | 183 |
| 742 | 3300046642 | Ga0495634_0192837 | Ga0495634_0192837_637_1197 | 183 |
| 743 | 3300046663 | Ga0495635_0033802 | Ga0495635_0033802_639_1205 | 183 |
| 744 | 3300046674 | Ga0495588_0368948 | Ga0495588_0368948_123_689 | 183 |
| 745 | 3300046675 | Ga0495657_0311656 | Ga0495657_0311656_96_662 | 183 |
| 746 | 3300046689 | Ga0495613_0079002 | Ga0495613_0079002_1779_2339 | 183 |
| 747 | 3300046694 | Ga0495649_0268699 | Ga0495649_0268699_82_642 | 183 |
| 748 | 3300046809 | Ga0495600_0193172 | Ga0495600_0193172_16_582 | 183 |
| 749 | 3300047315 | Ga0495581_0599848 | Ga0495581_0599848_60_620 | 183 |
| 750 | 3300047319 | Ga0495674_0240637 | Ga0495674_0240637_914_1474 | 183 |
| 751 | 3300047445 | Ga0495677_0149489 | Ga0495677_0149489_226_792 | 183 |
| 752 | 3300048905 | Ga0496102_0050697 | Ga0496102_0050697_1618_2178 | 183 |
| 753 | 3300048905 | Ga0496102_0230850 | Ga0496102_0230850_61_621 | 183 |
| 754 | 3300048905 | Ga0496102_0417831 | Ga0496102_0417831_635_1195 | 183 |
| 755 | 3300048906 | Ga0496103_0013067 | Ga0496103_0013067_3131_3691 | 183 |
| 756 | 3300048907 | Ga0496104_0040484 | Ga0496104_0040484_596_1156 | 183 |
| 757 | 3300048908 | Ga0496105_0164950 | Ga0496105_0164950_141_701 | 183 |
| 758 | 3300048910 | Ga0496107_0027625 | Ga0496107_0027625_2855_3415 | 183 |
| 759 | 3300048912 | Ga0496109_0025483 | Ga0496109_0025483_3155_3715 | 183 |
| 760 | 3300048912 | Ga0496109_0812446 | Ga0496109_0812446_205_771 | 183 |
| 761 | 3300048913 | Ga0496110_0059697 | Ga0496110_0059697_370_930 | 183 |
| 762 | 3300048914 | Ga0496111_0010111 | Ga0496111_0010111_2343_2903 | 183 |
| 763 | 3300048915 | Ga0496112_0010806 | Ga0496112_0010806_6666_7226 | 183 |
| 764 | 3300048916 | Ga0496113_0013516 | Ga0496113_0013516_1389_1949 | 183 |
| 765 | 3300048917 | Ga0496114_0027017 | Ga0496114_0027017_615_1175 | 183 |
| 766 | 3300048918 | Ga0496115_0026703 | Ga0496115_0026703_740_1300 | 183 |
| 767 | 3300048924 | Ga0496121_0157792 | Ga0496121_0157792_994_1554 | 183 |
| 768 | 3300048924 | Ga0496121_0201374 | Ga0496121_0201374_124_732 | 183 |
| 769 | 3300048924 | Ga0496121_0301368 | Ga0496121_0301368_404_970 | 183 |
| 770 | 3300048929 | Ga0496126_0078190 | Ga0496126_0078190_1199_1759 | 183 |
| 771 | 3300049569 | Ga0501032_0001778 | Ga0501032_0001778_1892_2452 | 183 |
| 772 | 3300049569 | Ga0501032_0163357 | Ga0501032_0163357_128_685 | 183 |
| 773 | 3300049570 | Ga0501033_0006961 | Ga0501033_0006961_4534_5094 | 183 |
| 774 | 3300049570 | Ga0501033_0021858 | Ga0501033_0021858_1458_2015 | 183 |
| 775 | 3300049571 | Ga0501034_0022252 | Ga0501034_0022252_2165_2725 | 183 |
| 776 | 3300049571 | Ga0501034_0037976 | Ga0501034_0037976_513_1073 | 183 |
| 777 | 3300049571 | Ga0501034_0265253 | Ga0501034_0265253_884_1441 | 183 |
| 778 | 3300049572 | Ga0501036_0001304 | Ga0501036_0001304_8792_9352 | 183 |
| 779 | 3300049573 | Ga0501037_0000852 | Ga0501037_0000852_4933_5493 | 183 |
| 780 | 3300049574 | Ga0501038_0003040 | Ga0501038_0003040_14369_14929 | 183 |
| 781 | 3300049574 | Ga0501038_0356423 | Ga0501038_0356423_96_653 | 183 |
| 782 | 3300049579 | Ga0501043_0008849 | Ga0501043_0008849_1400_1960 | 183 |
| 783 | 3300049580 | Ga0501046_0002656 | Ga0501046_0002656_2681_3241 | 183 |
| 784 | 3300049581 | Ga0501047_0007261 | Ga0501047_0007261_6059_6619 | 183 |
| 785 | 3300049581 | Ga0501047_0062899 | Ga0501047_0062899_2999_3556 | 183 |
| 786 | 3300049582 | Ga0501048_0004121 | Ga0501048_0004121_2229_2789 | 183 |
| 787 | 3300049583 | Ga0501067_0001824 | Ga0501067_0001824_7871_8431 | 183 |
| 788 | 3300049584 | Ga0501068_0000234 | Ga0501068_0000234_15378_15938 | 183 |
| 789 | 3300049584 | Ga0501068_0284314 | Ga0501068_0284314_313_873 | 183 |
| 790 | 3300049585 | Ga0501069_0003617 | Ga0501069_0003617_658_1218 | 183 |
| 791 | 3300049586 | Ga0501070_0000512 | Ga0501070_0000512_15532_16092 | 183 |
| 792 | 3300049586 | Ga0501070_0005792 | Ga0501070_0005792_3925_4485 | 183 |
| 793 | 3300049588 | Ga0501072_0002523 | Ga0501072_0002523_4349_4909 | 183 |
| 794 | 3300049589 | Ga0501073_0000482 | Ga0501073_0000482_1465_2025 | 183 |
| 795 | 3300049589 | Ga0501073_0004075 | Ga0501073_0004075_9703_10263 | 183 |
| 796 | 3300049590 | Ga0501074_0011232 | Ga0501074_0011232_3864_4424 | 183 |
| 797 | 3300049591 | Ga0501075_0514956 | Ga0501075_0514956_16_582 | 183 |
| 798 | 3300049592 | Ga0501076_0010528 | Ga0501076_0010528_5764_6324 | 183 |
| 799 | 3300049593 | Ga0501077_0036595 | Ga0501077_0036595_2292_2852 | 183 |
| 800 | 3300049741 | Ga0501079_0002938 | Ga0501079_0002938_5962_6522 | 183 |
| 801 | 3300049741 | Ga0501079_0613949 | Ga0501079_0613949_63_623 | 183 |
| 802 | 3300049742 | Ga0501080_0001468 | Ga0501080_0001468_5423_5983 | 183 |
| 803 | 3300049743 | Ga0501081_0265180 | Ga0501081_0265180_34_594 | 183 |
| 804 | 3300049744 | Ga0501083_0004962 | Ga0501083_0004962_4391_4951 | 183 |
| 805 | 3300049744 | Ga0501083_0010679 | Ga0501083_0010679_2293_2853 | 183 |
| 806 | 3300049822 | Ga0501035_0029424 | Ga0501035_0029424_3736_4296 | 183 |
| 807 | 3300049823 | Ga0501044_0011048 | Ga0501044_0011048_2486_3046 | 183 |
| 808 | 3300049823 | Ga0501044_0017635 | Ga0501044_0017635_6102_6659 | 183 |
| 809 | 3300050489 | nmdc:mga03683_139567_c1 | nmdc:mga03683_139567_c1_484_1050 | 183 |
| 810 | 3300050489 | nmdc:mga03683_26201_c1 | nmdc:mga03683_26201_c1_483_1049 | 183 |
| 811 | 3300050491 | nmdc:mga00v17_84765_c1 | nmdc:mga00v17_84765_c1_1352_1918 | 183 |
| 812 | 3300050492 | nmdc:mga0yw44_40072_c1 | nmdc:mga0yw44_40072_c1_1730_2296 | 183 |
| 813 | 3300050493 | nmdc:mga0k408_1207_c1 | nmdc:mga0k408_1207_c1_5871_6437 | 183 |
| 814 | 3300050494 | nmdc:mga06z11_5693_c1 | nmdc:mga06z11_5693_c1_2859_3425 | 183 |
| 815 | 3300050495 | nmdc:mga04h51_151709_c1 | nmdc:mga04h51_151709_c1_140_706 | 183 |
| 816 | 3300050507 | nmdc:mga05p37_1072532_c1 | nmdc:mga05p37_1072532_c1_126_710 | 183 |
| 817 | 3300050507 | nmdc:mga05p37_16430_c1 | nmdc:mga05p37_16430_c1_6116_6682 | 183 |
| 818 | 3300050507 | nmdc:mga05p37_181361_c1 | nmdc:mga05p37_181361_c1_348_914 | 183 |
| 819 | 3300050507 | nmdc:mga05p37_36945_c1 | nmdc:mga05p37_36945_c1_2815_3399 | 183 |
| 820 | 3300050507 | nmdc:mga05p37_464681_c1 | nmdc:mga05p37_464681_c1_679_1245 | 183 |
| 821 | 3300050508 | nmdc:mga09592_116016_c1 | nmdc:mga09592_116016_c1_661_1227 | 183 |
| 822 | 3300050508 | nmdc:mga09592_193971_c1 | nmdc:mga09592_193971_c1_172_738 | 183 |
| 823 | 3300050509 | nmdc:mga0qj67_713713_c1 | nmdc:mga0qj67_713713_c1_39_605 | 183 |
| 824 | 3300050509 | nmdc:mga0qj67_85972_c1 | nmdc:mga0qj67_85972_c1_1793_2359 | 183 |
| 825 | 3300050510 | nmdc:mga06r32_572_c1 | nmdc:mga06r32_572_c1_4114_4692 | 183 |
| 826 | 3300050510 | nmdc:mga06r32_578803_c1 | nmdc:mga06r32_578803_c1_284_850 | 183 |
| 827 | 3300050511 | nmdc:mga08y16_114314_c1 | nmdc:mga08y16_114314_c1_1931_2485 | 183 |
| 828 | 3300050511 | nmdc:mga08y16_1363715_c1 | nmdc:mga08y16_1363715_c1_34_603 | 183 |
| 829 | 3300050511 | nmdc:mga08y16_4466_c1 | nmdc:mga08y16_4466_c1_13891_14457 | 183 |
| 830 | 3300050511 | nmdc:mga08y16_6186_c1 | nmdc:mga08y16_6186_c1_2237_2803 | 183 |
| 831 | 3300050512 | nmdc:mga0n895_710305_c1 | nmdc:mga0n895_710305_c1_153_713 | 183 |
| 832 | 3300050513 | nmdc:mga0rr50_455605_c1 | nmdc:mga0rr50_455605_c1_167_727 | 183 |
| 833 | 3300050514 | nmdc:mga08x19_23637_c1 | nmdc:mga08x19_23637_c1_400_966 | 183 |
| 834 | 3300050514 | nmdc:mga08x19_319717_c1 | nmdc:mga08x19_319717_c1_204_779 | 183 |
| 835 | 3300053080 | Ga0500635_0005541 | Ga0500635_0005541_1780_2346 | 183 |
| 836 | 3300053083 | Ga0495655_0041471 | Ga0495655_0041471_489_1049 | 183 |
| 837 | 3300053091 | Ga0500647_0157488 | Ga0500647_0157488_235_801 | 183 |
| 838 | 3300053103 | Ga0500555_010682 | Ga0500555_010682_529_1095 | 183 |
| 839 | 3300053108 | Ga0500562_000016 | Ga0500562_000016_56215_56769 | 183 |
| 840 | 3300053133 | Ga0500655_049980 | Ga0500655_049980_127_687 | 183 |
| 841 | 3300053140 | Ga0500573_0042324 | Ga0500573_0042324_2026_2592 | 183 |
| 842 | 3300053148 | Ga0500590_000161 | Ga0500590_000161_17665_18231 | 183 |
| 843 | 3300053148 | Ga0500590_052882 | Ga0500590_052882_389_955 | 183 |
| 844 | 3300053150 | Ga0500603_005162 | Ga0500603_005162_1297_1863 | 183 |
| 845 | 3300053177 | Ga0500636_0064701 | Ga0500636_0064701_195_761 | 183 |
| 846 | 3300053177 | Ga0500636_0076909 | Ga0500636_0076909_380_946 | 183 |
| 847 | 3300053735 | Ga0500596_022312 | Ga0500596_022312_259_825 | 183 |
| 848 | 3300054114 | Ga0501084_0014970 | Ga0501084_0014970_4406_4966 | 183 |
| 849 | 3300055283 | Ga0500661_004595 | Ga0500661_004595_160_714 | 183 |
| 850 | 3300060353 | Ga0501082_0004844 | Ga0501082_0004844_4557_5117 | 183 |
| 851 | 3300060353 | Ga0501082_0005564 | Ga0501082_0005564_5289_5849 | 183 |
| 852 | 3300060353 | Ga0501082_0260899 | Ga0501082_0260899_795_1361 | 183 |
| 853 | iso_pu_bacteria | 2582581867 | 2585400018 | 183 |
| 854 | iso_pu_bacteria | 2585427590 | 2585822576 | 183 |
| 855 | 3300001979 | JGI24740J21852_10005322 | JGI24740J21852_100053222 | 184 |
| 856 | 3300002738 | JGI25154J39366_1000002 | JGI25154J39366_100000227 | 184 |
| 857 | 3300003322 | rootL2_10296761 | rootL2_102967612 | 184 |
| 858 | 3300009545 | Ga0105237_10001721 | Ga0105237_1000172117 | 184 |
| 859 | 3300025914 | Ga0207671_10001900 | Ga0207671_100019005 | 184 |
| 860 | 3300031251 | Ga0265327_10000010 | Ga0265327_1000001089 | 184 |
| 861 | 3300031507 | Ga0307509_10066136 | Ga0307509_100661363 | 184 |
| 862 | 3300053139 | Ga0500568_0189182 | Ga0500568_0189182_25_588 | 184 |
| 863 | 2162886007 | SwRhRL2b_contig_1498326 | SwRhRL2b_0696.00002010 | 185 |
| 864 | 3300005289 | Ga0065704_10070132 | Ga0065704_10070132496 | 185 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3jtw-assembly1.cif.gz_A-2 | crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution | 0.8293 | 1 | 184 |
| 3jtw-assembly1.cif.gz_A-2 | crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution | 0.825 | 1 | 184 |
| 3ky8-assembly1.cif.gz_B | crystal structure of putative riboflavin biosynthesis protein (yp_001092907.1) from shewanella sp. pv-4 at 2.12 a resolution | 0.8167 | 3 | 185 |
| 1d1g-assembly1.cif.gz_B | dihydrofolate reductase from thermotoga maritima | 0.8135 | 2 | 184 |
| 5ecx-assembly1.cif.gz_B | klebsiella pneumoniae dfra1 complexed with nadph and 6-ethyl-5-(3-(6-(pyridin-4-yl)benzo[d][1,3]dioxol-4-yl)but-1-yn-1-yl)pyrimidine-2,4-diamine | 0.8097 | 3 | 184 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2gd9B01 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.8254 | 3 | 181 | 3.40.430.10 |
| 2gd9B01 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.816 | 3 | 181 | 3.40.430.10 |
| 1cz3B00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.8159 | 2 | 185 | 3.40.430.10 |
| 5ecxB00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.8098 | 3 | 184 | 3.40.430.10 |
| 2xw7B00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.8065 | 1 | 185 | 3.40.430.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q5Q1X5-F1-model_v4 | deleted | 0.9624 | 1 | 152 |
|
| AF-M6K5Y5-F1-model_v4 | Riboflavin biosynthesis protein RibD C-terminal domain protein | 0.9622 | 1 | 184 |
GO:0008703
GO:0009231 |
| AF-A0A0H4P8U0-F1-model_v4 | Dihydrofolate reductase | 0.962 | 1 | 185 |
GO:0008703
GO:0009231 |
| AF-A0A1G9H0X7-F1-model_v4 | Dihydrofolate reductase | 0.9588 | 1 | 185 |
GO:0008703
GO:0009231 |
| AF-M6K5Y5-F1-model_v4 | Riboflavin biosynthesis protein RibD C-terminal domain protein | 0.957 | 1 | 184 |
GO:0008703
GO:0009231 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar