F483941

General Info

Members Datasets Scaffolds Average Seq Length
864 382 857 187

Family's Representative Sequence

Representative Sequence 3300005536|Ga0070697_100227796|Ga0070697_1002277962
Length 218
Sequence MPKLIVFNQVSLDGYFTGDNGDLSWAHTRNAQDPEWHSFVKENAKGGGVLVFGRVTYDMMAGYWPTPAAQKNDPVVAEQMNALPKIVFSRSLDHAEWKNTRLVKGDPAAEMRKMKQAPGQDMVIMGSGTIVSQLAQAGLIDEYQLVVIPVALGKGKTMFEGITKTLPMKPTRSRTFHNGNVLLCYEPGDQEGEADGSAARSDQRGQRTPEPAEASHRS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
5 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
6 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
7 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
8 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
9 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
10 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
11 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
12 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
40 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
44 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
45 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
46 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
47 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
48 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
49 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
56 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
57 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
58 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
59 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
62 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
63 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
64 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
65 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
66 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
67 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
68 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
69 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
70 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
71 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
72 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
73 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
74 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
75 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
76 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
77 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
78 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
79 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
80 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
81 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
82 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
83 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
84 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
85 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
86 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
87 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
88 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
89 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
90 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
91 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
92 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
93 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
94 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
95 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
96 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
97 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
98 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
100 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
101 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
102 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
103 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
104 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
105 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
106 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
107 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
108 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
109 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
111 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
112 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
113 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
114 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
116 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
117 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
118 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
119 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
120 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
121 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
122 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
123 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
124 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
125 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
126 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
127 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
128 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
129 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
130 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
131 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
132 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
133 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
134 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
135 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
136 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
137 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
138 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
139 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
140 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
141 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
196 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
198 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
201 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
202 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
203 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
204 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
205 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
206 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
207 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
208 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
209 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
210 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
211 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
212 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
213 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
214 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
215 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
216 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
217 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
218 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
219 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
220 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
221 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
222 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
223 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
224 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
225 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
226 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
227 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
228 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
229 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
230 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
231 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
232 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
233 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
234 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
235 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
236 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
237 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
238 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
239 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
240 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
241 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
242 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
243 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
244 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
245 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
246 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
247 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
248 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
249 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
250 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
251 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
252 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
253 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
254 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
255 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
256 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
257 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
258 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
259 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
260 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
261 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
262 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
263 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
264 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
265 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
266 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
267 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
268 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
269 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
270 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
271 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
272 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
273 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
274 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
275 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
276 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
277 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
278 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
279 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
280 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
281 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
282 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
283 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
284 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
285 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
286 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
287 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
288 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
289 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
290 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
291 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
292 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
293 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
294 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
295 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
296 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
297 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
298 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
299 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
300 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
301 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
302 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
303 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
304 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
305 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
306 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
307 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
308 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
319 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
320 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
321 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
322 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
323 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
324 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
325 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
326 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
327 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
328 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
329 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
330 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
331 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
332 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
333 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
334 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
335 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
336 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
338 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
339 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
340 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
341 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
342 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
343 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
344 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
345 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
346 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
347 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
348 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
349 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
350 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
351 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
352 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
353 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
354 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
355 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
356 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
357 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
358 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
359 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
360 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
361 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
362 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
363 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
364 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
365 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
366 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
367 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
368 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
369 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
370 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
371 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
372 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
373 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
374 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
375 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
376 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
377 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
378 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
379 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
380 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
381 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
382 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.84
Metatranscriptomes 0.35
Isolates 0.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.18
Nodule 0.23
Rhizoplane 2.55
Rhizosphere 87.27
Stem 0
Stem Tuber 0
Unclassified 2.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1498326 2162886007 Bacteria 186627
2 MRS1b_contig_1457758 2162886011 Unclassified 990
3 MBSR1b_contig_3044804 2162886012 Bacteria 1610
4 JGI24740J21852_10005322 3300001979 Bacteria 5458
5 JGI24740J21852_10067119 3300001979 Bacteria 971
6 JGI25154J39366_1000002 3300002738 Bacteria 466942
7 rootL2_10296761 3300003322 Bacteria 2208
8 Ga0058860_11931095 3300004801 Unclassified 791
9 Ga0065704_10070132 3300005289 Bacteria 1955461
10 Ga0065704_10237945 3300005289 Bacteria 1024
11 Ga0065715_10102710 3300005293 Bacteria 3091
12 Ga0065715_10139316 3300005293 Bacteria 1878
13 Ga0065715_10535115 3300005293 Unclassified 752
14 Ga0065707_10002593 3300005295 Bacteria 5316
15 Ga0065707_10085153 3300005295 Bacteria 6403
16 Ga0065707_10098721 3300005295 Bacteria 3063
17 Ga0070676_10424359 3300005328 Bacteria 930
18 Ga0070676_10622773 3300005328 Bacteria 780
19 Ga0070683_100009138 3300005329 Bacteria 8459
20 Ga0070683_101315910 3300005329 Bacteria 694
21 Ga0070690_100044822 3300005330 Bacteria 2808
22 Ga0070690_100087543 3300005330 Bacteria 2046
23 Ga0070690_100345247 3300005330 Bacteria 1079
24 Ga0070677_10045036 3300005333 Bacteria 1758
25 Ga0068869_100004191 3300005334 Bacteria 8946
26 Ga0068869_100034587 3300005334 Bacteria 3575
27 Ga0068869_100058187 3300005334 Bacteria 2825
28 Ga0068869_100065811 3300005334 Bacteria 2669
29 Ga0068869_100567355 3300005334 Bacteria 955
30 Ga0068869_100786774 3300005334 Bacteria 817
31 Ga0070680_100004972 3300005336 Bacteria 10013
32 Ga0070680_100066004 3300005336 Bacteria 2967
33 Ga0070680_100148885 3300005336 Bacteria 1965
34 Ga0070680_100159804 3300005336 Unclassified 1893
35 Ga0070680_100238817 3300005336 Bacteria 1536
36 Ga0070680_100463223 3300005336 Bacteria 1083
37 Ga0070682_100194929 3300005337 Bacteria 1425
38 Ga0068868_100007011 3300005338 Bacteria 8011
39 Ga0068868_100037370 3300005338 Bacteria 3764
40 Ga0068868_100430259 3300005338 Bacteria 1144
41 Ga0070660_100146524 3300005339 Bacteria 1897
42 Ga0070689_100013281 3300005340 Bacteria 5956
43 Ga0070689_100014255 3300005340 Bacteria 5771
44 Ga0070689_100066066 3300005340 Bacteria 2818
45 Ga0070689_100782599 3300005340 Bacteria 838
46 Ga0070687_100023879 3300005343 Bacteria 2911
47 Ga0070687_100361891 3300005343 Unclassified 939
48 Ga0070687_100399135 3300005343 Unclassified 901
49 Ga0070687_100559702 3300005343 Bacteria 779
50 Ga0070661_100063225 3300005344 Bacteria 2718
51 Ga0070661_100222342 3300005344 Unclassified 1449
52 Ga0070668_100120975 3300005347 Bacteria 2092
53 Ga0070669_100008417 3300005353 Bacteria 7363
54 Ga0070669_100756203 3300005353 Bacteria 824
55 Ga0070675_100045392 3300005354 Bacteria 3596
56 Ga0070675_100261089 3300005354 Bacteria 1518
57 Ga0070675_100747262 3300005354 Bacteria 892
58 Ga0070675_100768187 3300005354 Bacteria 880
59 Ga0070675_101170015 3300005354 Bacteria 708
60 Ga0070671_100091747 3300005355 Bacteria 2545
61 Ga0070671_100130150 3300005355 Bacteria 2119
62 Ga0070674_100016743 3300005356 Bacteria 4599
63 Ga0070673_100026710 3300005364 Bacteria 4269
64 Ga0070673_100058928 3300005364 Bacteria 3038
65 Ga0070688_100026143 3300005365 Bacteria 3465
66 Ga0070688_100354772 3300005365 Bacteria 1075
67 Ga0070688_100689858 3300005365 Bacteria 790
68 Ga0070659_100085296 3300005366 Unclassified 2526
69 Ga0070659_100154355 3300005366 Bacteria 1874
70 Ga0070667_100460308 3300005367 Bacteria 1163
71 Ga0070703_10038315 3300005406 Bacteria 1481
72 Ga0070709_10048099 3300005434 Bacteria 2660
73 Ga0070709_10058639 3300005434 Unclassified 2442
74 Ga0070709_10279951 3300005434 Unclassified 1212
75 Ga0070714_100002872 3300005435 Bacteria 12745
76 Ga0070714_100800072 3300005435 Bacteria 913
77 Ga0070713_100034050 3300005436 Bacteria 4088
78 Ga0070713_100214177 3300005436 Unclassified 1745
79 Ga0070713_100442732 3300005436 Bacteria 1219
80 Ga0070710_10008415 3300005437 Bacteria 5022
81 Ga0070710_10221536 3300005437 Bacteria 1204
82 Ga0070710_10583425 3300005437 Bacteria 776
83 Ga0070701_10004414 3300005438 Bacteria 5693
84 Ga0070701_10033535 3300005438 Bacteria 2566
85 Ga0070711_100037487 3300005439 Unclassified 3253
86 Ga0070711_100669151 3300005439 Bacteria 872
87 Ga0070705_100011137 3300005440 Bacteria 4526
88 Ga0070705_100210433 3300005440 Unclassified 1340
89 Ga0070705_100624481 3300005440 Unclassified 837
90 Ga0070700_100004458 3300005441 Bacteria 7313
91 Ga0070700_100086926 3300005441 Bacteria 2031
92 Ga0070694_100001335 3300005444 Bacteria 14395
93 Ga0070694_100059208 3300005444 Bacteria 2608
94 Ga0070694_100387644 3300005444 Bacteria 1091
95 Ga0070708_100000951 3300005445 Bacteria 21957
96 Ga0070708_100520621 3300005445 Bacteria 1122
97 Ga0070663_100045123 3300005455 Bacteria 3112
98 Ga0070678_100825390 3300005456 Bacteria 843
99 Ga0070662_100115953 3300005457 Bacteria 2047
100 Ga0070662_100925767 3300005457 Unclassified 744
101 Ga0070681_10006425 3300005458 Bacteria 11440
102 Ga0070681_10006494 3300005458 Bacteria 11378
103 Ga0070681_10015651 3300005458 Bacteria 7555
104 Ga0070681_10015673 3300005458 Bacteria 7551
105 Ga0070681_10046173 3300005458 Bacteria 4356
106 Ga0070681_10314381 3300005458 Unclassified 1476
107 Ga0068867_100000114 3300005459 Bacteria 51011
108 Ga0068867_100053038 3300005459 Bacteria 2994
109 Ga0068867_100826408 3300005459 Bacteria 828
110 Ga0068867_101128114 3300005459 Unclassified 717
111 Ga0070685_10010931 3300005466 Unclassified 4733
112 Ga0070685_10097452 3300005466 Bacteria 1790
113 Ga0070685_10196190 3300005466 Bacteria 1309
114 Ga0070685_10587666 3300005466 Unclassified 800
115 Ga0070706_100544990 3300005467 Unclassified 1079
116 Ga0070706_101109142 3300005467 Bacteria 728
117 Ga0070707_100169578 3300005468 Bacteria 2127
118 Ga0070707_100644683 3300005468 Unclassified 1022
119 Ga0070698_100064580 3300005471 Bacteria 3687
120 Ga0070698_100073836 3300005471 Bacteria 3416
121 Ga0070698_100438136 3300005471 Bacteria 1242
122 Ga0070699_100000102 3300005518 Bacteria 80731
123 Ga0070699_100000130 3300005518 Bacteria 69436
124 Ga0070679_100002404 3300005530 Bacteria 16972
125 Ga0070679_100023383 3300005530 Bacteria 6049
126 Ga0070679_100029436 3300005530 Bacteria 5418
127 Ga0070679_100095719 3300005530 Bacteria 2957
128 Ga0070684_100404805 3300005535 Bacteria 1258
129 Ga0070684_100825687 3300005535 Unclassified 867
130 Ga0070697_100016863 3300005536 Bacteria 5743
131 Ga0070697_100227796 3300005536 Unclassified 1589
132 Ga0068853_100020681 3300005539 Bacteria 5474
133 Ga0068853_100041079 3300005539 Bacteria 3949
134 Ga0068853_100081779 3300005539 Bacteria 2828
135 Ga0068853_100467037 3300005539 Bacteria 1188
136 Ga0068853_100501739 3300005539 Bacteria 1146
137 Ga0068853_100589117 3300005539 Bacteria 1055
138 Ga0068853_100623741 3300005539 Bacteria 1025
139 Ga0070672_100290187 3300005543 Bacteria 1385
140 Ga0070672_100525547 3300005543 Unclassified 1025
141 Ga0070672_100637722 3300005543 Bacteria 930
142 Ga0070686_100020224 3300005544 Bacteria 3936
143 Ga0070686_100023906 3300005544 Bacteria 3658
144 Ga0070686_100070115 3300005544 Bacteria 2291
145 Ga0070686_100159154 3300005544 Unclassified 1589
146 Ga0070695_100024050 3300005545 Bacteria 3751
147 Ga0070695_100143627 3300005545 Bacteria 1658
148 Ga0070695_100249454 3300005545 Bacteria 1291
149 Ga0070695_100361274 3300005545 Unclassified 1091
150 Ga0070695_100593796 3300005545 Bacteria 868
151 Ga0070695_100959447 3300005545 Unclassified 693
152 Ga0070696_100000006 3300005546 Bacteria 109170
153 Ga0070696_100003610 3300005546 Bacteria 10300
154 Ga0070696_100032695 3300005546 Unclassified 3570
155 Ga0070696_100041264 3300005546 Bacteria 3188
156 Ga0070696_100163955 3300005546 Bacteria 1639
157 Ga0070693_100025833 3300005547 Unclassified 3163
158 Ga0070693_100047393 3300005547 Bacteria 2445
159 Ga0070693_100336860 3300005547 Unclassified 1028
160 Ga0070693_100909727 3300005547 Bacteria 660
161 Ga0070665_100927906 3300005548 Bacteria 883
162 Ga0070665_101214153 3300005548 Archaea 765
163 Ga0070704_100036617 3300005549 Bacteria 3345
164 Ga0070704_100072347 3300005549 Unclassified 2508
165 Ga0070704_100226743 3300005549 Bacteria 1522
166 Ga0070704_100311582 3300005549 Bacteria 1315
167 Ga0068855_100033773 3300005563 Archaea 6103
168 Ga0068855_100065135 3300005563 Bacteria 4248
169 Ga0068855_100216748 3300005563 Unclassified 2148
170 Ga0068855_100367506 3300005563 Archaea 1582
171 Ga0070664_100079666 3300005564 Unclassified 2820
172 Ga0070664_101044808 3300005564 Unclassified 768
173 Ga0068857_100094474 3300005577 Bacteria 2678
174 Ga0068857_100203850 3300005577 Unclassified 1803
175 Ga0068857_100459325 3300005577 Bacteria 1191
176 Ga0068857_100475697 3300005577 Bacteria 1170
177 Ga0068857_100487508 3300005577 Bacteria 1156
178 Ga0068857_100808111 3300005577 Bacteria 896
179 Ga0068857_100996426 3300005577 Bacteria 806
180 Ga0068854_100243930 3300005578 Bacteria 1432
181 Ga0068856_100234971 3300005614 Bacteria 1848
182 Ga0068856_100888201 3300005614 Archaea 910
183 Ga0068856_100925705 3300005614 Unclassified 890
184 Ga0068856_100979151 3300005614 Bacteria 864
185 Ga0070702_100003115 3300005615 Bacteria 7347
186 Ga0068852_100082275 3300005616 Bacteria 2861
187 Ga0068852_100442994 3300005616 Unclassified 1285
188 Ga0068852_100918849 3300005616 Bacteria 892
189 Ga0068859_100010567 3300005617 Bacteria 9294
190 Ga0068859_100025922 3300005617 Bacteria 5881
191 Ga0068859_100087090 3300005617 Bacteria 3170
192 Ga0068859_100108729 3300005617 Bacteria 2834
193 Ga0068859_100340688 3300005617 Bacteria 1594
194 Ga0068859_100505304 3300005617 Bacteria 1304
195 Ga0068859_100539606 3300005617 Bacteria 1261
196 Ga0068864_100120927 3300005618 Bacteria 2341
197 Ga0068864_100166319 3300005618 Bacteria 2008
198 Ga0068864_100270917 3300005618 Unclassified 1582
199 Ga0068861_100052540 3300005719 Bacteria 3097
200 Ga0068861_100057010 3300005719 Bacteria 2983
201 Ga0068861_100059661 3300005719 Archaea 2922
202 Ga0068861_100149715 3300005719 Bacteria 1914
203 Ga0068861_100453965 3300005719 Bacteria 1149
204 Ga0068861_100624753 3300005719 Unclassified 992
205 Ga0068870_10141504 3300005840 Bacteria 1408
206 Ga0068863_100025634 3300005841 Bacteria 5622
207 Ga0068863_100083618 3300005841 Bacteria 3025
208 Ga0068858_100005323 3300005842 Bacteria 12620
209 Ga0068858_100190404 3300005842 Bacteria 1938
210 Ga0068858_100214554 3300005842 Bacteria 1822
211 Ga0068860_100042231 3300005843 Bacteria 4356
212 Ga0068860_100344486 3300005843 Bacteria 1466
213 Ga0068860_101188173 3300005843 Unclassified 783
214 Ga0068862_100019134 3300005844 Bacteria 5711
215 Ga0068862_100225180 3300005844 Bacteria 1699
216 Ga0068862_100270282 3300005844 Bacteria 1554
217 Ga0068862_100974861 3300005844 Bacteria 837
218 Ga0081455_10052558 3300005937 Bacteria 3486
219 Ga0081455_10063362 3300005937 Bacteria 3102
220 Ga0081455_10221824 3300005937 Unclassified 1400
221 Ga0070717_10002431 3300006028 Bacteria 13144
222 Ga0075365_10049622 3300006038 Bacteria 2765
223 Ga0075368_10033062 3300006042 Bacteria 2011
224 Ga0075368_10123184 3300006042 Bacteria 1075
225 Ga0075368_10141447 3300006042 Bacteria 1003
226 Ga0075363_100154023 3300006048 Bacteria 1298
227 Ga0075364_10196838 3300006051 Bacteria 1365
228 Ga0070715_10002390 3300006163 Bacteria 5749
229 Ga0070715_10015014 3300006163 Bacteria 2881
230 Ga0070715_10097134 3300006163 Bacteria 1367
231 Ga0070716_100000050 3300006173 Bacteria 45407
232 Ga0070716_100050088 3300006173 Bacteria 2369
233 Ga0070712_100005798 3300006175 Bacteria 7634
234 Ga0075362_10121034 3300006177 Bacteria 1239
235 Ga0075367_10008892 3300006178 Bacteria 5226
236 Ga0075367_10097229 3300006178 Bacteria 1796
237 Ga0075366_10000836 3300006195 Bacteria 14794
238 Ga0075366_10020978 3300006195 Bacteria 3796
239 Ga0075366_10028692 3300006195 Bacteria 3267
240 Ga0075366_10062559 3300006195 Bacteria 2212
241 Ga0075366_10076286 3300006195 Bacteria 2000
242 Ga0097621_100353586 3300006237 Bacteria 1307
243 Ga0097621_100440970 3300006237 Bacteria 1172
244 Ga0097621_100462691 3300006237 Bacteria 1144
245 Ga0075370_10024452 3300006353 Bacteria 3337
246 Ga0068871_100668206 3300006358 Unclassified 950
247 Ga0075428_100004062 3300006844 Bacteria 16086
248 Ga0075428_100010676 3300006844 Bacteria 10210
249 Ga0075428_100020430 3300006844 Bacteria 7330
250 Ga0075428_100137915 3300006844 Bacteria 2652
251 Ga0075428_100160866 3300006844 Bacteria 2437
252 Ga0075430_100045092 3300006846 Bacteria 3726
253 Ga0075430_100063554 3300006846 Bacteria 3100
254 Ga0075430_100258209 3300006846 Unclassified 1443
255 Ga0075430_100294353 3300006846 Bacteria 1343
256 Ga0075430_100824955 3300006846 Bacteria 764
257 Ga0075431_100001840 3300006847 Bacteria 20074
258 Ga0075431_100005633 3300006847 Bacteria 12371
259 Ga0075431_100589381 3300006847 Unclassified 1096
260 Ga0075433_10043130 3300006852 Bacteria 3915
261 Ga0075433_10049158 3300006852 Bacteria 3669
262 Ga0075433_10307498 3300006852 Unclassified 1403
263 Ga0075433_10874300 3300006852 Unclassified 784
264 Ga0075433_10952368 3300006852 Unclassified 748
265 Ga0075434_100012547 3300006871 Bacteria 8036
266 Ga0075434_100060267 3300006871 Bacteria 3774
267 Ga0075434_100095942 3300006871 Bacteria 2970
268 Ga0075434_100138359 3300006871 Bacteria 2454
269 Ga0075429_100009961 3300006880 Bacteria 8236
270 Ga0075429_100077418 3300006880 Bacteria 2898
271 Ga0075429_100080733 3300006880 Bacteria 2836
272 Ga0075429_100159128 3300006880 Bacteria 1978
273 Ga0075429_100205693 3300006880 Bacteria 1725
274 Ga0075429_100228423 3300006880 Bacteria 1630
275 Ga0068865_100036003 3300006881 Bacteria 3334
276 Ga0075436_100016913 3300006914 Bacteria 4991
277 Ga0075436_100028074 3300006914 Bacteria 3873
278 Ga0097620_100010568 3300006931 Bacteria 9294
279 Ga0097620_100025922 3300006931 Bacteria 5881
280 Ga0097620_100087090 3300006931 Bacteria 3170
281 Ga0097620_100108725 3300006931 Bacteria 2834
282 Ga0097620_100340689 3300006931 Bacteria 1594
283 Ga0097620_100505320 3300006931 Bacteria 1304
284 Ga0097620_100539502 3300006931 Bacteria 1261
285 Ga0097620_101000804 3300006931 Bacteria 918
286 Ga0075435_100002704 3300007076 Bacteria 11832
287 Ga0075435_100209216 3300007076 Bacteria 1654
288 Ga0075435_100253936 3300007076 Unclassified 1497
289 Ga0099794_10002520 3300007265 Bacteria 6768
290 Ga0099795_10011963 3300007788 Bacteria 2615
291 Ga0105240_10018029 3300009093 Bacteria 9495
292 Ga0105240_10259156 3300009093 Bacteria 2007
293 Ga0105240_10934728 3300009093 Unclassified 931
294 Ga0111539_10001106 3300009094 Bacteria 35560
295 Ga0111539_10006798 3300009094 Bacteria 14713
296 Ga0111539_10015937 3300009094 Bacteria 9338
297 Ga0111539_10055371 3300009094 Bacteria 4714
298 Ga0111539_10225630 3300009094 Bacteria 2182
299 Ga0111539_10345720 3300009094 Bacteria 1731
300 Ga0105245_10140817 3300009098 Unclassified 2271
301 Ga0105245_10813838 3300009098 Bacteria 973
302 Ga0105245_10838736 3300009098 Unclassified 959
303 Ga0105245_10853180 3300009098 Bacteria 951
304 Ga0105245_11079299 3300009098 Bacteria 849
305 Ga0105247_10136707 3300009101 Bacteria 1602
306 Ga0105247_10168770 3300009101 Bacteria 1454
307 Ga0105247_10385639 3300009101 Archaea 995
308 Ga0105247_10766834 3300009101 Unclassified 733
309 Ga0114129_10022328 3300009147 Bacteria 8982
310 Ga0114129_10033620 3300009147 Bacteria 7245
311 Ga0114129_10038702 3300009147 Bacteria 6725
312 Ga0114129_10056972 3300009147 Bacteria 5471
313 Ga0114129_10745361 3300009147 Bacteria 1254
314 Ga0114129_10819886 3300009147 Bacteria 1185
315 Ga0105243_10002335 3300009148 Bacteria 15884
316 Ga0105243_10032181 3300009148 Bacteria 4050
317 Ga0105243_10321217 3300009148 Bacteria 1411
318 Ga0105243_10901333 3300009148 Unclassified 880
319 Ga0105241_10042510 3300009174 Bacteria 3438
320 Ga0105241_10082704 3300009174 Bacteria 2517
321 Ga0105241_10171289 3300009174 Bacteria 1793
322 Ga0105242_10842159 3300009176 Bacteria 912
323 Ga0105242_11033056 3300009176 Bacteria 832
324 Ga0105248_10026278 3300009177 Bacteria 6477
325 Ga0105248_10059487 3300009177 Bacteria 4292
326 Ga0105248_10059823 3300009177 Bacteria 4279
327 Ga0105248_10079788 3300009177 Bacteria 3678
328 Ga0105248_10097715 3300009177 Bacteria 3308
329 Ga0105248_10160862 3300009177 Bacteria 2533
330 Ga0105248_10194562 3300009177 Bacteria 2285
331 Ga0105248_10500947 3300009177 Unclassified 1369
332 Ga0105248_11230859 3300009177 Unclassified 847
333 Ga0105248_11463628 3300009177 Bacteria 773
334 Ga0105237_10001721 3300009545 Bacteria 28293
335 Ga0105237_10008802 3300009545 Bacteria 10886
336 Ga0105237_10014774 3300009545 Bacteria 8149
337 Ga0105237_10087229 3300009545 Bacteria 3110
338 Ga0105237_10135980 3300009545 Bacteria 2452
339 Ga0105237_10259716 3300009545 Bacteria 1740
340 Ga0105237_10508024 3300009545 Bacteria 1212
341 Ga0105237_10630434 3300009545 Bacteria 1079
342 Ga0105237_11075172 3300009545 Bacteria 811
343 Ga0105238_10001033 3300009551 Bacteria 28272
344 Ga0105238_10919791 3300009551 Bacteria 894
345 Ga0105249_10096507 3300009553 Bacteria 2774
346 Ga0105249_10235327 3300009553 Bacteria 1808
347 Ga0105249_10264288 3300009553 Bacteria 1711
348 Ga0105249_11935162 3300009553 Unclassified 662
349 Ga0099796_10021539 3300010159 Bacteria 1986
350 Ga0105239_10009580 3300010375 Bacteria 10897
351 Ga0105239_10053633 3300010375 Bacteria 4422
352 Ga0105239_10164712 3300010375 Unclassified 2479
353 Ga0105239_10597350 3300010375 Bacteria 1259
354 Ga0105239_11550835 3300010375 Unclassified 766
355 Ga0105239_11777807 3300010375 Unclassified 714
356 Ga0157373_10053968 3300013100 Bacteria 2857
357 Ga0157373_10531255 3300013100 Unclassified 852
358 Ga0157370_10069454 3300013104 Bacteria 3327
359 Ga0157369_10304643 3300013105 Bacteria 1657
360 Ga0157374_10001392 3300013296 Bacteria 20515
361 Ga0157374_11428631 3300013296 Unclassified 715
362 Ga0157378_10158261 3300013297 Bacteria 2116
363 Ga0163162_10083053 3300013306 Bacteria 3276
364 Ga0163162_10319826 3300013306 Bacteria 1684
365 Ga0163162_10837848 3300013306 Bacteria 1035
366 Ga0163162_11976172 3300013306 Unclassified 668
367 Ga0157372_10054725 3300013307 Bacteria 4453
368 Ga0157372_11088963 3300013307 Unclassified 924
369 Ga0157372_11137886 3300013307 Bacteria 903
370 Ga0157375_10028446 3300013308 Bacteria 5239
371 Ga0157375_10037395 3300013308 Bacteria 4651
372 Ga0157375_10156346 3300013308 Bacteria 2419
373 Ga0157375_10330970 3300013308 Bacteria 1688
374 Ga0157375_10446839 3300013308 Bacteria 1458
375 Ga0163163_10033211 3300014325 Bacteria 4990
376 Ga0163163_10204742 3300014325 Unclassified 2022
377 Ga0163163_10213352 3300014325 Bacteria 1979
378 Ga0163163_10515085 3300014325 Bacteria 1258
379 Ga0157380_10068228 3300014326 Unclassified 2866
380 Ga0157380_10090627 3300014326 Bacteria 2523
381 Ga0157380_10217130 3300014326 Unclassified 1708
382 Ga0157380_10408380 3300014326 Bacteria 1291
383 Ga0157377_10000016 3300014745 Bacteria 190613
384 Ga0157377_10018617 3300014745 Unclassified 3612
385 Ga0157377_10059263 3300014745 Bacteria 2182
386 Ga0157379_10001159 3300014968 Bacteria 21489
387 Ga0157379_10037015 3300014968 Bacteria 4350
388 Ga0157379_10079832 3300014968 Unclassified 2930
389 Ga0157379_10199455 3300014968 Bacteria 1809
390 Ga0157379_10225971 3300014968 Bacteria 1696
391 Ga0157379_10522715 3300014968 Unclassified 1102
392 Ga0157379_10585998 3300014968 Bacteria 1040
393 Ga0157376_10033179 3300014969 Bacteria 4153
394 Ga0157376_10307673 3300014969 Bacteria 1502
395 Ga0163161_10387651 3300017792 Bacteria 1118
396 Ga0206350_10772802 3300020080 Bacteria 1019
397 Ga0224712_10218062 3300022467 Bacteria 872
398 Ga0207692_10020756 3300025898 Unclassified 2994
399 Ga0207710_10078113 3300025900 Bacteria 1530
400 Ga0207710_10117218 3300025900 Bacteria 1269
401 Ga0207688_10099005 3300025901 Archaea 1682
402 Ga0207647_10001594 3300025904 Bacteria 17417
403 Ga0207685_10002906 3300025905 Unclassified 4045
404 Ga0207685_10294213 3300025905 Bacteria 801
405 Ga0207699_10026434 3300025906 Unclassified 3200
406 Ga0207699_10047879 3300025906 Unclassified 2509
407 Ga0207643_10018379 3300025908 Bacteria 3828
408 Ga0207684_10708161 3300025910 Bacteria 855
409 Ga0207684_11258556 3300025910 Unclassified 611
410 Ga0207654_10131880 3300025911 Bacteria 1582
411 Ga0207654_10162029 3300025911 Unclassified 1446
412 Ga0207707_10002368 3300025912 Bacteria 16983
413 Ga0207707_10009442 3300025912 Bacteria 8461
414 Ga0207707_10071683 3300025912 Bacteria 3019
415 Ga0207707_10112755 3300025912 Bacteria 2377
416 Ga0207707_10664879 3300025912 Unclassified 877
417 Ga0207695_10346039 3300025913 Bacteria 1374
418 Ga0207695_10615702 3300025913 Bacteria 967
419 Ga0207671_10001900 3300025914 Bacteria 23233
420 Ga0207671_10053773 3300025914 Bacteria 2984
421 Ga0207671_10092749 3300025914 Bacteria 2277
422 Ga0207671_10226224 3300025914 Bacteria 1467
423 Ga0207693_10005991 3300025915 Bacteria 10081
424 Ga0207693_10007609 3300025915 Bacteria 8899
425 Ga0207663_10003380 3300025916 Bacteria 7796
426 Ga0207663_10240558 3300025916 Bacteria 1327
427 Ga0207660_10004660 3300025917 Bacteria 8936
428 Ga0207660_10195764 3300025917 Bacteria 1576
429 Ga0207660_10209111 3300025917 Unclassified 1527
430 Ga0207660_10357902 3300025917 Bacteria 1171
431 Ga0207662_10002056 3300025918 Bacteria 9967
432 Ga0207662_10052620 3300025918 Bacteria 2423
433 Ga0207662_10143240 3300025918 Bacteria 1515
434 Ga0207662_10313284 3300025918 Unclassified 1046
435 Ga0207662_10319220 3300025918 Bacteria 1037
436 Ga0207649_10059601 3300025920 Unclassified 2396
437 Ga0207649_10230885 3300025920 Unclassified 1323
438 Ga0207652_10002131 3300025921 Bacteria 16979
439 Ga0207652_10716258 3300025921 Bacteria 892
440 Ga0207646_10062119 3300025922 Bacteria 3335
441 Ga0207646_10079619 3300025922 Bacteria 2929
442 Ga0207646_10320225 3300025922 Bacteria 1401
443 Ga0207694_10006772 3300025924 Bacteria 8701
444 Ga0207659_10503974 3300025926 Bacteria 1025
445 Ga0207659_10860970 3300025926 Bacteria 779
446 Ga0207700_10050625 3300025928 Bacteria 3096
447 Ga0207700_10157862 3300025928 Bacteria 1881
448 Ga0207700_10394453 3300025928 Bacteria 1212
449 Ga0207644_10019146 3300025931 Bacteria 4641
450 Ga0207644_10101093 3300025931 Bacteria 2166
451 Ga0207644_10413684 3300025931 Bacteria 1104
452 Ga0207690_10336154 3300025932 Bacteria 1191
453 Ga0207706_10021936 3300025933 Bacteria 5732
454 Ga0207706_10383604 3300025933 Bacteria 1219
455 Ga0207706_10446972 3300025933 Bacteria 1118
456 Ga0207709_10059523 3300025935 Bacteria 2378
457 Ga0207709_10135906 3300025935 Unclassified 1683
458 Ga0207670_10301660 3300025936 Bacteria 1254
459 Ga0207670_10451227 3300025936 Bacteria 1037
460 Ga0207670_10886905 3300025936 Bacteria 746
461 Ga0207704_10012737 3300025938 Bacteria 4180
462 Ga0207704_10037378 3300025938 Bacteria 2804
463 Ga0207665_10000152 3300025939 Bacteria 46840
464 Ga0207665_10034350 3300025939 Bacteria 3364
465 Ga0207665_10258940 3300025939 Bacteria 1288
466 Ga0207665_10351977 3300025939 Bacteria 1112
467 Ga0207691_10012672 3300025940 Bacteria 8076
468 Ga0207711_10145855 3300025941 Bacteria 2132
469 Ga0207711_10168238 3300025941 Bacteria 1988
470 Ga0207711_10384869 3300025941 Unclassified 1302
471 Ga0207711_10429799 3300025941 Unclassified 1229
472 Ga0207689_10000714 3300025942 Bacteria 31774
473 Ga0207689_10011996 3300025942 Bacteria 7427
474 Ga0207689_10035742 3300025942 Bacteria 4125
475 Ga0207689_10039547 3300025942 Bacteria 3904
476 Ga0207689_10153316 3300025942 Bacteria 1899
477 Ga0207689_10260168 3300025942 Bacteria 1435
478 Ga0207689_10373176 3300025942 Bacteria 1187
479 Ga0207689_10785132 3300025942 Unclassified 804
480 Ga0207661_10220853 3300025944 Unclassified 1675
481 Ga0207679_10093635 3300025945 Unclassified 2331
482 Ga0207667_10014052 3300025949 Bacteria 9139
483 Ga0207667_10189220 3300025949 Bacteria 2112
484 Ga0207667_10955404 3300025949 Unclassified 846
485 Ga0207651_10086667 3300025960 Bacteria 2277
486 Ga0207651_10152099 3300025960 Bacteria 1803
487 Ga0207651_11451213 3300025960 Unclassified 618
488 Ga0207712_10226210 3300025961 Bacteria 1499
489 Ga0207712_10643979 3300025961 Bacteria 920
490 Ga0207640_10527925 3300025981 Bacteria 988
491 Ga0207658_10318455 3300025986 Unclassified 1346
492 Ga0207677_10026673 3300026023 Bacteria 3628
493 Ga0207703_10031981 3300026035 Viruses 4162
494 Ga0207703_10038495 3300026035 Unclassified 3817
495 Ga0207703_10081574 3300026035 Bacteria 2697
496 Ga0207703_10093141 3300026035 Bacteria 2537
497 Ga0207703_10106248 3300026035 Bacteria 2387
498 Ga0207639_10012886 3300026041 Bacteria 5834
499 Ga0207639_10120883 3300026041 Bacteria 2151
500 Ga0207639_10134472 3300026041 Unclassified 2051
501 Ga0207639_10404437 3300026041 Unclassified 1230
502 Ga0207639_10558588 3300026041 Unclassified 1051
503 Ga0207678_10053430 3300026067 Bacteria 3481
504 Ga0207678_10442456 3300026067 Unclassified 1129
505 Ga0207708_10039135 3300026075 Bacteria 3612
506 Ga0207708_10073706 3300026075 Bacteria 2617
507 Ga0207708_10810798 3300026075 Unclassified 806
508 Ga0207702_10128798 3300026078 Bacteria 2275
509 Ga0207702_10212614 3300026078 Unclassified 1799
510 Ga0207702_10935296 3300026078 Unclassified 859
511 Ga0207702_11054546 3300026078 Unclassified 807
512 Ga0207702_11171935 3300026078 Bacteria 763
513 Ga0207641_10064366 3300026088 Unclassified 3134
514 Ga0207641_10093744 3300026088 Bacteria 2632
515 Ga0207641_10189127 3300026088 Bacteria 1891
516 Ga0207648_10000343 3300026089 Bacteria 51081
517 Ga0207648_10026411 3300026089 Bacteria 5160
518 Ga0207648_10232089 3300026089 Bacteria 1641
519 Ga0207648_10279704 3300026089 Unclassified 1492
520 Ga0207676_10376477 3300026095 Unclassified 1320
521 Ga0207676_11535485 3300026095 Unclassified 663
522 Ga0207674_10093844 3300026116 Bacteria 2989
523 Ga0207674_10111698 3300026116 Unclassified 2707
524 Ga0207674_10173162 3300026116 Unclassified 2111
525 Ga0207674_10236182 3300026116 Bacteria 1775
526 Ga0207674_10314588 3300026116 Bacteria 1515
527 Ga0207674_10479225 3300026116 Bacteria 1203
528 Ga0207674_11225739 3300026116 Bacteria 720
529 Ga0207675_100004242 3300026118 Bacteria 13862
530 Ga0207675_100011414 3300026118 Bacteria 8313
531 Ga0207675_100236365 3300026118 Bacteria 1764
532 Ga0207675_100263506 3300026118 Bacteria 1671
533 Ga0207675_100302501 3300026118 Unclassified 1558
534 Ga0207675_100421248 3300026118 Bacteria 1319
535 Ga0207683_10090582 3300026121 Bacteria 2724
536 Ga0207683_10718697 3300026121 Bacteria 926
537 Ga0207698_10169642 3300026142 Unclassified 1920
538 Ga0207698_10183760 3300026142 Bacteria 1855
539 Ga0207698_10351329 3300026142 Unclassified 1393
540 Ga0209813_10124682 3300027866 Bacteria 900
541 Ga0209813_10274063 3300027866 Unclassified 648
542 Ga0209974_10012502 3300027876 Bacteria 2838
543 Ga0207428_10000633 3300027907 Bacteria 41339
544 Ga0207428_10018443 3300027907 Bacteria 5961
545 Ga0207428_10030638 3300027907 Bacteria 4445
546 Ga0207428_10047259 3300027907 Bacteria 3456
547 Ga0268265_10114994 3300028380 Bacteria 2204
548 Ga0268265_10286315 3300028380 Bacteria 1477
549 Ga0268265_10291801 3300028380 Bacteria 1464
550 Ga0268265_10414052 3300028380 Bacteria 1249
551 Ga0268265_11026149 3300028380 Bacteria 816
552 Ga0268264_10000051 3300028381 Bacteria 321565
553 Ga0268264_10078054 3300028381 Unclassified 2822
554 Ga0268264_10162352 3300028381 Unclassified 2014
555 Ga0268264_10196321 3300028381 Bacteria 1843
556 Ga0265337_1005772 3300028556 Bacteria 4859
557 Ga0265326_10100657 3300028558 Bacteria 819
558 Ga0307515_10030972 3300028794 Bacteria 8950
559 Ga0265338_10037653 3300028800 Bacteria 4598
560 Ga0265320_10000141 3300031240 Bacteria 61166
561 Ga0265340_10009210 3300031247 Bacteria 5306
562 Ga0265339_10138922 3300031249 Bacteria 1237
563 Ga0265331_10195679 3300031250 Bacteria 911
564 Ga0265327_10000010 3300031251 Bacteria 566817
565 Ga0265316_10000552 3300031344 Bacteria 42074
566 Ga0265316_10139818 3300031344 Bacteria 1819
567 Ga0307513_10055061 3300031456 Bacteria 4259
568 Ga0307509_10066136 3300031507 Bacteria 3794
569 Ga0307509_10080563 3300031507 Bacteria 3366
570 Ga0307509_10134566 3300031507 Bacteria 2420
571 Ga0307509_10632058 3300031507 Bacteria 740
572 Ga0307508_10028223 3300031616 Bacteria 5075
573 Ga0307508_10101106 3300031616 Bacteria 2479
574 Ga0316575_10000971 3300031665 Bacteria 8844
575 Ga0265314_10001011 3300031711 Bacteria 32906
576 Ga0265314_10240058 3300031711 Bacteria 1046
577 Ga0265342_10006483 3300031712 Bacteria 8714
578 Ga0307516_10002069 3300031730 Bacteria 27319
579 Ga0307516_10351299 3300031730 Bacteria 1140
580 Ga0307405_10005702 3300031731 Bacteria 6042
581 Ga0307416_100038314 3300032002 Bacteria 3698
582 Ga0307416_101603016 3300032002 Unclassified 756
583 Ga0316583_10001913 3300032133 Bacteria 7108
584 Ga0307507_10033111 3300033179 Bacteria 5374
585 Ga0307507_10333502 3300033179 Bacteria 904
586 Ga0307510_10080098 3300033180 Bacteria 3178
587 Ga0373948_0043097 3300034817 Bacteria 950
588 Ga0373938_0019463 3300034957 Bacteria 1358
589 Ga0373934_0014118 3300035086 Bacteria 3024
590 Ga0373934_0074528 3300035086 Bacteria 1360
591 Ga0373951_0048717 3300035091 Unclassified 1038
592 Ga0373954_0004315 3300035118 Bacteria 6111
593 Ga0373956_0004155 3300035119 Bacteria 5806
594 Ga0373943_0082552 3300035170 Bacteria 1650
595 Ga0373955_0003273 3300035172 Bacteria 7101
596 Ga0373955_0079239 3300035172 Bacteria 1853
597 Ga0373961_0153734 3300035241 Bacteria 786
598 Ga0373962_0014399 3300035242 Unclassified 2016
599 Ga0316574_0002419 3300035398 Bacteria 9366
600 Ga0373924_0091050 3300035410 Unclassified 1305
601 Ga0373931_0870609 3300035691 Bacteria 604
602 Ga0373935_0532092 3300035692 Bacteria 855
603 Ga0373927_0018429 3300035695 Bacteria 4588
604 Ga0373933_0000809 3300035724 Bacteria 19079
605 Ga0373937_0023561 3300036401 Bacteria 5544
606 Ga0373937_0744054 3300036401 Bacteria 928
607 Ga0395900_0030020 3300037418 Bacteria 5580
608 Ga0395898_0864815 3300037466 Bacteria 843
609 Ga0395905_0196637 3300037471 Bacteria 1891
610 Ga0395905_1025507 3300037471 Bacteria 728
611 Ga0395901_0546109 3300038443 Unclassified 1175
612 Ga0242420_001992 3300038996 Unclassified 2844
613 Ga0439439_0041353 3300041406 Bacteria 1195
614 Ga0451789_0643364 3300041443 Bacteria 1186
615 Ga0451793_0666774 3300041452 Bacteria 851
616 Ga0451853_2163079 3300041512 Bacteria 677
617 Ga0439449_0010774 3300042007 Bacteria 3450
618 Ga0439457_011054 3300042014 Bacteria 2061
619 Ga0439435_0017308 3300042436 Bacteria 1820
620 Ga0451577_0710649 3300042876 Bacteria 910
621 Ga0466963_0004899 3300044694 Bacteria 7807
622 Ga0453684_0775695 3300044712 Bacteria 1036
623 Ga0453684_1154500 3300044712 Unclassified 815
624 Ga0466957_0017882 3300044842 Bacteria 4159
625 Ga0451576_0033779 3300045051 Bacteria 5435
626 Ga0451576_0104032 3300045051 Bacteria 2953
627 Ga0451576_0144528 3300045051 Bacteria 2480
628 Ga0451576_1613762 3300045051 Unclassified 673
629 Ga0466958_0037410 3300045836 Bacteria 2908
630 Ga0466967_0041955 3300045976 Unclassified 3950
631 Ga0495592_0367743 3300046454 Bacteria 918
632 Ga0495629_0026281 3300046459 Unclassified 4137
633 Ga0495629_0162836 3300046459 Bacteria 1549
634 Ga0495651_0180420 3300046462 Bacteria 1495
635 Ga0495651_0248175 3300046462 Bacteria 1217
636 Ga0495651_0298298 3300046462 Bacteria 1082
637 Ga0495580_0001866 3300046472 Bacteria 18532
638 Ga0495580_0095254 3300046472 Bacteria 2071
639 Ga0495580_0377530 3300046472 Bacteria 958
640 Ga0495582_0001408 3300046473 Bacteria 13557
641 Ga0495582_0063020 3300046473 Bacteria 2048
642 Ga0495639_0030136 3300046475 Bacteria 2411
643 Ga0495662_0034990 3300046476 Bacteria 2424
644 Ga0495664_0246852 3300046477 Bacteria 1080
645 Ga0495664_0478343 3300046477 Bacteria 745
646 Ga0495594_0184499 3300046499 Unclassified 1188
647 Ga0495608_0015603 3300046511 Bacteria 5263
648 Ga0495618_0029851 3300046514 Bacteria 3403
649 Ga0495630_0595865 3300046517 Unclassified 847
650 Ga0495644_0043944 3300046523 Bacteria 1681
651 Ga0495586_0041739 3300046535 Bacteria 2471
652 Ga0495586_0047074 3300046535 Bacteria 2326
653 Ga0495587_0023501 3300046536 Bacteria 3787
654 Ga0495587_0563753 3300046536 Unclassified 628
655 Ga0495598_0070098 3300046537 Bacteria 1102
656 Ga0495645_0151926 3300046543 Unclassified 1608
657 Ga0495668_0245441 3300046616 Bacteria 980
658 Ga0495634_0192837 3300046642 Unclassified 1270
659 Ga0495635_0033802 3300046663 Bacteria 3547
660 Ga0495588_0368948 3300046674 Bacteria 754
661 Ga0495657_0311656 3300046675 Bacteria 937
662 Ga0495623_0345045 3300046679 Unclassified 812
663 Ga0495613_0079002 3300046689 Bacteria 2393
664 Ga0495613_0455208 3300046689 Unclassified 867
665 Ga0495649_0268699 3300046694 Bacteria 873
666 Ga0495600_0193172 3300046809 Bacteria 1308
667 Ga0495581_0599848 3300047315 Bacteria 638
668 Ga0495604_0177394 3300047317 Bacteria 1492
669 Ga0495674_0015352 3300047319 Bacteria 7164
670 Ga0495674_0240637 3300047319 Bacteria 1491
671 Ga0495680_0150730 3300047322 Unclassified 1696
672 Ga0495677_0149489 3300047445 Unclassified 899
673 Ga0495684_0036290 3300047471 Bacteria 3780
674 Ga0495602_0256016 3300048088 Unclassified 1301
675 Ga0496101_0349801 3300048904 Bacteria 1161
676 Ga0496102_0050697 3300048905 Bacteria 3780
677 Ga0496102_0230850 3300048905 Bacteria 1745
678 Ga0496102_0417831 3300048905 Bacteria 1260
679 Ga0496103_0013067 3300048906 Bacteria 4923
680 Ga0496104_0040484 3300048907 Bacteria 4367
681 Ga0496105_0164950 3300048908 Bacteria 1818
682 Ga0496106_0173155 3300048909 Unclassified 1712
683 Ga0496107_0027625 3300048910 Bacteria 4029
684 Ga0496107_0468620 3300048910 Unclassified 935
685 Ga0496109_0025483 3300048912 Bacteria 5271
686 Ga0496109_0812446 3300048912 Unclassified 873
687 Ga0496110_0059697 3300048913 Bacteria 3362
688 Ga0496111_0010111 3300048914 Bacteria 6316
689 Ga0496112_0010806 3300048915 Bacteria 8304
690 Ga0496112_0104179 3300048915 Unclassified 2807
691 Ga0496113_0013516 3300048916 Bacteria 5535
692 Ga0496114_0010721 3300048917 Bacteria 7295
693 Ga0496114_0027017 3300048917 Bacteria 4701
694 Ga0496115_0026703 3300048918 Bacteria 4509
695 Ga0496117_0522459 3300048920 Unclassified 571
696 Ga0496121_0157792 3300048924 Bacteria 1663
697 Ga0496121_0201374 3300048924 Bacteria 1419
698 Ga0496121_0301368 3300048924 Bacteria 1087
699 Ga0496126_0078190 3300048929 Bacteria 2932
700 Ga0501032_0001778 3300049569 Bacteria 17010
701 Ga0501032_0163357 3300049569 Bacteria 1462
702 Ga0501033_0006961 3300049570 Bacteria 8829
703 Ga0501033_0021858 3300049570 Bacteria 4828
704 Ga0501034_0017005 3300049571 Bacteria 7456
705 Ga0501034_0022252 3300049571 Bacteria 6460
706 Ga0501034_0037976 3300049571 Bacteria 4877
707 Ga0501034_0265253 3300049571 Unclassified 1659
708 Ga0501036_0001304 3300049572 Bacteria 19109
709 Ga0501036_0074907 3300049572 Bacteria 2863
710 Ga0501037_0000852 3300049573 Bacteria 22742
711 Ga0501037_0299833 3300049573 Unclassified 1116
712 Ga0501038_0003040 3300049574 Bacteria 15641
713 Ga0501038_0356423 3300049574 Bacteria 1138
714 Ga0501043_0008849 3300049579 Bacteria 7921
715 Ga0501043_0303286 3300049579 Bacteria 1220
716 Ga0501046_0002656 3300049580 Bacteria 16682
717 Ga0501046_0049736 3300049580 Bacteria 3315
718 Ga0501047_0007261 3300049581 Bacteria 10415
719 Ga0501047_0024643 3300049581 Bacteria 5775
720 Ga0501047_0062899 3300049581 Bacteria 3580
721 Ga0501048_0004121 3300049582 Bacteria 11077
722 Ga0501067_0001824 3300049583 Bacteria 11700
723 Ga0501067_0168459 3300049583 Unclassified 1220
724 Ga0501068_0000234 3300049584 Bacteria 26949
725 Ga0501068_0216293 3300049584 Unclassified 1217
726 Ga0501068_0284314 3300049584 Bacteria 1057
727 Ga0501069_0003617 3300049585 Bacteria 7964
728 Ga0501070_0000512 3300049586 Bacteria 35492
729 Ga0501070_0005792 3300049586 Bacteria 10543
730 Ga0501071_1004554 3300049587 Bacteria 644
731 Ga0501071_1470691 3300049587 Bacteria 526
732 Ga0501072_0002523 3300049588 Bacteria 13706
733 Ga0501073_0000482 3300049589 Bacteria 27716
734 Ga0501073_0000939 3300049589 Bacteria 20943
735 Ga0501073_0004075 3300049589 Bacteria 10956
736 Ga0501074_0011232 3300049590 Bacteria 6508
737 Ga0501075_0514956 3300049591 Bacteria 913
738 Ga0501076_0010528 3300049592 Bacteria 6864
739 Ga0501076_0021485 3300049592 Bacteria 4952
740 Ga0501076_0945888 3300049592 Bacteria 710
741 Ga0501077_0036595 3300049593 Bacteria 3127
742 Ga0501227_000344 3300049665 Bacteria 9808
743 Ga0501233_004341 3300049668 Bacteria 2595
744 Ga0501221_037828 3300049704 Unclassified 1040
745 Ga0501079_0002938 3300049741 Bacteria 12452
746 Ga0501079_0613949 3300049741 Bacteria 856
747 Ga0501080_0001468 3300049742 Bacteria 19844
748 Ga0501080_0006766 3300049742 Bacteria 10326
749 Ga0501080_0615792 3300049742 Bacteria 963
750 Ga0501081_0060404 3300049743 Bacteria 2626
751 Ga0501081_0265180 3300049743 Bacteria 1256
752 Ga0501081_0313634 3300049743 Bacteria 1152
753 Ga0501083_0004962 3300049744 Bacteria 9428
754 Ga0501083_0010679 3300049744 Bacteria 6460
755 Ga0501035_0029424 3300049822 Bacteria 5008
756 Ga0501035_0713565 3300049822 Bacteria 808
757 Ga0501044_0011048 3300049823 Bacteria 9793
758 Ga0501044_0017635 3300049823 Bacteria 7657
759 Ga0501044_0023212 3300049823 Bacteria 6601
760 nmdc:mga03683_139567_c1 3300050489 Bacteria 1089
761 nmdc:mga03683_26201_c1 3300050489 Bacteria 2298
762 nmdc:mga00v17_71326_c1 3300050491 Bacteria 2153
763 nmdc:mga00v17_84765_c1 3300050491 Bacteria 1984
764 nmdc:mga0yw44_40072_c1 3300050492 Bacteria 2781
765 nmdc:mga0k408_1207_c1 3300050493 Bacteria 14149
766 nmdc:mga0k408_152975_c1 3300050493 Bacteria 1374
767 nmdc:mga0k408_15687_c1 3300050493 Bacteria 4194
768 nmdc:mga0k408_204207_c1 3300050493 Unclassified 1180
769 nmdc:mga06z11_338229_c1 3300050494 Unclassified 900
770 nmdc:mga06z11_510447_c1 3300050494 Unclassified 729
771 nmdc:mga06z11_5693_c1 3300050494 Bacteria 5019
772 nmdc:mga04h51_111939_c1 3300050495 Bacteria 1007
773 nmdc:mga04h51_151709_c1 3300050495 Bacteria 886
774 nmdc:mga04h51_41577_c1 3300050495 Bacteria 1503
775 nmdc:mga04h51_87458_c1 3300050495 Bacteria 1116
776 nmdc:mga07m45_35738_c1 3300050496 Bacteria 2764
777 nmdc:mga05p37_1072532_c1 3300050507 Unclassified 847
778 nmdc:mga05p37_128315_c1 3300050507 Bacteria 3113
779 nmdc:mga05p37_16430_c1 3300050507 Bacteria 8918
780 nmdc:mga05p37_17427_c1 3300050507 Bacteria 8669
781 nmdc:mga05p37_181361_c1 3300050507 Bacteria 2561
782 nmdc:mga05p37_36945_c1 3300050507 Bacteria 5991
783 nmdc:mga05p37_464681_c1 3300050507 Bacteria 1461
784 nmdc:mga09592_116016_c1 3300050508 Bacteria 2298
785 nmdc:mga09592_119729_c1 3300050508 Bacteria 2261
786 nmdc:mga09592_193971_c1 3300050508 Bacteria 1758
787 nmdc:mga09592_757283_c1 3300050508 Bacteria 824
788 nmdc:mga0qj67_1060069_c1 3300050509 Unclassified 634
789 nmdc:mga0qj67_66287_c1 3300050509 Bacteria 2876
790 nmdc:mga0qj67_713713_c1 3300050509 Bacteria 797
791 nmdc:mga0qj67_85972_c1 3300050509 Bacteria 2523
792 nmdc:mga06r32_1484305_c1 3300050510 Unclassified 618
793 nmdc:mga06r32_20627_c1 3300050510 Bacteria 6070
794 nmdc:mga06r32_572_c1 3300050510 Bacteria 32014
795 nmdc:mga06r32_578803_c1 3300050510 Bacteria 1095
796 nmdc:mga06r32_604454_c1 3300050510 Bacteria 1067
797 nmdc:mga08y16_114314_c1 3300050511 Unclassified 2810
798 nmdc:mga08y16_117724_c1 3300050511 Bacteria 2765
799 nmdc:mga08y16_1363715_c1 3300050511 Unclassified 674
800 nmdc:mga08y16_4466_c1 3300050511 Bacteria 14618
801 nmdc:mga08y16_576945_c1 3300050511 Bacteria 1136
802 nmdc:mga08y16_6186_c1 3300050511 Bacteria 12561
803 nmdc:mga0n895_23728_c1 3300050512 Bacteria 5770
804 nmdc:mga0n895_441881_c1 3300050512 Unclassified 1314
805 nmdc:mga0n895_696469_c1 3300050512 Bacteria 1012
806 nmdc:mga0n895_710305_c1 3300050512 Bacteria 1001
807 nmdc:mga0n895_784385_c1 3300050512 Bacteria 944
808 nmdc:mga0n895_94016_c1 3300050512 Bacteria 3001
809 nmdc:mga0rr50_365612_c1 3300050513 Bacteria 1215
810 nmdc:mga0rr50_455605_c1 3300050513 Bacteria 1085
811 nmdc:mga08x19_14234_c1 3300050514 Unclassified 4822
812 nmdc:mga08x19_205403_c1 3300050514 Unclassified 1351
813 nmdc:mga08x19_23637_c1 3300050514 Unclassified 3814
814 nmdc:mga08x19_319717_c1 3300050514 Unclassified 1080
815 nmdc:mga0a205_100493_c1 3300050515 Bacteria 2791
816 nmdc:mga0a205_113170_c1 3300050515 Bacteria 2613
817 nmdc:mga0a205_5039_c1 3300050515 Bacteria 11897
818 nmdc:mga0a205_6643_c1 3300050515 Bacteria 6923
819 Ga0500635_0005541 3300053080 Bacteria 3318
820 Ga0495655_0041471 3300053083 Bacteria 1177
821 Ga0495619_0182471 3300053085 Unclassified 1452
822 Ga0500644_0000027 3300053088 Bacteria 92870
823 Ga0500646_0030543 3300053090 Bacteria 1479
824 Ga0500647_0157488 3300053091 Bacteria 1056
825 Ga0500583_0046558 3300053092 Bacteria 1996
826 Ga0500651_0254138 3300053093 Bacteria 1021
827 Ga0500566_0064756 3300053094 Bacteria 2063
828 Ga0500555_010682 3300053103 Bacteria 2635
829 Ga0500562_000016 3300053108 Bacteria 131323
830 Ga0500595_004150 3300053119 Bacteria 6568
831 Ga0500595_019866 3300053119 Bacteria 2429
832 Ga0500655_049980 3300053133 Bacteria 832
833 Ga0500658_0002143 3300053134 Bacteria 7677
834 Ga0500568_0013430 3300053139 Bacteria 3733
835 Ga0500568_0189182 3300053139 Bacteria 756
836 Ga0500573_0042324 3300053140 Bacteria 2630
837 Ga0500590_000161 3300053148 Bacteria 19480
838 Ga0500590_052882 3300053148 Bacteria 2060
839 Ga0500603_005162 3300053150 Bacteria 2801
840 Ga0500616_0013104 3300053153 Unclassified 4828
841 Ga0500622_0139946 3300053156 Unclassified 1155
842 Ga0500633_0000539 3300053160 Bacteria 6118
843 Ga0500634_0131591 3300053161 Bacteria 1200
844 Ga0500636_0064701 3300053177 Bacteria 2129
845 Ga0500636_0076909 3300053177 Bacteria 1929
846 Ga0500611_030026 3300053727 Bacteria 1117
847 Ga0500596_022312 3300053735 Bacteria 956
848 Ga0501084_0014970 3300054114 Bacteria 6430
849 Ga0500661_004595 3300055283 Bacteria 2580
850 Ga0501082_0004844 3300060353 Bacteria 11736
851 Ga0501082_0005564 3300060353 Bacteria 10939
852 Ga0501082_0020308 3300060353 Bacteria 5727
853 Ga0501082_0260899 3300060353 Bacteria 1507
854 Ga0501082_0342384 3300060353 Bacteria 1303
855 Ga0501082_0376574 3300060353 Unclassified 1238
856 Ga0501082_1340798 3300060353 Bacteria 625
857 Ga0530510_0194767 3300061734 Bacteria 1505

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026118 Ga0207675_100236365 Ga0207675_1002363651 159
2 3300037471 Ga0395905_1025507 Ga0395905_1025507_63_554 160
3 3300044712 Ga0453684_0775695 Ga0453684_0775695_476_973 160
4 3300049592 Ga0501076_0945888 Ga0501076_0945888_209_700 160
5 3300050494 nmdc:mga06z11_510447_c1 nmdc:mga06z11_510447_c1_13_504 160
6 3300026089 Ga0207648_10279704 Ga0207648_102797041 161
7 3300035241 Ga0373961_0153734 Ga0373961_0153734_33_527 161
8 3300048904 Ga0496101_0349801 Ga0496101_0349801_644_1138 161
9 3300048920 Ga0496117_0522459 Ga0496117_0522459_58_552 161
10 3300049587 Ga0501071_1470691 Ga0501071_1470691_10_513 161
11 3300050509 nmdc:mga0qj67_1060069_c1 nmdc:mga0qj67_1060069_c1_121_621 161
12 3300050512 nmdc:mga0n895_784385_c1 nmdc:mga0n895_784385_c1_51_551 161
13 3300060353 Ga0501082_1340798 Ga0501082_1340798_11_514 161
14 3300014969 Ga0157376_10307673 Ga0157376_103076732 162
15 3300050511 nmdc:mga08y16_576945_c1 nmdc:mga08y16_576945_c1_614_1126 166
16 3300005330 Ga0070690_100345247 Ga0070690_1003452472 170
17 iso_pu_bacteria 2883068021 2883071284 172
18 3300005336 Ga0070680_100238817 Ga0070680_1002388172 173
19 3300005344 Ga0070661_100063225 Ga0070661_1000632251 173
20 3300005458 Ga0070681_10015651 Ga0070681_100156511 173
21 3300005530 Ga0070679_100095719 Ga0070679_1000957192 173
22 3300005539 Ga0068853_100020681 Ga0068853_1000206815 173
23 3300005577 Ga0068857_100094474 Ga0068857_1000944742 173
24 3300013307 Ga0157372_10054725 Ga0157372_100547252 173
25 3300025912 Ga0207707_10112755 Ga0207707_101127553 173
26 3300025920 Ga0207649_10230885 Ga0207649_102308851 173
27 3300025949 Ga0207667_10955404 Ga0207667_109554041 173
28 3300026041 Ga0207639_10404437 Ga0207639_104044372 173
29 3300026067 Ga0207678_10442456 Ga0207678_104424561 173
30 3300026116 Ga0207674_10093844 Ga0207674_100938442 173
31 3300050510 nmdc:mga06r32_1484305_c1 nmdc:mga06r32_1484305_c1_38_586 173
32 3300005435 Ga0070714_100002872 Ga0070714_1000028728 174
33 3300049572 Ga0501036_0074907 Ga0501036_0074907_791_1324 174
34 3300049579 Ga0501043_0303286 Ga0501043_0303286_26_553 174
35 3300049592 Ga0501076_0021485 Ga0501076_0021485_2095_2628 174
36 3300049742 Ga0501080_0615792 Ga0501080_0615792_96_629 174
37 3300049743 Ga0501081_0060404 Ga0501081_0060404_810_1343 174
38 3300049822 Ga0501035_0713565 Ga0501035_0713565_102_635 174
39 3300053094 Ga0500566_0064756 Ga0500566_0064756_1513_2046 174
40 3300053119 Ga0500595_019866 Ga0500595_019866_14_547 174
41 3300060353 Ga0501082_0342384 Ga0501082_0342384_295_828 174
42 3300006237 Ga0097621_100353586 Ga0097621_1003535862 175
43 3300007788 Ga0099795_10011963 Ga0099795_100119632 175
44 3300053119 Ga0500595_004150 Ga0500595_004150_119_661 175
45 3300048910 Ga0496107_0468620 Ga0496107_0468620_270_824 176
46 3300048917 Ga0496114_0010721 Ga0496114_0010721_3957_4511 176
47 3300014325 Ga0163163_10033211 Ga0163163_100332114 177
48 3300036401 Ga0373937_0744054 Ga0373937_0744054_227_784 177
49 3300049668 Ga0501233_004341 Ga0501233_004341_223_771 177
50 3300049704 Ga0501221_037828 Ga0501221_037828_245_793 177
51 3300009147 Ga0114129_10033620 Ga0114129_100336208 178
52 3300009174 Ga0105241_10171289 Ga0105241_101712893 178
53 3300050507 nmdc:mga05p37_17427_c1 nmdc:mga05p37_17427_c1_5383_5928 178
54 3300050509 nmdc:mga0qj67_66287_c1 nmdc:mga0qj67_66287_c1_1204_1749 178
55 3300050510 nmdc:mga06r32_20627_c1 nmdc:mga06r32_20627_c1_4585_5130 178
56 3300053156 Ga0500622_0139946 Ga0500622_0139946_218_769 178
57 iso_pu_bacteria 2513237351 2514587098 178
58 3300005616 Ga0068852_100918849 Ga0068852_1009188491 179
59 3300013100 Ga0157373_10531255 Ga0157373_105312552 179
60 3300013306 Ga0163162_10083053 Ga0163162_100830535 179
61 3300013307 Ga0157372_11088963 Ga0157372_110889632 179
62 3300050508 nmdc:mga09592_119729_c1 nmdc:mga09592_119729_c1_896_1444 179
63 3300053088 Ga0500644_0000027 Ga0500644_0000027_53891_54448 179
64 3300053139 Ga0500568_0013430 Ga0500568_0013430_2723_3277 179
65 3300053160 Ga0500633_0000539 Ga0500633_0000539_5007_5564 179
66 3300053161 Ga0500634_0131591 Ga0500634_0131591_470_1027 179
67 3300061734 Ga0530510_0194767 Ga0530510_0194767_736_1287 179
68 iso_pu_bacteria 2513237138 2513868904 179
69 iso_pu_bacteria 2923556063 2923557466 179
70 3300005293 Ga0065715_10102710 Ga0065715_101027102 180
71 3300005546 Ga0070696_100041264 Ga0070696_1000412642 180
72 3300009147 Ga0114129_10745361 Ga0114129_107453611 180
73 3300013308 Ga0157375_10330970 Ga0157375_103309703 180
74 3300025910 Ga0207684_11258556 Ga0207684_112585561 180
75 3300044712 Ga0453684_1154500 Ga0453684_1154500_254_805 180
76 3300053090 Ga0500646_0030543 Ga0500646_0030543_59_619 180
77 3300053092 Ga0500583_0046558 Ga0500583_0046558_110_670 180
78 3300053093 Ga0500651_0254138 Ga0500651_0254138_311_871 180
79 3300053134 Ga0500658_0002143 Ga0500658_0002143_2820_3380 180
80 3300053153 Ga0500616_0013104 Ga0500616_0013104_2019_2579 180
81 iso_pu_bacteria 2929921140 2929927826 180
82 3300005328 Ga0070676_10622773 Ga0070676_106227731 181
83 3300005329 Ga0070683_101315910 Ga0070683_1013159102 181
84 3300005334 Ga0068869_100065811 Ga0068869_1000658112 181
85 3300005343 Ga0070687_100399135 Ga0070687_1003991351 181
86 3300005354 Ga0070675_100045392 Ga0070675_1000453924 181
87 3300005365 Ga0070688_100689858 Ga0070688_1006898582 181
88 3300005437 Ga0070710_10221536 Ga0070710_102215361 181
89 3300005458 Ga0070681_10006494 Ga0070681_100064941 181
90 3300005471 Ga0070698_100438136 Ga0070698_1004381362 181
91 3300005530 Ga0070679_100002404 Ga0070679_10000240412 181
92 3300005545 Ga0070695_100361274 Ga0070695_1003612741 181
93 3300005545 Ga0070695_100959447 Ga0070695_1009594471 181
94 3300005614 Ga0068856_100234971 Ga0068856_1002349711 181
95 3300006852 Ga0075433_10043130 Ga0075433_100431304 181
96 3300006871 Ga0075434_100012547 Ga0075434_1000125472 181
97 3300007076 Ga0075435_100253936 Ga0075435_1002539363 181
98 3300009098 Ga0105245_10140817 Ga0105245_101408172 181
99 3300009098 Ga0105245_10838736 Ga0105245_108387361 181
100 3300009101 Ga0105247_10766834 Ga0105247_107668341 181
101 3300009147 Ga0114129_10056972 Ga0114129_100569724 181
102 3300009177 Ga0105248_11230859 Ga0105248_112308592 181
103 3300013297 Ga0157378_10158261 Ga0157378_101582612 181
104 3300025912 Ga0207707_10002368 Ga0207707_100023681 181
105 3300025917 Ga0207660_10004660 Ga0207660_100046601 181
106 3300025918 Ga0207662_10143240 Ga0207662_101432401 181
107 3300025921 Ga0207652_10002131 Ga0207652_100021311 181
108 3300025942 Ga0207689_10035742 Ga0207689_100357424 181
109 3300026041 Ga0207639_10558588 Ga0207639_105585882 181
110 3300026078 Ga0207702_10128798 Ga0207702_101287983 181
111 3300026078 Ga0207702_11054546 Ga0207702_110545461 181
112 3300028380 Ga0268265_11026149 Ga0268265_110261492 181
113 3300028381 Ga0268264_10196321 Ga0268264_101963212 181
114 3300031731 Ga0307405_10005702 Ga0307405_100057026 181
115 3300035086 Ga0373934_0014118 Ga0373934_0014118_2023_2577 181
116 3300035091 Ga0373951_0048717 Ga0373951_0048717_89_643 181
117 3300035118 Ga0373954_0004315 Ga0373954_0004315_5006_5560 181
118 3300035119 Ga0373956_0004155 Ga0373956_0004155_1916_2470 181
119 3300035172 Ga0373955_0003273 Ga0373955_0003273_6254_6808 181
120 3300035242 Ga0373962_0014399 Ga0373962_0014399_425_979 181
121 3300035724 Ga0373933_0000809 Ga0373933_0000809_2147_2701 181
122 3300036401 Ga0373937_0023561 Ga0373937_0023561_2843_3397 181
123 3300037471 Ga0395905_0196637 Ga0395905_0196637_271_831 181
124 3300038996 Ga0242420_001992 Ga0242420_001992_1450_2004 181
125 3300045976 Ga0466967_0041955 Ga0466967_0041955_3302_3898 181
126 3300046462 Ga0495651_0248175 Ga0495651_0248175_39_593 181
127 3300046511 Ga0495608_0015603 Ga0495608_0015603_4251_4805 181
128 3300046536 Ga0495587_0023501 Ga0495587_0023501_2022_2576 181
129 3300046679 Ga0495623_0345045 Ga0495623_0345045_242_796 181
130 3300047317 Ga0495604_0177394 Ga0495604_0177394_135_689 181
131 3300047471 Ga0495684_0036290 Ga0495684_0036290_2274_2828 181
132 3300048088 Ga0495602_0256016 Ga0495602_0256016_281_835 181
133 3300048909 Ga0496106_0173155 Ga0496106_0173155_32_589 181
134 3300048915 Ga0496112_0104179 Ga0496112_0104179_323_877 181
135 3300049665 Ga0501227_000344 Ga0501227_000344_2898_3458 181
136 3300050512 nmdc:mga0n895_23728_c1 nmdc:mga0n895_23728_c1_4641_5195 181
137 3300050512 nmdc:mga0n895_441881_c1 nmdc:mga0n895_441881_c1_82_675 181
138 3300050514 nmdc:mga08x19_205403_c1 nmdc:mga08x19_205403_c1_501_1055 181
139 3300050515 nmdc:mga0a205_100493_c1 nmdc:mga0a205_100493_c1_2029_2622 181
140 3300050515 nmdc:mga0a205_5039_c1 nmdc:mga0a205_5039_c1_10012_10566 181
141 3300053085 Ga0495619_0182471 Ga0495619_0182471_661_1215 181
142 2162886011 MRS1b_contig_1457758 MRS1b_0668.00001720 182
143 3300005293 Ga0065715_10535115 Ga0065715_105351152 182
144 3300005295 Ga0065707_10085153 Ga0065707_100851532 182
145 3300005334 Ga0068869_100058187 Ga0068869_1000581871 182
146 3300005336 Ga0070680_100159804 Ga0070680_1001598042 182
147 3300005338 Ga0068868_100430259 Ga0068868_1004302592 182
148 3300005339 Ga0070660_100146524 Ga0070660_1001465242 182
149 3300005340 Ga0070689_100013281 Ga0070689_1000132816 182
150 3300005340 Ga0070689_100014255 Ga0070689_1000142555 182
151 3300005340 Ga0070689_100066066 Ga0070689_1000660661 182
152 3300005343 Ga0070687_100023879 Ga0070687_1000238794 182
153 3300005344 Ga0070661_100222342 Ga0070661_1002223422 182
154 3300005353 Ga0070669_100008417 Ga0070669_1000084173 182
155 3300005354 Ga0070675_100747262 Ga0070675_1007472621 182
156 3300005354 Ga0070675_100768187 Ga0070675_1007681872 182
157 3300005355 Ga0070671_100091747 Ga0070671_1000917472 182
158 3300005364 Ga0070673_100058928 Ga0070673_1000589284 182
159 3300005365 Ga0070688_100026143 Ga0070688_1000261434 182
160 3300005366 Ga0070659_100085296 Ga0070659_1000852964 182
161 3300005434 Ga0070709_10048099 Ga0070709_100480992 182
162 3300005436 Ga0070713_100214177 Ga0070713_1002141772 182
163 3300005438 Ga0070701_10033535 Ga0070701_100335356 182
164 3300005441 Ga0070700_100086926 Ga0070700_1000869264 182
165 3300005444 Ga0070694_100001335 Ga0070694_10000133510 182
166 3300005445 Ga0070708_100000951 Ga0070708_1000009519 182
167 3300005457 Ga0070662_100115953 Ga0070662_1001159533 182
168 3300005458 Ga0070681_10314381 Ga0070681_103143812 182
169 3300005459 Ga0068867_100053038 Ga0068867_1000530382 182
170 3300005466 Ga0070685_10587666 Ga0070685_105876661 182
171 3300005468 Ga0070707_100169578 Ga0070707_1001695781 182
172 3300005468 Ga0070707_100644683 Ga0070707_1006446832 182
173 3300005539 Ga0068853_100081779 Ga0068853_1000817794 182
174 3300005539 Ga0068853_100589117 Ga0068853_1005891172 182
175 3300005544 Ga0070686_100020224 Ga0070686_1000202243 182
176 3300005544 Ga0070686_100023906 Ga0070686_1000239066 182
177 3300005545 Ga0070695_100593796 Ga0070695_1005937962 182
178 3300005546 Ga0070696_100163955 Ga0070696_1001639552 182
179 3300005547 Ga0070693_100336860 Ga0070693_1003368602 182
180 3300005547 Ga0070693_100909727 Ga0070693_1009097271 182
181 3300005563 Ga0068855_100216748 Ga0068855_1002167483 182
182 3300005564 Ga0070664_100079666 Ga0070664_1000796664 182
183 3300005577 Ga0068857_100203850 Ga0068857_1002038502 182
184 3300005577 Ga0068857_100459325 Ga0068857_1004593252 182
185 3300005577 Ga0068857_100475697 Ga0068857_1004756972 182
186 3300005617 Ga0068859_100108729 Ga0068859_1001087296 182
187 3300005618 Ga0068864_100166319 Ga0068864_1001663192 182
188 3300005618 Ga0068864_100270917 Ga0068864_1002709172 182
189 3300005719 Ga0068861_100057010 Ga0068861_1000570101 182
190 3300005843 Ga0068860_101188173 Ga0068860_1011881731 182
191 3300005937 Ga0081455_10063362 Ga0081455_100633623 182
192 3300006042 Ga0075368_10033062 Ga0075368_100330622 182
193 3300006042 Ga0075368_10141447 Ga0075368_101414471 182
194 3300006048 Ga0075363_100154023 Ga0075363_1001540232 182
195 3300006051 Ga0075364_10196838 Ga0075364_101968382 182
196 3300006177 Ga0075362_10121034 Ga0075362_101210342 182
197 3300006178 Ga0075367_10097229 Ga0075367_100972292 182
198 3300006195 Ga0075366_10020978 Ga0075366_100209784 182
199 3300006195 Ga0075366_10028692 Ga0075366_100286922 182
200 3300006195 Ga0075366_10076286 Ga0075366_100762862 182
201 3300006353 Ga0075370_10024452 Ga0075370_100244522 182
202 3300006844 Ga0075428_100020430 Ga0075428_1000204302 182
203 3300006844 Ga0075428_100137915 Ga0075428_1001379152 182
204 3300006846 Ga0075430_100063554 Ga0075430_1000635544 182
205 3300006847 Ga0075431_100005633 Ga0075431_1000056338 182
206 3300006852 Ga0075433_10049158 Ga0075433_100491585 182
207 3300006852 Ga0075433_10307498 Ga0075433_103074982 182
208 3300006852 Ga0075433_10874300 Ga0075433_108743001 182
209 3300006871 Ga0075434_100095942 Ga0075434_1000959422 182
210 3300006871 Ga0075434_100138359 Ga0075434_1001383592 182
211 3300006880 Ga0075429_100080733 Ga0075429_1000807334 182
212 3300006880 Ga0075429_100159128 Ga0075429_1001591283 182
213 3300006880 Ga0075429_100205693 Ga0075429_1002056931 182
214 3300006931 Ga0097620_100108725 Ga0097620_1001087252 182
215 3300007076 Ga0075435_100002704 Ga0075435_1000027049 182
216 3300009094 Ga0111539_10225630 Ga0111539_102256304 182
217 3300009147 Ga0114129_10038702 Ga0114129_100387024 182
218 3300009177 Ga0105248_10026278 Ga0105248_100262787 182
219 3300009177 Ga0105248_10097715 Ga0105248_100977152 182
220 3300009177 Ga0105248_10500947 Ga0105248_105009471 182
221 3300010375 Ga0105239_11777807 Ga0105239_117778071 182
222 3300013308 Ga0157375_10446839 Ga0157375_104468392 182
223 3300014325 Ga0163163_10204742 Ga0163163_102047423 182
224 3300014326 Ga0157380_10408380 Ga0157380_104083802 182
225 3300025906 Ga0207699_10026434 Ga0207699_100264344 182
226 3300025917 Ga0207660_10209111 Ga0207660_102091113 182
227 3300025918 Ga0207662_10052620 Ga0207662_100526202 182
228 3300025920 Ga0207649_10059601 Ga0207649_100596014 182
229 3300025922 Ga0207646_10062119 Ga0207646_100621192 182
230 3300025926 Ga0207659_10503974 Ga0207659_105039741 182
231 3300025928 Ga0207700_10050625 Ga0207700_100506252 182
232 3300025931 Ga0207644_10019146 Ga0207644_100191463 182
233 3300025932 Ga0207690_10336154 Ga0207690_103361542 182
234 3300025933 Ga0207706_10021936 Ga0207706_100219366 182
235 3300025936 Ga0207670_10451227 Ga0207670_104512272 182
236 3300025939 Ga0207665_10034350 Ga0207665_100343502 182
237 3300025941 Ga0207711_10168238 Ga0207711_101682382 182
238 3300025941 Ga0207711_10384869 Ga0207711_103848692 182
239 3300025941 Ga0207711_10429799 Ga0207711_104297991 182
240 3300025942 Ga0207689_10039547 Ga0207689_100395476 182
241 3300025942 Ga0207689_10260168 Ga0207689_102601682 182
242 3300025942 Ga0207689_10785132 Ga0207689_107851322 182
243 3300025945 Ga0207679_10093635 Ga0207679_100936353 182
244 3300025949 Ga0207667_10189220 Ga0207667_101892204 182
245 3300025960 Ga0207651_10086667 Ga0207651_100866671 182
246 3300026035 Ga0207703_10093141 Ga0207703_100931411 182
247 3300026041 Ga0207639_10120883 Ga0207639_101208832 182
248 3300026041 Ga0207639_10134472 Ga0207639_101344723 182
249 3300026075 Ga0207708_10073706 Ga0207708_100737062 182
250 3300026078 Ga0207702_10212614 Ga0207702_102126144 182
251 3300026088 Ga0207641_10189127 Ga0207641_101891272 182
252 3300026089 Ga0207648_10232089 Ga0207648_102320891 182
253 3300026095 Ga0207676_10376477 Ga0207676_103764772 182
254 3300026116 Ga0207674_10173162 Ga0207674_101731624 182
255 3300026116 Ga0207674_10236182 Ga0207674_102361823 182
256 3300026116 Ga0207674_10479225 Ga0207674_104792252 182
257 3300026116 Ga0207674_11225739 Ga0207674_112257391 182
258 3300026118 Ga0207675_100011414 Ga0207675_1000114141 182
259 3300026142 Ga0207698_10169642 Ga0207698_101696424 182
260 3300027866 Ga0209813_10124682 Ga0209813_101246822 182
261 3300027866 Ga0209813_10274063 Ga0209813_102740631 182
262 3300031507 Ga0307509_10134566 Ga0307509_101345662 182
263 3300031730 Ga0307516_10351299 Ga0307516_103512992 182
264 3300032002 Ga0307416_101603016 Ga0307416_1016030162 182
265 3300035086 Ga0373934_0074528 Ga0373934_0074528_316_879 182
266 3300035172 Ga0373955_0079239 Ga0373955_0079239_202_765 182
267 3300035410 Ga0373924_0091050 Ga0373924_0091050_74_637 182
268 3300037466 Ga0395898_0864815 Ga0395898_0864815_121_678 182
269 3300038443 Ga0395901_0546109 Ga0395901_0546109_404_967 182
270 3300041443 Ga0451789_0643364 Ga0451789_0643364_539_1096 182
271 3300041452 Ga0451793_0666774 Ga0451793_0666774_64_621 182
272 3300044694 Ga0466963_0004899 Ga0466963_0004899_7180_7776 182
273 3300044842 Ga0466957_0017882 Ga0466957_0017882_2187_2783 182
274 3300045051 Ga0451576_0104032 Ga0451576_0104032_1290_1859 182
275 3300045051 Ga0451576_0144528 Ga0451576_0144528_1361_1939 182
276 3300045836 Ga0466958_0037410 Ga0466958_0037410_1686_2285 182
277 3300046459 Ga0495629_0026281 Ga0495629_0026281_379_942 182
278 3300046472 Ga0495580_0001866 Ga0495580_0001866_12260_12817 182
279 3300046473 Ga0495582_0001408 Ga0495582_0001408_6322_6879 182
280 3300046473 Ga0495582_0063020 Ga0495582_0063020_994_1557 182
281 3300046475 Ga0495639_0030136 Ga0495639_0030136_197_760 182
282 3300046477 Ga0495664_0246852 Ga0495664_0246852_280_843 182
283 3300046517 Ga0495630_0595865 Ga0495630_0595865_136_699 182
284 3300046535 Ga0495586_0041739 Ga0495586_0041739_1387_1950 182
285 3300046536 Ga0495587_0563753 Ga0495587_0563753_53_616 182
286 3300046543 Ga0495645_0151926 Ga0495645_0151926_415_978 182
287 3300046689 Ga0495613_0455208 Ga0495613_0455208_151_714 182
288 3300047319 Ga0495674_0015352 Ga0495674_0015352_1338_1901 182
289 3300047322 Ga0495680_0150730 Ga0495680_0150730_378_941 182
290 3300049571 Ga0501034_0017005 Ga0501034_0017005_2957_3520 182
291 3300049573 Ga0501037_0299833 Ga0501037_0299833_78_641 182
292 3300049580 Ga0501046_0049736 Ga0501046_0049736_2499_3062 182
293 3300049581 Ga0501047_0024643 Ga0501047_0024643_631_1194 182
294 3300049583 Ga0501067_0168459 Ga0501067_0168459_122_685 182
295 3300049584 Ga0501068_0216293 Ga0501068_0216293_544_1107 182
296 3300049587 Ga0501071_1004554 Ga0501071_1004554_43_609 182
297 3300049589 Ga0501073_0000939 Ga0501073_0000939_13350_13913 182
298 3300049742 Ga0501080_0006766 Ga0501080_0006766_6497_7060 182
299 3300049743 Ga0501081_0313634 Ga0501081_0313634_361_918 182
300 3300049823 Ga0501044_0023212 Ga0501044_0023212_5638_6201 182
301 3300050491 nmdc:mga00v17_71326_c1 nmdc:mga00v17_71326_c1_192_749 182
302 3300050493 nmdc:mga0k408_152975_c1 nmdc:mga0k408_152975_c1_494_1051 182
303 3300050493 nmdc:mga0k408_15687_c1 nmdc:mga0k408_15687_c1_2186_2743 182
304 3300050493 nmdc:mga0k408_204207_c1 nmdc:mga0k408_204207_c1_329_886 182
305 3300050494 nmdc:mga06z11_338229_c1 nmdc:mga06z11_338229_c1_127_684 182
306 3300050495 nmdc:mga04h51_111939_c1 nmdc:mga04h51_111939_c1_250_807 182
307 3300050495 nmdc:mga04h51_41577_c1 nmdc:mga04h51_41577_c1_904_1461 182
308 3300050495 nmdc:mga04h51_87458_c1 nmdc:mga04h51_87458_c1_26_583 182
309 3300050496 nmdc:mga07m45_35738_c1 nmdc:mga07m45_35738_c1_771_1328 182
310 3300050507 nmdc:mga05p37_128315_c1 nmdc:mga05p37_128315_c1_286_846 182
311 3300050508 nmdc:mga09592_757283_c1 nmdc:mga09592_757283_c1_149_709 182
312 3300050510 nmdc:mga06r32_604454_c1 nmdc:mga06r32_604454_c1_413_973 182
313 3300050511 nmdc:mga08y16_117724_c1 nmdc:mga08y16_117724_c1_1123_1692 182
314 3300050512 nmdc:mga0n895_696469_c1 nmdc:mga0n895_696469_c1_120_683 182
315 3300050512 nmdc:mga0n895_94016_c1 nmdc:mga0n895_94016_c1_1533_2090 182
316 3300050513 nmdc:mga0rr50_365612_c1 nmdc:mga0rr50_365612_c1_465_1082 182
317 3300050514 nmdc:mga08x19_14234_c1 nmdc:mga08x19_14234_c1_990_1550 182
318 3300050515 nmdc:mga0a205_113170_c1 nmdc:mga0a205_113170_c1_960_1577 182
319 3300050515 nmdc:mga0a205_6643_c1 nmdc:mga0a205_6643_c1_363_923 182
320 3300053727 Ga0500611_030026 Ga0500611_030026_338_895 182
321 3300060353 Ga0501082_0020308 Ga0501082_0020308_5029_5595 182
322 3300060353 Ga0501082_0376574 Ga0501082_0376574_558_1121 182
323 2162886012 MBSR1b_contig_3044804 MBSR1b_0295.00000770 183
324 3300001979 JGI24740J21852_10067119 JGI24740J21852_100671192 183
325 3300004801 Ga0058860_11931095 Ga0058860_119310951 183
326 3300005289 Ga0065704_10237945 Ga0065704_102379452 183
327 3300005293 Ga0065715_10139316 Ga0065715_101393162 183
328 3300005295 Ga0065707_10002593 Ga0065707_100025938 183
329 3300005295 Ga0065707_10098721 Ga0065707_100987213 183
330 3300005328 Ga0070676_10424359 Ga0070676_104243592 183
331 3300005329 Ga0070683_100009138 Ga0070683_10000913811 183
332 3300005330 Ga0070690_100044822 Ga0070690_1000448223 183
333 3300005330 Ga0070690_100087543 Ga0070690_1000875432 183
334 3300005333 Ga0070677_10045036 Ga0070677_100450362 183
335 3300005334 Ga0068869_100004191 Ga0068869_1000041914 183
336 3300005334 Ga0068869_100034587 Ga0068869_1000345871 183
337 3300005334 Ga0068869_100567355 Ga0068869_1005673552 183
338 3300005334 Ga0068869_100786774 Ga0068869_1007867741 183
339 3300005336 Ga0070680_100004972 Ga0070680_1000049723 183
340 3300005336 Ga0070680_100066004 Ga0070680_1000660041 183
341 3300005336 Ga0070680_100148885 Ga0070680_1001488852 183
342 3300005336 Ga0070680_100463223 Ga0070680_1004632232 183
343 3300005337 Ga0070682_100194929 Ga0070682_1001949292 183
344 3300005338 Ga0068868_100007011 Ga0068868_1000070118 183
345 3300005338 Ga0068868_100037370 Ga0068868_1000373702 183
346 3300005340 Ga0070689_100782599 Ga0070689_1007825991 183
347 3300005343 Ga0070687_100361891 Ga0070687_1003618911 183
348 3300005343 Ga0070687_100559702 Ga0070687_1005597021 183
349 3300005347 Ga0070668_100120975 Ga0070668_1001209752 183
350 3300005353 Ga0070669_100756203 Ga0070669_1007562032 183
351 3300005354 Ga0070675_100261089 Ga0070675_1002610891 183
352 3300005354 Ga0070675_101170015 Ga0070675_1011700151 183
353 3300005355 Ga0070671_100130150 Ga0070671_1001301502 183
354 3300005356 Ga0070674_100016743 Ga0070674_1000167434 183
355 3300005364 Ga0070673_100026710 Ga0070673_1000267103 183
356 3300005365 Ga0070688_100354772 Ga0070688_1003547721 183
357 3300005366 Ga0070659_100154355 Ga0070659_1001543552 183
358 3300005367 Ga0070667_100460308 Ga0070667_1004603082 183
359 3300005406 Ga0070703_10038315 Ga0070703_100383152 183
360 3300005434 Ga0070709_10058639 Ga0070709_100586393 183
361 3300005434 Ga0070709_10279951 Ga0070709_102799512 183
362 3300005435 Ga0070714_100800072 Ga0070714_1008000722 183
363 3300005436 Ga0070713_100034050 Ga0070713_1000340506 183
364 3300005436 Ga0070713_100442732 Ga0070713_1004427322 183
365 3300005437 Ga0070710_10008415 Ga0070710_100084155 183
366 3300005437 Ga0070710_10583425 Ga0070710_105834252 183
367 3300005438 Ga0070701_10004414 Ga0070701_100044144 183
368 3300005439 Ga0070711_100037487 Ga0070711_1000374874 183
369 3300005439 Ga0070711_100669151 Ga0070711_1006691512 183
370 3300005440 Ga0070705_100011137 Ga0070705_1000111374 183
371 3300005440 Ga0070705_100210433 Ga0070705_1002104331 183
372 3300005440 Ga0070705_100624481 Ga0070705_1006244811 183
373 3300005441 Ga0070700_100004458 Ga0070700_1000044584 183
374 3300005444 Ga0070694_100059208 Ga0070694_1000592082 183
375 3300005444 Ga0070694_100387644 Ga0070694_1003876442 183
376 3300005445 Ga0070708_100520621 Ga0070708_1005206211 183
377 3300005455 Ga0070663_100045123 Ga0070663_1000451232 183
378 3300005456 Ga0070678_100825390 Ga0070678_1008253902 183
379 3300005457 Ga0070662_100925767 Ga0070662_1009257671 183
380 3300005458 Ga0070681_10006425 Ga0070681_100064253 183
381 3300005458 Ga0070681_10015673 Ga0070681_100156736 183
382 3300005458 Ga0070681_10046173 Ga0070681_100461733 183
383 3300005459 Ga0068867_100000114 Ga0068867_10000011434 183
384 3300005459 Ga0068867_100826408 Ga0068867_1008264081 183
385 3300005459 Ga0068867_101128114 Ga0068867_1011281141 183
386 3300005466 Ga0070685_10010931 Ga0070685_100109313 183
387 3300005466 Ga0070685_10097452 Ga0070685_100974522 183
388 3300005466 Ga0070685_10196190 Ga0070685_101961902 183
389 3300005467 Ga0070706_100544990 Ga0070706_1005449902 183
390 3300005467 Ga0070706_101109142 Ga0070706_1011091421 183
391 3300005471 Ga0070698_100064580 Ga0070698_1000645805 183
392 3300005471 Ga0070698_100073836 Ga0070698_1000738362 183
393 3300005518 Ga0070699_100000102 Ga0070699_10000010225 183
394 3300005518 Ga0070699_100000130 Ga0070699_10000013062 183
395 3300005530 Ga0070679_100023383 Ga0070679_1000233833 183
396 3300005530 Ga0070679_100029436 Ga0070679_1000294364 183
397 3300005535 Ga0070684_100404805 Ga0070684_1004048052 183
398 3300005535 Ga0070684_100825687 Ga0070684_1008256872 183
399 3300005536 Ga0070697_100016863 Ga0070697_1000168635 183
400 3300005536 Ga0070697_100227796 Ga0070697_1002277962 183
401 3300005539 Ga0068853_100041079 Ga0068853_1000410793 183
402 3300005539 Ga0068853_100467037 Ga0068853_1004670373 183
403 3300005539 Ga0068853_100501739 Ga0068853_1005017392 183
404 3300005539 Ga0068853_100623741 Ga0068853_1006237412 183
405 3300005543 Ga0070672_100290187 Ga0070672_1002901871 183
406 3300005543 Ga0070672_100525547 Ga0070672_1005255472 183
407 3300005543 Ga0070672_100637722 Ga0070672_1006377222 183
408 3300005544 Ga0070686_100070115 Ga0070686_1000701153 183
409 3300005544 Ga0070686_100159154 Ga0070686_1001591542 183
410 3300005545 Ga0070695_100024050 Ga0070695_1000240504 183
411 3300005545 Ga0070695_100143627 Ga0070695_1001436272 183
412 3300005545 Ga0070695_100249454 Ga0070695_1002494542 183
413 3300005546 Ga0070696_100000006 Ga0070696_10000000667 183
414 3300005546 Ga0070696_100003610 Ga0070696_10000361014 183
415 3300005546 Ga0070696_100032695 Ga0070696_1000326954 183
416 3300005547 Ga0070693_100025833 Ga0070693_1000258331 183
417 3300005547 Ga0070693_100047393 Ga0070693_1000473936 183
418 3300005548 Ga0070665_100927906 Ga0070665_1009279062 183
419 3300005548 Ga0070665_101214153 Ga0070665_1012141532 183
420 3300005549 Ga0070704_100036617 Ga0070704_1000366172 183
421 3300005549 Ga0070704_100072347 Ga0070704_1000723474 183
422 3300005549 Ga0070704_100226743 Ga0070704_1002267432 183
423 3300005549 Ga0070704_100311582 Ga0070704_1003115822 183
424 3300005563 Ga0068855_100033773 Ga0068855_1000337732 183
425 3300005563 Ga0068855_100065135 Ga0068855_1000651352 183
426 3300005563 Ga0068855_100367506 Ga0068855_1003675063 183
427 3300005564 Ga0070664_101044808 Ga0070664_1010448082 183
428 3300005577 Ga0068857_100487508 Ga0068857_1004875082 183
429 3300005577 Ga0068857_100808111 Ga0068857_1008081112 183
430 3300005577 Ga0068857_100996426 Ga0068857_1009964261 183
431 3300005578 Ga0068854_100243930 Ga0068854_1002439302 183
432 3300005614 Ga0068856_100888201 Ga0068856_1008882011 183
433 3300005614 Ga0068856_100925705 Ga0068856_1009257052 183
434 3300005614 Ga0068856_100979151 Ga0068856_1009791511 183
435 3300005615 Ga0070702_100003115 Ga0070702_1000031155 183
436 3300005616 Ga0068852_100082275 Ga0068852_1000822755 183
437 3300005616 Ga0068852_100442994 Ga0068852_1004429942 183
438 3300005617 Ga0068859_100010567 Ga0068859_10001056712 183
439 3300005617 Ga0068859_100025922 Ga0068859_1000259224 183
440 3300005617 Ga0068859_100087090 Ga0068859_1000870904 183
441 3300005617 Ga0068859_100340688 Ga0068859_1003406882 183
442 3300005617 Ga0068859_100505304 Ga0068859_1005053041 183
443 3300005617 Ga0068859_100539606 Ga0068859_1005396062 183
444 3300005618 Ga0068864_100120927 Ga0068864_1001209272 183
445 3300005719 Ga0068861_100052540 Ga0068861_1000525402 183
446 3300005719 Ga0068861_100059661 Ga0068861_1000596613 183
447 3300005719 Ga0068861_100149715 Ga0068861_1001497152 183
448 3300005719 Ga0068861_100453965 Ga0068861_1004539652 183
449 3300005719 Ga0068861_100624753 Ga0068861_1006247532 183
450 3300005840 Ga0068870_10141504 Ga0068870_101415042 183
451 3300005841 Ga0068863_100025634 Ga0068863_1000256343 183
452 3300005841 Ga0068863_100083618 Ga0068863_1000836182 183
453 3300005842 Ga0068858_100005323 Ga0068858_1000053235 183
454 3300005842 Ga0068858_100190404 Ga0068858_1001904042 183
455 3300005842 Ga0068858_100214554 Ga0068858_1002145542 183
456 3300005843 Ga0068860_100042231 Ga0068860_1000422316 183
457 3300005843 Ga0068860_100344486 Ga0068860_1003444861 183
458 3300005844 Ga0068862_100019134 Ga0068862_1000191343 183
459 3300005844 Ga0068862_100225180 Ga0068862_1002251802 183
460 3300005844 Ga0068862_100270282 Ga0068862_1002702822 183
461 3300005844 Ga0068862_100974861 Ga0068862_1009748612 183
462 3300005937 Ga0081455_10052558 Ga0081455_100525586 183
463 3300005937 Ga0081455_10221824 Ga0081455_102218243 183
464 3300006028 Ga0070717_10002431 Ga0070717_100024316 183
465 3300006038 Ga0075365_10049622 Ga0075365_100496222 183
466 3300006042 Ga0075368_10123184 Ga0075368_101231841 183
467 3300006163 Ga0070715_10002390 Ga0070715_100023901 183
468 3300006163 Ga0070715_10015014 Ga0070715_100150143 183
469 3300006163 Ga0070715_10097134 Ga0070715_100971342 183
470 3300006173 Ga0070716_100000050 Ga0070716_10000005033 183
471 3300006173 Ga0070716_100050088 Ga0070716_1000500884 183
472 3300006175 Ga0070712_100005798 Ga0070712_1000057985 183
473 3300006178 Ga0075367_10008892 Ga0075367_100088924 183
474 3300006195 Ga0075366_10000836 Ga0075366_100008363 183
475 3300006195 Ga0075366_10062559 Ga0075366_100625594 183
476 3300006237 Ga0097621_100440970 Ga0097621_1004409702 183
477 3300006237 Ga0097621_100462691 Ga0097621_1004626912 183
478 3300006358 Ga0068871_100668206 Ga0068871_1006682062 183
479 3300006844 Ga0075428_100004062 Ga0075428_10000406215 183
480 3300006844 Ga0075428_100010676 Ga0075428_1000106768 183
481 3300006844 Ga0075428_100160866 Ga0075428_1001608662 183
482 3300006846 Ga0075430_100045092 Ga0075430_1000450924 183
483 3300006846 Ga0075430_100258209 Ga0075430_1002582091 183
484 3300006846 Ga0075430_100294353 Ga0075430_1002943532 183
485 3300006846 Ga0075430_100824955 Ga0075430_1008249552 183
486 3300006847 Ga0075431_100001840 Ga0075431_1000018406 183
487 3300006847 Ga0075431_100589381 Ga0075431_1005893812 183
488 3300006852 Ga0075433_10952368 Ga0075433_109523681 183
489 3300006871 Ga0075434_100060267 Ga0075434_1000602673 183
490 3300006880 Ga0075429_100009961 Ga0075429_1000099616 183
491 3300006880 Ga0075429_100077418 Ga0075429_1000774183 183
492 3300006880 Ga0075429_100228423 Ga0075429_1002284231 183
493 3300006881 Ga0068865_100036003 Ga0068865_1000360033 183
494 3300006914 Ga0075436_100016913 Ga0075436_1000169132 183
495 3300006914 Ga0075436_100028074 Ga0075436_1000280742 183
496 3300006931 Ga0097620_100010568 Ga0097620_1000105682 183
497 3300006931 Ga0097620_100025922 Ga0097620_1000259224 183
498 3300006931 Ga0097620_100087090 Ga0097620_1000870903 183
499 3300006931 Ga0097620_100340689 Ga0097620_1003406892 183
500 3300006931 Ga0097620_100505320 Ga0097620_1005053201 183
501 3300006931 Ga0097620_100539502 Ga0097620_1005395022 183
502 3300006931 Ga0097620_101000804 Ga0097620_1010008042 183
503 3300007076 Ga0075435_100209216 Ga0075435_1002092162 183
504 3300007265 Ga0099794_10002520 Ga0099794_100025204 183
505 3300009093 Ga0105240_10018029 Ga0105240_100180296 183
506 3300009093 Ga0105240_10259156 Ga0105240_102591562 183
507 3300009093 Ga0105240_10934728 Ga0105240_109347282 183
508 3300009094 Ga0111539_10001106 Ga0111539_1000110615 183
509 3300009094 Ga0111539_10006798 Ga0111539_100067985 183
510 3300009094 Ga0111539_10015937 Ga0111539_100159376 183
511 3300009094 Ga0111539_10055371 Ga0111539_100553715 183
512 3300009094 Ga0111539_10345720 Ga0111539_103457201 183
513 3300009098 Ga0105245_10813838 Ga0105245_108138382 183
514 3300009098 Ga0105245_10853180 Ga0105245_108531801 183
515 3300009098 Ga0105245_11079299 Ga0105245_110792992 183
516 3300009101 Ga0105247_10136707 Ga0105247_101367072 183
517 3300009101 Ga0105247_10168770 Ga0105247_101687701 183
518 3300009101 Ga0105247_10385639 Ga0105247_103856391 183
519 3300009147 Ga0114129_10022328 Ga0114129_100223283 183
520 3300009147 Ga0114129_10819886 Ga0114129_108198862 183
521 3300009148 Ga0105243_10002335 Ga0105243_1000233515 183
522 3300009148 Ga0105243_10032181 Ga0105243_100321813 183
523 3300009148 Ga0105243_10321217 Ga0105243_103212173 183
524 3300009148 Ga0105243_10901333 Ga0105243_109013332 183
525 3300009174 Ga0105241_10042510 Ga0105241_100425102 183
526 3300009174 Ga0105241_10082704 Ga0105241_100827045 183
527 3300009176 Ga0105242_10842159 Ga0105242_108421591 183
528 3300009176 Ga0105242_11033056 Ga0105242_110330562 183
529 3300009177 Ga0105248_10059487 Ga0105248_100594875 183
530 3300009177 Ga0105248_10059823 Ga0105248_100598232 183
531 3300009177 Ga0105248_10079788 Ga0105248_100797882 183
532 3300009177 Ga0105248_10160862 Ga0105248_101608624 183
533 3300009177 Ga0105248_10194562 Ga0105248_101945622 183
534 3300009177 Ga0105248_11463628 Ga0105248_114636282 183
535 3300009545 Ga0105237_10008802 Ga0105237_100088022 183
536 3300009545 Ga0105237_10014774 Ga0105237_100147744 183
537 3300009545 Ga0105237_10087229 Ga0105237_100872291 183
538 3300009545 Ga0105237_10135980 Ga0105237_101359805 183
539 3300009545 Ga0105237_10259716 Ga0105237_102597163 183
540 3300009545 Ga0105237_10508024 Ga0105237_105080241 183
541 3300009545 Ga0105237_10630434 Ga0105237_106304342 183
542 3300009545 Ga0105237_11075172 Ga0105237_110751722 183
543 3300009551 Ga0105238_10001033 Ga0105238_1000103322 183
544 3300009551 Ga0105238_10919791 Ga0105238_109197912 183
545 3300009553 Ga0105249_10096507 Ga0105249_100965072 183
546 3300009553 Ga0105249_10235327 Ga0105249_102353272 183
547 3300009553 Ga0105249_10264288 Ga0105249_102642882 183
548 3300009553 Ga0105249_11935162 Ga0105249_119351621 183
549 3300010159 Ga0099796_10021539 Ga0099796_100215393 183
550 3300010375 Ga0105239_10009580 Ga0105239_100095803 183
551 3300010375 Ga0105239_10053633 Ga0105239_100536332 183
552 3300010375 Ga0105239_10164712 Ga0105239_101647122 183
553 3300010375 Ga0105239_10597350 Ga0105239_105973503 183
554 3300010375 Ga0105239_11550835 Ga0105239_115508351 183
555 3300013100 Ga0157373_10053968 Ga0157373_100539684 183
556 3300013104 Ga0157370_10069454 Ga0157370_100694546 183
557 3300013105 Ga0157369_10304643 Ga0157369_103046432 183
558 3300013296 Ga0157374_10001392 Ga0157374_100013925 183
559 3300013296 Ga0157374_11428631 Ga0157374_114286311 183
560 3300013306 Ga0163162_10319826 Ga0163162_103198262 183
561 3300013306 Ga0163162_10837848 Ga0163162_108378481 183
562 3300013306 Ga0163162_11976172 Ga0163162_119761721 183
563 3300013307 Ga0157372_11137886 Ga0157372_111378862 183
564 3300013308 Ga0157375_10028446 Ga0157375_100284462 183
565 3300013308 Ga0157375_10037395 Ga0157375_100373954 183
566 3300013308 Ga0157375_10156346 Ga0157375_101563462 183
567 3300014325 Ga0163163_10213352 Ga0163163_102133522 183
568 3300014325 Ga0163163_10515085 Ga0163163_105150852 183
569 3300014326 Ga0157380_10068228 Ga0157380_100682282 183
570 3300014326 Ga0157380_10090627 Ga0157380_100906272 183
571 3300014326 Ga0157380_10217130 Ga0157380_102171302 183
572 3300014745 Ga0157377_10000016 Ga0157377_10000016116 183
573 3300014745 Ga0157377_10018617 Ga0157377_100186174 183
574 3300014745 Ga0157377_10059263 Ga0157377_100592633 183
575 3300014968 Ga0157379_10001159 Ga0157379_100011598 183
576 3300014968 Ga0157379_10037015 Ga0157379_100370152 183
577 3300014968 Ga0157379_10079832 Ga0157379_100798322 183
578 3300014968 Ga0157379_10199455 Ga0157379_101994552 183
579 3300014968 Ga0157379_10225971 Ga0157379_102259712 183
580 3300014968 Ga0157379_10522715 Ga0157379_105227153 183
581 3300014968 Ga0157379_10585998 Ga0157379_105859982 183
582 3300014969 Ga0157376_10033179 Ga0157376_100331793 183
583 3300017792 Ga0163161_10387651 Ga0163161_103876512 183
584 3300020080 Ga0206350_10772802 Ga0206350_107728021 183
585 3300022467 Ga0224712_10218062 Ga0224712_102180622 183
586 3300025898 Ga0207692_10020756 Ga0207692_100207563 183
587 3300025900 Ga0207710_10078113 Ga0207710_100781132 183
588 3300025900 Ga0207710_10117218 Ga0207710_101172181 183
589 3300025901 Ga0207688_10099005 Ga0207688_100990053 183
590 3300025904 Ga0207647_10001594 Ga0207647_1000159411 183
591 3300025905 Ga0207685_10002906 Ga0207685_100029063 183
592 3300025905 Ga0207685_10294213 Ga0207685_102942131 183
593 3300025906 Ga0207699_10047879 Ga0207699_100478793 183
594 3300025908 Ga0207643_10018379 Ga0207643_100183793 183
595 3300025910 Ga0207684_10708161 Ga0207684_107081611 183
596 3300025911 Ga0207654_10131880 Ga0207654_101318803 183
597 3300025911 Ga0207654_10162029 Ga0207654_101620292 183
598 3300025912 Ga0207707_10009442 Ga0207707_100094422 183
599 3300025912 Ga0207707_10071683 Ga0207707_100716833 183
600 3300025912 Ga0207707_10664879 Ga0207707_106648792 183
601 3300025913 Ga0207695_10346039 Ga0207695_103460392 183
602 3300025913 Ga0207695_10615702 Ga0207695_106157022 183
603 3300025914 Ga0207671_10053773 Ga0207671_100537733 183
604 3300025914 Ga0207671_10092749 Ga0207671_100927492 183
605 3300025914 Ga0207671_10226224 Ga0207671_102262242 183
606 3300025915 Ga0207693_10005991 Ga0207693_1000599110 183
607 3300025915 Ga0207693_10007609 Ga0207693_100076094 183
608 3300025916 Ga0207663_10003380 Ga0207663_100033807 183
609 3300025916 Ga0207663_10240558 Ga0207663_102405582 183
610 3300025917 Ga0207660_10195764 Ga0207660_101957644 183
611 3300025917 Ga0207660_10357902 Ga0207660_103579022 183
612 3300025918 Ga0207662_10002056 Ga0207662_100020567 183
613 3300025918 Ga0207662_10313284 Ga0207662_103132842 183
614 3300025918 Ga0207662_10319220 Ga0207662_103192202 183
615 3300025921 Ga0207652_10716258 Ga0207652_107162582 183
616 3300025922 Ga0207646_10079619 Ga0207646_100796191 183
617 3300025922 Ga0207646_10320225 Ga0207646_103202253 183
618 3300025924 Ga0207694_10006772 Ga0207694_100067725 183
619 3300025926 Ga0207659_10860970 Ga0207659_108609702 183
620 3300025928 Ga0207700_10157862 Ga0207700_101578623 183
621 3300025928 Ga0207700_10394453 Ga0207700_103944531 183
622 3300025931 Ga0207644_10101093 Ga0207644_101010933 183
623 3300025931 Ga0207644_10413684 Ga0207644_104136842 183
624 3300025933 Ga0207706_10383604 Ga0207706_103836042 183
625 3300025933 Ga0207706_10446972 Ga0207706_104469722 183
626 3300025935 Ga0207709_10059523 Ga0207709_100595233 183
627 3300025935 Ga0207709_10135906 Ga0207709_101359062 183
628 3300025936 Ga0207670_10301660 Ga0207670_103016602 183
629 3300025936 Ga0207670_10886905 Ga0207670_108869051 183
630 3300025938 Ga0207704_10012737 Ga0207704_100127376 183
631 3300025938 Ga0207704_10037378 Ga0207704_100373784 183
632 3300025939 Ga0207665_10000152 Ga0207665_1000015213 183
633 3300025939 Ga0207665_10258940 Ga0207665_102589402 183
634 3300025939 Ga0207665_10351977 Ga0207665_103519772 183
635 3300025940 Ga0207691_10012672 Ga0207691_100126723 183
636 3300025941 Ga0207711_10145855 Ga0207711_101458553 183
637 3300025942 Ga0207689_10000714 Ga0207689_1000071415 183
638 3300025942 Ga0207689_10011996 Ga0207689_100119965 183
639 3300025942 Ga0207689_10153316 Ga0207689_101533163 183
640 3300025942 Ga0207689_10373176 Ga0207689_103731762 183
641 3300025944 Ga0207661_10220853 Ga0207661_102208533 183
642 3300025949 Ga0207667_10014052 Ga0207667_100140524 183
643 3300025960 Ga0207651_10152099 Ga0207651_101520992 183
644 3300025960 Ga0207651_11451213 Ga0207651_114512131 183
645 3300025961 Ga0207712_10226210 Ga0207712_102262102 183
646 3300025961 Ga0207712_10643979 Ga0207712_106439792 183
647 3300025981 Ga0207640_10527925 Ga0207640_105279251 183
648 3300025986 Ga0207658_10318455 Ga0207658_103184553 183
649 3300026023 Ga0207677_10026673 Ga0207677_100266733 183
650 3300026035 Ga0207703_10031981 Ga0207703_100319812 183
651 3300026035 Ga0207703_10038495 Ga0207703_100384957 183
652 3300026035 Ga0207703_10081574 Ga0207703_100815743 183
653 3300026035 Ga0207703_10106248 Ga0207703_101062482 183
654 3300026041 Ga0207639_10012886 Ga0207639_100128865 183
655 3300026067 Ga0207678_10053430 Ga0207678_100534303 183
656 3300026075 Ga0207708_10039135 Ga0207708_100391353 183
657 3300026075 Ga0207708_10810798 Ga0207708_108107982 183
658 3300026078 Ga0207702_10935296 Ga0207702_109352962 183
659 3300026078 Ga0207702_11171935 Ga0207702_111719352 183
660 3300026088 Ga0207641_10064366 Ga0207641_100643665 183
661 3300026088 Ga0207641_10093744 Ga0207641_100937442 183
662 3300026089 Ga0207648_10000343 Ga0207648_1000034335 183
663 3300026089 Ga0207648_10026411 Ga0207648_100264114 183
664 3300026095 Ga0207676_11535485 Ga0207676_115354851 183
665 3300026116 Ga0207674_10111698 Ga0207674_101116983 183
666 3300026116 Ga0207674_10314588 Ga0207674_103145883 183
667 3300026118 Ga0207675_100004242 Ga0207675_10000424214 183
668 3300026118 Ga0207675_100263506 Ga0207675_1002635063 183
669 3300026118 Ga0207675_100302501 Ga0207675_1003025012 183
670 3300026118 Ga0207675_100421248 Ga0207675_1004212481 183
671 3300026121 Ga0207683_10090582 Ga0207683_100905823 183
672 3300026121 Ga0207683_10718697 Ga0207683_107186971 183
673 3300026142 Ga0207698_10183760 Ga0207698_101837602 183
674 3300026142 Ga0207698_10351329 Ga0207698_103513292 183
675 3300027876 Ga0209974_10012502 Ga0209974_100125021 183
676 3300027907 Ga0207428_10000633 Ga0207428_1000063313 183
677 3300027907 Ga0207428_10018443 Ga0207428_100184437 183
678 3300027907 Ga0207428_10030638 Ga0207428_100306382 183
679 3300027907 Ga0207428_10047259 Ga0207428_100472592 183
680 3300028380 Ga0268265_10114994 Ga0268265_101149942 183
681 3300028380 Ga0268265_10286315 Ga0268265_102863152 183
682 3300028380 Ga0268265_10291801 Ga0268265_102918011 183
683 3300028380 Ga0268265_10414052 Ga0268265_104140522 183
684 3300028381 Ga0268264_10000051 Ga0268264_10000051133 183
685 3300028381 Ga0268264_10078054 Ga0268264_100780542 183
686 3300028381 Ga0268264_10162352 Ga0268264_101623523 183
687 3300028556 Ga0265337_1005772 Ga0265337_10057725 183
688 3300028558 Ga0265326_10100657 Ga0265326_101006572 183
689 3300028794 Ga0307515_10030972 Ga0307515_100309727 183
690 3300028800 Ga0265338_10037653 Ga0265338_100376532 183
691 3300031240 Ga0265320_10000141 Ga0265320_1000014111 183
692 3300031247 Ga0265340_10009210 Ga0265340_100092103 183
693 3300031249 Ga0265339_10138922 Ga0265339_101389222 183
694 3300031250 Ga0265331_10195679 Ga0265331_101956792 183
695 3300031344 Ga0265316_10000552 Ga0265316_1000055211 183
696 3300031344 Ga0265316_10139818 Ga0265316_101398182 183
697 3300031456 Ga0307513_10055061 Ga0307513_100550617 183
698 3300031507 Ga0307509_10080563 Ga0307509_100805634 183
699 3300031507 Ga0307509_10632058 Ga0307509_106320581 183
700 3300031616 Ga0307508_10028223 Ga0307508_100282231 183
701 3300031616 Ga0307508_10101106 Ga0307508_101011062 183
702 3300031665 Ga0316575_10000971 Ga0316575_100009715 183
703 3300031711 Ga0265314_10001011 Ga0265314_100010116 183
704 3300031711 Ga0265314_10240058 Ga0265314_102400582 183
705 3300031712 Ga0265342_10006483 Ga0265342_100064833 183
706 3300031730 Ga0307516_10002069 Ga0307516_100020696 183
707 3300032002 Ga0307416_100038314 Ga0307416_1000383145 183
708 3300032133 Ga0316583_10001913 Ga0316583_100019131 183
709 3300033179 Ga0307507_10033111 Ga0307507_100331112 183
710 3300033179 Ga0307507_10333502 Ga0307507_103335021 183
711 3300033180 Ga0307510_10080098 Ga0307510_100800985 183
712 3300034817 Ga0373948_0043097 Ga0373948_0043097_47_607 183
713 3300034957 Ga0373938_0019463 Ga0373938_0019463_687_1247 183
714 3300035170 Ga0373943_0082552 Ga0373943_0082552_411_977 183
715 3300035398 Ga0316574_0002419 Ga0316574_0002419_7554_8111 183
716 3300035691 Ga0373931_0870609 Ga0373931_0870609_25_588 183
717 3300035692 Ga0373935_0532092 Ga0373935_0532092_189_755 183
718 3300035695 Ga0373927_0018429 Ga0373927_0018429_3558_4124 183
719 3300037418 Ga0395900_0030020 Ga0395900_0030020_3238_3798 183
720 3300041406 Ga0439439_0041353 Ga0439439_0041353_609_1163 183
721 3300041512 Ga0451853_2163079 Ga0451853_2163079_21_587 183
722 3300042007 Ga0439449_0010774 Ga0439449_0010774_1674_2228 183
723 3300042014 Ga0439457_011054 Ga0439457_011054_131_685 183
724 3300042436 Ga0439435_0017308 Ga0439435_0017308_108_671 183
725 3300042876 Ga0451577_0710649 Ga0451577_0710649_124_684 183
726 3300045051 Ga0451576_0033779 Ga0451576_0033779_3663_4223 183
727 3300045051 Ga0451576_1613762 Ga0451576_1613762_57_620 183
728 3300046454 Ga0495592_0367743 Ga0495592_0367743_167_733 183
729 3300046459 Ga0495629_0162836 Ga0495629_0162836_684_1250 183
730 3300046462 Ga0495651_0180420 Ga0495651_0180420_668_1234 183
731 3300046462 Ga0495651_0298298 Ga0495651_0298298_386_952 183
732 3300046472 Ga0495580_0095254 Ga0495580_0095254_701_1264 183
733 3300046472 Ga0495580_0377530 Ga0495580_0377530_54_614 183
734 3300046476 Ga0495662_0034990 Ga0495662_0034990_1009_1575 183
735 3300046477 Ga0495664_0478343 Ga0495664_0478343_146_712 183
736 3300046499 Ga0495594_0184499 Ga0495594_0184499_356_916 183
737 3300046514 Ga0495618_0029851 Ga0495618_0029851_33_593 183
738 3300046523 Ga0495644_0043944 Ga0495644_0043944_55_621 183
739 3300046535 Ga0495586_0047074 Ga0495586_0047074_672_1232 183
740 3300046537 Ga0495598_0070098 Ga0495598_0070098_192_749 183
741 3300046616 Ga0495668_0245441 Ga0495668_0245441_193_753 183
742 3300046642 Ga0495634_0192837 Ga0495634_0192837_637_1197 183
743 3300046663 Ga0495635_0033802 Ga0495635_0033802_639_1205 183
744 3300046674 Ga0495588_0368948 Ga0495588_0368948_123_689 183
745 3300046675 Ga0495657_0311656 Ga0495657_0311656_96_662 183
746 3300046689 Ga0495613_0079002 Ga0495613_0079002_1779_2339 183
747 3300046694 Ga0495649_0268699 Ga0495649_0268699_82_642 183
748 3300046809 Ga0495600_0193172 Ga0495600_0193172_16_582 183
749 3300047315 Ga0495581_0599848 Ga0495581_0599848_60_620 183
750 3300047319 Ga0495674_0240637 Ga0495674_0240637_914_1474 183
751 3300047445 Ga0495677_0149489 Ga0495677_0149489_226_792 183
752 3300048905 Ga0496102_0050697 Ga0496102_0050697_1618_2178 183
753 3300048905 Ga0496102_0230850 Ga0496102_0230850_61_621 183
754 3300048905 Ga0496102_0417831 Ga0496102_0417831_635_1195 183
755 3300048906 Ga0496103_0013067 Ga0496103_0013067_3131_3691 183
756 3300048907 Ga0496104_0040484 Ga0496104_0040484_596_1156 183
757 3300048908 Ga0496105_0164950 Ga0496105_0164950_141_701 183
758 3300048910 Ga0496107_0027625 Ga0496107_0027625_2855_3415 183
759 3300048912 Ga0496109_0025483 Ga0496109_0025483_3155_3715 183
760 3300048912 Ga0496109_0812446 Ga0496109_0812446_205_771 183
761 3300048913 Ga0496110_0059697 Ga0496110_0059697_370_930 183
762 3300048914 Ga0496111_0010111 Ga0496111_0010111_2343_2903 183
763 3300048915 Ga0496112_0010806 Ga0496112_0010806_6666_7226 183
764 3300048916 Ga0496113_0013516 Ga0496113_0013516_1389_1949 183
765 3300048917 Ga0496114_0027017 Ga0496114_0027017_615_1175 183
766 3300048918 Ga0496115_0026703 Ga0496115_0026703_740_1300 183
767 3300048924 Ga0496121_0157792 Ga0496121_0157792_994_1554 183
768 3300048924 Ga0496121_0201374 Ga0496121_0201374_124_732 183
769 3300048924 Ga0496121_0301368 Ga0496121_0301368_404_970 183
770 3300048929 Ga0496126_0078190 Ga0496126_0078190_1199_1759 183
771 3300049569 Ga0501032_0001778 Ga0501032_0001778_1892_2452 183
772 3300049569 Ga0501032_0163357 Ga0501032_0163357_128_685 183
773 3300049570 Ga0501033_0006961 Ga0501033_0006961_4534_5094 183
774 3300049570 Ga0501033_0021858 Ga0501033_0021858_1458_2015 183
775 3300049571 Ga0501034_0022252 Ga0501034_0022252_2165_2725 183
776 3300049571 Ga0501034_0037976 Ga0501034_0037976_513_1073 183
777 3300049571 Ga0501034_0265253 Ga0501034_0265253_884_1441 183
778 3300049572 Ga0501036_0001304 Ga0501036_0001304_8792_9352 183
779 3300049573 Ga0501037_0000852 Ga0501037_0000852_4933_5493 183
780 3300049574 Ga0501038_0003040 Ga0501038_0003040_14369_14929 183
781 3300049574 Ga0501038_0356423 Ga0501038_0356423_96_653 183
782 3300049579 Ga0501043_0008849 Ga0501043_0008849_1400_1960 183
783 3300049580 Ga0501046_0002656 Ga0501046_0002656_2681_3241 183
784 3300049581 Ga0501047_0007261 Ga0501047_0007261_6059_6619 183
785 3300049581 Ga0501047_0062899 Ga0501047_0062899_2999_3556 183
786 3300049582 Ga0501048_0004121 Ga0501048_0004121_2229_2789 183
787 3300049583 Ga0501067_0001824 Ga0501067_0001824_7871_8431 183
788 3300049584 Ga0501068_0000234 Ga0501068_0000234_15378_15938 183
789 3300049584 Ga0501068_0284314 Ga0501068_0284314_313_873 183
790 3300049585 Ga0501069_0003617 Ga0501069_0003617_658_1218 183
791 3300049586 Ga0501070_0000512 Ga0501070_0000512_15532_16092 183
792 3300049586 Ga0501070_0005792 Ga0501070_0005792_3925_4485 183
793 3300049588 Ga0501072_0002523 Ga0501072_0002523_4349_4909 183
794 3300049589 Ga0501073_0000482 Ga0501073_0000482_1465_2025 183
795 3300049589 Ga0501073_0004075 Ga0501073_0004075_9703_10263 183
796 3300049590 Ga0501074_0011232 Ga0501074_0011232_3864_4424 183
797 3300049591 Ga0501075_0514956 Ga0501075_0514956_16_582 183
798 3300049592 Ga0501076_0010528 Ga0501076_0010528_5764_6324 183
799 3300049593 Ga0501077_0036595 Ga0501077_0036595_2292_2852 183
800 3300049741 Ga0501079_0002938 Ga0501079_0002938_5962_6522 183
801 3300049741 Ga0501079_0613949 Ga0501079_0613949_63_623 183
802 3300049742 Ga0501080_0001468 Ga0501080_0001468_5423_5983 183
803 3300049743 Ga0501081_0265180 Ga0501081_0265180_34_594 183
804 3300049744 Ga0501083_0004962 Ga0501083_0004962_4391_4951 183
805 3300049744 Ga0501083_0010679 Ga0501083_0010679_2293_2853 183
806 3300049822 Ga0501035_0029424 Ga0501035_0029424_3736_4296 183
807 3300049823 Ga0501044_0011048 Ga0501044_0011048_2486_3046 183
808 3300049823 Ga0501044_0017635 Ga0501044_0017635_6102_6659 183
809 3300050489 nmdc:mga03683_139567_c1 nmdc:mga03683_139567_c1_484_1050 183
810 3300050489 nmdc:mga03683_26201_c1 nmdc:mga03683_26201_c1_483_1049 183
811 3300050491 nmdc:mga00v17_84765_c1 nmdc:mga00v17_84765_c1_1352_1918 183
812 3300050492 nmdc:mga0yw44_40072_c1 nmdc:mga0yw44_40072_c1_1730_2296 183
813 3300050493 nmdc:mga0k408_1207_c1 nmdc:mga0k408_1207_c1_5871_6437 183
814 3300050494 nmdc:mga06z11_5693_c1 nmdc:mga06z11_5693_c1_2859_3425 183
815 3300050495 nmdc:mga04h51_151709_c1 nmdc:mga04h51_151709_c1_140_706 183
816 3300050507 nmdc:mga05p37_1072532_c1 nmdc:mga05p37_1072532_c1_126_710 183
817 3300050507 nmdc:mga05p37_16430_c1 nmdc:mga05p37_16430_c1_6116_6682 183
818 3300050507 nmdc:mga05p37_181361_c1 nmdc:mga05p37_181361_c1_348_914 183
819 3300050507 nmdc:mga05p37_36945_c1 nmdc:mga05p37_36945_c1_2815_3399 183
820 3300050507 nmdc:mga05p37_464681_c1 nmdc:mga05p37_464681_c1_679_1245 183
821 3300050508 nmdc:mga09592_116016_c1 nmdc:mga09592_116016_c1_661_1227 183
822 3300050508 nmdc:mga09592_193971_c1 nmdc:mga09592_193971_c1_172_738 183
823 3300050509 nmdc:mga0qj67_713713_c1 nmdc:mga0qj67_713713_c1_39_605 183
824 3300050509 nmdc:mga0qj67_85972_c1 nmdc:mga0qj67_85972_c1_1793_2359 183
825 3300050510 nmdc:mga06r32_572_c1 nmdc:mga06r32_572_c1_4114_4692 183
826 3300050510 nmdc:mga06r32_578803_c1 nmdc:mga06r32_578803_c1_284_850 183
827 3300050511 nmdc:mga08y16_114314_c1 nmdc:mga08y16_114314_c1_1931_2485 183
828 3300050511 nmdc:mga08y16_1363715_c1 nmdc:mga08y16_1363715_c1_34_603 183
829 3300050511 nmdc:mga08y16_4466_c1 nmdc:mga08y16_4466_c1_13891_14457 183
830 3300050511 nmdc:mga08y16_6186_c1 nmdc:mga08y16_6186_c1_2237_2803 183
831 3300050512 nmdc:mga0n895_710305_c1 nmdc:mga0n895_710305_c1_153_713 183
832 3300050513 nmdc:mga0rr50_455605_c1 nmdc:mga0rr50_455605_c1_167_727 183
833 3300050514 nmdc:mga08x19_23637_c1 nmdc:mga08x19_23637_c1_400_966 183
834 3300050514 nmdc:mga08x19_319717_c1 nmdc:mga08x19_319717_c1_204_779 183
835 3300053080 Ga0500635_0005541 Ga0500635_0005541_1780_2346 183
836 3300053083 Ga0495655_0041471 Ga0495655_0041471_489_1049 183
837 3300053091 Ga0500647_0157488 Ga0500647_0157488_235_801 183
838 3300053103 Ga0500555_010682 Ga0500555_010682_529_1095 183
839 3300053108 Ga0500562_000016 Ga0500562_000016_56215_56769 183
840 3300053133 Ga0500655_049980 Ga0500655_049980_127_687 183
841 3300053140 Ga0500573_0042324 Ga0500573_0042324_2026_2592 183
842 3300053148 Ga0500590_000161 Ga0500590_000161_17665_18231 183
843 3300053148 Ga0500590_052882 Ga0500590_052882_389_955 183
844 3300053150 Ga0500603_005162 Ga0500603_005162_1297_1863 183
845 3300053177 Ga0500636_0064701 Ga0500636_0064701_195_761 183
846 3300053177 Ga0500636_0076909 Ga0500636_0076909_380_946 183
847 3300053735 Ga0500596_022312 Ga0500596_022312_259_825 183
848 3300054114 Ga0501084_0014970 Ga0501084_0014970_4406_4966 183
849 3300055283 Ga0500661_004595 Ga0500661_004595_160_714 183
850 3300060353 Ga0501082_0004844 Ga0501082_0004844_4557_5117 183
851 3300060353 Ga0501082_0005564 Ga0501082_0005564_5289_5849 183
852 3300060353 Ga0501082_0260899 Ga0501082_0260899_795_1361 183
853 iso_pu_bacteria 2582581867 2585400018 183
854 iso_pu_bacteria 2585427590 2585822576 183
855 3300001979 JGI24740J21852_10005322 JGI24740J21852_100053222 184
856 3300002738 JGI25154J39366_1000002 JGI25154J39366_100000227 184
857 3300003322 rootL2_10296761 rootL2_102967612 184
858 3300009545 Ga0105237_10001721 Ga0105237_1000172117 184
859 3300025914 Ga0207671_10001900 Ga0207671_100019005 184
860 3300031251 Ga0265327_10000010 Ga0265327_1000001089 184
861 3300031507 Ga0307509_10066136 Ga0307509_100661363 184
862 3300053139 Ga0500568_0189182 Ga0500568_0189182_25_588 184
863 2162886007 SwRhRL2b_contig_1498326 SwRhRL2b_0696.00002010 185
864 3300005289 Ga0065704_10070132 Ga0065704_10070132496 185

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

2

182

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3jtw-assembly1.cif.gz_A-2 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8293 1 184
3jtw-assembly1.cif.gz_A-2 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.825 1 184
3ky8-assembly1.cif.gz_B crystal structure of putative riboflavin biosynthesis protein (yp_001092907.1) from shewanella sp. pv-4 at 2.12 a resolution 0.8167 3 185
1d1g-assembly1.cif.gz_B dihydrofolate reductase from thermotoga maritima 0.8135 2 184
5ecx-assembly1.cif.gz_B klebsiella pneumoniae dfra1 complexed with nadph and 6-ethyl-5-(3-(6-(pyridin-4-yl)benzo[d][1,3]dioxol-4-yl)but-1-yn-1-yl)pyrimidine-2,4-diamine 0.8097 3 184
ID Description Score Start End Superfamily
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8254 3 181 3.40.430.10
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.816 3 181 3.40.430.10
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8159 2 185 3.40.430.10
5ecxB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8098 3 184 3.40.430.10
2xw7B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8065 1 185 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A4Q5Q1X5-F1-model_v4 deleted 0.9624 1 152
AF-M6K5Y5-F1-model_v4 Riboflavin biosynthesis protein RibD C-terminal domain protein 0.9622 1 184 GO:0008703
GO:0009231
AF-A0A0H4P8U0-F1-model_v4 Dihydrofolate reductase 0.962 1 185 GO:0008703
GO:0009231
AF-A0A1G9H0X7-F1-model_v4 Dihydrofolate reductase 0.9588 1 185 GO:0008703
GO:0009231
AF-M6K5Y5-F1-model_v4 Riboflavin biosynthesis protein RibD C-terminal domain protein 0.957 1 184 GO:0008703
GO:0009231

Feature Viewer

pLDDT pTM Quality
93.64 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map