F483565

General Info

Members Datasets Scaffolds Average Seq Length
853 435 817 226

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2547132103|2547374908
Length 266
Sequence HFECRRSSHNVPTDAPQIVNTFQASSGPRFAGGLALYGDTMLLHIPAVLSAEELALGRELLARADWADGRITAGSQSAQVKRNLQLPQQLPEAQQLQAMVEGALQRNGLFFSAALPAKIFPPLFNCYQAGMDFGNHVDNAVRRHPFDGGWVRTDVSCTLFFSRPDEYEGGELVIEDTYGSHSVKLDAGDMVLYPSTSLHRVEPVTAGARLASFFWVQSMISDDGKRRLLFDMDAAISSLRLQLGDNEALVALTANYHNLLRMWASP

Samples

Sample ID Description Type Environment
1 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
2 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
4 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
5 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
6 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
7 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
8 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
9 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
10 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
11 2721755523 Delftia sp. HK171 Isolate Unclassified
12 2744054655 Acinetobacter sp. BMW17 Isolate Unclassified
13 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
14 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
15 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
16 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
17 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
18 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
19 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
20 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
21 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
22 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
23 2857564685 Duganella sp. R-74599 Isolate Unclassified
24 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
25 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
26 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
27 2887630918 Psychrosphaera haliotis UCD-MCMsp1aY Isolate Unclassified
28 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
29 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
30 2919506607 Acinetobacter sp. 3657 Isolate Unclassified
31 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
32 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
33 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
34 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
35 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
36 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
37 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
38 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
39 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
40 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
41 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
42 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
43 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
44 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
45 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
46 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
47 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
48 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
49 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
50 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
51 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
52 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
53 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
54 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
55 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
56 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
57 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
58 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
59 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
60 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
61 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
62 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
63 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
64 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
65 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
66 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
67 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
68 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
69 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
70 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
71 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
72 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
73 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
74 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
75 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
76 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
77 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
78 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
79 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
80 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
81 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
82 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
83 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
84 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
85 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
86 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
87 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
88 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
89 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
90 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
91 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
92 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
93 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
94 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
95 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
96 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
97 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
98 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
99 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
100 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
101 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
102 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
103 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
104 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
105 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
106 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
107 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
108 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
109 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
110 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
111 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
112 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
113 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
114 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
115 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
116 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
117 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
118 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
119 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
120 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
121 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
122 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
123 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
124 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
125 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
126 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
127 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
128 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
129 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
130 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
131 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
132 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
133 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
134 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
135 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
136 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
137 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
138 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
139 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
140 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
141 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
142 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
143 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
144 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
145 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
146 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
147 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
148 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
149 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
150 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
151 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
152 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
153 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
154 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
155 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
156 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
157 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
158 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
159 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
160 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
161 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
162 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
163 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
164 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
165 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
166 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
167 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
168 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
169 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
170 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
172 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
173 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
174 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
176 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
177 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
178 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
180 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
244 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
245 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
246 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
247 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
248 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
252 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
253 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
254 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
255 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
256 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
257 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
258 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
259 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
260 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
261 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
262 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
263 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
264 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
265 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
266 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
267 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
268 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
269 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
270 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
271 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
272 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
273 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
274 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
275 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
276 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
277 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
278 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
279 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
280 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
281 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
282 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
283 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
284 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
285 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
286 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
287 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
288 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
289 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
290 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
291 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
292 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
293 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
294 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
295 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
296 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
297 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
298 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
299 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
300 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
301 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
302 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
303 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
304 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
305 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
306 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
307 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
308 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
309 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
310 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
311 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
312 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
313 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
314 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
315 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
316 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
317 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
318 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
319 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
320 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
321 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
322 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
323 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
324 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
325 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
326 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
327 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
328 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
329 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
330 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
331 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
332 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
333 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
334 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
335 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
336 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
337 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
338 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
339 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
340 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
341 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
342 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
343 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
344 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
345 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
346 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
347 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
348 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
349 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
350 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
352 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
353 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
354 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
356 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
357 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
358 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
361 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
364 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
366 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
368 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
369 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
370 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
371 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
372 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
373 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
374 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
375 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
376 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
377 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
378 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
379 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
380 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
381 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
382 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
383 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
384 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
385 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
386 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
387 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
388 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
389 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
390 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
391 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
392 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
393 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
394 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
395 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
396 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
397 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
398 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
399 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
400 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
401 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
402 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
403 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
404 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
405 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
406 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
407 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
408 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
409 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
410 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
411 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
412 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
413 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
414 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
415 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
416 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
417 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
418 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
419 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
420 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
421 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
422 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
423 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
424 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
425 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
426 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
427 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
428 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
429 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
430 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
431 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
432 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
433 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
434 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
435 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.66
Metatranscriptomes 0.12
Isolates 4.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.21
Nodule 1.06
Rhizoplane 2.23
Rhizosphere 82.77
Stem 0
Stem Tuber 0
Unclassified 5.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24750J21931_1016224 3300002070 Bacteria 1010
2 JGI24749J21850_1028161 3300002076 Bacteria 803
3 JGI24744J21845_10039574 3300002077 Bacteria 884
4 JGI24034J26672_10006470 3300002239 Bacteria 1690
5 rootL2_10083363 3300003322 Bacteria 16621
6 Ga0055526_1013787 3300003771 Bacteria 3385
7 Ga0055537_1005105 3300003773 Bacteria 3587
8 Ga0055524_1001263 3300003775 Bacteria 14843
9 Ga0055536_1003133 3300003781 Bacteria 8980
10 Ga0055536_1004801 3300003781 Bacteria 6768
11 Ga0055536_1005155 3300003781 Bacteria 6461
12 Ga0055534_1010687 3300003784 Bacteria 1905
13 Ga0055530_10000310 3300003791 Bacteria 44225
14 Ga0055531_10002945 3300003794 Bacteria 11076
15 Ga0055531_10007831 3300003794 Bacteria 5750
16 Ga0055531_10027351 3300003794 Bacteria 2004
17 Ga0058692_1000431 3300003856 Bacteria 19221
18 Ga0065704_10148704 3300005289 Bacteria 1448
19 Ga0065715_10100239 3300005293 Bacteria 3320
20 Ga0065707_10029968 3300005295 Bacteria 1119
21 Ga0070658_10002553 3300005327 Bacteria 15186
22 Ga0070676_10260264 3300005328 Bacteria 1161
23 Ga0070676_10261845 3300005328 Bacteria 1158
24 Ga0070683_100358925 3300005329 Bacteria 1388
25 Ga0070683_100508954 3300005329 Bacteria 1150
26 Ga0070690_100003142 3300005330 Bacteria 8993
27 Ga0070670_100006524 3300005331 Bacteria 9880
28 Ga0070670_100026480 3300005331 Bacteria 4989
29 Ga0070670_100134969 3300005331 Bacteria 2132
30 Ga0070670_100304558 3300005331 Unclassified 1394
31 Ga0070670_100468456 3300005331 Bacteria 1118
32 Ga0070670_100556076 3300005331 Bacteria 1024
33 Ga0070677_10006039 3300005333 Bacteria 4013
34 Ga0070677_10091383 3300005333 Bacteria 1325
35 Ga0068869_100001182 3300005334 Bacteria 15323
36 Ga0068869_100017486 3300005334 Bacteria 4861
37 Ga0068869_100557786 3300005334 Bacteria 963
38 Ga0068869_100942753 3300005334 Bacteria 749
39 Ga0070666_10026489 3300005335 Bacteria 3789
40 Ga0070666_10144040 3300005335 Bacteria 1660
41 Ga0070680_100177831 3300005336 Bacteria 1791
42 Ga0070660_100003289 3300005339 Bacteria 11105
43 Ga0070660_100018896 3300005339 Bacteria 5044
44 Ga0070689_100008082 3300005340 Bacteria 7391
45 Ga0070687_100000376 3300005343 Bacteria 15278
46 Ga0070661_100036204 3300005344 Bacteria 3588
47 Ga0070661_100245864 3300005344 Bacteria 1379
48 Ga0070668_100613705 3300005347 Bacteria 953
49 Ga0070669_100000001 3300005353 Bacteria 537589
50 Ga0070669_100169463 3300005353 Bacteria 1701
51 Ga0070675_100004297 3300005354 Bacteria 10855
52 Ga0070675_100018240 3300005354 Bacteria 5586
53 Ga0070675_100022287 3300005354 Bacteria 5060
54 Ga0070671_100000002 3300005355 Bacteria 292733
55 Ga0070671_100029085 3300005355 Bacteria 4555
56 Ga0070671_100041611 3300005355 Bacteria 3819
57 Ga0070674_100000167 3300005356 Bacteria 30534
58 Ga0070673_100056243 3300005364 Bacteria 3103
59 Ga0070688_100000491 3300005365 Bacteria 20041
60 Ga0070688_100233179 3300005365 Bacteria 1303
61 Ga0070659_100000743 3300005366 Bacteria 23664
62 Ga0070659_100000820 3300005366 Bacteria 22687
63 Ga0070659_100004983 3300005366 Bacteria 9508
64 Ga0070659_100030874 3300005366 Bacteria 4147
65 Ga0070659_100091984 3300005366 Bacteria 2432
66 Ga0070667_100004785 3300005367 Bacteria 11339
67 Ga0070703_10031602 3300005406 Bacteria 1602
68 Ga0070701_10043469 3300005438 Bacteria 2299
69 Ga0070705_100000983 3300005440 Bacteria 15930
70 Ga0070705_100005445 3300005440 Bacteria 6202
71 Ga0070705_100482493 3300005440 Bacteria 937
72 Ga0070700_100025169 3300005441 Bacteria 3503
73 Ga0070700_100295253 3300005441 Bacteria 1181
74 Ga0070694_100324945 3300005444 Bacteria 1185
75 Ga0070708_100040828 3300005445 Bacteria 4065
76 Ga0070663_100015868 3300005455 Bacteria 4875
77 Ga0070663_100501343 3300005455 Bacteria 1008
78 Ga0070678_100003331 3300005456 Bacteria 8940
79 Ga0070678_100006518 3300005456 Bacteria 6856
80 Ga0070678_100020327 3300005456 Bacteria 4353
81 Ga0070662_100002454 3300005457 Bacteria 11422
82 Ga0070681_10001866 3300005458 Bacteria 19023
83 Ga0070681_10015969 3300005458 Bacteria 7487
84 Ga0070681_10095047 3300005458 Bacteria 2929
85 Ga0070681_10176869 3300005458 Bacteria 2056
86 Ga0070681_10351413 3300005458 Bacteria 1384
87 Ga0068867_100014253 3300005459 Bacteria 5631
88 Ga0068867_100127993 3300005459 Bacteria 1970
89 Ga0070685_10000312 3300005466 Bacteria 30514
90 Ga0070706_100003178 3300005467 Bacteria 16216
91 Ga0070707_100130219 3300005468 Bacteria 2447
92 Ga0070679_100022623 3300005530 Bacteria 6145
93 Ga0070679_100055690 3300005530 Bacteria 3939
94 Ga0070679_100226611 3300005530 Bacteria 1829
95 Ga0070679_100403233 3300005530 Bacteria 1313
96 Ga0070684_100044363 3300005535 Bacteria 3846
97 Ga0068853_100005451 3300005539 Bacteria 9970
98 Ga0068853_100007924 3300005539 Bacteria 8516
99 Ga0068853_100501382 3300005539 Bacteria 1146
100 Ga0070672_100011434 3300005543 Bacteria 6191
101 Ga0070672_100441412 3300005543 Bacteria 1120
102 Ga0070686_100004704 3300005544 Bacteria 7525
103 Ga0070696_100033486 3300005546 Bacteria 3531
104 Ga0070696_100047787 3300005546 Bacteria 2970
105 Ga0070693_100000389 3300005547 Bacteria 19974
106 Ga0070693_100307119 3300005547 Bacteria 1071
107 Ga0070665_100058556 3300005548 Bacteria 3862
108 Ga0070665_100181062 3300005548 Bacteria 2108
109 Ga0070665_100273288 3300005548 Bacteria 1692
110 Ga0070704_100018066 3300005549 Bacteria 4499
111 Ga0070704_100193390 3300005549 Bacteria 1637
112 Ga0068855_100001278 3300005563 Bacteria 31177
113 Ga0068855_100001819 3300005563 Bacteria 26612
114 Ga0070664_100011160 3300005564 Bacteria 7286
115 Ga0068857_100214791 3300005577 Bacteria 1756
116 Ga0068854_100032491 3300005578 Bacteria 3632
117 Ga0068854_100057209 3300005578 Bacteria 2812
118 Ga0068854_100707637 3300005578 Bacteria 870
119 Ga0068856_100012081 3300005614 Bacteria 8363
120 Ga0068856_100020253 3300005614 Bacteria 6460
121 Ga0068856_100295606 3300005614 Bacteria 1637
122 Ga0068856_100669876 3300005614 Bacteria 1058
123 Ga0070702_100349868 3300005615 Bacteria 1040
124 Ga0068852_100004791 3300005616 Bacteria 9610
125 Ga0068852_100251423 3300005616 Bacteria 1694
126 Ga0068859_100002725 3300005617 Bacteria 17917
127 Ga0068864_100000323 3300005618 Bacteria 42172
128 Ga0068864_100040657 3300005618 Bacteria 3977
129 Ga0068864_100162383 3300005618 Bacteria 2031
130 Ga0068864_100207846 3300005618 Bacteria 1801
131 Ga0068861_100001192 3300005719 Bacteria 16170
132 Ga0068861_100002755 3300005719 Bacteria 11526
133 Ga0068861_100033317 3300005719 Bacteria 3799
134 Ga0068851_10000396 3300005834 Bacteria 19748
135 Ga0068870_10000513 3300005840 Bacteria 14666
136 Ga0068870_10001473 3300005840 Bacteria 9523
137 Ga0068870_10059711 3300005840 Bacteria 2045
138 Ga0068870_10138612 3300005840 Bacteria 1421
139 Ga0068863_100011337 3300005841 Bacteria 8631
140 Ga0068863_100017755 3300005841 Bacteria 6811
141 Ga0068863_100081617 3300005841 Bacteria 3063
142 Ga0068863_100084708 3300005841 Bacteria 3004
143 Ga0068863_100288715 3300005841 Bacteria 1590
144 Ga0068863_100290501 3300005841 Bacteria 1585
145 Ga0068858_100024171 3300005842 Bacteria 5662
146 Ga0068858_100107416 3300005842 Bacteria 2605
147 Ga0068858_100230425 3300005842 Bacteria 1756
148 Ga0068858_100682680 3300005842 Bacteria 999
149 Ga0068860_100057650 3300005843 Bacteria 3692
150 Ga0068860_100286332 3300005843 Bacteria 1611
151 Ga0068860_100296685 3300005843 Bacteria 1583
152 Ga0068862_100000856 3300005844 Bacteria 29863
153 Ga0068862_100004739 3300005844 Bacteria 11447
154 Ga0068862_100019061 3300005844 Bacteria 5721
155 Ga0068862_100204582 3300005844 Bacteria 1781
156 Ga0081455_10035349 3300005937 Bacteria 4467
157 Ga0081455_10159847 3300005937 Bacteria 1728
158 Ga0081540_1000069 3300005983 Bacteria 111562
159 Ga0081540_1000394 3300005983 Bacteria 43177
160 Ga0075365_10065906 3300006038 Bacteria 2428
161 Ga0075368_10000982 3300006042 Bacteria 8906
162 Ga0075363_100071829 3300006048 Bacteria 1881
163 Ga0075432_10126682 3300006058 Bacteria 964
164 Ga0070715_10070721 3300006163 Bacteria 1558
165 Ga0070715_10097515 3300006163 Bacteria 1365
166 Ga0075362_10010431 3300006177 Bacteria 3628
167 Ga0075367_10014576 3300006178 Bacteria 4256
168 Ga0075367_10018531 3300006178 Bacteria 3843
169 Ga0075366_10068062 3300006195 Bacteria 2119
170 Ga0097621_100000838 3300006237 Bacteria 21638
171 Ga0097621_100016607 3300006237 Bacteria 5569
172 Ga0097621_100103834 3300006237 Bacteria 2394
173 Ga0075370_10091817 3300006353 Bacteria 1752
174 Ga0068871_100000675 3300006358 Bacteria 23340
175 Ga0068871_100000829 3300006358 Bacteria 20718
176 Ga0068871_100054493 3300006358 Bacteria 3244
177 Ga0068871_100191445 3300006358 Bacteria 1762
178 Ga0075428_100593091 3300006844 Bacteria 1183
179 Ga0075430_100005542 3300006846 Bacteria 10659
180 Ga0075430_100018913 3300006846 Bacteria 5861
181 Ga0075430_100334527 3300006846 Bacteria 1251
182 Ga0075431_100001427 3300006847 Bacteria 21965
183 Ga0075431_100248618 3300006847 Bacteria 1807
184 Ga0075431_100416241 3300006847 Bacteria 1343
185 Ga0075431_100625367 3300006847 Bacteria 1059
186 Ga0075433_10064014 3300006852 Bacteria 3223
187 Ga0075434_100084101 3300006871 Bacteria 3180
188 Ga0075429_100054288 3300006880 Bacteria 3486
189 Ga0097620_100002725 3300006931 Bacteria 17917
190 Ga0079104_1000020 3300006946 Bacteria 256848
191 Ga0075435_100060907 3300007076 Bacteria 3061
192 Ga0105244_10069369 3300009036 Bacteria 1760
193 Ga0105250_10000684 3300009092 Bacteria 21197
194 Ga0105240_10001833 3300009093 Bacteria 35581
195 Ga0105240_10103614 3300009093 Bacteria 3456
196 Ga0111539_10001473 3300009094 Bacteria 31441
197 Ga0111539_10118726 3300009094 Bacteria 3099
198 Ga0111539_10191639 3300009094 Bacteria 2385
199 Ga0105245_10001784 3300009098 Bacteria 19587
200 Ga0105247_10000499 3300009101 Bacteria 32445
201 Ga0105247_10001755 3300009101 Bacteria 15272
202 Ga0105247_10092067 3300009101 Bacteria 1926
203 Ga0114129_10005737 3300009147 Bacteria 17592
204 Ga0114129_10028119 3300009147 Bacteria 7966
205 Ga0114129_10034844 3300009147 Bacteria 7112
206 Ga0114129_10845816 3300009147 Bacteria 1164
207 Ga0114129_11530976 3300009147 Bacteria 818
208 Ga0105243_10003516 3300009148 Bacteria 12656
209 Ga0105243_10040411 3300009148 Bacteria 3643
210 Ga0105241_10099312 3300009174 Bacteria 2311
211 Ga0105241_10106187 3300009174 Bacteria 2241
212 Ga0105241_10491433 3300009174 Bacteria 1093
213 Ga0105241_10623475 3300009174 Bacteria 977
214 Ga0105242_10000776 3300009176 Bacteria 24808
215 Ga0105242_10016603 3300009176 Bacteria 5726
216 Ga0105248_10052796 3300009177 Bacteria 4562
217 Ga0105248_10270480 3300009177 Bacteria 1913
218 Ga0105237_10000240 3300009545 Bacteria 77901
219 Ga0105237_10151970 3300009545 Bacteria 2312
220 Ga0105238_10001156 3300009551 Bacteria 26656
221 Ga0105238_10002207 3300009551 Bacteria 19641
222 Ga0105238_10046900 3300009551 Bacteria 4358
223 Ga0105249_10002404 3300009553 Bacteria 16271
224 Ga0105249_10064841 3300009553 Bacteria 3359
225 Ga0105239_10003666 3300010375 Bacteria 18760
226 Ga0105239_10261190 3300010375 Bacteria 1946
227 Ga0105246_10005681 3300011119 Bacteria 7612
228 Ga0157373_10001212 3300013100 Bacteria 19706
229 Ga0157373_10009846 3300013100 Bacteria 7045
230 Ga0157371_10001038 3300013102 Bacteria 30445
231 Ga0157371_10004495 3300013102 Bacteria 12160
232 Ga0157371_10017286 3300013102 Bacteria 5363
233 Ga0157370_10000662 3300013104 Bacteria 42848
234 Ga0157370_10002750 3300013104 Bacteria 21019
235 Ga0157370_10008238 3300013104 Bacteria 11255
236 Ga0157369_10024719 3300013105 Bacteria 6676
237 Ga0157374_10000876 3300013296 Bacteria 26225
238 Ga0157374_10593162 3300013296 Bacteria 1117
239 Ga0157378_10000880 3300013297 Bacteria 27725
240 Ga0157378_10183652 3300013297 Bacteria 1969
241 Ga0157378_10420922 3300013297 Bacteria 1320
242 Ga0163162_10001408 3300013306 Bacteria 22388
243 Ga0163162_10017854 3300013306 Bacteria 6942
244 Ga0163162_10468019 3300013306 Bacteria 1392
245 Ga0163162_10867132 3300013306 Bacteria 1017
246 Ga0163162_11403658 3300013306 Bacteria 794
247 Ga0157372_10013278 3300013307 Bacteria 8790
248 Ga0157372_10030186 3300013307 Bacteria 5927
249 Ga0157375_10012511 3300013308 Bacteria 7531
250 Ga0157375_10080250 3300013308 Bacteria 3300
251 Ga0157375_10265028 3300013308 Bacteria 1880
252 Ga0163163_10071581 3300014325 Bacteria 3455
253 Ga0163163_10076193 3300014325 Bacteria 3349
254 Ga0163163_10158478 3300014325 Bacteria 2308
255 Ga0157380_10011035 3300014326 Bacteria 6516
256 Ga0157380_10032233 3300014326 Bacteria 4029
257 Ga0157380_10152128 3300014326 Bacteria 2001
258 Ga0157377_10000421 3300014745 Bacteria 18342
259 Ga0157379_10002360 3300014968 Bacteria 15768
260 Ga0157379_10095916 3300014968 Bacteria 2661
261 Ga0157379_10223518 3300014968 Bacteria 1706
262 Ga0157379_10330518 3300014968 Bacteria 1393
263 Ga0157379_10416273 3300014968 Bacteria 1237
264 Ga0157376_10004912 3300014969 Bacteria 9322
265 Ga0157376_10047151 3300014969 Bacteria 3556
266 Ga0157376_10066788 3300014969 Bacteria 3041
267 Ga0157376_10081219 3300014969 Bacteria 2783
268 Ga0182007_10043767 3300015262 Bacteria 1487
269 Ga0183369_1007 3300015685 Bacteria 414878
270 Ga0163161_10019395 3300017792 Bacteria 4771
271 Ga0213872_10000211 3300021361 Bacteria 51730
272 Ga0213872_10029040 3300021361 Bacteria 2536
273 Ga0213876_10000987 3300021384 Bacteria 18681
274 Ga0213876_10130061 3300021384 Bacteria 1338
275 Ga0209674_100635 3300025226 Bacteria 12776
276 Ga0209026_1000037 3300025250 Bacteria 282562
277 Ga0209565_1001442 3300025263 Bacteria 10501
278 Ga0209675_1000025 3300025291 Bacteria 294102
279 Ga0209675_1003444 3300025291 Bacteria 7521
280 Ga0209676_1000198 3300025292 Bacteria 134708
281 Ga0209676_1001165 3300025292 Bacteria 28524
282 Ga0209676_1001500 3300025292 Bacteria 21339
283 Ga0209676_1050538 3300025292 Bacteria 1096
284 Ga0209025_1028558 3300025294 Bacteria 2728
285 Ga0209025_1096882 3300025294 Bacteria 946
286 Ga0209564_1003296 3300025295 Bacteria 11221
287 Ga0209758_1007867 3300025297 Bacteria 7097
288 Ga0209050_1000104 3300025298 Bacteria 228921
289 Ga0209050_1002306 3300025298 Bacteria 16802
290 Ga0209050_1013188 3300025298 Bacteria 3697
291 Ga0209256_1000964 3300025299 Bacteria 34690
292 Ga0209257_1000860 3300025304 Bacteria 43237
293 Ga0209257_1001790 3300025304 Bacteria 23629
294 Ga0209257_1003091 3300025304 Bacteria 14969
295 Ga0209257_1018503 3300025304 Bacteria 2677
296 Ga0207697_10000248 3300025315 Bacteria 29669
297 Ga0207697_10001354 3300025315 Bacteria 13437
298 Ga0207697_10004831 3300025315 Bacteria 6363
299 Ga0207656_10007391 3300025321 Bacteria 3999
300 Ga0207656_10048795 3300025321 Bacteria 1824
301 Ga0207696_1002516 3300025711 Bacteria 8949
302 Ga0207682_10000093 3300025893 Bacteria 41366
303 Ga0207682_10001426 3300025893 Bacteria 11040
304 Ga0207642_10099894 3300025899 Bacteria 1454
305 Ga0207710_10004910 3300025900 Bacteria 5798
306 Ga0207710_10036099 3300025900 Bacteria 2178
307 Ga0207688_10022722 3300025901 Bacteria 3433
308 Ga0207680_10000256 3300025903 Bacteria 25532
309 Ga0207680_10021323 3300025903 Bacteria 3504
310 Ga0207680_10124747 3300025903 Bacteria 1689
311 Ga0207680_10139928 3300025903 Bacteria 1604
312 Ga0207647_10020714 3300025904 Bacteria 4405
313 Ga0207647_10272005 3300025904 Bacteria 968
314 Ga0207645_10000101 3300025907 Bacteria 63405
315 Ga0207645_10139169 3300025907 Bacteria 1581
316 Ga0207643_10000166 3300025908 Bacteria 45538
317 Ga0207643_10002758 3300025908 Bacteria 9501
318 Ga0207643_10163904 3300025908 Bacteria 1338
319 Ga0207643_10209240 3300025908 Bacteria 1190
320 Ga0207705_10029847 3300025909 Bacteria 3888
321 Ga0207705_10061876 3300025909 Bacteria 2704
322 Ga0207684_10008871 3300025910 Bacteria 8927
323 Ga0207654_10414508 3300025911 Bacteria 939
324 Ga0207707_10012137 3300025912 Bacteria 7489
325 Ga0207707_10013190 3300025912 Bacteria 7205
326 Ga0207707_10092784 3300025912 Bacteria 2638
327 Ga0207707_10138615 3300025912 Bacteria 2127
328 Ga0207707_10145645 3300025912 Bacteria 2071
329 Ga0207695_10087457 3300025913 Bacteria 3139
330 Ga0207695_10114082 3300025913 Bacteria 2678
331 Ga0207663_10391493 3300025916 Bacteria 1061
332 Ga0207660_10294296 3300025917 Bacteria 1291
333 Ga0207662_10000010 3300025918 Bacteria 91647
334 Ga0207657_10000353 3300025919 Bacteria 48893
335 Ga0207657_10030005 3300025919 Bacteria 4940
336 Ga0207657_10038401 3300025919 Bacteria 4262
337 Ga0207649_10045312 3300025920 Bacteria 2696
338 Ga0207649_10056595 3300025920 Bacteria 2449
339 Ga0207652_10023091 3300025921 Bacteria 5152
340 Ga0207652_10168974 3300025921 Bacteria 1962
341 Ga0207652_10327530 3300025921 Bacteria 1383
342 Ga0207646_10041233 3300025922 Bacteria 4151
343 Ga0207681_10000002 3300025923 Bacteria 985597
344 Ga0207681_10019058 3300025923 Bacteria 4331
345 Ga0207694_10000623 3300025924 Bacteria 32207
346 Ga0207694_10021700 3300025924 Bacteria 4866
347 Ga0207694_10062426 3300025924 Bacteria 2901
348 Ga0207650_10003185 3300025925 Bacteria 11308
349 Ga0207650_10024028 3300025925 Bacteria 4327
350 Ga0207650_10201645 3300025925 Unclassified 1594
351 Ga0207650_10219288 3300025925 Bacteria 1530
352 Ga0207659_10020488 3300025926 Bacteria 4372
353 Ga0207659_10109120 3300025926 Bacteria 2100
354 Ga0207659_10680183 3300025926 Bacteria 880
355 Ga0207687_10001680 3300025927 Bacteria 15253
356 Ga0207687_10085191 3300025927 Bacteria 2292
357 Ga0207700_10026229 3300025928 Bacteria 4061
358 Ga0207644_10000002 3300025931 Bacteria 942221
359 Ga0207644_10169640 3300025931 Bacteria 1702
360 Ga0207644_10189599 3300025931 Bacteria 1616
361 Ga0207644_10596442 3300025931 Bacteria 917
362 Ga0207644_10869035 3300025931 Bacteria 755
363 Ga0207690_10000424 3300025932 Bacteria 27614
364 Ga0207690_10001856 3300025932 Bacteria 12985
365 Ga0207690_10003818 3300025932 Bacteria 8915
366 Ga0207690_10327261 3300025932 Bacteria 1206
367 Ga0207706_10000077 3300025933 Bacteria 102336
368 Ga0207706_10008405 3300025933 Bacteria 9525
369 Ga0207686_10471912 3300025934 Bacteria 969
370 Ga0207709_10000055 3300025935 Bacteria 222373
371 Ga0207709_10021881 3300025935 Bacteria 3622
372 Ga0207670_10018583 3300025936 Bacteria 4230
373 Ga0207669_10031514 3300025937 Bacteria 2963
374 Ga0207704_10009730 3300025938 Bacteria 4654
375 Ga0207704_10441779 3300025938 Bacteria 1036
376 Ga0207665_10117829 3300025939 Bacteria 1873
377 Ga0207665_10170312 3300025939 Bacteria 1572
378 Ga0207691_10000033 3300025940 Bacteria 115126
379 Ga0207691_10000680 3300025940 Bacteria 33596
380 Ga0207691_10004283 3300025940 Bacteria 13863
381 Ga0207711_10036711 3300025941 Bacteria 4159
382 Ga0207711_10675841 3300025941 Bacteria 963
383 Ga0207689_10003350 3300025942 Bacteria 14674
384 Ga0207689_10032746 3300025942 Bacteria 4321
385 Ga0207689_10403368 3300025942 Bacteria 1140
386 Ga0207689_10653300 3300025942 Bacteria 886
387 Ga0207661_10038621 3300025944 Bacteria 3743
388 Ga0207661_10799434 3300025944 Bacteria 868
389 Ga0207679_10023078 3300025945 Bacteria 4248
390 Ga0207667_10008704 3300025949 Bacteria 12029
391 Ga0207667_10015762 3300025949 Bacteria 8570
392 Ga0207651_10014737 3300025960 Bacteria 4523
393 Ga0207651_10066916 3300025960 Bacteria 2526
394 Ga0207712_10002383 3300025961 Bacteria 12182
395 Ga0207712_10008093 3300025961 Bacteria 6651
396 Ga0207668_10097860 3300025972 Bacteria 2172
397 Ga0207640_10041946 3300025981 Bacteria 2914
398 Ga0207640_10117583 3300025981 Bacteria 1898
399 Ga0207640_10230495 3300025981 Bacteria 1424
400 Ga0207640_10402962 3300025981 Bacteria 1114
401 Ga0207658_10010583 3300025986 Bacteria 6267
402 Ga0207658_10029130 3300025986 Bacteria 3895
403 Ga0207658_10039364 3300025986 Bacteria 3411
404 Ga0207677_10004853 3300026023 Bacteria 7256
405 Ga0207677_10019078 3300026023 Bacteria 4132
406 Ga0207703_10014955 3300026035 Bacteria 6055
407 Ga0207703_10024943 3300026035 Bacteria 4704
408 Ga0207703_10072035 3300026035 Bacteria 2856
409 Ga0207639_10657331 3300026041 Bacteria 970
410 Ga0207678_10000464 3300026067 Bacteria 36746
411 Ga0207678_10691855 3300026067 Bacteria 897
412 Ga0207708_10011861 3300026075 Bacteria 6489
413 Ga0207708_10082139 3300026075 Bacteria 2477
414 Ga0207708_10379530 3300026075 Bacteria 1165
415 Ga0207708_10452851 3300026075 Bacteria 1069
416 Ga0207702_10229162 3300026078 Bacteria 1735
417 Ga0207641_10009679 3300026088 Bacteria 7940
418 Ga0207641_10015606 3300026088 Bacteria 6225
419 Ga0207641_10115063 3300026088 Bacteria 2391
420 Ga0207641_10459667 3300026088 Bacteria 1231
421 Ga0207648_10000189 3300026089 Bacteria 64801
422 Ga0207648_10015036 3300026089 Bacteria 7127
423 Ga0207648_10459721 3300026089 Bacteria 1160
424 Ga0207676_10000304 3300026095 Bacteria 42178
425 Ga0207676_10007112 3300026095 Bacteria 7931
426 Ga0207676_10026418 3300026095 Bacteria 4319
427 Ga0207676_10093156 3300026095 Bacteria 2479
428 Ga0207676_10489054 3300026095 Bacteria 1167
429 Ga0207674_10000224 3300026116 Bacteria 70660
430 Ga0207674_10368821 3300026116 Bacteria 1388
431 Ga0207675_100000043 3300026118 Bacteria 89667
432 Ga0207675_100000137 3300026118 Bacteria 62412
433 Ga0207675_100019121 3300026118 Bacteria 6395
434 Ga0207675_100042371 3300026118 Bacteria 4250
435 Ga0207683_10011248 3300026121 Bacteria 7630
436 Ga0207683_10023264 3300026121 Bacteria 5327
437 Ga0207683_10031886 3300026121 Bacteria 4576
438 Ga0207683_10188941 3300026121 Bacteria 1870
439 Ga0207683_10498685 3300026121 Bacteria 1124
440 Ga0207698_10001141 3300026142 Bacteria 15454
441 Ga0209281_1000002 3300027111 Bacteria 1924012
442 Ga0209983_1013907 3300027665 Bacteria 1656
443 Ga0209813_10002831 3300027866 Bacteria 4014
444 Ga0209974_10019699 3300027876 Bacteria 2237
445 Ga0207428_10000018 3300027907 Bacteria 293117
446 Ga0207428_10000043 3300027907 Bacteria 198931
447 Ga0207428_10275384 3300027907 Bacteria 1250
448 Ga0268266_10010399 3300028379 Bacteria 8133
449 Ga0268266_10041792 3300028379 Bacteria 3914
450 Ga0268266_10227150 3300028379 Bacteria 1718
451 Ga0268265_10000264 3300028380 Bacteria 59642
452 Ga0268265_10023793 3300028380 Bacteria 4323
453 Ga0268265_10032629 3300028380 Bacteria 3776
454 Ga0268265_10103258 3300028380 Bacteria 2308
455 Ga0268265_10214672 3300028380 Bacteria 1679
456 Ga0268265_10477623 3300028380 Bacteria 1170
457 Ga0268264_10000071 3300028381 Bacteria 267236
458 Ga0268264_10120771 3300028381 Bacteria 2309
459 Ga0268264_10238196 3300028381 Bacteria 1684
460 Ga0268264_10522847 3300028381 Bacteria 1160
461 Ga0265323_10075991 3300028653 Unclassified 1140
462 Ga0307515_10003406 3300028794 Bacteria 33481
463 Ga0307515_10006103 3300028794 Bacteria 24230
464 Ga0307515_10027473 3300028794 Bacteria 9726
465 Ga0307515_10068694 3300028794 Bacteria 4861
466 Ga0307515_10307019 3300028794 Bacteria 1265
467 Ga0307515_10347750 3300028794 Bacteria 1131
468 Ga0265338_10040980 3300028800 Bacteria 4339
469 Ga0307512_10066250 3300030522 Bacteria 2730
470 Ga0265332_10056750 3300031238 Bacteria 1678
471 Ga0265339_10270648 3300031249 Bacteria 817
472 Ga0265316_10000349 3300031344 Bacteria 51876
473 Ga0307513_10105713 3300031456 Bacteria 2823
474 Ga0307513_10393839 3300031456 Bacteria 1121
475 Ga0307509_10004212 3300031507 Bacteria 20986
476 Ga0307408_100002690 3300031548 Bacteria 12339
477 Ga0307408_100012733 3300031548 Bacteria 5577
478 Ga0307408_100345880 3300031548 Bacteria 1260
479 Ga0307408_100419130 3300031548 Bacteria 1154
480 Ga0307408_100749231 3300031548 Bacteria 882
481 Ga0307508_10000048 3300031616 Bacteria 137587
482 Ga0307508_10344018 3300031616 Bacteria 1083
483 Ga0265314_10011769 3300031711 Bacteria 7196
484 Ga0265314_10058937 3300031711 Bacteria 2629
485 Ga0265342_10081350 3300031712 Bacteria 1870
486 Ga0307516_10346404 3300031730 Bacteria 1152
487 Ga0307405_10006369 3300031731 Bacteria 5802
488 Ga0307405_10009680 3300031731 Bacteria 4953
489 Ga0307405_10253818 3300031731 Bacteria 1310
490 Ga0307413_10056193 3300031824 Bacteria 2399
491 Ga0307413_10190893 3300031824 Bacteria 1471
492 Ga0307518_10233755 3300031838 Bacteria 1187
493 Ga0307410_10108851 3300031852 Bacteria 2002
494 Ga0307410_10161971 3300031852 Bacteria 1677
495 Ga0307410_10189257 3300031852 Bacteria 1564
496 Ga0307406_10009322 3300031901 Bacteria 5501
497 Ga0307406_10081421 3300031901 Bacteria 2153
498 Ga0307406_10087312 3300031901 Bacteria 2090
499 Ga0307406_10200855 3300031901 Bacteria 1467
500 Ga0307407_10065456 3300031903 Bacteria 2140
501 Ga0307407_10496013 3300031903 Bacteria 894
502 Ga0307412_10014216 3300031911 Bacteria 4690
503 Ga0307412_10022171 3300031911 Bacteria 3889
504 Ga0307412_10064124 3300031911 Bacteria 2481
505 Ga0307412_10085707 3300031911 Bacteria 2190
506 Ga0307412_10103139 3300031911 Bacteria 2021
507 Ga0307412_10104851 3300031911 Bacteria 2007
508 Ga0307412_10264090 3300031911 Bacteria 1344
509 Ga0307412_10625517 3300031911 Bacteria 915
510 Ga0307412_10960940 3300031911 Bacteria 752
511 Ga0307409_100134923 3300031995 Bacteria 2116
512 Ga0307409_100542934 3300031995 Bacteria 1140
513 Ga0307416_100004163 3300032002 Bacteria 8670
514 Ga0307416_100050988 3300032002 Bacteria 3302
515 Ga0307416_100367942 3300032002 Bacteria 1462
516 Ga0307416_101294113 3300032002 Bacteria 835
517 Ga0307414_10002973 3300032004 Bacteria 8971
518 Ga0307414_10055406 3300032004 Bacteria 2776
519 Ga0307414_10075866 3300032004 Bacteria 2441
520 Ga0307414_10108443 3300032004 Bacteria 2106
521 Ga0307411_10000528 3300032005 Bacteria 13457
522 Ga0307411_10017762 3300032005 Bacteria 4064
523 Ga0307411_10745652 3300032005 Bacteria 857
524 Ga0307415_100011676 3300032126 Bacteria 5040
525 Ga0307415_100752758 3300032126 Bacteria 885
526 Ga0307510_10218823 3300033180 Bacteria 1418
527 Ga0373940_0052288 3300035088 Bacteria 1150
528 Ga0373943_0267748 3300035170 Bacteria 963
529 Ga0316574_0340729 3300035398 Bacteria 950
530 Ga0373931_0003751 3300035691 Bacteria 6870
531 Ga0373931_0408658 3300035691 Bacteria 861
532 Ga0373937_0024289 3300036401 Bacteria 5465
533 Ga0373937_0048181 3300036401 Bacteria 3900
534 Ga0373937_0099401 3300036401 Bacteria 2699
535 Ga0373937_0341582 3300036401 Bacteria 1418
536 Ga0373925_0062160 3300037068 Bacteria 2808
537 Ga0373925_0376142 3300037068 Bacteria 1156
538 Ga0436364_0516927 3300037853 Bacteria 1938
539 Ga0436364_0791589 3300037853 Bacteria 3861
540 Ga0436365_1599716 3300039437 Bacteria 29460
541 Ga0436361_0057254 3300039447 Bacteria 8651
542 Ga0436361_0606718 3300039447 Bacteria 5397
543 Ga0436361_0991571 3300039447 Bacteria 8152
544 Ga0436361_1094211 3300039447 Bacteria 10053
545 Ga0439438_000002 3300041405 Bacteria 618223
546 Ga0439447_004906 3300041407 Bacteria 4525
547 Ga0451839_1570770 3300041496 Unclassified 1598
548 Ga0451841_0746418 3300041498 Bacteria 1276
549 Ga0451851_0269188 3300041507 Bacteria 1515
550 Ga0451843_1443981 3300041509 Bacteria 793
551 Ga0439441_024856 3300042001 Bacteria 1128
552 Ga0439464_0009337 3300042439 Bacteria 2581
553 Ga0439464_0011418 3300042439 Bacteria 2354
554 Ga0450893_0000595 3300042532 Bacteria 5170
555 Ga0451577_0503113 3300042876 Bacteria 1100
556 Ga0439440_0021028 3300042993 Bacteria 1468
557 Ga0466972_0074519 3300044658 Bacteria 1617
558 Ga0453684_0063816 3300044712 Bacteria 4708
559 Ga0453684_0110535 3300044712 Bacteria 3340
560 Ga0453684_0194669 3300044712 Bacteria 2368
561 Ga0453684_1344060 3300044712 Bacteria 743
562 Ga0466957_0285841 3300044842 Bacteria 1105
563 Ga0451576_0246624 3300045051 Bacteria 1866
564 Ga0495617_000554 3300046452 Bacteria 19232
565 Ga0495627_073813 3300046453 Bacteria 994
566 Ga0495590_0003858 3300046457 Bacteria 6100
567 Ga0495580_0000143 3300046472 Bacteria 51276
568 Ga0495580_0422069 3300046472 Bacteria 897
569 Ga0495584_0001236 3300046491 Bacteria 15593
570 Ga0495584_0211580 3300046491 Bacteria 986
571 Ga0495584_0315117 3300046491 Bacteria 794
572 Ga0495585_0000050 3300046492 Bacteria 119283
573 Ga0495585_0000053 3300046492 Bacteria 115559
574 Ga0495585_0002270 3300046492 Bacteria 13878
575 Ga0495585_0019274 3300046492 Bacteria 3934
576 Ga0495596_0004585 3300046500 Bacteria 6703
577 Ga0495607_0032804 3300046501 Bacteria 3165
578 Ga0495583_0000318 3300046506 Bacteria 76178
579 Ga0495583_0046727 3300046506 Bacteria 1995
580 Ga0495606_0076693 3300046507 Bacteria 2088
581 Ga0495606_0153892 3300046507 Bacteria 1347
582 Ga0495610_0000012 3300046512 Bacteria 517442
583 Ga0495616_0000860 3300046513 Bacteria 22061
584 Ga0495616_0002305 3300046513 Bacteria 12769
585 Ga0495616_0023292 3300046513 Bacteria 3332
586 Ga0495643_0080075 3300046522 Bacteria 1701
587 Ga0495648_0000080 3300046524 Bacteria 126026
588 Ga0495648_0000320 3300046524 Bacteria 53330
589 Ga0495654_0001046 3300046530 Bacteria 20265
590 Ga0495654_0028958 3300046530 Bacteria 2828
591 Ga0495654_0086072 3300046530 Bacteria 1465
592 Ga0495665_0010830 3300046531 Bacteria 4934
593 Ga0495598_0028406 3300046537 Bacteria 1551
594 Ga0495609_0003471 3300046538 Bacteria 9018
595 Ga0495597_0000687 3300046542 Bacteria 27336
596 Ga0495633_0001928 3300046558 Bacteria 15107
597 Ga0495633_0021967 3300046558 Bacteria 3184
598 Ga0495668_0000001 3300046616 Bacteria 1013420
599 Ga0495668_0005283 3300046616 Bacteria 8832
600 Ga0495611_0209906 3300046648 Bacteria 907
601 Ga0495625_0000362 3300046660 Bacteria 69497
602 Ga0495625_0031630 3300046660 Bacteria 3933
603 Ga0495588_0264778 3300046674 Unclassified 906
604 Ga0495670_0002312 3300046691 Bacteria 9417
605 Ga0495671_0000006 3300046692 Bacteria 500471
606 Ga0495660_0000484 3300046810 Bacteria 33161
607 Ga0495604_0047813 3300047317 Bacteria 3331
608 Ga0495636_0010356 3300047318 Bacteria 3682
609 Ga0495683_0000079 3300047323 Bacteria 96333
610 Ga0495681_0050816 3300047470 Bacteria 1952
611 Ga0495686_0060297 3300047472 Bacteria 2359
612 Ga0495615_0057830 3300048090 Bacteria 1016
613 Ga0495626_0078800 3300048091 Bacteria 1467
614 Ga0495626_0095229 3300048091 Bacteria 1304
615 Ga0495626_0138329 3300048091 Bacteria 1034
616 Ga0496100_0594439 3300048903 Bacteria 859
617 Ga0496102_0001755 3300048905 Bacteria 18917
618 Ga0496102_0036708 3300048905 Bacteria 4416
619 Ga0496102_0047207 3300048905 Bacteria 3912
620 Ga0496102_0102899 3300048905 Bacteria 2655
621 Ga0496102_0839520 3300048905 Bacteria 841
622 Ga0496104_0014231 3300048907 Bacteria 7181
623 Ga0496104_1067454 3300048907 Bacteria 711
624 Ga0496106_0014891 3300048909 Bacteria 5753
625 Ga0496107_0029674 3300048910 Bacteria 3893
626 Ga0496107_0030293 3300048910 Bacteria 3857
627 Ga0496109_0061532 3300048912 Bacteria 3432
628 Ga0496112_0005601 3300048915 Bacteria 10892
629 Ga0496112_0349570 3300048915 Bacteria 1421
630 Ga0496113_0033418 3300048916 Bacteria 3745
631 Ga0496113_0303190 3300048916 Unclassified 1279
632 Ga0496113_0425505 3300048916 Bacteria 1067
633 Ga0496114_1025408 3300048917 Bacteria 709
634 Ga0496121_0153883 3300048924 Bacteria 1689
635 Ga0496122_0008622 3300048925 Bacteria 10945
636 Ga0496123_0009128 3300048926 Bacteria 8972
637 Ga0496124_0098966 3300048927 Bacteria 2365
638 Ga0496126_0031046 3300048929 Bacteria 5054
639 Ga0496126_0395996 3300048929 Bacteria 1121
640 Ga0501310_003920 3300049130 Bacteria 1473
641 Ga0495682_0040174 3300049460 Bacteria 1716
642 Ga0501295_000664 3300049518 Bacteria 3227
643 Ga0501300_004637 3300049523 Bacteria 2033
644 Ga0501032_0127621 3300049569 Bacteria 1679
645 Ga0501033_0003236 3300049570 Bacteria 13474
646 Ga0501033_0010481 3300049570 Bacteria 7110
647 Ga0501033_0033222 3300049570 Bacteria 3874
648 Ga0501033_0084621 3300049570 Bacteria 2324
649 Ga0501033_0099157 3300049570 Bacteria 2127
650 Ga0501033_0106255 3300049570 Bacteria 2045
651 Ga0501033_0177232 3300049570 Bacteria 1529
652 Ga0501034_0014593 3300049571 Bacteria 8088
653 Ga0501034_0029450 3300049571 Bacteria 5580
654 Ga0501034_0043880 3300049571 Bacteria 4522
655 Ga0501034_0113887 3300049571 Bacteria 2694
656 Ga0501036_0001437 3300049572 Bacteria 18309
657 Ga0501036_0083371 3300049572 Bacteria 2702
658 Ga0501036_0179170 3300049572 Bacteria 1784
659 Ga0501036_0184880 3300049572 Bacteria 1754
660 Ga0501037_0005886 3300049573 Bacteria 8960
661 Ga0501037_0017242 3300049573 Bacteria 5317
662 Ga0501037_0074982 3300049573 Bacteria 2457
663 Ga0501037_0109552 3300049573 Bacteria 1990
664 Ga0501038_0002195 3300049574 Bacteria 18153
665 Ga0501038_0009271 3300049574 Bacteria 9026
666 Ga0501038_0418042 3300049574 Bacteria 1035
667 Ga0501039_0034416 3300049575 Bacteria 3909
668 Ga0501039_0123174 3300049575 Bacteria 2032
669 Ga0501039_0313667 3300049575 Bacteria 1233
670 Ga0501040_0000010 3300049576 Bacteria 80841
671 Ga0501040_0077260 3300049576 Bacteria 2303
672 Ga0501041_0008456 3300049577 Bacteria 6055
673 Ga0501041_0040286 3300049577 Bacteria 2835
674 Ga0501041_0150534 3300049577 Bacteria 1453
675 Ga0501042_0000323 3300049578 Bacteria 23831
676 Ga0501042_0074718 3300049578 Bacteria 2425
677 Ga0501043_0023855 3300049579 Bacteria 4798
678 Ga0501043_0025869 3300049579 Bacteria 4604
679 Ga0501043_0124534 3300049579 Bacteria 2021
680 Ga0501043_0299341 3300049579 Bacteria 1229
681 Ga0501046_0004727 3300049580 Bacteria 12284
682 Ga0501046_0123836 3300049580 Bacteria 1965
683 Ga0501046_0135376 3300049580 Bacteria 1866
684 Ga0501047_0000984 3300049581 Bacteria 28735
685 Ga0501047_0009139 3300049581 Bacteria 9356
686 Ga0501047_0093597 3300049581 Bacteria 2884
687 Ga0501047_0106118 3300049581 Bacteria 2689
688 Ga0501047_0186772 3300049581 Bacteria 1938
689 Ga0501047_0250758 3300049581 Bacteria 1619
690 Ga0501047_0302899 3300049581 Unclassified 1440
691 Ga0501047_0305728 3300049581 Bacteria 1432
692 Ga0501048_0020833 3300049582 Bacteria 4804
693 Ga0501048_0084795 3300049582 Bacteria 2234
694 Ga0501068_0024875 3300049584 Bacteria 3519
695 Ga0501070_0070755 3300049586 Bacteria 2888
696 Ga0501070_0082962 3300049586 Bacteria 2653
697 Ga0501070_0121976 3300049586 Bacteria 2154
698 Ga0501070_0130847 3300049586 Bacteria 2073
699 Ga0501070_0298675 3300049586 Bacteria 1312
700 Ga0501071_0020060 3300049587 Bacteria 4644
701 Ga0501071_0084352 3300049587 Bacteria 2328
702 Ga0501072_0033851 3300049588 Bacteria 4003
703 Ga0501072_0039242 3300049588 Bacteria 3718
704 Ga0501072_0150802 3300049588 Bacteria 1853
705 Ga0501073_0116260 3300049589 Bacteria 1854
706 Ga0501073_0330784 3300049589 Bacteria 1052
707 Ga0501074_0135492 3300049590 Bacteria 1761
708 Ga0501075_0000090 3300049591 Bacteria 41736
709 Ga0501075_0058090 3300049591 Bacteria 2913
710 Ga0501076_0003453 3300049592 Bacteria 11085
711 Ga0501076_0019707 3300049592 Bacteria 5158
712 Ga0501076_0597280 3300049592 Bacteria 911
713 Ga0501077_0000017 3300049593 Bacteria 86892
714 Ga0501077_0043870 3300049593 Bacteria 2841
715 Ga0501077_0226542 3300049593 Bacteria 1188
716 Ga0501211_000027 3300049658 Bacteria 10788
717 Ga0501222_005706 3300049662 Bacteria 1674
718 Ga0501223_020669 3300049663 Bacteria 1288
719 Ga0501227_001013 3300049665 Bacteria 6227
720 Ga0501233_030032 3300049668 Bacteria 1222
721 Ga0501235_004365 3300049669 Bacteria 3059
722 Ga0501236_017275 3300049670 Bacteria 1030
723 Ga0501253_001290 3300049683 Bacteria 2508
724 Ga0501255_000775 3300049684 Bacteria 2334
725 Ga0501257_000064 3300049686 Bacteria 29858
726 Ga0501221_000998 3300049704 Bacteria 4650
727 Ga0501229_006708 3300049706 Bacteria 1426
728 Ga0501079_0000063 3300049741 Bacteria 48461
729 Ga0501079_0133991 3300049741 Bacteria 1928
730 Ga0501080_0020796 3300049742 Bacteria 6075
731 Ga0501080_0054679 3300049742 Bacteria 3717
732 Ga0501081_0000085 3300049743 Bacteria 37187
733 Ga0501081_0044647 3300049743 Bacteria 3042
734 Ga0501081_0081609 3300049743 Bacteria 2265
735 Ga0501081_0378437 3300049743 Bacteria 1046
736 Ga0501083_0057315 3300049744 Bacteria 2608
737 Ga0501262_001434 3300049759 Bacteria 2674
738 Ga0501267_000696 3300049764 Bacteria 2696
739 Ga0501268_008679 3300049765 Bacteria 1546
740 Ga0501269_010095 3300049766 Bacteria 1146
741 Ga0501274_003133 3300049771 Bacteria 1325
742 Ga0501280_004097 3300049776 Bacteria 2168
743 Ga0501282_019814 3300049778 Bacteria 737
744 Ga0501283_019534 3300049779 Bacteria 1073
745 Ga0501035_0002403 3300049822 Bacteria 18351
746 Ga0501035_0003576 3300049822 Bacteria 14852
747 Ga0501035_0010161 3300049822 Bacteria 8736
748 Ga0501035_0011687 3300049822 Bacteria 8137
749 Ga0501035_0038689 3300049822 Bacteria 4318
750 Ga0501035_0099678 3300049822 Bacteria 2550
751 Ga0501035_0367969 3300049822 Bacteria 1200
752 Ga0501035_0553431 3300049822 Bacteria 942
753 Ga0501044_0003486 3300049823 Bacteria 17718
754 Ga0501044_0013688 3300049823 Bacteria 8767
755 Ga0501044_0019918 3300049823 Bacteria 7166
756 Ga0501044_0023203 3300049823 Bacteria 6602
757 Ga0501044_0093581 3300049823 Bacteria 3030
758 Ga0501044_0248177 3300049823 Bacteria 1722
759 Ga0501045_0004295 3300049824 Bacteria 9827
760 Ga0501045_0056311 3300049824 Bacteria 2875
761 nmdc:mga00v17_412249_c1 3300050491 Bacteria 878
762 nmdc:mga0yw44_250829_c1 3300050492 Bacteria 1178
763 nmdc:mga0k408_139038_c1 3300050493 Bacteria 1444
764 nmdc:mga0k408_33801_c1 3300050493 Bacteria 2926
765 nmdc:mga0k408_7914_c1 3300050493 Bacteria 5692
766 nmdc:mga06z11_118651_c1 3300050494 Bacteria 1473
767 nmdc:mga06z11_3889_c1 3300050494 Bacteria 5823
768 nmdc:mga07m45_15425_c1 3300050496 Bacteria 4080
769 nmdc:mga07m45_46577_c1 3300050496 Bacteria 2437
770 nmdc:mga07m45_5812_c1 3300050496 Bacteria 6184
771 nmdc:mga05p37_13597_c1 3300050507 Bacteria 9754
772 nmdc:mga05p37_23630_c1 3300050507 Bacteria 7462
773 nmdc:mga09592_11219_c1 3300050508 Bacteria 7291
774 nmdc:mga09592_61725_c1 3300050508 Bacteria 3170
775 nmdc:mga0qj67_11191_c1 3300050509 Bacteria 6719
776 nmdc:mga0qj67_32483_c1 3300050509 Bacteria 4070
777 nmdc:mga0qj67_387_c1 3300050509 Bacteria 30412
778 nmdc:mga0qj67_503545_c1 3300050509 Bacteria 973
779 nmdc:mga06r32_14997_c1 3300050510 Bacteria 7034
780 nmdc:mga06r32_33713_c1 3300050510 Bacteria 4824
781 nmdc:mga06r32_497125_c1 3300050510 Bacteria 1197
782 nmdc:mga08y16_12498_c2 3300050511 Bacteria 5604
783 nmdc:mga08y16_162264_c1 3300050511 Bacteria 2322
784 nmdc:mga08y16_267526_c1 3300050511 Bacteria 1765
785 nmdc:mga08y16_95098_c1 3300050511 Bacteria 3104
786 nmdc:mga0n895_148318_c1 3300050512 Bacteria 2375
787 nmdc:mga0n895_531651_c1 3300050512 Bacteria 1183
788 nmdc:mga0n895_81312_c1 3300050512 Bacteria 3229
789 nmdc:mga0rr50_101551_c1 3300050513 Bacteria 2261
790 nmdc:mga0rr50_60001_c1 3300050513 Bacteria 2859
791 nmdc:mga0a205_25112_c1 3300050515 Bacteria 5673
792 nmdc:mga0sz30_227324_c1 3300050516 Bacteria 830
793 Ga0500643_036169 3300053087 Bacteria 1476
794 Ga0500643_079371 3300053087 Bacteria 903
795 Ga0500643_081047 3300053087 Bacteria 891
796 Ga0500643_103732 3300053087 Bacteria 770
797 Ga0500641_0103669 3300053096 Bacteria 1221
798 Ga0500557_020196 3300053105 Bacteria 1891
799 Ga0500562_000349 3300053108 Bacteria 11114
800 Ga0500592_000217 3300053116 Bacteria 10476
801 Ga0500608_010809 3300053122 Bacteria 3934
802 Ga0500618_000391 3300053125 Bacteria 30070
803 Ga0500642_0000002 3300053130 Bacteria 795093
804 Ga0500658_0014928 3300053134 Bacteria 2879
805 Ga0500564_186009 3300053138 Bacteria 863
806 Ga0500604_0035494 3300053151 Bacteria 1484
807 Ga0500616_0004492 3300053153 Bacteria 9917
808 Ga0500622_0000023 3300053156 Bacteria 251170
809 Ga0500622_0283844 3300053156 Bacteria 712
810 Ga0500627_0000027 3300053158 Bacteria 99420
811 Ga0500627_0000230 3300053158 Bacteria 15971
812 Ga0501084_0033174 3300054114 Bacteria 4318
813 Ga0501082_0000908 3300060353 Bacteria 26064
814 Ga0501082_0046584 3300060353 Bacteria 3737
815 Ga0501082_0224781 3300060353 Bacteria 1633
816 Ga0530510_0132847 3300061734 Bacteria 1831
817 Ga0530510_0300547 3300061734 Bacteria 1201

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050516 nmdc:mga0sz30_227324_c1 nmdc:mga0sz30_227324_c1_18_572 183
2 3300009174 Ga0105241_10106187 Ga0105241_101061872 205
3 3300014968 Ga0157379_10002360 Ga0157379_100023604 205
4 3300048909 Ga0496106_0014891 Ga0496106_0014891_4621_5280 205
5 3300009101 Ga0105247_10092067 Ga0105247_100920672 206
6 3300025942 Ga0207689_10653300 Ga0207689_106533001 206
7 3300035691 Ga0373931_0408658 Ga0373931_0408658_124_783 206
8 3300048903 Ga0496100_0594439 Ga0496100_0594439_163_822 206
9 3300048905 Ga0496102_0001755 Ga0496102_0001755_4823_5482 206
10 3300048907 Ga0496104_0014231 Ga0496104_0014231_1183_1842 206
11 3300049581 Ga0501047_0302899 Ga0501047_0302899_81_704 207
12 3300005841 Ga0068863_100288715 Ga0068863_1002887152 210
13 3300026088 Ga0207641_10459667 Ga0207641_104596672 210
14 3300028380 Ga0268265_10214672 Ga0268265_102146722 210
15 3300005331 Ga0070670_100468456 Ga0070670_1004684562 211
16 3300005334 Ga0068869_100942753 Ga0068869_1009427531 211
17 3300005335 Ga0070666_10144040 Ga0070666_101440402 211
18 3300014968 Ga0157379_10330518 Ga0157379_103305182 211
19 3300048907 Ga0496104_1067454 Ga0496104_1067454_46_693 211
20 3300048917 Ga0496114_1025408 Ga0496114_1025408_29_676 211
21 3300025939 Ga0207665_10117829 Ga0207665_101178292 212
22 3300005440 Ga0070705_100482493 Ga0070705_1004824931 213
23 3300006163 Ga0070715_10097515 Ga0070715_100975152 213
24 3300035088 Ga0373940_0052288 Ga0373940_0052288_74_715 213
25 3300035691 Ga0373931_0003751 Ga0373931_0003751_4263_4904 213
26 3300046501 Ga0495607_0032804 Ga0495607_0032804_225_914 213
27 3300046507 Ga0495606_0076693 Ga0495606_0076693_18_707 213
28 3300048905 Ga0496102_0839520 Ga0496102_0839520_149_829 213
29 3300048910 Ga0496107_0029674 Ga0496107_0029674_1203_1844 213
30 3300050512 nmdc:mga0n895_148318_c1 nmdc:mga0n895_148318_c1_596_1237 213
31 3300050513 nmdc:mga0rr50_101551_c1 nmdc:mga0rr50_101551_c1_892_1533 213
32 3300048925 Ga0496122_0008622 Ga0496122_0008622_3756_4433 215
33 3300048926 Ga0496123_0009128 Ga0496123_0009128_6904_7581 215
34 3300048929 Ga0496126_0395996 Ga0496126_0395996_237_914 215
35 3300050493 nmdc:mga0k408_7914_c1 nmdc:mga0k408_7914_c1_1852_2625 215
36 3300050496 nmdc:mga07m45_5812_c1 nmdc:mga07m45_5812_c1_4457_5230 215
37 iso_pu_bacteria 2919501602 2919501933 218
38 iso_pu_bacteria 2926063275 2926063606 218
39 3300005339 Ga0070660_100018896 Ga0070660_1000188966 219
40 3300005366 Ga0070659_100000743 Ga0070659_1000007433 219
41 3300025911 Ga0207654_10414508 Ga0207654_104145082 219
42 3300025919 Ga0207657_10030005 Ga0207657_100300052 219
43 3300025932 Ga0207690_10000424 Ga0207690_100004248 219
44 iso_pu_bacteria 2744054655 2745162240 219
45 iso_pu_bacteria 2843690924 2843695697 219
46 iso_pu_bacteria 2881101125 2881104249 219
47 iso_pu_bacteria 2919506607 2919509092 219
48 iso_pu_bacteria 2998344455 2998344880 219
49 3300044712 Ga0453684_0110535 Ga0453684_0110535_237_902 220
50 iso_pu_bacteria 2887630918 2887631410 220
51 3300031911 Ga0307412_10264090 Ga0307412_102640902 221
52 3300044712 Ga0453684_0194669 Ga0453684_0194669_28_699 221
53 3300049571 Ga0501034_0113887 Ga0501034_0113887_1874_2542 221
54 iso_pu_bacteria 2515154122 2515683113 221
55 iso_pu_bacteria 2687453130 2687583839 221
56 iso_pu_bacteria 2744054900 2746090958 221
57 iso_pu_bacteria 2744054901 2746093507 221
58 iso_pu_bacteria 2811994881 2812368642 221
59 iso_pu_bacteria 2842324504 2842326359 221
60 iso_pu_bacteria 2842348783 2842351122 221
61 iso_pu_bacteria 2842454564 2842455670 221
62 iso_pu_bacteria 2923519811 2923522701 221
63 iso_pu_bacteria 2932422444 2932423370 221
64 3300031911 Ga0307412_10103139 Ga0307412_101031392 222
65 3300049518 Ga0501295_000664 Ga0501295_000664_1028_1705 222
66 iso_pu_bacteria 2501025502 2501077461 222
67 iso_pu_bacteria 2510917013 2511092593 222
68 iso_pu_bacteria 2513237082 2513557193 222
69 iso_pu_bacteria 2513237083 2513562819 222
70 iso_pu_bacteria 2526164512 2526211242 222
71 iso_pu_bacteria 2643221563 2643835631 222
72 iso_pu_bacteria 2643221608 2644056557 222
73 iso_pu_bacteria 2721755523 2722885979 222
74 iso_pu_bacteria 2823421272 2823422660 222
75 iso_pu_bacteria 2839138175 2839144253 222
76 iso_pu_bacteria 2857504554 2857505825 222
77 iso_pu_bacteria 2857564685 2857568318 222
78 iso_pu_bacteria 2881927736 2881928003 222
79 iso_pu_bacteria 2887375801 2887379156 222
80 iso_pu_bacteria 2895511927 2895516954 222
81 iso_pu_bacteria 2974320154 2974320744 222
82 iso_pu_bacteria 8003955200 8003955977 222
83 3300021361 Ga0213872_10029040 Ga0213872_100290402 223
84 3300039447 Ga0436361_0606718 Ga0436361_0606718_3754_4434 223
85 3300039447 Ga0436361_0991571 Ga0436361_0991571_7099_7779 223
86 3300046674 Ga0495588_0264778 Ga0495588_0264778_16_696 223
87 3300048916 Ga0496113_0303190 Ga0496113_0303190_70_750 223
88 3300048929 Ga0496126_0031046 Ga0496126_0031046_3427_4107 223
89 3300053156 Ga0500622_0000023 Ga0500622_0000023_128458_129138 223
90 iso_pu_bacteria 2547132103 2547374908 223
91 3300005441 Ga0070700_100295253 Ga0070700_1002952531 224
92 3300005563 Ga0068855_100001278 Ga0068855_10000127819 224
93 3300005614 Ga0068856_100020253 Ga0068856_1000202534 224
94 3300006195 Ga0075366_10068062 Ga0075366_100680622 224
95 3300009545 Ga0105237_10151970 Ga0105237_101519702 224
96 3300025913 Ga0207695_10114082 Ga0207695_101140822 224
97 3300025926 Ga0207659_10680183 Ga0207659_106801831 224
98 3300025949 Ga0207667_10008704 Ga0207667_1000870410 224
99 3300026075 Ga0207708_10379530 Ga0207708_103795301 224
100 3300027665 Ga0209983_1013907 Ga0209983_10139072 224
101 3300027876 Ga0209974_10019699 Ga0209974_100196992 224
102 3300028794 Ga0307515_10003406 Ga0307515_100034066 224
103 3300031344 Ga0265316_10000349 Ga0265316_1000034920 224
104 3300031711 Ga0265314_10011769 Ga0265314_100117693 224
105 3300031911 Ga0307412_10022171 Ga0307412_100221713 224
106 3300031911 Ga0307412_10104851 Ga0307412_101048512 224
107 3300031911 Ga0307412_10960940 Ga0307412_109609401 224
108 3300032004 Ga0307414_10002973 Ga0307414_100029733 224
109 3300032005 Ga0307411_10000528 Ga0307411_100005289 224
110 3300036401 Ga0373937_0048181 Ga0373937_0048181_460_1143 224
111 3300037068 Ga0373925_0376142 Ga0373925_0376142_317_991 224
112 3300044712 Ga0453684_0063816 Ga0453684_0063816_3525_4205 224
113 3300044712 Ga0453684_1344060 Ga0453684_1344060_37_717 224
114 3300046457 Ga0495590_0003858 Ga0495590_0003858_4175_4858 224
115 3300046472 Ga0495580_0422069 Ga0495580_0422069_158_832 224
116 3300046530 Ga0495654_0001046 Ga0495654_0001046_15820_16503 224
117 3300046531 Ga0495665_0010830 Ga0495665_0010830_2765_3439 224
118 3300049130 Ga0501310_003920 Ga0501310_003920_22_705 224
119 3300049570 Ga0501033_0010481 Ga0501033_0010481_269_943 224
120 3300049573 Ga0501037_0017242 Ga0501037_0017242_4603_5277 224
121 3300049579 Ga0501043_0124534 Ga0501043_0124534_319_993 224
122 3300049581 Ga0501047_0000984 Ga0501047_0000984_6541_7215 224
123 3300049589 Ga0501073_0330784 Ga0501073_0330784_225_902 224
124 3300049658 Ga0501211_000027 Ga0501211_000027_9033_9716 224
125 3300049662 Ga0501222_005706 Ga0501222_005706_96_779 224
126 3300049669 Ga0501235_004365 Ga0501235_004365_1496_2179 224
127 3300049670 Ga0501236_017275 Ga0501236_017275_211_894 224
128 3300049683 Ga0501253_001290 Ga0501253_001290_630_1313 224
129 3300049684 Ga0501255_000775 Ga0501255_000775_789_1472 224
130 3300049704 Ga0501221_000998 Ga0501221_000998_798_1481 224
131 3300049706 Ga0501229_006708 Ga0501229_006708_244_927 224
132 3300049759 Ga0501262_001434 Ga0501262_001434_1392_2075 224
133 3300049764 Ga0501267_000696 Ga0501267_000696_1230_1913 224
134 3300049765 Ga0501268_008679 Ga0501268_008679_486_1169 224
135 3300049771 Ga0501274_003133 Ga0501274_003133_240_923 224
136 3300049779 Ga0501283_019534 Ga0501283_019534_165_848 224
137 3300049822 Ga0501035_0010161 Ga0501035_0010161_5396_6070 224
138 3300049823 Ga0501044_0003486 Ga0501044_0003486_2112_2786 224
139 3300050493 nmdc:mga0k408_33801_c1 nmdc:mga0k408_33801_c1_871_1551 224
140 3300053125 Ga0500618_000391 Ga0500618_000391_909_1598 224
141 3300060353 Ga0501082_0000908 Ga0501082_0000908_15201_15878 224
142 3300003794 Ga0055531_10027351 Ga0055531_100273511 225
143 3300003856 Ga0058692_1000431 Ga0058692_10004316 225
144 3300005295 Ga0065707_10029968 Ga0065707_100299682 225
145 3300005331 Ga0070670_100026480 Ga0070670_1000264802 225
146 3300005353 Ga0070669_100000001 Ga0070669_100000001338 225
147 3300005355 Ga0070671_100000002 Ga0070671_100000002277 225
148 3300005367 Ga0070667_100004785 Ga0070667_1000047855 225
149 3300005440 Ga0070705_100005445 Ga0070705_1000054452 225
150 3300005445 Ga0070708_100040828 Ga0070708_1000408282 225
151 3300005548 Ga0070665_100058556 Ga0070665_1000585562 225
152 3300005614 Ga0068856_100669876 Ga0068856_1006698761 225
153 3300005617 Ga0068859_100002725 Ga0068859_10000272515 225
154 3300005618 Ga0068864_100000323 Ga0068864_10000032333 225
155 3300005719 Ga0068861_100002755 Ga0068861_1000027552 225
156 3300005841 Ga0068863_100011337 Ga0068863_1000113376 225
157 3300005842 Ga0068858_100024171 Ga0068858_1000241713 225
158 3300005844 Ga0068862_100000856 Ga0068862_10000085622 225
159 3300006931 Ga0097620_100002725 Ga0097620_1000027257 225
160 3300009036 Ga0105244_10069369 Ga0105244_100693692 225
161 3300009101 Ga0105247_10001755 Ga0105247_100017558 225
162 3300009553 Ga0105249_10002404 Ga0105249_100024046 225
163 3300013102 Ga0157371_10004495 Ga0157371_100044956 225
164 3300013306 Ga0163162_10017854 Ga0163162_100178542 225
165 3300014968 Ga0157379_10223518 Ga0157379_102235182 225
166 3300015685 Ga0183369_1007 Ga0183369_1007308 225
167 3300025315 Ga0207697_10000248 Ga0207697_100002482 225
168 3300025900 Ga0207710_10004910 Ga0207710_100049106 225
169 3300025903 Ga0207680_10000256 Ga0207680_100002568 225
170 3300025923 Ga0207681_10000002 Ga0207681_10000002666 225
171 3300025925 Ga0207650_10003185 Ga0207650_1000318510 225
172 3300025931 Ga0207644_10000002 Ga0207644_10000002668 225
173 3300025961 Ga0207712_10008093 Ga0207712_100080933 225
174 3300025986 Ga0207658_10010583 Ga0207658_100105832 225
175 3300026035 Ga0207703_10072035 Ga0207703_100720352 225
176 3300026088 Ga0207641_10009679 Ga0207641_100096792 225
177 3300026095 Ga0207676_10000304 Ga0207676_1000030417 225
178 3300026118 Ga0207675_100000137 Ga0207675_10000013716 225
179 3300028379 Ga0268266_10041792 Ga0268266_100417922 225
180 3300028380 Ga0268265_10000264 Ga0268265_1000026413 225
181 3300028381 Ga0268264_10000071 Ga0268264_10000071257 225
182 3300028800 Ga0265338_10040980 Ga0265338_100409803 225
183 3300031548 Ga0307408_100002690 Ga0307408_10000269012 225
184 3300031548 Ga0307408_100012733 Ga0307408_1000127337 225
185 3300031548 Ga0307408_100749231 Ga0307408_1007492311 225
186 3300031731 Ga0307405_10006369 Ga0307405_100063696 225
187 3300031731 Ga0307405_10009680 Ga0307405_100096801 225
188 3300031824 Ga0307413_10056193 Ga0307413_100561934 225
189 3300031903 Ga0307407_10065456 Ga0307407_100654563 225
190 3300031911 Ga0307412_10014216 Ga0307412_100142162 225
191 3300031911 Ga0307412_10064124 Ga0307412_100641244 225
192 3300031911 Ga0307412_10625517 Ga0307412_106255172 225
193 3300031995 Ga0307409_100134923 Ga0307409_1001349231 225
194 3300032002 Ga0307416_100050988 Ga0307416_1000509883 225
195 3300032002 Ga0307416_101294113 Ga0307416_1012941132 225
196 3300032004 Ga0307414_10075866 Ga0307414_100758662 225
197 3300032004 Ga0307414_10108443 Ga0307414_101084431 225
198 3300032005 Ga0307411_10017762 Ga0307411_100177622 225
199 3300032126 Ga0307415_100011676 Ga0307415_1000116763 225
200 3300032126 Ga0307415_100752758 Ga0307415_1007527581 225
201 3300036401 Ga0373937_0099401 Ga0373937_0099401_453_1130 225
202 3300041405 Ga0439438_000002 Ga0439438_000002_51941_52618 225
203 3300041407 Ga0439447_004906 Ga0439447_004906_1848_2525 225
204 3300042001 Ga0439441_024856 Ga0439441_024856_315_995 225
205 3300042532 Ga0450893_0000595 Ga0450893_0000595_643_1323 225
206 3300044842 Ga0466957_0285841 Ga0466957_0285841_191_868 225
207 3300046542 Ga0495597_0000687 Ga0495597_0000687_11289_11978 225
208 3300048905 Ga0496102_0102899 Ga0496102_0102899_1673_2359 225
209 3300049574 Ga0501038_0418042 Ga0501038_0418042_226_903 225
210 3300049581 Ga0501047_0250758 Ga0501047_0250758_129_806 225
211 3300049586 Ga0501070_0082962 Ga0501070_0082962_712_1389 225
212 3300049586 Ga0501070_0121976 Ga0501070_0121976_17_694 225
213 3300049822 Ga0501035_0367969 Ga0501035_0367969_12_689 225
214 3300053096 Ga0500641_0103669 Ga0500641_0103669_269_949 225
215 3300002070 JGI24750J21931_1016224 JGI24750J21931_10162242 226
216 3300002076 JGI24749J21850_1028161 JGI24749J21850_10281611 226
217 3300002077 JGI24744J21845_10039574 JGI24744J21845_100395742 226
218 3300002239 JGI24034J26672_10006470 JGI24034J26672_100064702 226
219 3300003322 rootL2_10083363 rootL2_100833636 226
220 3300003771 Ga0055526_1013787 Ga0055526_10137872 226
221 3300003773 Ga0055537_1005105 Ga0055537_10051052 226
222 3300003775 Ga0055524_1001263 Ga0055524_10012637 226
223 3300003781 Ga0055536_1003133 Ga0055536_10031335 226
224 3300003781 Ga0055536_1004801 Ga0055536_10048017 226
225 3300003781 Ga0055536_1005155 Ga0055536_10051556 226
226 3300003784 Ga0055534_1010687 Ga0055534_10106872 226
227 3300003791 Ga0055530_10000310 Ga0055530_1000031028 226
228 3300003794 Ga0055531_10002945 Ga0055531_100029457 226
229 3300003794 Ga0055531_10007831 Ga0055531_100078312 226
230 3300005289 Ga0065704_10148704 Ga0065704_101487042 226
231 3300005293 Ga0065715_10100239 Ga0065715_101002391 226
232 3300005327 Ga0070658_10002553 Ga0070658_1000255310 226
233 3300005328 Ga0070676_10260264 Ga0070676_102602642 226
234 3300005328 Ga0070676_10261845 Ga0070676_102618452 226
235 3300005329 Ga0070683_100358925 Ga0070683_1003589252 226
236 3300005329 Ga0070683_100508954 Ga0070683_1005089541 226
237 3300005330 Ga0070690_100003142 Ga0070690_1000031429 226
238 3300005331 Ga0070670_100006524 Ga0070670_1000065246 226
239 3300005331 Ga0070670_100134969 Ga0070670_1001349692 226
240 3300005331 Ga0070670_100304558 Ga0070670_1003045581 226
241 3300005331 Ga0070670_100556076 Ga0070670_1005560762 226
242 3300005333 Ga0070677_10006039 Ga0070677_100060393 226
243 3300005333 Ga0070677_10091383 Ga0070677_100913831 226
244 3300005334 Ga0068869_100001182 Ga0068869_10000118210 226
245 3300005334 Ga0068869_100017486 Ga0068869_1000174862 226
246 3300005334 Ga0068869_100557786 Ga0068869_1005577862 226
247 3300005335 Ga0070666_10026489 Ga0070666_100264892 226
248 3300005336 Ga0070680_100177831 Ga0070680_1001778312 226
249 3300005339 Ga0070660_100003289 Ga0070660_1000032895 226
250 3300005340 Ga0070689_100008082 Ga0070689_1000080822 226
251 3300005343 Ga0070687_100000376 Ga0070687_10000037615 226
252 3300005344 Ga0070661_100036204 Ga0070661_1000362042 226
253 3300005344 Ga0070661_100245864 Ga0070661_1002458642 226
254 3300005347 Ga0070668_100613705 Ga0070668_1006137051 226
255 3300005353 Ga0070669_100169463 Ga0070669_1001694632 226
256 3300005354 Ga0070675_100004297 Ga0070675_1000042979 226
257 3300005354 Ga0070675_100018240 Ga0070675_1000182405 226
258 3300005354 Ga0070675_100022287 Ga0070675_1000222877 226
259 3300005355 Ga0070671_100029085 Ga0070671_1000290852 226
260 3300005355 Ga0070671_100041611 Ga0070671_1000416113 226
261 3300005356 Ga0070674_100000167 Ga0070674_10000016710 226
262 3300005364 Ga0070673_100056243 Ga0070673_1000562435 226
263 3300005365 Ga0070688_100000491 Ga0070688_10000049115 226
264 3300005365 Ga0070688_100233179 Ga0070688_1002331792 226
265 3300005366 Ga0070659_100000820 Ga0070659_1000008203 226
266 3300005366 Ga0070659_100004983 Ga0070659_1000049832 226
267 3300005366 Ga0070659_100030874 Ga0070659_1000308742 226
268 3300005366 Ga0070659_100091984 Ga0070659_1000919843 226
269 3300005406 Ga0070703_10031602 Ga0070703_100316022 226
270 3300005438 Ga0070701_10043469 Ga0070701_100434692 226
271 3300005440 Ga0070705_100000983 Ga0070705_10000098310 226
272 3300005441 Ga0070700_100025169 Ga0070700_1000251693 226
273 3300005444 Ga0070694_100324945 Ga0070694_1003249452 226
274 3300005455 Ga0070663_100015868 Ga0070663_1000158684 226
275 3300005455 Ga0070663_100501343 Ga0070663_1005013432 226
276 3300005456 Ga0070678_100003331 Ga0070678_1000033317 226
277 3300005456 Ga0070678_100006518 Ga0070678_1000065182 226
278 3300005456 Ga0070678_100020327 Ga0070678_1000203275 226
279 3300005457 Ga0070662_100002454 Ga0070662_1000024545 226
280 3300005458 Ga0070681_10001866 Ga0070681_100018662 226
281 3300005458 Ga0070681_10015969 Ga0070681_100159694 226
282 3300005458 Ga0070681_10095047 Ga0070681_100950471 226
283 3300005458 Ga0070681_10176869 Ga0070681_101768692 226
284 3300005458 Ga0070681_10351413 Ga0070681_103514132 226
285 3300005459 Ga0068867_100014253 Ga0068867_1000142532 226
286 3300005459 Ga0068867_100127993 Ga0068867_1001279932 226
287 3300005466 Ga0070685_10000312 Ga0070685_1000031224 226
288 3300005467 Ga0070706_100003178 Ga0070706_1000031788 226
289 3300005468 Ga0070707_100130219 Ga0070707_1001302192 226
290 3300005530 Ga0070679_100022623 Ga0070679_1000226235 226
291 3300005530 Ga0070679_100055690 Ga0070679_1000556902 226
292 3300005530 Ga0070679_100226611 Ga0070679_1002266112 226
293 3300005530 Ga0070679_100403233 Ga0070679_1004032332 226
294 3300005535 Ga0070684_100044363 Ga0070684_1000443633 226
295 3300005539 Ga0068853_100005451 Ga0068853_1000054512 226
296 3300005539 Ga0068853_100007924 Ga0068853_1000079242 226
297 3300005539 Ga0068853_100501382 Ga0068853_1005013822 226
298 3300005543 Ga0070672_100011434 Ga0070672_1000114343 226
299 3300005543 Ga0070672_100441412 Ga0070672_1004414122 226
300 3300005544 Ga0070686_100004704 Ga0070686_1000047045 226
301 3300005546 Ga0070696_100033486 Ga0070696_1000334862 226
302 3300005546 Ga0070696_100047787 Ga0070696_1000477872 226
303 3300005547 Ga0070693_100000389 Ga0070693_1000003895 226
304 3300005547 Ga0070693_100307119 Ga0070693_1003071192 226
305 3300005548 Ga0070665_100181062 Ga0070665_1001810622 226
306 3300005548 Ga0070665_100273288 Ga0070665_1002732882 226
307 3300005549 Ga0070704_100018066 Ga0070704_1000180663 226
308 3300005549 Ga0070704_100193390 Ga0070704_1001933902 226
309 3300005563 Ga0068855_100001819 Ga0068855_10000181917 226
310 3300005564 Ga0070664_100011160 Ga0070664_1000111602 226
311 3300005577 Ga0068857_100214791 Ga0068857_1002147912 226
312 3300005578 Ga0068854_100032491 Ga0068854_1000324912 226
313 3300005578 Ga0068854_100057209 Ga0068854_1000572093 226
314 3300005578 Ga0068854_100707637 Ga0068854_1007076371 226
315 3300005614 Ga0068856_100012081 Ga0068856_1000120812 226
316 3300005614 Ga0068856_100295606 Ga0068856_1002956062 226
317 3300005615 Ga0070702_100349868 Ga0070702_1003498681 226
318 3300005616 Ga0068852_100004791 Ga0068852_1000047913 226
319 3300005616 Ga0068852_100251423 Ga0068852_1002514233 226
320 3300005618 Ga0068864_100040657 Ga0068864_1000406572 226
321 3300005618 Ga0068864_100162383 Ga0068864_1001623832 226
322 3300005618 Ga0068864_100207846 Ga0068864_1002078462 226
323 3300005719 Ga0068861_100001192 Ga0068861_1000011923 226
324 3300005719 Ga0068861_100033317 Ga0068861_1000333172 226
325 3300005834 Ga0068851_10000396 Ga0068851_100003966 226
326 3300005840 Ga0068870_10000513 Ga0068870_100005132 226
327 3300005840 Ga0068870_10001473 Ga0068870_100014736 226
328 3300005840 Ga0068870_10059711 Ga0068870_100597112 226
329 3300005840 Ga0068870_10138612 Ga0068870_101386122 226
330 3300005841 Ga0068863_100017755 Ga0068863_1000177552 226
331 3300005841 Ga0068863_100081617 Ga0068863_1000816172 226
332 3300005841 Ga0068863_100084708 Ga0068863_1000847083 226
333 3300005841 Ga0068863_100290501 Ga0068863_1002905012 226
334 3300005842 Ga0068858_100107416 Ga0068858_1001074162 226
335 3300005842 Ga0068858_100230425 Ga0068858_1002304252 226
336 3300005842 Ga0068858_100682680 Ga0068858_1006826802 226
337 3300005843 Ga0068860_100057650 Ga0068860_1000576503 226
338 3300005843 Ga0068860_100286332 Ga0068860_1002863322 226
339 3300005843 Ga0068860_100296685 Ga0068860_1002966851 226
340 3300005844 Ga0068862_100004739 Ga0068862_1000047392 226
341 3300005844 Ga0068862_100019061 Ga0068862_1000190612 226
342 3300005844 Ga0068862_100204582 Ga0068862_1002045821 226
343 3300005937 Ga0081455_10035349 Ga0081455_100353492 226
344 3300005937 Ga0081455_10159847 Ga0081455_101598473 226
345 3300005983 Ga0081540_1000069 Ga0081540_100006955 226
346 3300005983 Ga0081540_1000394 Ga0081540_10003948 226
347 3300006038 Ga0075365_10065906 Ga0075365_100659062 226
348 3300006042 Ga0075368_10000982 Ga0075368_100009826 226
349 3300006048 Ga0075363_100071829 Ga0075363_1000718292 226
350 3300006058 Ga0075432_10126682 Ga0075432_101266822 226
351 3300006163 Ga0070715_10070721 Ga0070715_100707212 226
352 3300006177 Ga0075362_10010431 Ga0075362_100104312 226
353 3300006178 Ga0075367_10014576 Ga0075367_100145762 226
354 3300006178 Ga0075367_10018531 Ga0075367_100185312 226
355 3300006237 Ga0097621_100000838 Ga0097621_1000008385 226
356 3300006237 Ga0097621_100016607 Ga0097621_1000166076 226
357 3300006237 Ga0097621_100103834 Ga0097621_1001038342 226
358 3300006353 Ga0075370_10091817 Ga0075370_100918171 226
359 3300006358 Ga0068871_100000675 Ga0068871_1000006757 226
360 3300006358 Ga0068871_100000829 Ga0068871_1000008295 226
361 3300006358 Ga0068871_100054493 Ga0068871_1000544932 226
362 3300006358 Ga0068871_100191445 Ga0068871_1001914452 226
363 3300006844 Ga0075428_100593091 Ga0075428_1005930911 226
364 3300006846 Ga0075430_100005542 Ga0075430_1000055422 226
365 3300006846 Ga0075430_100018913 Ga0075430_1000189132 226
366 3300006846 Ga0075430_100334527 Ga0075430_1003345271 226
367 3300006847 Ga0075431_100001427 Ga0075431_1000014276 226
368 3300006847 Ga0075431_100248618 Ga0075431_1002486182 226
369 3300006847 Ga0075431_100416241 Ga0075431_1004162413 226
370 3300006847 Ga0075431_100625367 Ga0075431_1006253672 226
371 3300006852 Ga0075433_10064014 Ga0075433_100640142 226
372 3300006871 Ga0075434_100084101 Ga0075434_1000841012 226
373 3300006880 Ga0075429_100054288 Ga0075429_1000542882 226
374 3300006946 Ga0079104_1000020 Ga0079104_1000020203 226
375 3300007076 Ga0075435_100060907 Ga0075435_1000609072 226
376 3300009092 Ga0105250_10000684 Ga0105250_100006849 226
377 3300009093 Ga0105240_10001833 Ga0105240_1000183334 226
378 3300009093 Ga0105240_10103614 Ga0105240_101036142 226
379 3300009094 Ga0111539_10001473 Ga0111539_100014734 226
380 3300009094 Ga0111539_10118726 Ga0111539_101187262 226
381 3300009094 Ga0111539_10191639 Ga0111539_101916393 226
382 3300009098 Ga0105245_10001784 Ga0105245_100017845 226
383 3300009101 Ga0105247_10000499 Ga0105247_1000049923 226
384 3300009147 Ga0114129_10005737 Ga0114129_1000573720 226
385 3300009147 Ga0114129_10028119 Ga0114129_100281192 226
386 3300009147 Ga0114129_10034844 Ga0114129_100348446 226
387 3300009147 Ga0114129_10845816 Ga0114129_108458162 226
388 3300009147 Ga0114129_11530976 Ga0114129_115309762 226
389 3300009148 Ga0105243_10003516 Ga0105243_100035165 226
390 3300009148 Ga0105243_10040411 Ga0105243_100404112 226
391 3300009174 Ga0105241_10099312 Ga0105241_100993122 226
392 3300009174 Ga0105241_10491433 Ga0105241_104914332 226
393 3300009174 Ga0105241_10623475 Ga0105241_106234751 226
394 3300009176 Ga0105242_10000776 Ga0105242_1000077614 226
395 3300009176 Ga0105242_10016603 Ga0105242_100166036 226
396 3300009177 Ga0105248_10052796 Ga0105248_100527962 226
397 3300009177 Ga0105248_10270480 Ga0105248_102704802 226
398 3300009545 Ga0105237_10000240 Ga0105237_100002402 226
399 3300009551 Ga0105238_10001156 Ga0105238_1000115622 226
400 3300009551 Ga0105238_10002207 Ga0105238_1000220716 226
401 3300009551 Ga0105238_10046900 Ga0105238_100469002 226
402 3300009553 Ga0105249_10064841 Ga0105249_100648412 226
403 3300010375 Ga0105239_10003666 Ga0105239_100036662 226
404 3300010375 Ga0105239_10261190 Ga0105239_102611902 226
405 3300011119 Ga0105246_10005681 Ga0105246_100056812 226
406 3300013100 Ga0157373_10001212 Ga0157373_100012122 226
407 3300013100 Ga0157373_10009846 Ga0157373_100098462 226
408 3300013102 Ga0157371_10001038 Ga0157371_1000103824 226
409 3300013102 Ga0157371_10017286 Ga0157371_100172862 226
410 3300013104 Ga0157370_10000662 Ga0157370_100006622 226
411 3300013104 Ga0157370_10002750 Ga0157370_100027502 226
412 3300013104 Ga0157370_10008238 Ga0157370_100082386 226
413 3300013105 Ga0157369_10024719 Ga0157369_100247196 226
414 3300013296 Ga0157374_10000876 Ga0157374_1000087610 226
415 3300013296 Ga0157374_10593162 Ga0157374_105931621 226
416 3300013297 Ga0157378_10000880 Ga0157378_1000088010 226
417 3300013297 Ga0157378_10183652 Ga0157378_101836522 226
418 3300013297 Ga0157378_10420922 Ga0157378_104209222 226
419 3300013306 Ga0163162_10001408 Ga0163162_1000140812 226
420 3300013306 Ga0163162_10468019 Ga0163162_104680192 226
421 3300013306 Ga0163162_10867132 Ga0163162_108671322 226
422 3300013306 Ga0163162_11403658 Ga0163162_114036581 226
423 3300013307 Ga0157372_10013278 Ga0157372_100132783 226
424 3300013307 Ga0157372_10030186 Ga0157372_100301862 226
425 3300013308 Ga0157375_10012511 Ga0157375_100125116 226
426 3300013308 Ga0157375_10080250 Ga0157375_100802502 226
427 3300013308 Ga0157375_10265028 Ga0157375_102650281 226
428 3300014325 Ga0163163_10071581 Ga0163163_100715812 226
429 3300014325 Ga0163163_10076193 Ga0163163_100761935 226
430 3300014325 Ga0163163_10158478 Ga0163163_101584783 226
431 3300014326 Ga0157380_10011035 Ga0157380_100110352 226
432 3300014326 Ga0157380_10032233 Ga0157380_100322333 226
433 3300014326 Ga0157380_10152128 Ga0157380_101521283 226
434 3300014745 Ga0157377_10000421 Ga0157377_100004213 226
435 3300014968 Ga0157379_10095916 Ga0157379_100959162 226
436 3300014968 Ga0157379_10416273 Ga0157379_104162732 226
437 3300014969 Ga0157376_10004912 Ga0157376_100049122 226
438 3300014969 Ga0157376_10047151 Ga0157376_100471512 226
439 3300014969 Ga0157376_10066788 Ga0157376_100667882 226
440 3300014969 Ga0157376_10081219 Ga0157376_100812192 226
441 3300015262 Ga0182007_10043767 Ga0182007_100437671 226
442 3300017792 Ga0163161_10019395 Ga0163161_100193953 226
443 3300021361 Ga0213872_10000211 Ga0213872_1000021141 226
444 3300021384 Ga0213876_10000987 Ga0213876_1000098710 226
445 3300021384 Ga0213876_10130061 Ga0213876_101300611 226
446 3300025226 Ga0209674_100635 Ga0209674_1006355 226
447 3300025250 Ga0209026_1000037 Ga0209026_1000037193 226
448 3300025263 Ga0209565_1001442 Ga0209565_10014424 226
449 3300025291 Ga0209675_1000025 Ga0209675_1000025151 226
450 3300025291 Ga0209675_1003444 Ga0209675_10034442 226
451 3300025292 Ga0209676_1000198 Ga0209676_100019825 226
452 3300025292 Ga0209676_1001165 Ga0209676_100116510 226
453 3300025292 Ga0209676_1001500 Ga0209676_10015009 226
454 3300025292 Ga0209676_1050538 Ga0209676_10505382 226
455 3300025294 Ga0209025_1028558 Ga0209025_10285584 226
456 3300025294 Ga0209025_1096882 Ga0209025_10968822 226
457 3300025295 Ga0209564_1003296 Ga0209564_10032967 226
458 3300025297 Ga0209758_1007867 Ga0209758_10078675 226
459 3300025298 Ga0209050_1000104 Ga0209050_10001049 226
460 3300025298 Ga0209050_1002306 Ga0209050_10023064 226
461 3300025298 Ga0209050_1013188 Ga0209050_10131884 226
462 3300025299 Ga0209256_1000964 Ga0209256_100096433 226
463 3300025304 Ga0209257_1000860 Ga0209257_100086034 226
464 3300025304 Ga0209257_1001790 Ga0209257_100179030 226
465 3300025304 Ga0209257_1003091 Ga0209257_100309111 226
466 3300025304 Ga0209257_1018503 Ga0209257_10185032 226
467 3300025315 Ga0207697_10001354 Ga0207697_100013543 226
468 3300025315 Ga0207697_10004831 Ga0207697_100048316 226
469 3300025321 Ga0207656_10007391 Ga0207656_100073913 226
470 3300025321 Ga0207656_10048795 Ga0207656_100487953 226
471 3300025711 Ga0207696_1002516 Ga0207696_10025165 226
472 3300025893 Ga0207682_10000093 Ga0207682_1000009312 226
473 3300025893 Ga0207682_10001426 Ga0207682_100014266 226
474 3300025899 Ga0207642_10099894 Ga0207642_100998942 226
475 3300025900 Ga0207710_10036099 Ga0207710_100360992 226
476 3300025901 Ga0207688_10022722 Ga0207688_100227222 226
477 3300025903 Ga0207680_10021323 Ga0207680_100213232 226
478 3300025903 Ga0207680_10124747 Ga0207680_101247471 226
479 3300025903 Ga0207680_10139928 Ga0207680_101399282 226
480 3300025904 Ga0207647_10020714 Ga0207647_100207142 226
481 3300025904 Ga0207647_10272005 Ga0207647_102720052 226
482 3300025907 Ga0207645_10000101 Ga0207645_1000010135 226
483 3300025907 Ga0207645_10139169 Ga0207645_101391692 226
484 3300025908 Ga0207643_10000166 Ga0207643_1000016626 226
485 3300025908 Ga0207643_10002758 Ga0207643_100027584 226
486 3300025908 Ga0207643_10163904 Ga0207643_101639042 226
487 3300025908 Ga0207643_10209240 Ga0207643_102092402 226
488 3300025909 Ga0207705_10029847 Ga0207705_100298472 226
489 3300025909 Ga0207705_10061876 Ga0207705_100618763 226
490 3300025910 Ga0207684_10008871 Ga0207684_100088718 226
491 3300025912 Ga0207707_10012137 Ga0207707_100121374 226
492 3300025912 Ga0207707_10013190 Ga0207707_100131906 226
493 3300025912 Ga0207707_10092784 Ga0207707_100927841 226
494 3300025912 Ga0207707_10138615 Ga0207707_101386152 226
495 3300025912 Ga0207707_10145645 Ga0207707_101456452 226
496 3300025913 Ga0207695_10087457 Ga0207695_100874572 226
497 3300025916 Ga0207663_10391493 Ga0207663_103914932 226
498 3300025917 Ga0207660_10294296 Ga0207660_102942962 226
499 3300025918 Ga0207662_10000010 Ga0207662_1000001074 226
500 3300025919 Ga0207657_10000353 Ga0207657_1000035322 226
501 3300025919 Ga0207657_10038401 Ga0207657_100384012 226
502 3300025920 Ga0207649_10045312 Ga0207649_100453122 226
503 3300025920 Ga0207649_10056595 Ga0207649_100565952 226
504 3300025921 Ga0207652_10023091 Ga0207652_100230912 226
505 3300025921 Ga0207652_10168974 Ga0207652_101689742 226
506 3300025921 Ga0207652_10327530 Ga0207652_103275302 226
507 3300025922 Ga0207646_10041233 Ga0207646_100412332 226
508 3300025923 Ga0207681_10019058 Ga0207681_100190583 226
509 3300025924 Ga0207694_10000623 Ga0207694_1000062315 226
510 3300025924 Ga0207694_10021700 Ga0207694_100217004 226
511 3300025924 Ga0207694_10062426 Ga0207694_100624261 226
512 3300025925 Ga0207650_10024028 Ga0207650_100240282 226
513 3300025925 Ga0207650_10201645 Ga0207650_102016453 226
514 3300025925 Ga0207650_10219288 Ga0207650_102192882 226
515 3300025926 Ga0207659_10020488 Ga0207659_100204885 226
516 3300025926 Ga0207659_10109120 Ga0207659_101091202 226
517 3300025927 Ga0207687_10001680 Ga0207687_100016802 226
518 3300025927 Ga0207687_10085191 Ga0207687_100851912 226
519 3300025928 Ga0207700_10026229 Ga0207700_100262292 226
520 3300025931 Ga0207644_10169640 Ga0207644_101696402 226
521 3300025931 Ga0207644_10189599 Ga0207644_101895992 226
522 3300025931 Ga0207644_10596442 Ga0207644_105964422 226
523 3300025931 Ga0207644_10869035 Ga0207644_108690351 226
524 3300025932 Ga0207690_10001856 Ga0207690_100018566 226
525 3300025932 Ga0207690_10003818 Ga0207690_100038183 226
526 3300025932 Ga0207690_10327261 Ga0207690_103272612 226
527 3300025933 Ga0207706_10000077 Ga0207706_1000007774 226
528 3300025933 Ga0207706_10008405 Ga0207706_100084058 226
529 3300025934 Ga0207686_10471912 Ga0207686_104719122 226
530 3300025935 Ga0207709_10000055 Ga0207709_10000055108 226
531 3300025935 Ga0207709_10021881 Ga0207709_100218812 226
532 3300025936 Ga0207670_10018583 Ga0207670_100185833 226
533 3300025937 Ga0207669_10031514 Ga0207669_100315143 226
534 3300025938 Ga0207704_10009730 Ga0207704_100097303 226
535 3300025938 Ga0207704_10441779 Ga0207704_104417792 226
536 3300025939 Ga0207665_10170312 Ga0207665_101703122 226
537 3300025940 Ga0207691_10000033 Ga0207691_1000003376 226
538 3300025940 Ga0207691_10000680 Ga0207691_100006803 226
539 3300025940 Ga0207691_10004283 Ga0207691_1000428310 226
540 3300025941 Ga0207711_10036711 Ga0207711_100367112 226
541 3300025941 Ga0207711_10675841 Ga0207711_106758412 226
542 3300025942 Ga0207689_10003350 Ga0207689_100033502 226
543 3300025942 Ga0207689_10032746 Ga0207689_100327462 226
544 3300025942 Ga0207689_10403368 Ga0207689_104033682 226
545 3300025944 Ga0207661_10038621 Ga0207661_100386212 226
546 3300025944 Ga0207661_10799434 Ga0207661_107994342 226
547 3300025945 Ga0207679_10023078 Ga0207679_100230782 226
548 3300025949 Ga0207667_10015762 Ga0207667_100157622 226
549 3300025960 Ga0207651_10014737 Ga0207651_100147373 226
550 3300025960 Ga0207651_10066916 Ga0207651_100669162 226
551 3300025961 Ga0207712_10002383 Ga0207712_100023831 226
552 3300025972 Ga0207668_10097860 Ga0207668_100978602 226
553 3300025981 Ga0207640_10041946 Ga0207640_100419463 226
554 3300025981 Ga0207640_10117583 Ga0207640_101175832 226
555 3300025981 Ga0207640_10230495 Ga0207640_102304952 226
556 3300025981 Ga0207640_10402962 Ga0207640_104029622 226
557 3300025986 Ga0207658_10029130 Ga0207658_100291302 226
558 3300025986 Ga0207658_10039364 Ga0207658_100393642 226
559 3300026023 Ga0207677_10004853 Ga0207677_100048535 226
560 3300026023 Ga0207677_10019078 Ga0207677_100190785 226
561 3300026035 Ga0207703_10014955 Ga0207703_100149554 226
562 3300026035 Ga0207703_10024943 Ga0207703_100249433 226
563 3300026041 Ga0207639_10657331 Ga0207639_106573312 226
564 3300026067 Ga0207678_10000464 Ga0207678_1000046432 226
565 3300026067 Ga0207678_10691855 Ga0207678_106918551 226
566 3300026075 Ga0207708_10011861 Ga0207708_100118613 226
567 3300026075 Ga0207708_10082139 Ga0207708_100821392 226
568 3300026075 Ga0207708_10452851 Ga0207708_104528512 226
569 3300026078 Ga0207702_10229162 Ga0207702_102291622 226
570 3300026088 Ga0207641_10015606 Ga0207641_100156061 226
571 3300026088 Ga0207641_10115063 Ga0207641_101150632 226
572 3300026089 Ga0207648_10000189 Ga0207648_1000018924 226
573 3300026089 Ga0207648_10015036 Ga0207648_1001503611 226
574 3300026089 Ga0207648_10459721 Ga0207648_104597212 226
575 3300026095 Ga0207676_10007112 Ga0207676_100071129 226
576 3300026095 Ga0207676_10026418 Ga0207676_100264183 226
577 3300026095 Ga0207676_10093156 Ga0207676_100931562 226
578 3300026095 Ga0207676_10489054 Ga0207676_104890542 226
579 3300026116 Ga0207674_10000224 Ga0207674_1000022434 226
580 3300026116 Ga0207674_10368821 Ga0207674_103688212 226
581 3300026118 Ga0207675_100000043 Ga0207675_10000004375 226
582 3300026118 Ga0207675_100019121 Ga0207675_1000191212 226
583 3300026118 Ga0207675_100042371 Ga0207675_1000423715 226
584 3300026121 Ga0207683_10011248 Ga0207683_100112489 226
585 3300026121 Ga0207683_10023264 Ga0207683_100232642 226
586 3300026121 Ga0207683_10031886 Ga0207683_100318863 226
587 3300026121 Ga0207683_10188941 Ga0207683_101889412 226
588 3300026121 Ga0207683_10498685 Ga0207683_104986852 226
589 3300026142 Ga0207698_10001141 Ga0207698_100011413 226
590 3300027111 Ga0209281_1000002 Ga0209281_1000002544 226
591 3300027866 Ga0209813_10002831 Ga0209813_100028314 226
592 3300027907 Ga0207428_10000018 Ga0207428_10000018215 226
593 3300027907 Ga0207428_10000043 Ga0207428_1000004387 226
594 3300027907 Ga0207428_10275384 Ga0207428_102753841 226
595 3300028379 Ga0268266_10010399 Ga0268266_100103995 226
596 3300028379 Ga0268266_10227150 Ga0268266_102271502 226
597 3300028380 Ga0268265_10023793 Ga0268265_100237932 226
598 3300028380 Ga0268265_10032629 Ga0268265_100326293 226
599 3300028380 Ga0268265_10103258 Ga0268265_101032581 226
600 3300028380 Ga0268265_10477623 Ga0268265_104776232 226
601 3300028381 Ga0268264_10120771 Ga0268264_101207714 226
602 3300028381 Ga0268264_10238196 Ga0268264_102381961 226
603 3300028381 Ga0268264_10522847 Ga0268264_105228472 226
604 3300028653 Ga0265323_10075991 Ga0265323_100759911 226
605 3300028794 Ga0307515_10006103 Ga0307515_1000610311 226
606 3300028794 Ga0307515_10027473 Ga0307515_100274733 226
607 3300028794 Ga0307515_10068694 Ga0307515_100686945 226
608 3300028794 Ga0307515_10307019 Ga0307515_103070192 226
609 3300028794 Ga0307515_10347750 Ga0307515_103477502 226
610 3300030522 Ga0307512_10066250 Ga0307512_100662504 226
611 3300031238 Ga0265332_10056750 Ga0265332_100567502 226
612 3300031249 Ga0265339_10270648 Ga0265339_102706481 226
613 3300031456 Ga0307513_10105713 Ga0307513_101057131 226
614 3300031456 Ga0307513_10393839 Ga0307513_103938392 226
615 3300031507 Ga0307509_10004212 Ga0307509_100042124 226
616 3300031548 Ga0307408_100345880 Ga0307408_1003458802 226
617 3300031548 Ga0307408_100419130 Ga0307408_1004191302 226
618 3300031616 Ga0307508_10000048 Ga0307508_1000004866 226
619 3300031616 Ga0307508_10344018 Ga0307508_103440182 226
620 3300031711 Ga0265314_10058937 Ga0265314_100589374 226
621 3300031712 Ga0265342_10081350 Ga0265342_100813502 226
622 3300031730 Ga0307516_10346404 Ga0307516_103464042 226
623 3300031731 Ga0307405_10253818 Ga0307405_102538182 226
624 3300031824 Ga0307413_10190893 Ga0307413_101908931 226
625 3300031838 Ga0307518_10233755 Ga0307518_102337552 226
626 3300031852 Ga0307410_10108851 Ga0307410_101088513 226
627 3300031852 Ga0307410_10161971 Ga0307410_101619712 226
628 3300031852 Ga0307410_10189257 Ga0307410_101892572 226
629 3300031901 Ga0307406_10009322 Ga0307406_100093223 226
630 3300031901 Ga0307406_10081421 Ga0307406_100814213 226
631 3300031901 Ga0307406_10087312 Ga0307406_100873123 226
632 3300031901 Ga0307406_10200855 Ga0307406_102008552 226
633 3300031903 Ga0307407_10496013 Ga0307407_104960132 226
634 3300031911 Ga0307412_10085707 Ga0307412_100857072 226
635 3300031995 Ga0307409_100542934 Ga0307409_1005429342 226
636 3300032002 Ga0307416_100004163 Ga0307416_1000041636 226
637 3300032002 Ga0307416_100367942 Ga0307416_1003679422 226
638 3300032004 Ga0307414_10055406 Ga0307414_100554063 226
639 3300032005 Ga0307411_10745652 Ga0307411_107456522 226
640 3300033180 Ga0307510_10218823 Ga0307510_102188232 226
641 3300035170 Ga0373943_0267748 Ga0373943_0267748_259_939 226
642 3300035398 Ga0316574_0340729 Ga0316574_0340729_106_789 226
643 3300036401 Ga0373937_0024289 Ga0373937_0024289_2605_3285 226
644 3300036401 Ga0373937_0341582 Ga0373937_0341582_52_744 226
645 3300037068 Ga0373925_0062160 Ga0373925_0062160_342_1022 226
646 3300037853 Ga0436364_0516927 Ga0436364_0516927_997_1683 226
647 3300037853 Ga0436364_0791589 Ga0436364_0791589_2281_2967 226
648 3300039437 Ga0436365_1599716 Ga0436365_1599716_21831_22514 226
649 3300039447 Ga0436361_0057254 Ga0436361_0057254_1980_2660 226
650 3300039447 Ga0436361_1094211 Ga0436361_1094211_8704_9384 226
651 3300041496 Ga0451839_1570770 Ga0451839_1570770_390_1070 226
652 3300041498 Ga0451841_0746418 Ga0451841_0746418_555_1235 226
653 3300041507 Ga0451851_0269188 Ga0451851_0269188_322_1002 226
654 3300041509 Ga0451843_1443981 Ga0451843_1443981_75_764 226
655 3300042439 Ga0439464_0009337 Ga0439464_0009337_1627_2316 226
656 3300042439 Ga0439464_0011418 Ga0439464_0011418_216_896 226
657 3300042876 Ga0451577_0503113 Ga0451577_0503113_72_752 226
658 3300042993 Ga0439440_0021028 Ga0439440_0021028_95_784 226
659 3300044658 Ga0466972_0074519 Ga0466972_0074519_151_831 226
660 3300045051 Ga0451576_0246624 Ga0451576_0246624_802_1482 226
661 3300046452 Ga0495617_000554 Ga0495617_000554_6529_7212 226
662 3300046453 Ga0495627_073813 Ga0495627_073813_115_795 226
663 3300046472 Ga0495580_0000143 Ga0495580_0000143_9742_10422 226
664 3300046491 Ga0495584_0001236 Ga0495584_0001236_13301_13984 226
665 3300046491 Ga0495584_0211580 Ga0495584_0211580_18_698 226
666 3300046491 Ga0495584_0315117 Ga0495584_0315117_59_742 226
667 3300046492 Ga0495585_0000050 Ga0495585_0000050_62488_63171 226
668 3300046492 Ga0495585_0000053 Ga0495585_0000053_88719_89402 226
669 3300046492 Ga0495585_0002270 Ga0495585_0002270_10097_10780 226
670 3300046492 Ga0495585_0019274 Ga0495585_0019274_1322_2005 226
671 3300046500 Ga0495596_0004585 Ga0495596_0004585_4648_5331 226
672 3300046506 Ga0495583_0000318 Ga0495583_0000318_20544_21227 226
673 3300046506 Ga0495583_0046727 Ga0495583_0046727_623_1306 226
674 3300046507 Ga0495606_0153892 Ga0495606_0153892_579_1262 226
675 3300046512 Ga0495610_0000012 Ga0495610_0000012_366745_367425 226
676 3300046513 Ga0495616_0000860 Ga0495616_0000860_20117_20824 226
677 3300046513 Ga0495616_0002305 Ga0495616_0002305_1560_2243 226
678 3300046513 Ga0495616_0023292 Ga0495616_0023292_724_1407 226
679 3300046522 Ga0495643_0080075 Ga0495643_0080075_354_1037 226
680 3300046524 Ga0495648_0000080 Ga0495648_0000080_21238_21921 226
681 3300046524 Ga0495648_0000320 Ga0495648_0000320_18000_18680 226
682 3300046530 Ga0495654_0028958 Ga0495654_0028958_73_756 226
683 3300046530 Ga0495654_0086072 Ga0495654_0086072_156_839 226
684 3300046537 Ga0495598_0028406 Ga0495598_0028406_259_939 226
685 3300046538 Ga0495609_0003471 Ga0495609_0003471_6655_7338 226
686 3300046558 Ga0495633_0001928 Ga0495633_0001928_2021_2704 226
687 3300046558 Ga0495633_0021967 Ga0495633_0021967_1793_2476 226
688 3300046616 Ga0495668_0000001 Ga0495668_0000001_417798_418481 226
689 3300046616 Ga0495668_0005283 Ga0495668_0005283_6445_7128 226
690 3300046648 Ga0495611_0209906 Ga0495611_0209906_95_778 226
691 3300046660 Ga0495625_0000362 Ga0495625_0000362_22561_23244 226
692 3300046660 Ga0495625_0031630 Ga0495625_0031630_2512_3192 226
693 3300046691 Ga0495670_0002312 Ga0495670_0002312_7113_7796 226
694 3300046692 Ga0495671_0000006 Ga0495671_0000006_275248_275928 226
695 3300046810 Ga0495660_0000484 Ga0495660_0000484_10892_11575 226
696 3300047317 Ga0495604_0047813 Ga0495604_0047813_2594_3274 226
697 3300047318 Ga0495636_0010356 Ga0495636_0010356_469_1149 226
698 3300047323 Ga0495683_0000079 Ga0495683_0000079_3216_3899 226
699 3300047470 Ga0495681_0050816 Ga0495681_0050816_20_703 226
700 3300047472 Ga0495686_0060297 Ga0495686_0060297_617_1300 226
701 3300048090 Ga0495615_0057830 Ga0495615_0057830_290_970 226
702 3300048091 Ga0495626_0078800 Ga0495626_0078800_136_816 226
703 3300048091 Ga0495626_0095229 Ga0495626_0095229_493_1173 226
704 3300048091 Ga0495626_0138329 Ga0495626_0138329_55_744 226
705 3300048905 Ga0496102_0036708 Ga0496102_0036708_1593_2273 226
706 3300048905 Ga0496102_0047207 Ga0496102_0047207_3017_3700 226
707 3300048910 Ga0496107_0030293 Ga0496107_0030293_3110_3790 226
708 3300048912 Ga0496109_0061532 Ga0496109_0061532_1825_2505 226
709 3300048915 Ga0496112_0005601 Ga0496112_0005601_283_963 226
710 3300048915 Ga0496112_0349570 Ga0496112_0349570_232_912 226
711 3300048916 Ga0496113_0033418 Ga0496113_0033418_2678_3358 226
712 3300048916 Ga0496113_0425505 Ga0496113_0425505_262_942 226
713 3300048924 Ga0496121_0153883 Ga0496121_0153883_394_1083 226
714 3300048927 Ga0496124_0098966 Ga0496124_0098966_375_1058 226
715 3300049460 Ga0495682_0040174 Ga0495682_0040174_734_1417 226
716 3300049523 Ga0501300_004637 Ga0501300_004637_740_1423 226
717 3300049569 Ga0501032_0127621 Ga0501032_0127621_335_1015 226
718 3300049570 Ga0501033_0003236 Ga0501033_0003236_6190_6870 226
719 3300049570 Ga0501033_0033222 Ga0501033_0033222_623_1303 226
720 3300049570 Ga0501033_0084621 Ga0501033_0084621_1016_1696 226
721 3300049570 Ga0501033_0099157 Ga0501033_0099157_805_1485 226
722 3300049570 Ga0501033_0106255 Ga0501033_0106255_107_787 226
723 3300049570 Ga0501033_0177232 Ga0501033_0177232_52_732 226
724 3300049571 Ga0501034_0014593 Ga0501034_0014593_3603_4283 226
725 3300049571 Ga0501034_0029450 Ga0501034_0029450_717_1397 226
726 3300049571 Ga0501034_0043880 Ga0501034_0043880_1948_2628 226
727 3300049572 Ga0501036_0001437 Ga0501036_0001437_2828_3508 226
728 3300049572 Ga0501036_0083371 Ga0501036_0083371_291_971 226
729 3300049572 Ga0501036_0179170 Ga0501036_0179170_183_863 226
730 3300049572 Ga0501036_0184880 Ga0501036_0184880_773_1453 226
731 3300049573 Ga0501037_0005886 Ga0501037_0005886_6173_6853 226
732 3300049573 Ga0501037_0074982 Ga0501037_0074982_33_713 226
733 3300049573 Ga0501037_0109552 Ga0501037_0109552_46_726 226
734 3300049574 Ga0501038_0002195 Ga0501038_0002195_16657_17337 226
735 3300049574 Ga0501038_0009271 Ga0501038_0009271_8306_8986 226
736 3300049575 Ga0501039_0034416 Ga0501039_0034416_2675_3355 226
737 3300049575 Ga0501039_0123174 Ga0501039_0123174_914_1594 226
738 3300049575 Ga0501039_0313667 Ga0501039_0313667_96_776 226
739 3300049576 Ga0501040_0000010 Ga0501040_0000010_18487_19167 226
740 3300049576 Ga0501040_0077260 Ga0501040_0077260_846_1526 226
741 3300049577 Ga0501041_0008456 Ga0501041_0008456_1504_2184 226
742 3300049577 Ga0501041_0040286 Ga0501041_0040286_732_1412 226
743 3300049577 Ga0501041_0150534 Ga0501041_0150534_503_1183 226
744 3300049578 Ga0501042_0000323 Ga0501042_0000323_1134_1814 226
745 3300049578 Ga0501042_0074718 Ga0501042_0074718_860_1540 226
746 3300049579 Ga0501043_0023855 Ga0501043_0023855_2225_2905 226
747 3300049579 Ga0501043_0025869 Ga0501043_0025869_2459_3139 226
748 3300049579 Ga0501043_0299341 Ga0501043_0299341_168_848 226
749 3300049580 Ga0501046_0004727 Ga0501046_0004727_3944_4624 226
750 3300049580 Ga0501046_0123836 Ga0501046_0123836_643_1323 226
751 3300049580 Ga0501046_0135376 Ga0501046_0135376_176_856 226
752 3300049581 Ga0501047_0009139 Ga0501047_0009139_7010_7690 226
753 3300049581 Ga0501047_0093597 Ga0501047_0093597_969_1649 226
754 3300049581 Ga0501047_0106118 Ga0501047_0106118_1800_2480 226
755 3300049581 Ga0501047_0186772 Ga0501047_0186772_100_789 226
756 3300049581 Ga0501047_0305728 Ga0501047_0305728_26_706 226
757 3300049582 Ga0501048_0020833 Ga0501048_0020833_3269_3949 226
758 3300049582 Ga0501048_0084795 Ga0501048_0084795_525_1205 226
759 3300049584 Ga0501068_0024875 Ga0501068_0024875_2766_3446 226
760 3300049586 Ga0501070_0070755 Ga0501070_0070755_2180_2860 226
761 3300049586 Ga0501070_0130847 Ga0501070_0130847_870_1550 226
762 3300049586 Ga0501070_0298675 Ga0501070_0298675_506_1186 226
763 3300049587 Ga0501071_0020060 Ga0501071_0020060_831_1511 226
764 3300049587 Ga0501071_0084352 Ga0501071_0084352_887_1567 226
765 3300049588 Ga0501072_0033851 Ga0501072_0033851_2592_3272 226
766 3300049588 Ga0501072_0039242 Ga0501072_0039242_451_1131 226
767 3300049588 Ga0501072_0150802 Ga0501072_0150802_914_1594 226
768 3300049589 Ga0501073_0116260 Ga0501073_0116260_735_1415 226
769 3300049590 Ga0501074_0135492 Ga0501074_0135492_665_1345 226
770 3300049591 Ga0501075_0000090 Ga0501075_0000090_15516_16196 226
771 3300049591 Ga0501075_0058090 Ga0501075_0058090_692_1372 226
772 3300049592 Ga0501076_0003453 Ga0501076_0003453_7814_8494 226
773 3300049592 Ga0501076_0019707 Ga0501076_0019707_3717_4397 226
774 3300049592 Ga0501076_0597280 Ga0501076_0597280_114_794 226
775 3300049593 Ga0501077_0000017 Ga0501077_0000017_83387_84067 226
776 3300049593 Ga0501077_0043870 Ga0501077_0043870_907_1587 226
777 3300049593 Ga0501077_0226542 Ga0501077_0226542_486_1166 226
778 3300049663 Ga0501223_020669 Ga0501223_020669_77_769 226
779 3300049665 Ga0501227_001013 Ga0501227_001013_502_1194 226
780 3300049668 Ga0501233_030032 Ga0501233_030032_64_744 226
781 3300049686 Ga0501257_000064 Ga0501257_000064_16862_17545 226
782 3300049741 Ga0501079_0000063 Ga0501079_0000063_13612_14292 226
783 3300049741 Ga0501079_0133991 Ga0501079_0133991_953_1633 226
784 3300049742 Ga0501080_0020796 Ga0501080_0020796_3006_3686 226
785 3300049742 Ga0501080_0054679 Ga0501080_0054679_2799_3479 226
786 3300049743 Ga0501081_0000085 Ga0501081_0000085_25194_25874 226
787 3300049743 Ga0501081_0044647 Ga0501081_0044647_884_1564 226
788 3300049743 Ga0501081_0081609 Ga0501081_0081609_979_1659 226
789 3300049743 Ga0501081_0378437 Ga0501081_0378437_155_835 226
790 3300049744 Ga0501083_0057315 Ga0501083_0057315_654_1334 226
791 3300049766 Ga0501269_010095 Ga0501269_010095_310_990 226
792 3300049776 Ga0501280_004097 Ga0501280_004097_807_1490 226
793 3300049778 Ga0501282_019814 Ga0501282_019814_20_703 226
794 3300049822 Ga0501035_0002403 Ga0501035_0002403_12043_12723 226
795 3300049822 Ga0501035_0003576 Ga0501035_0003576_11836_12516 226
796 3300049822 Ga0501035_0011687 Ga0501035_0011687_3742_4422 226
797 3300049822 Ga0501035_0038689 Ga0501035_0038689_2135_2815 226
798 3300049822 Ga0501035_0099678 Ga0501035_0099678_1672_2352 226
799 3300049822 Ga0501035_0553431 Ga0501035_0553431_105_785 226
800 3300049823 Ga0501044_0013688 Ga0501044_0013688_6662_7342 226
801 3300049823 Ga0501044_0019918 Ga0501044_0019918_3893_4573 226
802 3300049823 Ga0501044_0023203 Ga0501044_0023203_5113_5793 226
803 3300049823 Ga0501044_0093581 Ga0501044_0093581_742_1422 226
804 3300049823 Ga0501044_0248177 Ga0501044_0248177_294_974 226
805 3300049824 Ga0501045_0004295 Ga0501045_0004295_2312_2992 226
806 3300049824 Ga0501045_0056311 Ga0501045_0056311_914_1594 226
807 3300050491 nmdc:mga00v17_412249_c1 nmdc:mga00v17_412249_c1_72_752 226
808 3300050492 nmdc:mga0yw44_250829_c1 nmdc:mga0yw44_250829_c1_433_1113 226
809 3300050493 nmdc:mga0k408_139038_c1 nmdc:mga0k408_139038_c1_519_1208 226
810 3300050494 nmdc:mga06z11_118651_c1 nmdc:mga06z11_118651_c1_109_789 226
811 3300050494 nmdc:mga06z11_3889_c1 nmdc:mga06z11_3889_c1_128_808 226
812 3300050496 nmdc:mga07m45_15425_c1 nmdc:mga07m45_15425_c1_2362_3051 226
813 3300050496 nmdc:mga07m45_46577_c1 nmdc:mga07m45_46577_c1_579_1268 226
814 3300050507 nmdc:mga05p37_13597_c1 nmdc:mga05p37_13597_c1_3051_3731 226
815 3300050507 nmdc:mga05p37_23630_c1 nmdc:mga05p37_23630_c1_1897_2577 226
816 3300050508 nmdc:mga09592_11219_c1 nmdc:mga09592_11219_c1_1288_1968 226
817 3300050508 nmdc:mga09592_61725_c1 nmdc:mga09592_61725_c1_683_1363 226
818 3300050509 nmdc:mga0qj67_11191_c1 nmdc:mga0qj67_11191_c1_1288_1968 226
819 3300050509 nmdc:mga0qj67_32483_c1 nmdc:mga0qj67_32483_c1_3132_3812 226
820 3300050509 nmdc:mga0qj67_387_c1 nmdc:mga0qj67_387_c1_27301_27981 226
821 3300050509 nmdc:mga0qj67_503545_c1 nmdc:mga0qj67_503545_c1_53_733 226
822 3300050510 nmdc:mga06r32_14997_c1 nmdc:mga06r32_14997_c1_955_1635 226
823 3300050510 nmdc:mga06r32_33713_c1 nmdc:mga06r32_33713_c1_1891_2571 226
824 3300050510 nmdc:mga06r32_497125_c1 nmdc:mga06r32_497125_c1_290_970 226
825 3300050511 nmdc:mga08y16_12498_c2 nmdc:mga08y16_12498_c2_401_1081 226
826 3300050511 nmdc:mga08y16_162264_c1 nmdc:mga08y16_162264_c1_585_1265 226
827 3300050511 nmdc:mga08y16_267526_c1 nmdc:mga08y16_267526_c1_690_1370 226
828 3300050511 nmdc:mga08y16_95098_c1 nmdc:mga08y16_95098_c1_323_1003 226
829 3300050512 nmdc:mga0n895_531651_c1 nmdc:mga0n895_531651_c1_229_909 226
830 3300050512 nmdc:mga0n895_81312_c1 nmdc:mga0n895_81312_c1_847_1527 226
831 3300050513 nmdc:mga0rr50_60001_c1 nmdc:mga0rr50_60001_c1_671_1351 226
832 3300050515 nmdc:mga0a205_25112_c1 nmdc:mga0a205_25112_c1_2590_3270 226
833 3300053087 Ga0500643_036169 Ga0500643_036169_708_1391 226
834 3300053087 Ga0500643_079371 Ga0500643_079371_36_719 226
835 3300053087 Ga0500643_081047 Ga0500643_081047_191_871 226
836 3300053087 Ga0500643_103732 Ga0500643_103732_41_733 226
837 3300053105 Ga0500557_020196 Ga0500557_020196_1201_1881 226
838 3300053108 Ga0500562_000349 Ga0500562_000349_2430_3113 226
839 3300053116 Ga0500592_000217 Ga0500592_000217_3698_4381 226
840 3300053122 Ga0500608_010809 Ga0500608_010809_1756_2436 226
841 3300053130 Ga0500642_0000002 Ga0500642_0000002_368552_369232 226
842 3300053134 Ga0500658_0014928 Ga0500658_0014928_1083_1766 226
843 3300053138 Ga0500564_186009 Ga0500564_186009_16_696 226
844 3300053151 Ga0500604_0035494 Ga0500604_0035494_616_1296 226
845 3300053153 Ga0500616_0004492 Ga0500616_0004492_8640_9323 226
846 3300053156 Ga0500622_0283844 Ga0500622_0283844_10_690 226
847 3300053158 Ga0500627_0000027 Ga0500627_0000027_76906_77589 226
848 3300053158 Ga0500627_0000230 Ga0500627_0000230_10048_10731 226
849 3300054114 Ga0501084_0033174 Ga0501084_0033174_1504_2184 226
850 3300060353 Ga0501082_0046584 Ga0501082_0046584_1415_2095 226
851 3300060353 Ga0501082_0224781 Ga0501082_0224781_817_1497 226
852 3300061734 Ga0530510_0132847 Ga0530510_0132847_892_1572 226
853 3300061734 Ga0530510_0300547 Ga0530510_0300547_351_1031 226

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18331

PKHD_C

PKHD-type hydroxylase C-terminal domain

223

265

0.99

PF13640

2OG-FeII_Oxy_3

2OG-Fe(II) oxygenase superfamily

122

217

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dkq-assembly1.cif.gz_B-2 crystal structure of putative oxygenase (yp_001051978.1) from shewanella baltica os155 at 2.26 a resolution 0.9797 2 226
3dkq-assembly1.cif.gz_C-2 crystal structure of putative oxygenase (yp_001051978.1) from shewanella baltica os155 at 2.26 a resolution 0.9616 1 226
3dkq-assembly1.cif.gz_B-2 crystal structure of putative oxygenase (yp_001051978.1) from shewanella baltica os155 at 2.26 a resolution 0.9425 2 226
3dkq-assembly1.cif.gz_A-2 crystal structure of putative oxygenase (yp_001051978.1) from shewanella baltica os155 at 2.26 a resolution 0.9418 1 226
3dkq-assembly1.cif.gz_C-2 crystal structure of putative oxygenase (yp_001051978.1) from shewanella baltica os155 at 2.26 a resolution 0.9362 1 226
ID Description Score Start End Superfamily
3dkqA02 Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;Rabenosyn, Rab binding domain 0.9654 180 226 4.10.860.20
3dkqC02 Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;Rabenosyn, Rab binding domain 0.9645 180 226 4.10.860.20
3dkqC01 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.963 2 178 2.60.120.620
3dkqA02 Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;Rabenosyn, Rab binding domain 0.9456 180 226 4.10.860.20
3dkqC02 Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;Rabenosyn, Rab binding domain 0.9448 180 226 4.10.860.20
ID Description Score Start End GO Terms
AF-A0A1H8NHS7-F1-model_v4 PKHD-type hydroxylase 0.9975 1 199 GO:0005506
GO:0006879
GO:0006974
GO:0016706
GO:0031418
AF-A0A399IX52-F1-model_v4 Fe2+-dependent dioxygenase 0.9968 1 226 GO:0005506
GO:0006879
GO:0006974
GO:0016706
GO:0031418
AF-A0A377TSW3-F1-model_v4 Iron-uptake factor PiuC (EC 1.14.11.-) 0.9959 111 191 GO:0006879
GO:0006974
GO:0016706
AF-A0A1I3CYU9-F1-model_v4 PKHD-type hydroxylase 0.9952 1 226 GO:0005506
GO:0006879
GO:0006974
GO:0016706
GO:0031418
AF-G6XFC2-F1-model_v4 Putative hydroxylase 0.9944 1 226 GO:0005506
GO:0006879
GO:0006974
GO:0016706
GO:0031418

Feature Viewer

pLDDT pTM Quality
96.26 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map