F483420

General Info

Members Datasets Scaffolds Average Seq Length
850 438 818 202

Family's Representative Sequence

Representative Sequence 3300005339|Ga0070660_100291310|Ga0070660_1002913102
Length 222
Sequence VKAALLPPASETSTMAPPTDDALALRRDNRRMLGKLAVIAALMFGFAYGLASMYNQICQALGINVLALSEAGGAVGERGPVNTQVDASRTITVEFDANAHGPWEFKPALRSLEVHPGELATVMYEFRNVQNRTMAAQAIPSYAPQQAMSHFNKIECFCFSEHTLKPGESKQWPVVFVIDAKLPKDVKTITLSYTFFEVGGKTPPAPDGAHAAGDPLAAGKAS

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2547132374 Acidovorax radicis N35 Isolate Unclassified
3 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
4 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
5 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
6 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
7 2643221570 Acidovorax sp. Root568 Isolate Unclassified
8 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
9 2643221596 Acidovorax sp. Root70 Isolate Unclassified
10 2643221609 Acidovorax sp. Root217 Isolate Unclassified
11 2643221611 Acidovorax sp. Root219 Isolate Unclassified
12 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
13 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
14 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
15 2643221652 Acidovorax sp. Root402 Isolate Unclassified
16 2643221660 Methylibium sp. Root1272 Isolate Unclassified
17 2643221717 Acidovorax sp. Root267 Isolate Unclassified
18 2721755523 Delftia sp. HK171 Isolate Unclassified
19 2738543012 Acidovorax sp. CF301 Isolate Unclassified
20 2738543013 Variovorax sp. BT01 Isolate Unclassified
21 2816332133 Acidovorax radicis 2721A Isolate Unclassified
22 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
23 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
24 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
25 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
26 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
27 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
28 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
29 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
30 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
31 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
32 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
33 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
34 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
35 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
36 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
37 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
38 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
39 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
40 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
41 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
42 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
43 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
44 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
45 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
46 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
47 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
48 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
49 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
50 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
51 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
52 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
53 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
54 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
55 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
56 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
57 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
58 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
59 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
60 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
61 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
62 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
63 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
64 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
65 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
66 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
67 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
68 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
69 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
70 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
71 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
72 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
73 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
74 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
75 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
76 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
77 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
78 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
79 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
80 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
81 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
82 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
83 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
84 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
85 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
86 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
87 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
88 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
89 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
90 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
91 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
92 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
93 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
94 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
95 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
96 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
97 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
98 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
99 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
100 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
101 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
102 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
103 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
104 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
105 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
106 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
107 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
108 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
109 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
110 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
111 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
112 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
113 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
114 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
115 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
116 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
117 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
118 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
119 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
120 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
121 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
122 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
123 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
124 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
125 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
126 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
127 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
128 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
129 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
130 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
131 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
132 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
133 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
134 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
135 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
136 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
137 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
138 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
139 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
140 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
141 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
142 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
143 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
144 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
145 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
146 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
147 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
148 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
149 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
150 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
151 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
152 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
153 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
154 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
155 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
156 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
157 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
160 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
162 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
163 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
164 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
166 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
167 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
168 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
171 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
172 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
173 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
175 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
176 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
177 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
179 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
180 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
229 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
231 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
241 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
243 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
244 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
245 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
246 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
247 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
248 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
249 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
250 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
251 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
252 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
253 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
254 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
255 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
256 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
257 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
258 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
259 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
260 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
261 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
262 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
263 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
264 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
265 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
266 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
267 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
268 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
269 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
270 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
271 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
272 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
273 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
274 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
275 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
276 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
277 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
278 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
279 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
280 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
281 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
282 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
283 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
284 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
285 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
286 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
287 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
288 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
289 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
290 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
291 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
292 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
293 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
294 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
295 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
296 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
297 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
298 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
299 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
300 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
301 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
302 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
303 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
304 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
305 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
306 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
307 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
308 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
309 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
310 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
311 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
312 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
313 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
314 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
315 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
316 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
317 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
318 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
319 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
320 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
321 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
322 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
323 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
324 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
325 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
326 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
327 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
328 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
329 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
330 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
331 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
332 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
333 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
334 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
335 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
336 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
337 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
338 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
339 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
340 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
341 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
342 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
343 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
344 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
345 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
346 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
347 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
348 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
349 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
350 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
351 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
352 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
353 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
354 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
355 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
356 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
357 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
358 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
359 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
360 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
361 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
362 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
363 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
364 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
365 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
366 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
367 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
368 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
369 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
370 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
371 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
372 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
373 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
374 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
375 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
376 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
377 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
380 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
381 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
382 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
383 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
384 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
385 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
386 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
387 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
388 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
389 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
390 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
391 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
392 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
393 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
394 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
395 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
396 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
397 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
398 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
399 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
400 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
401 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
402 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
403 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
404 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
405 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
406 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
407 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
408 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
409 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
410 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
411 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
412 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
413 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
414 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
415 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
416 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
417 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
418 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
419 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
420 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
421 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
422 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
423 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
424 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
425 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
426 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
427 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
428 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
429 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
430 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
431 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
432 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
433 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
434 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
435 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
436 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
437 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
438 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96
Metatranscriptomes 0.24
Isolates 3.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 27.65
Nodule 1.18
Rhizoplane 4.24
Rhizosphere 55.29
Stem 0
Stem Tuber 0
Unclassified 11.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10003715 3300001979 Bacteria 6644
2 JGI25155J39150_1000264 3300002704 Bacteria 19417
3 JGI25156J39149_1000010 3300002705 Bacteria 200080
4 JGI25156J39149_1014497 3300002705 Bacteria 1622
5 JGI25156J39149_1020981 3300002705 Bacteria 1137
6 JGI25154J39366_1000027 3300002738 Bacteria 200075
7 JGI25154J39366_1003058 3300002738 Bacteria 3774
8 JGI25157J39369_1000021 3300002741 Bacteria 163907
9 JGI25157J39369_1000146 3300002741 Bacteria 59929
10 JGI25157J39369_1000351 3300002741 Bacteria 32381
11 JGI25152J39213_1000752 3300002773 Bacteria 16498
12 JGI25150J39212_1004196 3300002774 Bacteria 3243
13 JGI25150J39212_1004919 3300002774 Bacteria 2909
14 JGI25150J39212_1006810 3300002774 Bacteria 2332
15 JGI25159J45721_1000445 3300002987 Bacteria 19077
16 JGI25159J45721_1002455 3300002987 Bacteria 7032
17 JGI25159J45721_1014855 3300002987 Bacteria 1734
18 JGI25151J46595_10052728 3300003187 Bacteria 1365
19 JGI25151J46595_10062909 3300003187 Bacteria 1170
20 JGI25151J46595_10062969 3300003187 Bacteria 1169
21 JGI25153J46596_10014796 3300003215 Bacteria 3221
22 rootH1_10029887 3300003316 Bacteria 1403
23 rootH1_10029888 3300003316 Bacteria 1582
24 rootH1_10083951 3300003316 Bacteria 1149
25 rootL2_10000579 3300003322 Bacteria 16628
26 rootL2_10014092 3300003322 Bacteria 1333
27 rootL2_10051303 3300003322 Bacteria 1414
28 rootH1_10016701 3300003323 Bacteria 1920
29 rootH1_10042174 3300003323 Bacteria 1582
30 rootH1_10049916 3300003323 Bacteria 1560
31 JGI25160J50197_1000129 3300003354 Bacteria 68068
32 JGI25160J50197_1024830 3300003354 Bacteria 1691
33 JGI25161J50226_1000080 3300003374 Bacteria 79971
34 Ga0055539_1000651 3300003752 Bacteria 9229
35 Ga0055539_1009683 3300003752 Bacteria 1194
36 Ga0055533_1000033 3300003756 Bacteria 265716
37 Ga0055525_1000767 3300003759 Bacteria 10537
38 Ga0055535_1000307 3300003761 Bacteria 49806
39 Ga0055529_1000488 3300003763 Bacteria 36464
40 Ga0055526_1007400 3300003771 Bacteria 5717
41 Ga0055526_1009134 3300003771 Bacteria 4823
42 Ga0055537_1007693 3300003773 Bacteria 2569
43 Ga0055524_1000120 3300003775 Bacteria 91299
44 Ga0055524_1000146 3300003775 Bacteria 84190
45 Ga0055524_1000733 3300003775 Bacteria 22506
46 Ga0055524_1005494 3300003775 Bacteria 5643
47 Ga0055536_1007145 3300003781 Bacteria 5055
48 Ga0055534_1005931 3300003784 Bacteria 3171
49 Ga0055534_1024493 3300003784 Bacteria 977
50 Ga0055528_1002282 3300003790 Bacteria 10398
51 Ga0055528_1056769 3300003790 Bacteria 758
52 Ga0055530_10006485 3300003791 Bacteria 5212
53 Ga0055530_10007449 3300003791 Bacteria 4602
54 Ga0055530_10026894 3300003791 Bacteria 1580
55 Ga0055540_1000001 3300003792 Bacteria 466834
56 Ga0055540_1000067 3300003792 Bacteria 122108
57 Ga0055540_1004852 3300003792 Bacteria 5893
58 Ga0055540_1008475 3300003792 Bacteria 3698
59 Ga0055531_10000480 3300003794 Bacteria 36934
60 Ga0055531_10001273 3300003794 Bacteria 19046
61 Ga0055531_10002124 3300003794 Bacteria 13597
62 Ga0055531_10007153 3300003794 Bacteria 6154
63 Ga0055531_10021663 3300003794 Bacteria 2482
64 Ga0055543_1000239 3300004625 Bacteria 42667
65 Ga0055543_1001806 3300004625 Bacteria 7883
66 Ga0065165_1000016 3300005262 Bacteria 286248
67 Ga0065165_1000295 3300005262 Bacteria 84323
68 Ga0065165_1001501 3300005262 Bacteria 24680
69 Ga0065165_1055090 3300005262 Bacteria 1111
70 Ga0065714_10150799 3300005288 Bacteria 1099
71 Ga0065704_10082029 3300005289 Bacteria 3665
72 Ga0065715_10098707 3300005293 Bacteria 3498
73 Ga0070658_10055164 3300005327 Bacteria 3228
74 Ga0070658_10131358 3300005327 Bacteria 2087
75 Ga0070658_10192649 3300005327 Bacteria 1719
76 Ga0070676_10075764 3300005328 Bacteria 2029
77 Ga0070676_10123452 3300005328 Bacteria 1628
78 Ga0070690_100045265 3300005330 Bacteria 2795
79 Ga0070690_100171827 3300005330 Bacteria 1492
80 Ga0070670_100213738 3300005331 Bacteria 1677
81 Ga0070670_100219080 3300005331 Bacteria 1655
82 Ga0070677_10008129 3300005333 Bacteria 3522
83 Ga0068869_100006901 3300005334 Bacteria 7225
84 Ga0068869_100462883 3300005334 Bacteria 1053
85 Ga0070666_10308493 3300005335 Bacteria 1128
86 Ga0070682_100304596 3300005337 Bacteria 1171
87 Ga0070660_100096947 3300005339 Bacteria 2332
88 Ga0070660_100178681 3300005339 Bacteria 1717
89 Ga0070660_100291310 3300005339 Bacteria 1337
90 Ga0070661_100007719 3300005344 Bacteria 7431
91 Ga0070668_100063350 3300005347 Bacteria 2866
92 Ga0070669_100026644 3300005353 Bacteria 4160
93 Ga0070669_100093224 3300005353 Bacteria 2261
94 Ga0070669_100239421 3300005353 Bacteria 1441
95 Ga0070675_100315206 3300005354 Bacteria 1381
96 Ga0070675_100358761 3300005354 Bacteria 1294
97 Ga0070671_100007158 3300005355 Bacteria 8919
98 Ga0070671_100009262 3300005355 Bacteria 7910
99 Ga0070671_100405534 3300005355 Bacteria 1166
100 Ga0070671_100728386 3300005355 Bacteria 861
101 Ga0070674_100075398 3300005356 Bacteria 2395
102 Ga0070674_100394874 3300005356 Bacteria 1129
103 Ga0070673_100105779 3300005364 Bacteria 2325
104 Ga0070673_100111483 3300005364 Bacteria 2269
105 Ga0070673_100159226 3300005364 Bacteria 1919
106 Ga0070673_100650071 3300005364 Bacteria 965
107 Ga0070659_100001726 3300005366 Bacteria 15700
108 Ga0070667_100010858 3300005367 Bacteria 7530
109 Ga0070667_100134776 3300005367 Bacteria 2159
110 Ga0070667_100761789 3300005367 Bacteria 898
111 Ga0070708_100110016 3300005445 Bacteria 2531
112 Ga0070663_100000226 3300005455 Bacteria 28442
113 Ga0070678_100004379 3300005456 Bacteria 7998
114 Ga0070678_100446201 3300005456 Bacteria 1132
115 Ga0070681_10374680 3300005458 Bacteria 1334
116 Ga0068867_100001941 3300005459 Bacteria 14401
117 Ga0068867_100173038 3300005459 Bacteria 1711
118 Ga0068867_100415805 3300005459 Bacteria 1138
119 Ga0070707_100617116 3300005468 Bacteria 1047
120 Ga0070679_100230208 3300005530 Bacteria 1813
121 Ga0070684_100369827 3300005535 Bacteria 1320
122 Ga0068853_100142484 3300005539 Bacteria 2152
123 Ga0068853_100852996 3300005539 Bacteria 874
124 Ga0070672_100005168 3300005543 Bacteria 8627
125 Ga0070665_100300282 3300005548 Bacteria 1609
126 Ga0068855_100095565 3300005563 Bacteria 3425
127 Ga0068855_100306943 3300005563 Bacteria 1756
128 Ga0068855_100809919 3300005563 Bacteria 995
129 Ga0070664_100476314 3300005564 Bacteria 1148
130 Ga0068857_100035461 3300005577 Bacteria 4418
131 Ga0068857_100155748 3300005577 Bacteria 2072
132 Ga0068854_100111674 3300005578 Bacteria 2062
133 Ga0068854_100459358 3300005578 Bacteria 1065
134 Ga0068856_100016853 3300005614 Bacteria 7081
135 Ga0068856_100020989 3300005614 Bacteria 6346
136 Ga0068864_100137148 3300005618 Bacteria 2204
137 Ga0068864_100248084 3300005618 Bacteria 1652
138 Ga0068861_100324978 3300005719 Bacteria 1341
139 Ga0068851_10206900 3300005834 Bacteria 1097
140 Ga0068863_100282268 3300005841 Bacteria 1609
141 Ga0068860_100225833 3300005843 Bacteria 1819
142 Ga0075365_10166779 3300006038 Bacteria 1536
143 Ga0075368_10048243 3300006042 Bacteria 1687
144 Ga0075363_100048837 3300006048 Bacteria 2251
145 Ga0075363_100091748 3300006048 Bacteria 1672
146 Ga0075363_100125655 3300006048 Bacteria 1436
147 Ga0075363_100347380 3300006048 Bacteria 866
148 Ga0075364_10100907 3300006051 Bacteria 1921
149 Ga0075364_10161643 3300006051 Bacteria 1512
150 Ga0075432_10062450 3300006058 Bacteria 1328
151 Ga0075362_10032080 3300006177 Bacteria 2277
152 Ga0075362_10043209 3300006177 Bacteria 1995
153 Ga0075362_10052090 3300006177 Bacteria 1833
154 Ga0075362_10052668 3300006177 Bacteria 1825
155 Ga0075362_10090415 3300006177 Bacteria 1420
156 Ga0075362_10172671 3300006177 Bacteria 1045
157 Ga0075367_10050981 3300006178 Bacteria 2445
158 Ga0075369_10024698 3300006186 Bacteria 2493
159 Ga0075369_10222545 3300006186 Bacteria 874
160 Ga0075366_10001953 3300006195 Bacteria 10427
161 Ga0075366_10006604 3300006195 Bacteria 6364
162 Ga0075366_10014699 3300006195 Bacteria 4474
163 Ga0075366_10036060 3300006195 Bacteria 2915
164 Ga0075366_10039564 3300006195 Bacteria 2787
165 Ga0075366_10058904 3300006195 Bacteria 2282
166 Ga0075366_10063663 3300006195 Bacteria 2192
167 Ga0075366_10066059 3300006195 Bacteria 2151
168 Ga0075366_10066159 3300006195 Bacteria 2150
169 Ga0075366_10090117 3300006195 Bacteria 1836
170 Ga0075366_10092421 3300006195 Bacteria 1813
171 Ga0075366_10098875 3300006195 Bacteria 1750
172 Ga0075366_10129493 3300006195 Bacteria 1523
173 Ga0075366_10180326 3300006195 Bacteria 1283
174 Ga0075366_10333389 3300006195 Bacteria 930
175 Ga0075366_10454251 3300006195 Bacteria 791
176 Ga0097621_100052565 3300006237 Bacteria 3319
177 Ga0075370_10000954 3300006353 Bacteria 11903
178 Ga0075370_10001826 3300006353 Bacteria 9524
179 Ga0075370_10002711 3300006353 Bacteria 8289
180 Ga0075370_10031240 3300006353 Bacteria 2972
181 Ga0075370_10050514 3300006353 Bacteria 2359
182 Ga0075370_10102663 3300006353 Bacteria 1656
183 Ga0068871_100143810 3300006358 Bacteria 2029
184 Ga0075428_100408943 3300006844 Bacteria 1454
185 Ga0075430_100342555 3300006846 Bacteria 1235
186 Ga0075429_100428302 3300006880 Bacteria 1159
187 Ga0068865_100085871 3300006881 Bacteria 2271
188 Ga0099824_1030030 3300006942 Bacteria 2231
189 Ga0099823_1000101 3300006944 Bacteria 41834
190 Ga0079104_1000001 3300006946 Bacteria 521847
191 Ga0079104_1000072 3300006946 Bacteria 152567
192 Ga0079104_1028202 3300006946 Bacteria 1429
193 Ga0099826_10141023 3300006948 Bacteria 1392
194 Ga0105244_10063490 3300009036 Bacteria 1855
195 Ga0105250_10000680 3300009092 Bacteria 21348
196 Ga0105240_10171884 3300009093 Bacteria 2566
197 Ga0105240_10314240 3300009093 Bacteria 1788
198 Ga0105240_10331162 3300009093 Bacteria 1733
199 Ga0105240_10880735 3300009093 Bacteria 964
200 Ga0105240_10962580 3300009093 Bacteria 915
201 Ga0114129_10478674 3300009147 Bacteria 1629
202 Ga0105243_10002347 3300009148 Bacteria 15835
203 Ga0105243_10035553 3300009148 Bacteria 3863
204 Ga0105243_10965989 3300009148 Bacteria 852
205 Ga0105242_10012979 3300009176 Bacteria 6423
206 Ga0105242_10211390 3300009176 Bacteria 1729
207 Ga0105248_10007163 3300009177 Bacteria 12236
208 Ga0105248_10214122 3300009177 Bacteria 2170
209 Ga0105248_10540780 3300009177 Bacteria 1314
210 Ga0105248_11260356 3300009177 Bacteria 836
211 Ga0105237_10001471 3300009545 Bacteria 31034
212 Ga0105237_10487407 3300009545 Bacteria 1239
213 Ga0105238_10053658 3300009551 Bacteria 4050
214 Ga0105238_10467434 3300009551 Bacteria 1260
215 Ga0105239_10003011 3300010375 Bacteria 20996
216 Ga0105239_10020553 3300010375 Bacteria 7284
217 Ga0157317_1000388 3300012475 Bacteria 1808
218 Ga0157319_1000015 3300012497 Bacteria 130857
219 Ga0157370_10370307 3300013104 Bacteria 1320
220 Ga0157369_10055954 3300013105 Bacteria 4257
221 Ga0157369_10817373 3300013105 Bacteria 957
222 Ga0157374_10016697 3300013296 Bacteria 6457
223 Ga0157374_10571637 3300013296 Bacteria 1139
224 Ga0157378_10252643 3300013297 Bacteria 1688
225 Ga0157378_11103912 3300013297 Bacteria 830
226 Ga0163162_10148095 3300013306 Bacteria 2464
227 Ga0163162_10149785 3300013306 Bacteria 2450
228 Ga0157372_11019184 3300013307 Bacteria 959
229 Ga0157375_10143413 3300013308 Bacteria 2517
230 Ga0163163_10469441 3300014325 Bacteria 1319
231 Ga0163163_11028806 3300014325 Bacteria 887
232 Ga0157380_10476896 3300014326 Bacteria 1205
233 Ga0157380_11221444 3300014326 Bacteria 796
234 Ga0182008_10003510 3300014497 Bacteria 9451
235 Ga0182008_10018684 3300014497 Bacteria 3587
236 Ga0182008_10075392 3300014497 Bacteria 1659
237 Ga0157377_10076280 3300014745 Bacteria 1949
238 Ga0157379_10369461 3300014968 Bacteria 1315
239 Ga0157379_10655909 3300014968 Bacteria 983
240 Ga0157376_10292276 3300014969 Bacteria 1539
241 Ga0182007_10009603 3300015262 Bacteria 3887
242 Ga0182005_1021523 3300015265 Bacteria 1768
243 Ga0183362_10005 3300015683 Bacteria 437616
244 Ga0163161_10021384 3300017792 Bacteria 4547
245 Ga0163161_10141927 3300017792 Bacteria 1819
246 Ga0213872_10000068 3300021361 Bacteria 91693
247 Ga0213872_10000132 3300021361 Bacteria 67609
248 Ga0213872_10023786 3300021361 Bacteria 2818
249 Ga0209435_100003 3300025206 Bacteria 669534
250 Ga0209674_100064 3300025226 Bacteria 265769
251 Ga0209563_100099 3300025230 Bacteria 153336
252 Ga0209563_114383 3300025230 Bacteria 1017
253 Ga0207427_101039 3300025231 Bacteria 11567
254 Ga0209258_100319 3300025242 Bacteria 74569
255 Ga0209258_100699 3300025242 Bacteria 22932
256 Ga0207425_1002311 3300025245 Bacteria 6842
257 Ga0207425_1003440 3300025245 Bacteria 5070
258 Ga0207425_1005823 3300025245 Bacteria 3456
259 Ga0209646_1000008 3300025246 Bacteria 669534
260 Ga0209646_1000060 3300025246 Bacteria 256386
261 Ga0209026_1000007 3300025250 Bacteria 669534
262 Ga0209026_1000049 3300025250 Bacteria 255273
263 Ga0209026_1035999 3300025250 Bacteria 725
264 Ga0209677_100175 3300025253 Bacteria 55052
265 Ga0209677_100782 3300025253 Bacteria 16014
266 Ga0209759_1000019 3300025256 Bacteria 357908
267 Ga0209759_1000069 3300025256 Bacteria 182437
268 Ga0209759_1001175 3300025256 Bacteria 16458
269 Ga0209759_1002013 3300025256 Bacteria 9668
270 Ga0209759_1004778 3300025256 Bacteria 4945
271 Ga0209759_1021590 3300025256 Bacteria 1460
272 Ga0209759_1037604 3300025256 Bacteria 869
273 Ga0209129_1000062 3300025258 Bacteria 240655
274 Ga0209565_1000116 3300025263 Bacteria 114340
275 Ga0209565_1001214 3300025263 Bacteria 12172
276 Ga0209565_1017359 3300025263 Bacteria 1579
277 Ga0207666_1003182 3300025271 Bacteria 2006
278 Ga0209455_1000157 3300025272 Bacteria 119719
279 Ga0209673_1001210 3300025273 Bacteria 27444
280 Ga0209673_1013829 3300025273 Bacteria 3163
281 Ga0209673_1022830 3300025273 Bacteria 2146
282 Ga0209673_1028406 3300025273 Bacteria 1801
283 Ga0209130_1000095 3300025284 Bacteria 145126
284 Ga0209130_1000134 3300025284 Bacteria 119102
285 Ga0209675_1000373 3300025291 Bacteria 38099
286 Ga0209675_1005068 3300025291 Bacteria 5630
287 Ga0209675_1045089 3300025291 Bacteria 940
288 Ga0209676_1000145 3300025292 Bacteria 174391
289 Ga0209676_1008763 3300025292 Bacteria 4458
290 Ga0209676_1031787 3300025292 Bacteria 1595
291 Ga0209025_1007514 3300025294 Bacteria 8096
292 Ga0209025_1018512 3300025294 Bacteria 3938
293 Ga0209025_1021495 3300025294 Bacteria 3472
294 Ga0209025_1041211 3300025294 Bacteria 1981
295 Ga0209564_1000008 3300025295 Bacteria 953227
296 Ga0209564_1000176 3300025295 Bacteria 152363
297 Ga0209564_1004068 3300025295 Bacteria 9222
298 Ga0209564_1006206 3300025295 Bacteria 6529
299 Ga0209758_1000129 3300025297 Bacteria 185022
300 Ga0209758_1000327 3300025297 Bacteria 89663
301 Ga0209758_1016925 3300025297 Bacteria 3669
302 Ga0209758_1096062 3300025297 Bacteria 855
303 Ga0209050_1000023 3300025298 Bacteria 537172
304 Ga0209050_1000118 3300025298 Bacteria 202586
305 Ga0209050_1001120 3300025298 Bacteria 32400
306 Ga0209050_1002654 3300025298 Bacteria 14636
307 Ga0209050_1010700 3300025298 Bacteria 4477
308 Ga0209050_1017603 3300025298 Bacteria 2834
309 Ga0209256_1000003 3300025299 Bacteria 1661127
310 Ga0209256_1000015 3300025299 Bacteria 622953
311 Ga0209256_1005979 3300025299 Bacteria 6687
312 Ga0209256_1008383 3300025299 Bacteria 4810
313 Ga0207426_1000397 3300025302 Bacteria 73966
314 Ga0207426_1031894 3300025302 Bacteria 1715
315 Ga0209051_1000017 3300025303 Bacteria 537172
316 Ga0209051_1000018 3300025303 Bacteria 527061
317 Ga0209051_1000456 3300025303 Bacteria 54000
318 Ga0209051_1002067 3300025303 Bacteria 15222
319 Ga0209051_1002891 3300025303 Bacteria 11797
320 Ga0209051_1046473 3300025303 Bacteria 1493
321 Ga0209257_1000015 3300025304 Bacteria 908141
322 Ga0209257_1000041 3300025304 Bacteria 537172
323 Ga0209257_1000324 3300025304 Bacteria 100144
324 Ga0209257_1002253 3300025304 Bacteria 19751
325 Ga0209257_1003886 3300025304 Bacteria 12194
326 Ga0209257_1056523 3300025304 Bacteria 1083
327 Ga0207697_10011905 3300025315 Bacteria 3664
328 Ga0207696_1002009 3300025711 Bacteria 10296
329 Ga0207682_10011022 3300025893 Bacteria 3538
330 Ga0207642_10085586 3300025899 Bacteria 1543
331 Ga0207688_10070573 3300025901 Bacteria 1981
332 Ga0207680_10186033 3300025903 Bacteria 1407
333 Ga0207645_10037665 3300025907 Bacteria 3103
334 Ga0207645_10098849 3300025907 Bacteria 1882
335 Ga0207705_10119401 3300025909 Bacteria 1955
336 Ga0207705_10364619 3300025909 Bacteria 1114
337 Ga0207684_10245880 3300025910 Bacteria 1544
338 Ga0207654_10069835 3300025911 Bacteria 2083
339 Ga0207707_10631970 3300025912 Bacteria 904
340 Ga0207695_10009579 3300025913 Bacteria 11969
341 Ga0207695_10016584 3300025913 Bacteria 8611
342 Ga0207695_10196087 3300025913 Bacteria 1935
343 Ga0207671_10013202 3300025914 Bacteria 6592
344 Ga0207671_10318775 3300025914 Bacteria 1230
345 Ga0207657_10216323 3300025919 Bacteria 1536
346 Ga0207649_10002028 3300025920 Bacteria 11519
347 Ga0207652_10057081 3300025921 Bacteria 3362
348 Ga0207646_10404822 3300025922 Bacteria 1232
349 Ga0207681_10035624 3300025923 Bacteria 3280
350 Ga0207694_10021765 3300025924 Bacteria 4859
351 Ga0207694_10274909 3300025924 Bacteria 1382
352 Ga0207650_10017584 3300025925 Bacteria 5007
353 Ga0207650_10168936 3300025925 Bacteria 1737
354 Ga0207659_10001102 3300025926 Bacteria 16008
355 Ga0207644_10000537 3300025931 Bacteria 24617
356 Ga0207644_10106468 3300025931 Bacteria 2114
357 Ga0207690_10002544 3300025932 Bacteria 11021
358 Ga0207690_10157275 3300025932 Bacteria 1691
359 Ga0207706_10620741 3300025933 Bacteria 927
360 Ga0207686_10010264 3300025934 Bacteria 5095
361 Ga0207686_10410455 3300025934 Bacteria 1034
362 Ga0207709_10000132 3300025935 Bacteria 109578
363 Ga0207709_10018759 3300025935 Bacteria 3879
364 Ga0207709_10175770 3300025935 Bacteria 1507
365 Ga0207669_10076629 3300025937 Bacteria 2123
366 Ga0207669_10083862 3300025937 Bacteria 2051
367 Ga0207669_10457492 3300025937 Bacteria 1013
368 Ga0207691_10002343 3300025940 Bacteria 18561
369 Ga0207711_10045155 3300025941 Bacteria 3764
370 Ga0207689_10006852 3300025942 Bacteria 10021
371 Ga0207679_10000647 3300025945 Bacteria 23264
372 Ga0207679_10691594 3300025945 Bacteria 925
373 Ga0207667_10133371 3300025949 Bacteria 2558
374 Ga0207667_10372014 3300025949 Bacteria 1456
375 Ga0207651_10009684 3300025960 Bacteria 5295
376 Ga0207651_10099185 3300025960 Bacteria 2156
377 Ga0207640_10082829 3300025981 Bacteria 2198
378 Ga0207640_10336679 3300025981 Bacteria 1207
379 Ga0207640_10380766 3300025981 Bacteria 1143
380 Ga0207658_10060560 3300025986 Bacteria 2825
381 Ga0207658_10127736 3300025986 Bacteria 2037
382 Ga0207677_10114502 3300026023 Bacteria 2015
383 Ga0207639_10203670 3300026041 Bacteria 1699
384 Ga0207639_10217663 3300026041 Bacteria 1647
385 Ga0207639_10427923 3300026041 Bacteria 1198
386 Ga0207678_10000644 3300026067 Bacteria 32105
387 Ga0207702_10005245 3300026078 Bacteria 11378
388 Ga0207702_10039951 3300026078 Bacteria 3933
389 Ga0207641_10052852 3300026088 Bacteria 3442
390 Ga0207641_10245768 3300026088 Bacteria 1669
391 Ga0207648_10012148 3300026089 Bacteria 8071
392 Ga0207648_10013271 3300026089 Bacteria 7676
393 Ga0207648_10158469 3300026089 Bacteria 1999
394 Ga0207648_10211078 3300026089 Bacteria 1723
395 Ga0207676_10041554 3300026095 Bacteria 3531
396 Ga0207676_10120268 3300026095 Bacteria 2213
397 Ga0207674_10126161 3300026116 Bacteria 2525
398 Ga0207674_10703547 3300026116 Bacteria 975
399 Ga0207675_100199947 3300026118 Bacteria 1919
400 Ga0207683_10102933 3300026121 Bacteria 2550
401 Ga0207683_10162030 3300026121 Bacteria 2022
402 Ga0207698_10108356 3300026142 Bacteria 2322
403 Ga0207698_10223884 3300026142 Bacteria 1702
404 Ga0207698_10388720 3300026142 Bacteria 1330
405 Ga0209281_1000002 3300027111 Bacteria 1924012
406 Ga0209281_1000151 3300027111 Bacteria 167268
407 Ga0209973_1005543 3300027252 Bacteria 1347
408 Ga0209389_1001650 3300027296 Bacteria 16043
409 Ga0209371_1005027 3300027312 Bacteria 5450
410 Ga0209996_1001287 3300027395 Bacteria 3012
411 Ga0209984_1000927 3300027424 Bacteria 3136
412 Ga0209968_1000086 3300027526 Bacteria 16448
413 Ga0209999_1035045 3300027543 Bacteria 935
414 Ga0209970_1000061 3300027614 Bacteria 14543
415 Ga0209983_1010179 3300027665 Bacteria 1921
416 Ga0209983_1038061 3300027665 Bacteria 1037
417 Ga0209971_1000817 3300027682 Bacteria 8001
418 Ga0209966_1000084 3300027695 Bacteria 40899
419 Ga0209974_10002610 3300027876 Bacteria 6539
420 Ga0209974_10013714 3300027876 Bacteria 2700
421 Ga0268266_10055366 3300028379 Bacteria 3410
422 Ga0268266_10178609 3300028379 Bacteria 1931
423 Ga0268266_10316773 3300028379 Bacteria 1459
424 Ga0268266_10844590 3300028379 Bacteria 885
425 Ga0265334_10057688 3300028573 Bacteria 1471
426 Ga0265336_10000040 3300028666 Bacteria 138266
427 Ga0307517_10001975 3300028786 Bacteria 33407
428 Ga0307515_10005119 3300028794 Bacteria 26636
429 Ga0307515_10044865 3300028794 Bacteria 6812
430 Ga0307515_10053971 3300028794 Bacteria 5911
431 Ga0307515_10064108 3300028794 Bacteria 5143
432 Ga0307515_10264829 3300028794 Bacteria 1449
433 Ga0265324_10004950 3300029957 Bacteria 5856
434 Ga0268256_1004264 3300030500 Bacteria 6002
435 Ga0307511_10000144 3300030521 Bacteria 66850
436 Ga0307512_10084973 3300030522 Bacteria 2246
437 Ga0307512_10095143 3300030522 Bacteria 2051
438 Ga0307512_10095711 3300030522 Bacteria 2041
439 Ga0307512_10198141 3300030522 Bacteria 1093
440 Ga0265330_10000110 3300031235 Bacteria 68461
441 Ga0265332_10000011 3300031238 Bacteria 284299
442 Ga0265332_10000027 3300031238 Bacteria 190796
443 Ga0265332_10003699 3300031238 Bacteria 7320
444 Ga0265328_10029761 3300031239 Bacteria 2037
445 Ga0265340_10134722 3300031247 Bacteria 1131
446 Ga0265331_10008263 3300031250 Bacteria 5932
447 Ga0265327_10000042 3300031251 Bacteria 287487
448 Ga0265327_10000158 3300031251 Bacteria 145905
449 Ga0265327_10006235 3300031251 Bacteria 9607
450 Ga0265316_10325976 3300031344 Bacteria 1115
451 Ga0307513_10000104 3300031456 Bacteria 119239
452 Ga0307513_10014677 3300031456 Bacteria 9536
453 Ga0307513_10103621 3300031456 Bacteria 2861
454 Ga0307513_10181687 3300031456 Bacteria 1966
455 Ga0307509_10009555 3300031507 Bacteria 12087
456 Ga0307509_10237953 3300031507 Bacteria 1616
457 Ga0307509_10457598 3300031507 Bacteria 969
458 Ga0307509_10534446 3300031507 Bacteria 852
459 Ga0307408_100000131 3300031548 Bacteria 83295
460 Ga0307408_100038396 3300031548 Bacteria 3379
461 Ga0307408_100198707 3300031548 Bacteria 1621
462 Ga0307408_100882047 3300031548 Bacteria 817
463 Ga0307408_100962614 3300031548 Bacteria 785
464 Ga0307508_10000271 3300031616 Bacteria 63576
465 Ga0307508_10003497 3300031616 Bacteria 15837
466 Ga0307508_10259716 3300031616 Bacteria 1332
467 Ga0307508_10391419 3300031616 Bacteria 981
468 Ga0307514_10000558 3300031649 Bacteria 71090
469 Ga0307514_10004100 3300031649 Bacteria 13518
470 Ga0265314_10000026 3300031711 Bacteria 284299
471 Ga0265314_10004418 3300031711 Bacteria 13056
472 Ga0265314_10179414 3300031711 Bacteria 1271
473 Ga0307516_10003164 3300031730 Bacteria 21417
474 Ga0307516_10089269 3300031730 Bacteria 2913
475 Ga0307516_10126387 3300031730 Bacteria 2341
476 Ga0307516_10185772 3300031730 Bacteria 1809
477 Ga0307516_10211370 3300031730 Bacteria 1654
478 Ga0307516_10306335 3300031730 Bacteria 1263
479 Ga0307413_10369239 3300031824 Bacteria 1114
480 Ga0307410_10095895 3300031852 Bacteria 2116
481 Ga0307406_10007581 3300031901 Bacteria 6025
482 Ga0307406_10121124 3300031901 Bacteria 1819
483 Ga0307406_10140648 3300031901 Bacteria 1708
484 Ga0307412_10246354 3300031911 Bacteria 1385
485 Ga0307412_10335494 3300031911 Bacteria 1208
486 Ga0307412_10345613 3300031911 Bacteria 1192
487 Ga0307412_10347407 3300031911 Bacteria 1190
488 Ga0307412_10540681 3300031911 Bacteria 977
489 Ga0307416_100208100 3300032002 Bacteria 1863
490 Ga0307416_100290074 3300032002 Bacteria 1619
491 Ga0307416_100454592 3300032002 Bacteria 1334
492 Ga0307416_100509776 3300032002 Bacteria 1269
493 Ga0307414_10068509 3300032004 Bacteria 2547
494 Ga0307411_10226646 3300032005 Bacteria 1454
495 Ga0307507_10132512 3300033179 Bacteria 1944
496 Ga0307510_10029427 3300033180 Bacteria 6252
497 Ga0307510_10041455 3300033180 Bacteria 5032
498 Ga0307510_10150256 3300033180 Bacteria 1950
499 Ga0373934_0169026 3300035086 Bacteria 897
500 Ga0373931_0015954 3300035691 Bacteria 3691
501 Ga0373937_0127620 3300036401 Bacteria 2374
502 Ga0395899_0010279 3300037312 Bacteria 7174
503 Ga0395899_0135733 3300037312 Bacteria 1754
504 Ga0395899_0251091 3300037312 Bacteria 1214
505 Ga0395900_0000058 3300037418 Bacteria 206785
506 Ga0395900_0138988 3300037418 Bacteria 2488
507 Ga0395900_0380144 3300037418 Bacteria 1380
508 Ga0395900_0775401 3300037418 Bacteria 888
509 Ga0395898_0000283 3300037466 Bacteria 122630
510 Ga0395898_0025536 3300037466 Bacteria 5951
511 Ga0395898_0365130 3300037466 Bacteria 1377
512 Ga0395898_0755809 3300037466 Bacteria 913
513 Ga0395905_0000212 3300037471 Bacteria 89838
514 Ga0395905_0000672 3300037471 Bacteria 45490
515 Ga0395905_0001350 3300037471 Bacteria 29884
516 Ga0395905_0035342 3300037471 Bacteria 4692
517 Ga0395905_0036695 3300037471 Bacteria 4604
518 Ga0395905_0051508 3300037471 Bacteria 3856
519 Ga0395905_0078432 3300037471 Bacteria 3095
520 Ga0395905_0081944 3300037471 Bacteria 3023
521 Ga0395905_0131971 3300037471 Bacteria 2349
522 Ga0395905_0153417 3300037471 Bacteria 2166
523 Ga0395905_0188487 3300037471 Bacteria 1935
524 Ga0395905_0190268 3300037471 Bacteria 1925
525 Ga0395905_0214672 3300037471 Bacteria 1802
526 Ga0395905_0219376 3300037471 Bacteria 1780
527 Ga0395905_0369071 3300037471 Bacteria 1328
528 Ga0395905_0676674 3300037471 Bacteria 934
529 Ga0395905_0789584 3300037471 Bacteria 852
530 Ga0395901_0003173 3300038443 Bacteria 16538
531 Ga0395901_0037127 3300038443 Bacteria 5039
532 Ga0395901_0059598 3300038443 Bacteria 3971
533 Ga0395901_0080774 3300038443 Bacteria 3395
534 Ga0395901_0276095 3300038443 Bacteria 1747
535 Ga0395901_0449369 3300038443 Bacteria 1318
536 Ga0395901_0558458 3300038443 Bacteria 1159
537 Ga0242420_010152 3300038996 Bacteria 1559
538 Ga0436361_0144777 3300039447 Bacteria 2492
539 Ga0436361_0793297 3300039447 Bacteria 22989
540 Ga0436361_1206467 3300039447 Bacteria 80244
541 Ga0439436_0045552 3300041404 Bacteria 1248
542 Ga0439438_051623 3300041405 Bacteria 1044
543 Ga0439438_057224 3300041405 Bacteria 981
544 Ga0451787_558123 3300041441 Bacteria 1436
545 Ga0451797_0055608 3300041453 Bacteria 1105
546 Ga0451798_0677714 3300041458 Bacteria 2400
547 Ga0451800_0260100 3300041459 Bacteria 2393
548 Ga0451800_0550407 3300041459 Bacteria 989
549 Ga0451802_0380592 3300041460 Bacteria 1270
550 Ga0451802_1761845 3300041460 Bacteria 2765
551 Ga0451804_0372939 3300041463 Bacteria 770
552 Ga0451804_0450657 3300041463 Bacteria 2037
553 Ga0451804_1107278 3300041463 Bacteria 794
554 Ga0451807_0033591 3300041486 Bacteria 1054
555 Ga0451807_0378624 3300041486 Bacteria 2224
556 Ga0451807_0511307 3300041486 Bacteria 1698
557 Ga0451833_0440785 3300041491 Bacteria 737
558 Ga0451837_0311690 3300041494 Bacteria 836
559 Ga0451845_0484302 3300041501 Bacteria 1134
560 Ga0451847_0563971 3300041503 Bacteria 869
561 Ga0451851_0371223 3300041507 Bacteria 862
562 Ga0451853_2273887 3300041512 Bacteria 2106
563 Ga0439433_0010034 3300041999 Bacteria 2067
564 Ga0439433_0059453 3300041999 Bacteria 910
565 Ga0439442_017630 3300042002 Bacteria 1474
566 Ga0439449_0011120 3300042007 Bacteria 3392
567 Ga0439449_0014829 3300042007 Bacteria 2929
568 Ga0439455_0036044 3300042012 Bacteria 1250
569 Ga0439462_0027913 3300042015 Bacteria 1491
570 Ga0450919_000087 3300042121 Bacteria 9017
571 Ga0450920_047060 3300042122 Bacteria 862
572 Ga0450923_021693 3300042125 Bacteria 1254
573 Ga0450890_004502 3300042127 Bacteria 1820
574 Ga0450898_006055 3300042134 Bacteria 1846
575 Ga0450898_007978 3300042134 Bacteria 1660
576 Ga0450906_015933 3300042145 Bacteria 1363
577 Ga0439446_0019867 3300042156 Bacteria 1889
578 Ga0439444_0060284 3300042437 Bacteria 791
579 Ga0439459_0001722 3300042438 Bacteria 3270
580 Ga0439464_0001997 3300042439 Bacteria 4945
581 Ga0439464_0028968 3300042439 Bacteria 1545
582 Ga0450918_000012 3300042531 Bacteria 36451
583 Ga0450893_0007476 3300042532 Bacteria 1775
584 Ga0450893_0011256 3300042532 Bacteria 1477
585 Ga0451577_0000166 3300042876 Bacteria 145166
586 Ga0451577_0000697 3300042876 Bacteria 52454
587 Ga0451577_0011783 3300042876 Bacteria 8252
588 Ga0451577_0098069 3300042876 Bacteria 2617
589 Ga0451577_0421926 3300042876 Bacteria 1211
590 Ga0451577_0512282 3300042876 Bacteria 1089
591 Ga0451577_0706583 3300042876 Bacteria 913
592 Ga0451577_0779031 3300042876 Bacteria 864
593 Ga0466969_0017099 3300044656 Bacteria 3790
594 Ga0466969_0038862 3300044656 Bacteria 2392
595 Ga0466969_0058084 3300044656 Bacteria 1884
596 Ga0453683_0014521 3300044673 Bacteria 5110
597 Ga0466965_0003310 3300044683 Bacteria 7053
598 Ga0466965_0229814 3300044683 Bacteria 990
599 Ga0466966_0009059 3300044684 Bacteria 6593
600 Ga0466966_0018660 3300044684 Bacteria 4571
601 Ga0466966_0054691 3300044684 Bacteria 2528
602 Ga0466961_0025989 3300044693 Bacteria 3763
603 Ga0466961_0028342 3300044693 Bacteria 3600
604 Ga0466961_0152181 3300044693 Bacteria 1444
605 Ga0466961_0188658 3300044693 Bacteria 1278
606 Ga0466963_0182023 3300044694 Bacteria 1467
607 Ga0466963_0550571 3300044694 Bacteria 815
608 Ga0466964_0004084 3300044706 Bacteria 5371
609 Ga0453684_0000187 3300044712 Bacteria 272378
610 Ga0453684_0006584 3300044712 Bacteria 21971
611 Ga0453684_0150188 3300044712 Bacteria 2770
612 Ga0453684_0347160 3300044712 Bacteria 1674
613 Ga0453684_0427163 3300044712 Bacteria 1479
614 Ga0453684_0504607 3300044712 Bacteria 1339
615 Ga0453684_0795806 3300044712 Bacteria 1020
616 Ga0453684_0804517 3300044712 Bacteria 1013
617 Ga0453684_0965221 3300044712 Bacteria 909
618 Ga0453684_1041258 3300044712 Bacteria 868
619 Ga0466971_0004547 3300044719 Bacteria 6000
620 Ga0466968_0034015 3300044735 Bacteria 2125
621 Ga0466970_0030835 3300044765 Bacteria 2829
622 Ga0466970_0037204 3300044765 Bacteria 2579
623 Ga0466957_0073116 3300044842 Bacteria 2124
624 Ga0466957_0125583 3300044842 Bacteria 1639
625 Ga0466957_0483597 3300044842 Bacteria 856
626 Ga0466960_0020598 3300044901 Bacteria 2923
627 Ga0466960_0044930 3300044901 Bacteria 2108
628 Ga0466959_0011390 3300045049 Bacteria 6388
629 Ga0466959_0026708 3300045049 Bacteria 4280
630 Ga0466959_0130992 3300045049 Bacteria 1777
631 Ga0466959_0141375 3300045049 Bacteria 1701
632 Ga0451576_0011722 3300045051 Bacteria 9930
633 Ga0451576_0218089 3300045051 Bacteria 1992
634 Ga0451576_0499886 3300045051 Bacteria 1277
635 Ga0466958_0007306 3300045836 Bacteria 6067
636 Ga0466958_0147366 3300045836 Bacteria 1484
637 Ga0466958_0588797 3300045836 Bacteria 723
638 Ga0466967_0299334 3300045976 Bacteria 1547
639 Ga0466967_0656883 3300045976 Bacteria 1037
640 Ga0466967_1411330 3300045976 Bacteria 693
641 Ga0495592_0000153 3300046454 Bacteria 60062
642 Ga0495638_0053127 3300046460 Bacteria 2522
643 Ga0495638_0069218 3300046460 Bacteria 2163
644 Ga0495650_0028496 3300046471 Bacteria 2562
645 Ga0495650_0030946 3300046471 Bacteria 2416
646 Ga0495639_0018532 3300046475 Bacteria 3032
647 Ga0495639_0046029 3300046475 Bacteria 1974
648 Ga0495585_0025055 3300046492 Bacteria 3419
649 Ga0495583_0000046 3300046506 Bacteria 218059
650 Ga0495606_0017068 3300046507 Bacteria 5505
651 Ga0495606_0167199 3300046507 Bacteria 1279
652 Ga0495620_0048512 3300046515 Bacteria 1822
653 Ga0495620_0113570 3300046515 Bacteria 1072
654 Ga0495628_0743506 3300046516 Bacteria 690
655 Ga0495632_0008733 3300046519 Bacteria 6178
656 Ga0495632_0009624 3300046519 Bacteria 5804
657 Ga0495643_0074601 3300046522 Bacteria 1776
658 Ga0495643_0083424 3300046522 Bacteria 1659
659 Ga0495648_0125340 3300046524 Bacteria 1374
660 Ga0495642_0043618 3300046528 Bacteria 1829
661 Ga0495642_0046766 3300046528 Bacteria 1770
662 Ga0495656_0004207 3300046615 Bacteria 4914
663 Ga0495656_0043700 3300046615 Bacteria 1883
664 Ga0495656_0059450 3300046615 Bacteria 1663
665 Ga0495625_0002511 3300046660 Bacteria 19764
666 Ga0495625_0107219 3300046660 Bacteria 1912
667 Ga0495625_0136444 3300046660 Bacteria 1658
668 Ga0495588_0072015 3300046674 Bacteria 1798
669 Ga0495599_0202936 3300046678 Bacteria 1218
670 Ga0495669_0007695 3300046684 Bacteria 4522
671 Ga0495670_0047547 3300046691 Bacteria 2145
672 Ga0495649_0000548 3300046694 Bacteria 31877
673 Ga0495589_0007530 3300046794 Bacteria 5704
674 Ga0495660_0029299 3300046810 Bacteria 3107
675 Ga0495581_0056860 3300047315 Bacteria 2258
676 Ga0495636_0058997 3300047318 Bacteria 1619
677 Ga0495673_0160256 3300047469 Bacteria 864
678 Ga0496100_0015801 3300048903 Bacteria 4415
679 Ga0496102_0006927 3300048905 Bacteria 9670
680 Ga0496102_0007775 3300048905 Bacteria 9163
681 Ga0496102_0350529 3300048905 Bacteria 1390
682 Ga0496104_0003316 3300048907 Bacteria 13888
683 Ga0496104_0303203 3300048907 Bacteria 1510
684 Ga0496104_0332905 3300048907 Bacteria 1431
685 Ga0496105_0033011 3300048908 Bacteria 4249
686 Ga0496105_0139762 3300048908 Bacteria 1994
687 Ga0496106_0120152 3300048909 Bacteria 2053
688 Ga0496107_0243422 3300048910 Bacteria 1338
689 Ga0496108_0120778 3300048911 Bacteria 2247
690 Ga0496108_0340009 3300048911 Bacteria 1309
691 Ga0496109_0060340 3300048912 Bacteria 3466
692 Ga0496109_1103316 3300048912 Bacteria 730
693 Ga0496110_0081564 3300048913 Bacteria 2883
694 Ga0496110_0219634 3300048913 Bacteria 1728
695 Ga0496110_0688911 3300048913 Bacteria 923
696 Ga0496110_1008096 3300048913 Bacteria 740
697 Ga0496111_0354222 3300048914 Bacteria 1086
698 Ga0496112_0011790 3300048915 Bacteria 8002
699 Ga0496113_0016666 3300048916 Bacteria 5080
700 Ga0496114_0004146 3300048917 Bacteria 11214
701 Ga0496122_0003759 3300048925 Bacteria 19568
702 Ga0496123_0097421 3300048926 Bacteria 1723
703 Ga0496124_0124076 3300048927 Bacteria 2060
704 Ga0496124_0125855 3300048927 Bacteria 2042
705 Ga0496124_0153862 3300048927 Bacteria 1801
706 Ga0496125_0003024 3300048928 Bacteria 21033
707 Ga0496125_0136353 3300048928 Bacteria 1716
708 Ga0496126_0094457 3300048929 Bacteria 2624
709 Ga0501292_003271 3300049515 Bacteria 2158
710 Ga0501313_025191 3300049529 Bacteria 752
711 Ga0501320_031279 3300049536 Bacteria 663
712 Ga0501032_0092027 3300049569 Bacteria 2012
713 Ga0501034_0215211 3300049571 Bacteria 1875
714 Ga0501034_0539668 3300049571 Bacteria 1076
715 Ga0501038_0197511 3300049574 Bacteria 1616
716 Ga0501042_0377135 3300049578 Bacteria 1027
717 Ga0501043_0175748 3300049579 Bacteria 1669
718 Ga0501046_0032960 3300049580 Bacteria 4191
719 Ga0501047_0060409 3300049581 Bacteria 3658
720 Ga0501071_0523602 3300049587 Bacteria 910
721 Ga0501073_0133203 3300049589 Bacteria 1723
722 Ga0501199_002565 3300049650 Bacteria 1705
723 Ga0501223_031134 3300049663 Bacteria 1037
724 Ga0501257_026227 3300049686 Bacteria 1390
725 Ga0501257_070510 3300049686 Bacteria 893
726 Ga0501080_0085913 3300049742 Bacteria 2923
727 Ga0501265_001527 3300049762 Bacteria 2605
728 Ga0501266_000273 3300049763 Bacteria 6788
729 Ga0501279_040283 3300049775 Bacteria 715
730 Ga0501280_007909 3300049776 Bacteria 1485
731 Ga0501035_0154779 3300049822 Bacteria 1987
732 nmdc:mga03683_126512_c1 3300050489 Bacteria 1140
733 nmdc:mga03683_158783_c1 3300050489 Bacteria 1023
734 nmdc:mga03683_34515_c1 3300050489 Bacteria 2047
735 nmdc:mga03683_70266_c1 3300050489 Bacteria 1496
736 nmdc:mga03683_75353_c1 3300050489 Bacteria 1449
737 nmdc:mga03n38_115787_c1 3300050490 Bacteria 1311
738 nmdc:mga03n38_83260_c1 3300050490 Bacteria 1508
739 nmdc:mga00v17_147229_c1 3300050491 Bacteria 1512
740 nmdc:mga0yw44_192448_c1 3300050492 Bacteria 1346
741 nmdc:mga0yw44_604602_c1 3300050492 Bacteria 745
742 nmdc:mga0k408_130854_c1 3300050493 Bacteria 1490
743 nmdc:mga0k408_148640_c1 3300050493 Bacteria 1395
744 nmdc:mga0k408_175268_c1 3300050493 Bacteria 1278
745 nmdc:mga0k408_186897_c1 3300050493 Bacteria 1236
746 nmdc:mga0k408_189563_c1 3300050493 Bacteria 1227
747 nmdc:mga0k408_189842_c1 3300050493 Bacteria 1226
748 nmdc:mga0k408_267989_c1 3300050493 Bacteria 1020
749 nmdc:mga0k408_474819_c1 3300050493 Bacteria 742
750 nmdc:mga0k408_51943_c1 3300050493 Bacteria 2375
751 nmdc:mga0k408_55538_c1 3300050493 Bacteria 2296
752 nmdc:mga0k408_58092_c1 3300050493 Bacteria 2247
753 nmdc:mga0k408_642_c1 3300050493 Bacteria 19227
754 nmdc:mga0k408_87958_c1 3300050493 Bacteria 1825
755 nmdc:mga06z11_206669_c1 3300050494 Bacteria 1142
756 nmdc:mga06z11_67145_c1 3300050494 Bacteria 1887
757 nmdc:mga07m45_14447_c1 3300050496 Bacteria 4205
758 nmdc:mga07m45_2243_c2 3300050496 Bacteria 8377
759 nmdc:mga07m45_271171_c1 3300050496 Bacteria 987
760 nmdc:mga07m45_2723_c1 3300050496 Bacteria 8330
761 nmdc:mga07m45_61642_c1 3300050496 Bacteria 2125
762 nmdc:mga07m45_6665_c1 3300050496 Bacteria 5856
763 nmdc:mga05p37_389871_c1 3300050507 Bacteria 1629
764 nmdc:mga0qj67_241261_c1 3300050509 Bacteria 1466
765 nmdc:mga0sz30_13115_c2 3300050516 Bacteria 2488
766 nmdc:mga0sz30_248349_c1 3300050516 Bacteria 792
767 Ga0500635_0000113 3300053080 Bacteria 49202
768 Ga0495619_0848922 3300053085 Bacteria 616
769 Ga0500578_0000079 3300053086 Bacteria 107137
770 Ga0500643_058178 3300053087 Bacteria 1090
771 Ga0500644_0011166 3300053088 Bacteria 2449
772 Ga0500644_0023838 3300053088 Bacteria 1863
773 Ga0500644_0026762 3300053088 Bacteria 1787
774 Ga0500644_0033629 3300053088 Bacteria 1647
775 Ga0500644_0143738 3300053088 Bacteria 950
776 Ga0500646_0020684 3300053090 Bacteria 1749
777 Ga0500583_0114963 3300053092 Bacteria 1328
778 Ga0500583_0161084 3300053092 Bacteria 1117
779 Ga0500651_0045939 3300053093 Bacteria 2746
780 Ga0500651_0059147 3300053093 Bacteria 2396
781 Ga0500566_0094384 3300053094 Bacteria 1649
782 Ga0500641_0042497 3300053096 Bacteria 1842
783 Ga0500562_044402 3300053108 Bacteria 1183
784 Ga0500569_006494 3300053109 Bacteria 2571
785 Ga0500593_004453 3300053117 Bacteria 5424
786 Ga0500593_005843 3300053117 Bacteria 4885
787 Ga0500594_0005906 3300053118 Bacteria 2728
788 Ga0500608_066183 3300053122 Bacteria 1723
789 Ga0500642_0040098 3300053130 Bacteria 2017
790 Ga0500642_0082410 3300053130 Bacteria 1479
791 Ga0500652_000857 3300053131 Bacteria 10055
792 Ga0500655_007327 3300053133 Bacteria 1985
793 Ga0500655_019792 3300053133 Bacteria 1255
794 Ga0500559_0000494 3300053136 Bacteria 27657
795 Ga0500559_0008544 3300053136 Bacteria 4481
796 Ga0500561_0030841 3300053137 Bacteria 1350
797 Ga0500568_0010029 3300053139 Bacteria 4465
798 Ga0500568_0055429 3300053139 Bacteria 1547
799 Ga0500577_0064048 3300053142 Bacteria 1423
800 Ga0500604_0026411 3300053151 Bacteria 1674
801 Ga0500604_0026847 3300053151 Bacteria 1663
802 Ga0500604_0098325 3300053151 Bacteria 962
803 Ga0500620_119950 3300053155 Bacteria 922
804 Ga0500622_0000053 3300053156 Bacteria 145070
805 Ga0500622_0007498 3300053156 Bacteria 6192
806 Ga0500622_0035639 3300053156 Bacteria 2603
807 Ga0500622_0049996 3300053156 Bacteria 2154
808 Ga0500634_0112788 3300053161 Bacteria 1338
809 Ga0500636_0025438 3300053177 Bacteria 3498
810 Ga0500637_0105294 3300053178 Bacteria 1636
811 Ga0500570_095197 3300053724 Bacteria 1278
812 Ga0500570_151845 3300053724 Bacteria 822
813 Ga0500587_003978 3300053739 Bacteria 2043
814 Ga0500587_007084 3300053739 Bacteria 1469
815 Ga0500661_001399 3300055283 Bacteria 4505
816 Ga0500661_030667 3300055283 Bacteria 949
817 Ga0466962_0005278 3300061719 Bacteria 6207
818 Ga0466962_0081674 3300061719 Bacteria 1546

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045836 Ga0466958_0588797 Ga0466958_0588797_13_519 162
2 3300031616 Ga0307508_10391419 Ga0307508_103914193 171
3 3300006038 Ga0075365_10166779 Ga0075365_101667793 172
4 3300006177 Ga0075362_10090415 Ga0075362_100904152 172
5 3300006195 Ga0075366_10180326 Ga0075366_101803263 172
6 3300005563 Ga0068855_100306943 Ga0068855_1003069433 174
7 3300025949 Ga0207667_10133371 Ga0207667_101333713 174
8 3300037471 Ga0395905_0131971 Ga0395905_0131971_1140_1682 175
9 3300044694 Ga0466963_0182023 Ga0466963_0182023_485_1045 175
10 3300044842 Ga0466957_0125583 Ga0466957_0125583_651_1211 175
11 3300045976 Ga0466967_0299334 Ga0466967_0299334_554_1114 175
12 3300045976 Ga0466967_1411330 Ga0466967_1411330_122_679 175
13 3300048912 Ga0496109_1103316 Ga0496109_1103316_10_555 176
14 3300003752 Ga0055539_1000651 Ga0055539_10006512 177
15 3300003756 Ga0055533_1000033 Ga0055533_1000033149 177
16 3300003759 Ga0055525_1000767 Ga0055525_10007677 177
17 3300025226 Ga0209674_100064 Ga0209674_100064100 177
18 3300025230 Ga0209563_100099 Ga0209563_100099100 177
19 3300025253 Ga0209677_100175 Ga0209677_10017537 177
20 3300044901 Ga0466960_0044930 Ga0466960_0044930_222_815 177
21 3300025945 Ga0207679_10691594 Ga0207679_106915942 178
22 3300037312 Ga0395899_0135733 Ga0395899_0135733_1181_1744 178
23 3300037418 Ga0395900_0380144 Ga0395900_0380144_135_695 179
24 3300037471 Ga0395905_0081944 Ga0395905_0081944_1905_2465 179
25 3300041463 Ga0451804_0372939 Ga0451804_0372939_202_750 179
26 3300042876 Ga0451577_0421926 Ga0451577_0421926_440_988 179
27 3300044712 Ga0453684_0965221 Ga0453684_0965221_180_728 179
28 3300050492 nmdc:mga0yw44_604602_c1 nmdc:mga0yw44_604602_c1_166_723 179
29 3300003316 rootH1_10029887 rootH1_100298873 180
30 3300003322 rootL2_10051303 rootL2_100513032 180
31 3300003323 rootH1_10049916 rootH1_100499163 180
32 3300005564 Ga0070664_100476314 Ga0070664_1004763142 180
33 3300021361 Ga0213872_10000132 Ga0213872_1000013228 180
34 3300039447 Ga0436361_1206467 Ga0436361_1206467_36222_36806 180
35 3300044842 Ga0466957_0073116 Ga0466957_0073116_538_1098 180
36 3300005339 Ga0070660_100178681 Ga0070660_1001786813 181
37 3300005344 Ga0070661_100007719 Ga0070661_10000771910 181
38 3300005366 Ga0070659_100001726 Ga0070659_1000017269 181
39 3300009093 Ga0105240_10314240 Ga0105240_103142402 181
40 3300013105 Ga0157369_10817373 Ga0157369_108173732 181
41 3300025231 Ga0207427_101039 Ga0207427_10103910 181
42 3300025913 Ga0207695_10196087 Ga0207695_101960873 181
43 3300025919 Ga0207657_10216323 Ga0207657_102163233 181
44 3300031548 Ga0307408_100962614 Ga0307408_1009626142 181
45 3300031911 Ga0307412_10540681 Ga0307412_105406811 181
46 3300037418 Ga0395900_0000058 Ga0395900_0000058_163482_164069 181
47 3300037466 Ga0395898_0000283 Ga0395898_0000283_111874_112461 181
48 3300037466 Ga0395898_0365130 Ga0395898_0365130_175_786 181
49 3300037471 Ga0395905_0188487 Ga0395905_0188487_845_1456 181
50 3300038443 Ga0395901_0558458 Ga0395901_0558458_418_1029 181
51 3300049581 Ga0501047_0060409 Ga0501047_0060409_3084_3647 181
52 3300006186 Ga0075369_10024698 Ga0075369_100246981 182
53 3300006844 Ga0075428_100408943 Ga0075428_1004089433 182
54 3300006846 Ga0075430_100342555 Ga0075430_1003425552 182
55 3300006880 Ga0075429_100428302 Ga0075429_1004283023 182
56 3300025250 Ga0209026_1035999 Ga0209026_10359992 182
57 3300030521 Ga0307511_10000144 Ga0307511_100001443 182
58 3300038443 Ga0395901_0449369 Ga0395901_0449369_16_582 182
59 3300050509 nmdc:mga0qj67_241261_c1 nmdc:mga0qj67_241261_c1_553_1119 182
60 3300050516 nmdc:mga0sz30_13115_c2 nmdc:mga0sz30_13115_c2_1852_2439 182
61 3300053092 Ga0500583_0161084 Ga0500583_0161084_267_854 182
62 3300053133 Ga0500655_019792 Ga0500655_019792_576_1163 182
63 3300053151 Ga0500604_0098325 Ga0500604_0098325_212_799 182
64 3300053155 Ga0500620_119950 Ga0500620_119950_238_804 182
65 3300005354 Ga0070675_100358761 Ga0070675_1003587612 183
66 3300005355 Ga0070671_100728386 Ga0070671_1007283861 183
67 3300005364 Ga0070673_100159226 Ga0070673_1001592262 183
68 3300025273 Ga0209673_1028406 Ga0209673_10284063 183
69 3300025937 Ga0207669_10457492 Ga0207669_104574923 183
70 3300031250 Ga0265331_10008263 Ga0265331_100082634 183
71 3300031251 Ga0265327_10000042 Ga0265327_10000042264 183
72 3300031852 Ga0307410_10095895 Ga0307410_100958953 183
73 3300031911 Ga0307412_10335494 Ga0307412_103354943 183
74 3300031911 Ga0307412_10347407 Ga0307412_103474072 183
75 3300038443 Ga0395901_0276095 Ga0395901_0276095_57_626 183
76 3300038996 Ga0242420_010152 Ga0242420_010152_509_1066 183
77 3300049686 Ga0501257_026227 Ga0501257_026227_15_575 183
78 3300049775 Ga0501279_040283 Ga0501279_040283_100_675 183
79 3300005288 Ga0065714_10150799 Ga0065714_101507991 184
80 3300005458 Ga0070681_10374680 Ga0070681_103746803 184
81 3300005530 Ga0070679_100230208 Ga0070679_1002302083 184
82 3300006195 Ga0075366_10066159 Ga0075366_100661592 184
83 3300025921 Ga0207652_10057081 Ga0207652_100570813 184
84 3300025935 Ga0207709_10175770 Ga0207709_101757703 184
85 3300031238 Ga0265332_10000027 Ga0265332_1000002710 184
86 3300035086 Ga0373934_0169026 Ga0373934_0169026_121_750 184
87 3300041405 Ga0439438_057224 Ga0439438_057224_42_605 184
88 3300044694 Ga0466963_0550571 Ga0466963_0550571_33_605 184
89 3300050493 nmdc:mga0k408_55538_c1 nmdc:mga0k408_55538_c1_1152_1745 184
90 3300053080 Ga0500635_0000113 Ga0500635_0000113_34122_34751 184
91 iso_pu_bacteria 2886848708 2886849888 184
92 3300002705 JGI25156J39149_1020981 JGI25156J39149_10209812 185
93 3300005334 Ga0068869_100462883 Ga0068869_1004628832 185
94 3300006195 Ga0075366_10092421 Ga0075366_100924213 185
95 3300009177 Ga0105248_10007163 Ga0105248_100071639 185
96 3300025256 Ga0209759_1002013 Ga0209759_10020136 185
97 3300025932 Ga0207690_10157275 Ga0207690_101572753 185
98 3300026142 Ga0207698_10223884 Ga0207698_102238843 185
99 3300042876 Ga0451577_0779031 Ga0451577_0779031_196_792 185
100 3300044712 Ga0453684_0504607 Ga0453684_0504607_105_710 185
101 3300044712 Ga0453684_0804517 Ga0453684_0804517_329_904 185
102 3300045051 Ga0451576_0218089 Ga0451576_0218089_1292_1888 185
103 3300046615 Ga0495656_0043700 Ga0495656_0043700_685_1263 185
104 3300048905 Ga0496102_0350529 Ga0496102_0350529_358_936 185
105 3300048917 Ga0496114_0004146 Ga0496114_0004146_369_935 185
106 3300048928 Ga0496125_0136353 Ga0496125_0136353_1123_1701 185
107 3300049587 Ga0501071_0523602 Ga0501071_0523602_304_870 185
108 3300050489 nmdc:mga03683_126512_c1 nmdc:mga03683_126512_c1_245_841 185
109 3300050493 nmdc:mga0k408_51943_c1 nmdc:mga0k408_51943_c1_500_1132 185
110 3300050494 nmdc:mga06z11_206669_c1 nmdc:mga06z11_206669_c1_77_673 185
111 iso_pu_bacteria 2881101125 2881102612 185
112 3300003322 rootL2_10000579 rootL2_1000057919 186
113 3300003323 rootH1_10016701 rootH1_100167013 186
114 3300003771 Ga0055526_1007400 Ga0055526_10074004 186
115 3300003775 Ga0055524_1005494 Ga0055524_10054947 186
116 3300003794 Ga0055531_10021663 Ga0055531_100216633 186
117 3300004625 Ga0055543_1001806 Ga0055543_100180610 186
118 3300005262 Ga0065165_1000016 Ga0065165_1000016161 186
119 3300005339 Ga0070660_100096947 Ga0070660_1000969472 186
120 3300006942 Ga0099824_1030030 Ga0099824_10300302 186
121 3300006944 Ga0099823_1000101 Ga0099823_100010110 186
122 3300025295 Ga0209564_1000008 Ga0209564_1000008382 186
123 3300025298 Ga0209050_1010700 Ga0209050_10107003 186
124 3300025299 Ga0209256_1008383 Ga0209256_10083833 186
125 3300025303 Ga0209051_1002891 Ga0209051_10028914 186
126 3300025304 Ga0209257_1003886 Ga0209257_10038864 186
127 3300025909 Ga0207705_10119401 Ga0207705_101194013 186
128 3300027296 Ga0209389_1001650 Ga0209389_10016506 186
129 3300048927 Ga0496124_0125855 Ga0496124_0125855_783_1391 186
130 3300050496 nmdc:mga07m45_61642_c1 nmdc:mga07m45_61642_c1_847_1416 186
131 3300053085 Ga0495619_0848922 Ga0495619_0848922_29_598 186
132 3300005445 Ga0070708_100110016 Ga0070708_1001100162 187
133 3300005539 Ga0068853_100852996 Ga0068853_1008529961 187
134 3300006195 Ga0075366_10454251 Ga0075366_104542512 187
135 3300009147 Ga0114129_10478674 Ga0114129_104786743 187
136 3300021361 Ga0213872_10000068 Ga0213872_1000006838 187
137 3300021361 Ga0213872_10023786 Ga0213872_100237864 187
138 3300026041 Ga0207639_10427923 Ga0207639_104279233 187
139 3300039447 Ga0436361_0144777 Ga0436361_0144777_866_1480 187
140 3300039447 Ga0436361_0793297 Ga0436361_0793297_21516_22130 187
141 3300041999 Ga0439433_0059453 Ga0439433_0059453_118_705 187
142 3300042007 Ga0439449_0011120 Ga0439449_0011120_2771_3364 187
143 3300042015 Ga0439462_0027913 Ga0439462_0027913_432_1019 187
144 3300042145 Ga0450906_015933 Ga0450906_015933_29_622 187
145 3300042439 Ga0439464_0001997 Ga0439464_0001997_1338_1934 187
146 3300046691 Ga0495670_0047547 Ga0495670_0047547_722_1348 187
147 3300049578 Ga0501042_0377135 Ga0501042_0377135_298_882 187
148 3300050507 nmdc:mga05p37_389871_c1 nmdc:mga05p37_389871_c1_589_1158 187
149 3300053156 Ga0500622_0035639 Ga0500622_0035639_606_1232 187
150 3300053178 Ga0500637_0105294 Ga0500637_0105294_753_1355 187
151 iso_pu_bacteria 2585428057 2587728036 187
152 iso_pu_bacteria 2585428058 2587731100 187
153 iso_pu_bacteria 2585428062 2587754147 187
154 iso_pu_bacteria 2588253510 2588289852 187
155 iso_pu_bacteria 2643221592 2643972349 187
156 iso_pu_bacteria 2643221625 2644141540 187
157 iso_pu_bacteria 2643221648 2644275689 187
158 3300003316 rootH1_10029888 rootH1_100298883 188
159 3300003775 Ga0055524_1000733 Ga0055524_100073320 188
160 3300003792 Ga0055540_1004852 Ga0055540_10048528 188
161 3300003794 Ga0055531_10002124 Ga0055531_1000212412 188
162 3300003794 Ga0055531_10007153 Ga0055531_100071532 188
163 3300006195 Ga0075366_10039564 Ga0075366_100395643 188
164 3300006353 Ga0075370_10000954 Ga0075370_1000095410 188
165 3300012475 Ga0157317_1000388 Ga0157317_10003883 188
166 3300012497 Ga0157319_1000015 Ga0157319_1000015117 188
167 3300013307 Ga0157372_11019184 Ga0157372_110191843 188
168 3300025273 Ga0209673_1022830 Ga0209673_10228303 188
169 3300025299 Ga0209256_1005979 Ga0209256_10059793 188
170 3300025303 Ga0209051_1000456 Ga0209051_100045633 188
171 3300025304 Ga0209257_1000015 Ga0209257_1000015807 188
172 3300025304 Ga0209257_1002253 Ga0209257_10022533 188
173 3300025909 Ga0207705_10364619 Ga0207705_103646192 188
174 3300027312 Ga0209371_1005027 Ga0209371_10050273 188
175 3300030500 Ga0268256_1004264 Ga0268256_10042647 188
176 3300031548 Ga0307408_100038396 Ga0307408_1000383965 188
177 3300031711 Ga0265314_10179414 Ga0265314_101794143 188
178 3300031730 Ga0307516_10306335 Ga0307516_103063351 188
179 3300031911 Ga0307412_10345613 Ga0307412_103456132 188
180 3300032002 Ga0307416_100290074 Ga0307416_1002900743 188
181 3300035691 Ga0373931_0015954 Ga0373931_0015954_2451_3044 188
182 3300037471 Ga0395905_0676674 Ga0395905_0676674_50_631 188
183 3300041494 Ga0451837_0311690 Ga0451837_0311690_123_719 188
184 3300041999 Ga0439433_0010034 Ga0439433_0010034_1107_1694 188
185 3300042007 Ga0439449_0014829 Ga0439449_0014829_1848_2435 188
186 3300042127 Ga0450890_004502 Ga0450890_004502_764_1384 188
187 3300042134 Ga0450898_006055 Ga0450898_006055_1081_1668 188
188 3300042438 Ga0439459_0001722 Ga0439459_0001722_1831_2451 188
189 3300042532 Ga0450893_0007476 Ga0450893_0007476_649_1251 188
190 3300042532 Ga0450893_0011256 Ga0450893_0011256_225_815 188
191 3300044656 Ga0466969_0058084 Ga0466969_0058084_1018_1599 188
192 3300044673 Ga0453683_0014521 Ga0453683_0014521_1031_1621 188
193 3300044693 Ga0466961_0152181 Ga0466961_0152181_719_1300 188
194 3300044842 Ga0466957_0483597 Ga0466957_0483597_16_597 188
195 3300045049 Ga0466959_0141375 Ga0466959_0141375_290_871 188
196 3300045051 Ga0451576_0011722 Ga0451576_0011722_358_948 188
197 3300045836 Ga0466958_0147366 Ga0466958_0147366_315_896 188
198 3300046528 Ga0495642_0043618 Ga0495642_0043618_525_1121 188
199 3300046615 Ga0495656_0004207 Ga0495656_0004207_2734_3330 188
200 3300046674 Ga0495588_0072015 Ga0495588_0072015_266_862 188
201 3300047318 Ga0495636_0058997 Ga0495636_0058997_493_1089 188
202 3300049529 Ga0501313_025191 Ga0501313_025191_130_732 188
203 3300049686 Ga0501257_070510 Ga0501257_070510_117_701 188
204 3300050493 nmdc:mga0k408_267989_c1 nmdc:mga0k408_267989_c1_158_778 188
205 3300061719 Ga0466962_0081674 Ga0466962_0081674_920_1501 188
206 3300005262 Ga0065165_1000295 Ga0065165_100029524 189
207 3300005327 Ga0070658_10055164 Ga0070658_100551642 189
208 3300031238 Ga0265332_10003699 Ga0265332_100036993 189
209 3300031344 Ga0265316_10325976 Ga0265316_103259763 189
210 3300031711 Ga0265314_10004418 Ga0265314_100044184 189
211 3300037312 Ga0395899_0010279 Ga0395899_0010279_2531_3121 189
212 3300037312 Ga0395899_0251091 Ga0395899_0251091_235_828 189
213 3300037418 Ga0395900_0775401 Ga0395900_0775401_49_642 189
214 3300037471 Ga0395905_0000212 Ga0395905_0000212_87765_88358 189
215 3300037471 Ga0395905_0000672 Ga0395905_0000672_44204_44797 189
216 3300037471 Ga0395905_0051508 Ga0395905_0051508_1071_1661 189
217 3300037471 Ga0395905_0078432 Ga0395905_0078432_1588_2178 189
218 3300037471 Ga0395905_0219376 Ga0395905_0219376_861_1448 189
219 3300037471 Ga0395905_0369071 Ga0395905_0369071_367_960 189
220 3300038443 Ga0395901_0080774 Ga0395901_0080774_1373_1963 189
221 3300041463 Ga0451804_1107278 Ga0451804_1107278_32_655 189
222 3300042439 Ga0439464_0028968 Ga0439464_0028968_295_885 189
223 3300045051 Ga0451576_0499886 Ga0451576_0499886_520_1125 189
224 3300049569 Ga0501032_0092027 Ga0501032_0092027_57_647 189
225 3300049571 Ga0501034_0215211 Ga0501034_0215211_590_1180 189
226 3300049574 Ga0501038_0197511 Ga0501038_0197511_591_1181 189
227 3300049579 Ga0501043_0175748 Ga0501043_0175748_739_1329 189
228 3300049580 Ga0501046_0032960 Ga0501046_0032960_2503_3093 189
229 3300049589 Ga0501073_0133203 Ga0501073_0133203_772_1362 189
230 3300049742 Ga0501080_0085913 Ga0501080_0085913_1710_2300 189
231 3300049822 Ga0501035_0154779 Ga0501035_0154779_706_1296 189
232 3300050493 nmdc:mga0k408_175268_c1 nmdc:mga0k408_175268_c1_521_1102 189
233 iso_pu_bacteria 2511231002 2511242779 189
234 3300005289 Ga0065704_10082029 Ga0065704_100820291 190
235 3300005330 Ga0070690_100045265 Ga0070690_1000452652 190
236 3300005334 Ga0068869_100006901 Ga0068869_1000069012 190
237 3300005337 Ga0070682_100304596 Ga0070682_1003045962 190
238 3300005353 Ga0070669_100239421 Ga0070669_1002394213 190
239 3300005364 Ga0070673_100650071 Ga0070673_1006500711 190
240 3300005535 Ga0070684_100369827 Ga0070684_1003698273 190
241 3300005719 Ga0068861_100324978 Ga0068861_1003249783 190
242 3300006042 Ga0075368_10048243 Ga0075368_100482432 190
243 3300006177 Ga0075362_10032080 Ga0075362_100320803 190
244 3300006946 Ga0079104_1028202 Ga0079104_10282021 190
245 3300006948 Ga0099826_10141023 Ga0099826_101410233 190
246 3300009177 Ga0105248_10214122 Ga0105248_102141223 190
247 3300009545 Ga0105237_10487407 Ga0105237_104874073 190
248 3300010375 Ga0105239_10020553 Ga0105239_100205533 190
249 3300014325 Ga0163163_11028806 Ga0163163_110288062 190
250 3300025230 Ga0209563_114383 Ga0209563_1143832 190
251 3300025242 Ga0209258_100699 Ga0209258_1006996 190
252 3300025914 Ga0207671_10318775 Ga0207671_103187753 190
253 3300025924 Ga0207694_10274909 Ga0207694_102749092 190
254 3300025934 Ga0207686_10410455 Ga0207686_104104552 190
255 3300025942 Ga0207689_10006852 Ga0207689_100068525 190
256 3300026088 Ga0207641_10245768 Ga0207641_102457683 190
257 3300026118 Ga0207675_100199947 Ga0207675_1001999473 190
258 3300028794 Ga0307515_10064108 Ga0307515_100641087 190
259 3300031730 Ga0307516_10089269 Ga0307516_100892693 190
260 3300032002 Ga0307416_100509776 Ga0307416_1005097762 190
261 3300041404 Ga0439436_0045552 Ga0439436_0045552_271_873 190
262 3300042134 Ga0450898_007978 Ga0450898_007978_781_1383 190
263 3300042156 Ga0439446_0019867 Ga0439446_0019867_596_1198 190
264 3300042437 Ga0439444_0060284 Ga0439444_0060284_95_706 190
265 3300044656 Ga0466969_0017099 Ga0466969_0017099_2366_2959 190
266 3300044683 Ga0466965_0229814 Ga0466965_0229814_27_623 190
267 3300044684 Ga0466966_0054691 Ga0466966_0054691_1101_1694 190
268 3300044693 Ga0466961_0028342 Ga0466961_0028342_2351_2944 190
269 3300044765 Ga0466970_0030835 Ga0466970_0030835_1220_1813 190
270 3300045049 Ga0466959_0130992 Ga0466959_0130992_549_1142 190
271 3300046492 Ga0495585_0025055 Ga0495585_0025055_348_947 190
272 3300046507 Ga0495606_0167199 Ga0495606_0167199_268_867 190
273 3300048925 Ga0496122_0003759 Ga0496122_0003759_18371_18964 190
274 3300048926 Ga0496123_0097421 Ga0496123_0097421_767_1357 190
275 3300048927 Ga0496124_0153862 Ga0496124_0153862_571_1164 190
276 3300048928 Ga0496125_0003024 Ga0496125_0003024_19483_20076 190
277 3300048929 Ga0496126_0094457 Ga0496126_0094457_1104_1697 190
278 3300049536 Ga0501320_031279 Ga0501320_031279_47_652 190
279 iso_pu_bacteria 2919704043 2919706348 190
280 iso_pu_bacteria 2939631187 2939635718 190
281 3300002704 JGI25155J39150_1000264 JGI25155J39150_100026417 191
282 3300002705 JGI25156J39149_1000010 JGI25156J39149_1000010120 191
283 3300002738 JGI25154J39366_1000027 JGI25154J39366_1000027120 191
284 3300002741 JGI25157J39369_1000146 JGI25157J39369_100014614 191
285 3300002774 JGI25150J39212_1004919 JGI25150J39212_10049192 191
286 3300002774 JGI25150J39212_1006810 JGI25150J39212_10068103 191
287 3300002987 JGI25159J45721_1000445 JGI25159J45721_100044521 191
288 3300002987 JGI25159J45721_1002455 JGI25159J45721_10024552 191
289 3300003187 JGI25151J46595_10052728 JGI25151J46595_100527282 191
290 3300003187 JGI25151J46595_10062909 JGI25151J46595_100629093 191
291 3300003187 JGI25151J46595_10062969 JGI25151J46595_100629693 191
292 3300003354 JGI25160J50197_1000129 JGI25160J50197_100012971 191
293 3300003354 JGI25160J50197_1024830 JGI25160J50197_10248302 191
294 3300003374 JGI25161J50226_1000080 JGI25161J50226_100008090 191
295 3300003773 Ga0055537_1007693 Ga0055537_10076933 191
296 3300003775 Ga0055524_1000120 Ga0055524_10001203 191
297 3300003781 Ga0055536_1007145 Ga0055536_10071453 191
298 3300003784 Ga0055534_1005931 Ga0055534_10059313 191
299 3300003784 Ga0055534_1024493 Ga0055534_10244931 191
300 3300003790 Ga0055528_1002282 Ga0055528_10022821 191
301 3300003791 Ga0055530_10007449 Ga0055530_100074496 191
302 3300003791 Ga0055530_10026894 Ga0055530_100268943 191
303 3300003792 Ga0055540_1000067 Ga0055540_100006733 191
304 3300003794 Ga0055531_10000480 Ga0055531_1000048016 191
305 3300004625 Ga0055543_1000239 Ga0055543_10002398 191
306 3300005262 Ga0065165_1001501 Ga0065165_100150116 191
307 3300005262 Ga0065165_1055090 Ga0065165_10550902 191
308 3300005841 Ga0068863_100282268 Ga0068863_1002822682 191
309 3300006048 Ga0075363_100048837 Ga0075363_1000488373 191
310 3300006048 Ga0075363_100091748 Ga0075363_1000917482 191
311 3300006048 Ga0075363_100125655 Ga0075363_1001256553 191
312 3300006051 Ga0075364_10100907 Ga0075364_101009072 191
313 3300006051 Ga0075364_10161643 Ga0075364_101616433 191
314 3300006058 Ga0075432_10062450 Ga0075432_100624502 191
315 3300006177 Ga0075362_10043209 Ga0075362_100432093 191
316 3300006178 Ga0075367_10050981 Ga0075367_100509813 191
317 3300006353 Ga0075370_10001826 Ga0075370_1000182610 191
318 3300013296 Ga0157374_10016697 Ga0157374_100166978 191
319 3300025206 Ga0209435_100003 Ga0209435_100003398 191
320 3300025245 Ga0207425_1002311 Ga0207425_10023114 191
321 3300025245 Ga0207425_1005823 Ga0207425_10058235 191
322 3300025246 Ga0209646_1000008 Ga0209646_1000008398 191
323 3300025250 Ga0209026_1000007 Ga0209026_1000007398 191
324 3300025256 Ga0209759_1000019 Ga0209759_1000019119 191
325 3300025263 Ga0209565_1000116 Ga0209565_10001164 191
326 3300025263 Ga0209565_1001214 Ga0209565_10012143 191
327 3300025273 Ga0209673_1001210 Ga0209673_100121032 191
328 3300025284 Ga0209130_1000095 Ga0209130_100009566 191
329 3300025284 Ga0209130_1000134 Ga0209130_10001343 191
330 3300025291 Ga0209675_1000373 Ga0209675_100037317 191
331 3300025291 Ga0209675_1005068 Ga0209675_10050687 191
332 3300025291 Ga0209675_1045089 Ga0209675_10450892 191
333 3300025292 Ga0209676_1000145 Ga0209676_1000145144 191
334 3300025292 Ga0209676_1008763 Ga0209676_10087633 191
335 3300025294 Ga0209025_1007514 Ga0209025_10075144 191
336 3300025294 Ga0209025_1018512 Ga0209025_10185123 191
337 3300025294 Ga0209025_1021495 Ga0209025_10214953 191
338 3300025294 Ga0209025_1041211 Ga0209025_10412113 191
339 3300025295 Ga0209564_1004068 Ga0209564_10040689 191
340 3300025295 Ga0209564_1006206 Ga0209564_10062069 191
341 3300025297 Ga0209758_1016925 Ga0209758_10169253 191
342 3300025297 Ga0209758_1096062 Ga0209758_10960622 191
343 3300025298 Ga0209050_1000023 Ga0209050_100002333 191
344 3300025298 Ga0209050_1000118 Ga0209050_100011827 191
345 3300025298 Ga0209050_1002654 Ga0209050_10026543 191
346 3300025298 Ga0209050_1017603 Ga0209050_10176033 191
347 3300025299 Ga0209256_1000003 Ga0209256_1000003767 191
348 3300025302 Ga0207426_1000397 Ga0207426_100039792 191
349 3300025302 Ga0207426_1031894 Ga0207426_10318943 191
350 3300025303 Ga0209051_1000017 Ga0209051_100001733 191
351 3300025303 Ga0209051_1046473 Ga0209051_10464733 191
352 3300025304 Ga0209257_1000041 Ga0209257_100004133 191
353 3300025304 Ga0209257_1056523 Ga0209257_10565232 191
354 3300027614 Ga0209970_1000061 Ga0209970_100006114 191
355 3300027665 Ga0209983_1010179 Ga0209983_10101793 191
356 3300027876 Ga0209974_10013714 Ga0209974_100137143 191
357 3300028794 Ga0307515_10044865 Ga0307515_100448659 191
358 3300028794 Ga0307515_10053971 Ga0307515_100539718 191
359 3300030522 Ga0307512_10095143 Ga0307512_100951433 191
360 3300030522 Ga0307512_10095711 Ga0307512_100957113 191
361 3300031456 Ga0307513_10000104 Ga0307513_1000010429 191
362 3300031456 Ga0307513_10014677 Ga0307513_100146773 191
363 3300031548 Ga0307408_100882047 Ga0307408_1008820472 191
364 3300031616 Ga0307508_10000271 Ga0307508_1000027149 191
365 3300031730 Ga0307516_10126387 Ga0307516_101263873 191
366 3300031824 Ga0307413_10369239 Ga0307413_103692393 191
367 3300031901 Ga0307406_10121124 Ga0307406_101211242 191
368 3300033179 Ga0307507_10132512 Ga0307507_101325123 191
369 3300037471 Ga0395905_0035342 Ga0395905_0035342_2891_3490 191
370 3300041441 Ga0451787_558123 Ga0451787_558123_123_707 191
371 3300041453 Ga0451797_0055608 Ga0451797_0055608_505_1089 191
372 3300041459 Ga0451800_0550407 Ga0451800_0550407_183_767 191
373 3300041486 Ga0451807_0033591 Ga0451807_0033591_248_832 191
374 3300041491 Ga0451833_0440785 Ga0451833_0440785_41_625 191
375 3300041503 Ga0451847_0563971 Ga0451847_0563971_258_842 191
376 3300041507 Ga0451851_0371223 Ga0451851_0371223_116_700 191
377 3300041512 Ga0451853_2273887 Ga0451853_2273887_254_838 191
378 3300042876 Ga0451577_0706583 Ga0451577_0706583_184_783 191
379 3300044684 Ga0466966_0018660 Ga0466966_0018660_1281_1904 191
380 3300044693 Ga0466961_0188658 Ga0466961_0188658_554_1177 191
381 3300045049 Ga0466959_0011390 Ga0466959_0011390_956_1579 191
382 3300046519 Ga0495632_0008733 Ga0495632_0008733_4940_5524 191
383 3300046519 Ga0495632_0009624 Ga0495632_0009624_4630_5214 191
384 3300046522 Ga0495643_0074601 Ga0495643_0074601_1163_1747 191
385 3300046660 Ga0495625_0002511 Ga0495625_0002511_18249_18833 191
386 3300050489 nmdc:mga03683_34515_c1 nmdc:mga03683_34515_c1_180_779 191
387 3300050489 nmdc:mga03683_70266_c1 nmdc:mga03683_70266_c1_151_735 191
388 3300050490 nmdc:mga03n38_115787_c1 nmdc:mga03n38_115787_c1_222_833 191
389 3300050490 nmdc:mga03n38_83260_c1 nmdc:mga03n38_83260_c1_294_893 191
390 3300050491 nmdc:mga00v17_147229_c1 nmdc:mga00v17_147229_c1_344_955 191
391 3300050493 nmdc:mga0k408_148640_c1 nmdc:mga0k408_148640_c1_381_992 191
392 3300050493 nmdc:mga0k408_58092_c1 nmdc:mga0k408_58092_c1_718_1317 191
393 3300050494 nmdc:mga06z11_67145_c1 nmdc:mga06z11_67145_c1_510_1094 191
394 3300050496 nmdc:mga07m45_14447_c1 nmdc:mga07m45_14447_c1_2869_3468 191
395 3300050496 nmdc:mga07m45_271171_c1 nmdc:mga07m45_271171_c1_240_851 191
396 3300053086 Ga0500578_0000079 Ga0500578_0000079_105857_106456 191
397 3300053088 Ga0500644_0011166 Ga0500644_0011166_229_840 191
398 3300053088 Ga0500644_0143738 Ga0500644_0143738_316_900 191
399 3300053094 Ga0500566_0094384 Ga0500566_0094384_994_1605 191
400 3300053117 Ga0500593_005843 Ga0500593_005843_554_1165 191
401 3300053130 Ga0500642_0082410 Ga0500642_0082410_854_1453 191
402 3300053137 Ga0500561_0030841 Ga0500561_0030841_455_1054 191
403 3300053139 Ga0500568_0010029 Ga0500568_0010029_3478_4062 191
404 3300053151 Ga0500604_0026847 Ga0500604_0026847_459_1070 191
405 3300053156 Ga0500622_0049996 Ga0500622_0049996_951_1550 191
406 3300053724 Ga0500570_151845 Ga0500570_151845_68_652 191
407 3300053739 Ga0500587_003978 Ga0500587_003978_496_1080 191
408 3300055283 Ga0500661_001399 Ga0500661_001399_332_943 191
409 iso_pu_bacteria 2721755523 2722885524 191
410 iso_pu_bacteria 2839138175 2839142297 191
411 iso_pu_bacteria 2974320154 2974320552 191
412 3300003792 Ga0055540_1008475 Ga0055540_10084753 192
413 3300005468 Ga0070707_100617116 Ga0070707_1006171162 192
414 3300005563 Ga0068855_100095565 Ga0068855_1000955652 192
415 3300009093 Ga0105240_10880735 Ga0105240_108807352 192
416 3300009177 Ga0105248_11260356 Ga0105248_112603562 192
417 3300025303 Ga0209051_1002067 Ga0209051_100206710 192
418 3300025922 Ga0207646_10404822 Ga0207646_104048222 192
419 3300027252 Ga0209973_1005543 Ga0209973_10055433 192
420 3300031507 Ga0307509_10534446 Ga0307509_105344461 192
421 3300037418 Ga0395900_0138988 Ga0395900_0138988_1418_2020 192
422 3300037466 Ga0395898_0025536 Ga0395898_0025536_3807_4409 192
423 3300037471 Ga0395905_0153417 Ga0395905_0153417_1379_1981 192
424 3300037471 Ga0395905_0190268 Ga0395905_0190268_968_1570 192
425 3300038443 Ga0395901_0037127 Ga0395901_0037127_1181_1783 192
426 3300038443 Ga0395901_0059598 Ga0395901_0059598_1360_1962 192
427 3300042012 Ga0439455_0036044 Ga0439455_0036044_369_1004 192
428 3300042876 Ga0451577_0000166 Ga0451577_0000166_36553_37167 192
429 3300044712 Ga0453684_0000187 Ga0453684_0000187_231702_232316 192
430 3300044712 Ga0453684_0347160 Ga0453684_0347160_459_1064 192
431 3300044901 Ga0466960_0020598 Ga0466960_0020598_951_1553 192
432 iso_pu_bacteria 2738543012 2739240940 192
433 iso_pu_bacteria 2816332133 2816471982 192
434 iso_pu_bacteria 2928115317 2928119328 192
435 3300005353 Ga0070669_100093224 Ga0070669_1000932242 193
436 3300005577 Ga0068857_100155748 Ga0068857_1001557483 193
437 3300006177 Ga0075362_10052668 Ga0075362_100526683 193
438 3300006177 Ga0075362_10172671 Ga0075362_101726712 193
439 3300006195 Ga0075366_10036060 Ga0075366_100360604 193
440 3300006195 Ga0075366_10063663 Ga0075366_100636633 193
441 3300006195 Ga0075366_10129493 Ga0075366_101294933 193
442 3300006195 Ga0075366_10333389 Ga0075366_103333891 193
443 3300006946 Ga0079104_1000072 Ga0079104_1000072137 193
444 3300009036 Ga0105244_10063490 Ga0105244_100634902 193
445 3300009092 Ga0105250_10000680 Ga0105250_100006808 193
446 3300009148 Ga0105243_10002347 Ga0105243_100023479 193
447 3300009148 Ga0105243_10965989 Ga0105243_109659891 193
448 3300009176 Ga0105242_10012979 Ga0105242_100129796 193
449 3300025711 Ga0207696_1002009 Ga0207696_100200911 193
450 3300025934 Ga0207686_10010264 Ga0207686_100102645 193
451 3300025935 Ga0207709_10000132 Ga0207709_1000013226 193
452 3300027111 Ga0209281_1000002 Ga0209281_1000002988 193
453 3300028794 Ga0307515_10005119 Ga0307515_1000511921 193
454 3300031456 Ga0307513_10103621 Ga0307513_101036213 193
455 3300031649 Ga0307514_10004100 Ga0307514_1000410015 193
456 3300031901 Ga0307406_10140648 Ga0307406_101406483 193
457 3300031911 Ga0307412_10246354 Ga0307412_102463541 193
458 3300037466 Ga0395898_0755809 Ga0395898_0755809_251_847 193
459 3300037471 Ga0395905_0001350 Ga0395905_0001350_20042_20638 193
460 3300037471 Ga0395905_0789584 Ga0395905_0789584_43_639 193
461 3300046810 Ga0495660_0029299 Ga0495660_0029299_1845_2444 193
462 3300049763 Ga0501266_000273 Ga0501266_000273_437_1057 193
463 3300050489 nmdc:mga03683_158783_c1 nmdc:mga03683_158783_c1_67_687 193
464 3300050493 nmdc:mga0k408_130854_c1 nmdc:mga0k408_130854_c1_490_1110 193
465 3300050493 nmdc:mga0k408_474819_c1 nmdc:mga0k408_474819_c1_66_674 193
466 3300053088 Ga0500644_0033629 Ga0500644_0033629_641_1267 193
467 3300053108 Ga0500562_044402 Ga0500562_044402_185_811 193
468 3300053142 Ga0500577_0064048 Ga0500577_0064048_248_871 193
469 iso_pu_bacteria 2643221609 2644059419 193
470 iso_pu_bacteria 2643221611 2644074188 193
471 iso_pu_bacteria 2738543013 2739249563 193
472 iso_pu_bacteria 2842718218 2842718574 193
473 iso_pu_bacteria 2885192300 2885193001 193
474 3300005354 Ga0070675_100315206 Ga0070675_1003152063 194
475 3300005356 Ga0070674_100394874 Ga0070674_1003948743 194
476 3300006048 Ga0075363_100347380 Ga0075363_1003473802 194
477 3300006353 Ga0075370_10031240 Ga0075370_100312403 194
478 3300027424 Ga0209984_1000927 Ga0209984_10009275 194
479 3300027543 Ga0209999_1035045 Ga0209999_10350453 194
480 3300027665 Ga0209983_1038061 Ga0209983_10380613 194
481 3300027682 Ga0209971_1000817 Ga0209971_100081711 194
482 3300031235 Ga0265330_10000110 Ga0265330_1000011013 194
483 3300031238 Ga0265332_10000011 Ga0265332_1000001112 194
484 3300031247 Ga0265340_10134722 Ga0265340_101347223 194
485 3300031711 Ga0265314_10000026 Ga0265314_10000026256 194
486 3300042876 Ga0451577_0098069 Ga0451577_0098069_623_1243 194
487 3300044712 Ga0453684_0795806 Ga0453684_0795806_335_955 194
488 3300049650 Ga0501199_002565 Ga0501199_002565_747_1358 194
489 3300049663 Ga0501223_031134 Ga0501223_031134_335_946 194
490 3300049776 Ga0501280_007909 Ga0501280_007909_434_1045 194
491 3300050492 nmdc:mga0yw44_192448_c1 nmdc:mga0yw44_192448_c1_123_746 194
492 3300050496 nmdc:mga07m45_2723_c1 nmdc:mga07m45_2723_c1_745_1359 194
493 3300053161 Ga0500634_0112788 Ga0500634_0112788_618_1235 194
494 iso_pu_bacteria 2547132374 2548497673 194
495 iso_pu_bacteria 2643221570 2643867124 194
496 iso_pu_bacteria 2643221596 2643990064 194
497 iso_pu_bacteria 2643221652 2644295545 194
498 iso_pu_bacteria 2643221717 2644645080 194
499 iso_pu_bacteria 2894023352 2894027233 194
500 iso_pu_bacteria 2990710928 2990711281 194
501 3300002987 JGI25159J45721_1014855 JGI25159J45721_10148552 195
502 3300003316 rootH1_10083951 rootH1_100839512 195
503 3300003322 rootL2_10014092 rootL2_100140923 195
504 3300003323 rootH1_10042174 rootH1_100421742 195
505 3300005614 Ga0068856_100016853 Ga0068856_1000168538 195
506 3300025256 Ga0209759_1037604 Ga0209759_10376042 195
507 3300025912 Ga0207707_10631970 Ga0207707_106319702 195
508 3300026078 Ga0207702_10039951 Ga0207702_100399513 195
509 3300027876 Ga0209974_10002610 Ga0209974_100026105 195
510 3300028573 Ga0265334_10057688 Ga0265334_100576883 195
511 3300031548 Ga0307408_100000131 Ga0307408_10000013113 195
512 3300031649 Ga0307514_10000558 Ga0307514_1000055832 195
513 3300031901 Ga0307406_10007581 Ga0307406_100075818 195
514 3300032005 Ga0307411_10226646 Ga0307411_102266463 195
515 3300036401 Ga0373937_0127620 Ga0373937_0127620_425_1054 195
516 3300041460 Ga0451802_1761845 Ga0451802_1761845_207_812 195
517 3300041486 Ga0451807_0378624 Ga0451807_0378624_715_1320 195
518 3300042125 Ga0450923_021693 Ga0450923_021693_263_898 195
519 3300044656 Ga0466969_0038862 Ga0466969_0038862_1356_2000 195
520 3300044683 Ga0466965_0003310 Ga0466965_0003310_1815_2459 195
521 3300044684 Ga0466966_0009059 Ga0466966_0009059_4195_4839 195
522 3300044693 Ga0466961_0025989 Ga0466961_0025989_2727_3371 195
523 3300044706 Ga0466964_0004084 Ga0466964_0004084_545_1189 195
524 3300044719 Ga0466971_0004547 Ga0466971_0004547_4516_5160 195
525 3300044735 Ga0466968_0034015 Ga0466968_0034015_642_1286 195
526 3300044765 Ga0466970_0037204 Ga0466970_0037204_278_922 195
527 3300045049 Ga0466959_0026708 Ga0466959_0026708_1245_1889 195
528 3300045836 Ga0466958_0007306 Ga0466958_0007306_1631_2275 195
529 3300045976 Ga0466967_0656883 Ga0466967_0656883_225_869 195
530 3300053136 Ga0500559_0008544 Ga0500559_0008544_3337_3954 195
531 3300061719 Ga0466962_0005278 Ga0466962_0005278_2709_3353 195
532 3300005327 Ga0070658_10192649 Ga0070658_101926492 196
533 3300005331 Ga0070670_100213738 Ga0070670_1002137383 196
534 3300005335 Ga0070666_10308493 Ga0070666_103084931 196
535 3300005347 Ga0070668_100063350 Ga0070668_1000633505 196
536 3300005367 Ga0070667_100010858 Ga0070667_1000108583 196
537 3300005456 Ga0070678_100446201 Ga0070678_1004462012 196
538 3300006177 Ga0075362_10052090 Ga0075362_100520902 196
539 3300006186 Ga0075369_10222545 Ga0075369_102225452 196
540 3300006195 Ga0075366_10098875 Ga0075366_100988753 196
541 3300006353 Ga0075370_10102663 Ga0075370_101026632 196
542 3300013104 Ga0157370_10370307 Ga0157370_103703073 196
543 3300013297 Ga0157378_11103912 Ga0157378_111039122 196
544 3300013306 Ga0163162_10149785 Ga0163162_101497853 196
545 3300014325 Ga0163163_10469441 Ga0163163_104694412 196
546 3300014326 Ga0157380_10476896 Ga0157380_104768963 196
547 3300014497 Ga0182008_10003510 Ga0182008_100035103 196
548 3300014497 Ga0182008_10018684 Ga0182008_100186843 196
549 3300014497 Ga0182008_10075392 Ga0182008_100753923 196
550 3300014968 Ga0157379_10655909 Ga0157379_106559092 196
551 3300015262 Ga0182007_10009603 Ga0182007_100096035 196
552 3300015265 Ga0182005_1021523 Ga0182005_10215233 196
553 3300015683 Ga0183362_10005 Ga0183362_10005275 196
554 3300017792 Ga0163161_10141927 Ga0163161_101419273 196
555 3300025271 Ga0207666_1003182 Ga0207666_10031822 196
556 3300025292 Ga0209676_1031787 Ga0209676_10317873 196
557 3300025937 Ga0207669_10083862 Ga0207669_100838623 196
558 3300025986 Ga0207658_10127736 Ga0207658_101277363 196
559 3300026041 Ga0207639_10203670 Ga0207639_102036702 196
560 3300026089 Ga0207648_10211078 Ga0207648_102110783 196
561 3300026116 Ga0207674_10703547 Ga0207674_107035472 196
562 3300026121 Ga0207683_10102933 Ga0207683_101029332 196
563 3300028379 Ga0268266_10178609 Ga0268266_101786093 196
564 3300028379 Ga0268266_10844590 Ga0268266_108445902 196
565 3300031251 Ga0265327_10006235 Ga0265327_100062359 196
566 3300042002 Ga0439442_017630 Ga0439442_017630_269_901 196
567 3300046471 Ga0495650_0030946 Ga0495650_0030946_388_1014 196
568 3300046475 Ga0495639_0046029 Ga0495639_0046029_1019_1651 196
569 3300046522 Ga0495643_0083424 Ga0495643_0083424_697_1320 196
570 3300046528 Ga0495642_0046766 Ga0495642_0046766_1122_1754 196
571 3300046615 Ga0495656_0059450 Ga0495656_0059450_733_1365 196
572 3300046678 Ga0495599_0202936 Ga0495599_0202936_141_773 196
573 3300047315 Ga0495581_0056860 Ga0495581_0056860_475_1107 196
574 3300047469 Ga0495673_0160256 Ga0495673_0160256_55_654 196
575 3300048903 Ga0496100_0015801 Ga0496100_0015801_478_1110 196
576 3300048905 Ga0496102_0006927 Ga0496102_0006927_665_1297 196
577 3300048907 Ga0496104_0003316 Ga0496104_0003316_13240_13872 196
578 3300048907 Ga0496104_0303203 Ga0496104_0303203_427_1050 196
579 3300048908 Ga0496105_0033011 Ga0496105_0033011_2741_3373 196
580 3300048909 Ga0496106_0120152 Ga0496106_0120152_786_1418 196
581 3300048910 Ga0496107_0243422 Ga0496107_0243422_213_845 196
582 3300048911 Ga0496108_0120778 Ga0496108_0120778_690_1322 196
583 3300048911 Ga0496108_0340009 Ga0496108_0340009_394_1026 196
584 3300048912 Ga0496109_0060340 Ga0496109_0060340_2020_2652 196
585 3300048913 Ga0496110_0081564 Ga0496110_0081564_1474_2106 196
586 3300048914 Ga0496111_0354222 Ga0496111_0354222_427_1059 196
587 3300050489 nmdc:mga03683_75353_c1 nmdc:mga03683_75353_c1_626_1258 196
588 3300050493 nmdc:mga0k408_87958_c1 nmdc:mga0k408_87958_c1_893_1525 196
589 3300050496 nmdc:mga07m45_6665_c1 nmdc:mga07m45_6665_c1_633_1265 196
590 3300050516 nmdc:mga0sz30_248349_c1 nmdc:mga0sz30_248349_c1_20_652 196
591 3300002773 JGI25152J39213_1000752 JGI25152J39213_100075212 197
592 3300002774 JGI25150J39212_1004196 JGI25150J39212_10041962 197
593 3300003215 JGI25153J46596_10014796 JGI25153J46596_100147965 197
594 3300003771 Ga0055526_1009134 Ga0055526_10091342 197
595 3300003790 Ga0055528_1056769 Ga0055528_10567691 197
596 3300009176 Ga0105242_10211390 Ga0105242_102113901 197
597 3300025245 Ga0207425_1003440 Ga0207425_10034403 197
598 3300025258 Ga0209129_1000062 Ga0209129_1000062166 197
599 3300025273 Ga0209673_1013829 Ga0209673_10138295 197
600 3300025295 Ga0209564_1000176 Ga0209564_100017686 197
601 3300025297 Ga0209758_1000129 Ga0209758_10001293 197
602 3300048913 Ga0496110_0219634 Ga0496110_0219634_464_1066 197
603 3300048913 Ga0496110_1008096 Ga0496110_1008096_94_696 197
604 3300048927 Ga0496124_0124076 Ga0496124_0124076_360_971 197
605 3300049571 Ga0501034_0539668 Ga0501034_0539668_171_797 197
606 3300002705 JGI25156J39149_1014497 JGI25156J39149_10144973 198
607 3300002738 JGI25154J39366_1003058 JGI25154J39366_10030582 198
608 3300002741 JGI25157J39369_1000021 JGI25157J39369_100002114 198
609 3300002741 JGI25157J39369_1000351 JGI25157J39369_10003513 198
610 3300003752 Ga0055539_1009683 Ga0055539_10096831 198
611 3300003761 Ga0055535_1000307 Ga0055535_100030726 198
612 3300003763 Ga0055529_1000488 Ga0055529_100048822 198
613 3300005355 Ga0070671_100009262 Ga0070671_1000092629 198
614 3300005364 Ga0070673_100111483 Ga0070673_1001114833 198
615 3300005459 Ga0068867_100415805 Ga0068867_1004158052 198
616 3300005539 Ga0068853_100142484 Ga0068853_1001424842 198
617 3300005548 Ga0070665_100300282 Ga0070665_1003002823 198
618 3300005577 Ga0068857_100035461 Ga0068857_1000354616 198
619 3300005614 Ga0068856_100020989 Ga0068856_1000209893 198
620 3300005618 Ga0068864_100137148 Ga0068864_1001371483 198
621 3300006353 Ga0075370_10002711 Ga0075370_100027116 198
622 3300009093 Ga0105240_10171884 Ga0105240_101718843 198
623 3300009093 Ga0105240_10331162 Ga0105240_103311623 198
624 3300009093 Ga0105240_10962580 Ga0105240_109625801 198
625 3300009545 Ga0105237_10001471 Ga0105237_1000147110 198
626 3300009551 Ga0105238_10053658 Ga0105238_100536585 198
627 3300009551 Ga0105238_10467434 Ga0105238_104674342 198
628 3300010375 Ga0105239_10003011 Ga0105239_100030113 198
629 3300013105 Ga0157369_10055954 Ga0157369_100559543 198
630 3300014968 Ga0157379_10369461 Ga0157379_103694612 198
631 3300025242 Ga0209258_100319 Ga0209258_10031952 198
632 3300025246 Ga0209646_1000060 Ga0209646_1000060144 198
633 3300025250 Ga0209026_1000049 Ga0209026_1000049142 198
634 3300025253 Ga0209677_100782 Ga0209677_10078212 198
635 3300025256 Ga0209759_1000069 Ga0209759_1000069142 198
636 3300025256 Ga0209759_1001175 Ga0209759_10011759 198
637 3300025256 Ga0209759_1004778 Ga0209759_10047783 198
638 3300025256 Ga0209759_1021590 Ga0209759_10215902 198
639 3300025272 Ga0209455_1000157 Ga0209455_100015791 198
640 3300025901 Ga0207688_10070573 Ga0207688_100705733 198
641 3300025911 Ga0207654_10069835 Ga0207654_100698353 198
642 3300025913 Ga0207695_10009579 Ga0207695_100095794 198
643 3300025913 Ga0207695_10016584 Ga0207695_1001658412 198
644 3300025914 Ga0207671_10013202 Ga0207671_100132028 198
645 3300025920 Ga0207649_10002028 Ga0207649_1000202811 198
646 3300025924 Ga0207694_10021765 Ga0207694_100217653 198
647 3300025931 Ga0207644_10106468 Ga0207644_101064683 198
648 3300025932 Ga0207690_10002544 Ga0207690_1000254413 198
649 3300025933 Ga0207706_10620741 Ga0207706_106207412 198
650 3300025941 Ga0207711_10045155 Ga0207711_100451555 198
651 3300025945 Ga0207679_10000647 Ga0207679_100006479 198
652 3300025949 Ga0207667_10372014 Ga0207667_103720143 198
653 3300025960 Ga0207651_10009684 Ga0207651_100096843 198
654 3300025981 Ga0207640_10082829 Ga0207640_100828293 198
655 3300026041 Ga0207639_10217663 Ga0207639_102176633 198
656 3300026078 Ga0207702_10005245 Ga0207702_1000524510 198
657 3300026095 Ga0207676_10120268 Ga0207676_101202683 198
658 3300026116 Ga0207674_10126161 Ga0207674_101261613 198
659 3300026121 Ga0207683_10162030 Ga0207683_101620303 198
660 3300028379 Ga0268266_10055366 Ga0268266_100553663 198
661 3300028666 Ga0265336_10000040 Ga0265336_1000004033 198
662 3300029957 Ga0265324_10004950 Ga0265324_100049502 198
663 3300031507 Ga0307509_10457598 Ga0307509_104575983 198
664 3300031730 Ga0307516_10003164 Ga0307516_1000316426 198
665 3300037471 Ga0395905_0214672 Ga0395905_0214672_1125_1757 198
666 3300038443 Ga0395901_0003173 Ga0395901_0003173_6041_6673 198
667 3300041458 Ga0451798_0677714 Ga0451798_0677714_727_1335 198
668 3300041459 Ga0451800_0260100 Ga0451800_0260100_1409_2017 198
669 3300041460 Ga0451802_0380592 Ga0451802_0380592_150_758 198
670 3300041463 Ga0451804_0450657 Ga0451804_0450657_875_1483 198
671 3300041486 Ga0451807_0511307 Ga0451807_0511307_324_932 198
672 3300041501 Ga0451845_0484302 Ga0451845_0484302_466_1074 198
673 3300042876 Ga0451577_0000697 Ga0451577_0000697_464_1093 198
674 3300046460 Ga0495638_0069218 Ga0495638_0069218_618_1226 198
675 3300046471 Ga0495650_0028496 Ga0495650_0028496_796_1425 198
676 3300046475 Ga0495639_0018532 Ga0495639_0018532_1866_2495 198
677 3300046506 Ga0495583_0000046 Ga0495583_0000046_67531_68163 198
678 3300046507 Ga0495606_0017068 Ga0495606_0017068_1310_1942 198
679 3300046515 Ga0495620_0048512 Ga0495620_0048512_837_1445 198
680 3300046660 Ga0495625_0107219 Ga0495625_0107219_555_1187 198
681 3300046684 Ga0495669_0007695 Ga0495669_0007695_3334_3966 198
682 3300046694 Ga0495649_0000548 Ga0495649_0000548_29888_30520 198
683 3300046794 Ga0495589_0007530 Ga0495589_0007530_1050_1682 198
684 3300048907 Ga0496104_0332905 Ga0496104_0332905_318_947 198
685 3300048908 Ga0496105_0139762 Ga0496105_0139762_525_1154 198
686 3300048913 Ga0496110_0688911 Ga0496110_0688911_241_870 198
687 3300048915 Ga0496112_0011790 Ga0496112_0011790_2701_3330 198
688 3300048916 Ga0496113_0016666 Ga0496113_0016666_949_1578 198
689 3300050496 nmdc:mga07m45_2243_c2 nmdc:mga07m45_2243_c2_2736_3368 198
690 3300053087 Ga0500643_058178 Ga0500643_058178_273_881 198
691 3300053088 Ga0500644_0023838 Ga0500644_0023838_642_1250 198
692 3300053090 Ga0500646_0020684 Ga0500646_0020684_301_909 198
693 3300053093 Ga0500651_0045939 Ga0500651_0045939_1484_2092 198
694 3300053096 Ga0500641_0042497 Ga0500641_0042497_238_846 198
695 3300053109 Ga0500569_006494 Ga0500569_006494_1563_2171 198
696 3300053122 Ga0500608_066183 Ga0500608_066183_919_1551 198
697 3300053130 Ga0500642_0040098 Ga0500642_0040098_819_1427 198
698 3300053131 Ga0500652_000857 Ga0500652_000857_1156_1764 198
699 3300053133 Ga0500655_007327 Ga0500655_007327_972_1580 198
700 3300053151 Ga0500604_0026411 Ga0500604_0026411_561_1169 198
701 3300053156 Ga0500622_0000053 Ga0500622_0000053_5001_5609 198
702 3300053177 Ga0500636_0025438 Ga0500636_0025438_335_967 198
703 3300053724 Ga0500570_095197 Ga0500570_095197_558_1166 198
704 3300055283 Ga0500661_030667 Ga0500661_030667_216_848 198
705 3300005327 Ga0070658_10131358 Ga0070658_101313582 199
706 3300005330 Ga0070690_100171827 Ga0070690_1001718273 199
707 3300005367 Ga0070667_100761789 Ga0070667_1007617891 199
708 3300005563 Ga0068855_100809919 Ga0068855_1008099192 199
709 3300006195 Ga0075366_10058904 Ga0075366_100589043 199
710 3300006195 Ga0075366_10066059 Ga0075366_100660593 199
711 3300006353 Ga0075370_10050514 Ga0075370_100505143 199
712 3300030522 Ga0307512_10084973 Ga0307512_100849732 199
713 3300031239 Ga0265328_10029761 Ga0265328_100297613 199
714 3300031251 Ga0265327_10000158 Ga0265327_10000158101 199
715 3300031507 Ga0307509_10009555 Ga0307509_1000955512 199
716 3300031507 Ga0307509_10237953 Ga0307509_102379533 199
717 3300031616 Ga0307508_10259716 Ga0307508_102597162 199
718 3300033180 Ga0307510_10029427 Ga0307510_100294273 199
719 3300033180 Ga0307510_10041455 Ga0307510_100414557 199
720 3300042876 Ga0451577_0011783 Ga0451577_0011783_7117_7725 199
721 3300044712 Ga0453684_0427163 Ga0453684_0427163_299_907 199
722 3300046454 Ga0495592_0000153 Ga0495592_0000153_649_1257 199
723 3300046460 Ga0495638_0053127 Ga0495638_0053127_85_693 199
724 3300046515 Ga0495620_0113570 Ga0495620_0113570_362_970 199
725 3300046516 Ga0495628_0743506 Ga0495628_0743506_36_644 199
726 3300048905 Ga0496102_0007775 Ga0496102_0007775_7821_8435 199
727 3300050493 nmdc:mga0k408_189842_c1 nmdc:mga0k408_189842_c1_522_1130 199
728 3300053088 Ga0500644_0026762 Ga0500644_0026762_501_1109 199
729 3300053093 Ga0500651_0059147 Ga0500651_0059147_1243_1851 199
730 3300053117 Ga0500593_004453 Ga0500593_004453_4462_5073 199
731 3300053118 Ga0500594_0005906 Ga0500594_0005906_1349_1957 199
732 3300053136 Ga0500559_0000494 Ga0500559_0000494_1289_1897 199
733 3300053139 Ga0500568_0055429 Ga0500568_0055429_363_971 199
734 3300053156 Ga0500622_0007498 Ga0500622_0007498_4431_5039 199
735 3300053739 Ga0500587_007084 Ga0500587_007084_357_965 199
736 iso_pu_bacteria 2643221644 2644246917 199
737 3300003775 Ga0055524_1000146 Ga0055524_100014665 200
738 3300005843 Ga0068860_100225833 Ga0068860_1002258333 200
739 3300006195 Ga0075366_10090117 Ga0075366_100901172 200
740 3300009177 Ga0105248_10540780 Ga0105248_105407803 200
741 3300025263 Ga0209565_1017359 Ga0209565_10173593 200
742 3300025297 Ga0209758_1000327 Ga0209758_10003273 200
743 3300025299 Ga0209256_1000015 Ga0209256_1000015453 200
744 3300025899 Ga0207642_10085586 Ga0207642_100855863 200
745 3300031548 Ga0307408_100198707 Ga0307408_1001987072 200
746 3300050493 nmdc:mga0k408_186897_c1 nmdc:mga0k408_186897_c1_87_701 200
747 3300050493 nmdc:mga0k408_189563_c1 nmdc:mga0k408_189563_c1_234_869 200
748 3300006946 Ga0079104_1000001 Ga0079104_1000001365 201
749 3300027111 Ga0209281_1000151 Ga0209281_100015148 201
750 3300028786 Ga0307517_10001975 Ga0307517_1000197513 201
751 3300028794 Ga0307515_10264829 Ga0307515_102648292 201
752 3300030522 Ga0307512_10198141 Ga0307512_101981413 201
753 3300031616 Ga0307508_10003497 Ga0307508_1000349716 201
754 3300031730 Ga0307516_10211370 Ga0307516_102113703 201
755 3300032002 Ga0307416_100208100 Ga0307416_1002081003 201
756 3300032002 Ga0307416_100454592 Ga0307416_1004545923 201
757 3300041405 Ga0439438_051623 Ga0439438_051623_156_797 201
758 3300042121 Ga0450919_000087 Ga0450919_000087_1625_2251 201
759 3300042122 Ga0450920_047060 Ga0450920_047060_104_730 201
760 3300042531 Ga0450918_000012 Ga0450918_000012_20513_21139 201
761 3300046524 Ga0495648_0125340 Ga0495648_0125340_519_1133 201
762 3300046660 Ga0495625_0136444 Ga0495625_0136444_575_1189 201
763 3300049515 Ga0501292_003271 Ga0501292_003271_1055_1669 201
764 3300049762 Ga0501265_001527 Ga0501265_001527_403_1017 201
765 3300053092 Ga0500583_0114963 Ga0500583_0114963_174_788 201
766 iso_pu_bacteria 2643221660 2644338617 201
767 3300003791 Ga0055530_10006485 Ga0055530_100064856 202
768 3300003792 Ga0055540_1000001 Ga0055540_1000001397 202
769 3300003794 Ga0055531_10001273 Ga0055531_100012735 202
770 3300005293 Ga0065715_10098707 Ga0065715_100987072 202
771 3300005328 Ga0070676_10075764 Ga0070676_100757643 202
772 3300005328 Ga0070676_10123452 Ga0070676_101234523 202
773 3300005331 Ga0070670_100219080 Ga0070670_1002190802 202
774 3300005333 Ga0070677_10008129 Ga0070677_100081295 202
775 3300005353 Ga0070669_100026644 Ga0070669_1000266445 202
776 3300005355 Ga0070671_100007158 Ga0070671_1000071582 202
777 3300005355 Ga0070671_100405534 Ga0070671_1004055342 202
778 3300005356 Ga0070674_100075398 Ga0070674_1000753982 202
779 3300005364 Ga0070673_100105779 Ga0070673_1001057792 202
780 3300005367 Ga0070667_100134776 Ga0070667_1001347764 202
781 3300005455 Ga0070663_100000226 Ga0070663_10000022620 202
782 3300005456 Ga0070678_100004379 Ga0070678_1000043792 202
783 3300005459 Ga0068867_100001941 Ga0068867_1000019415 202
784 3300005459 Ga0068867_100173038 Ga0068867_1001730383 202
785 3300005543 Ga0070672_100005168 Ga0070672_1000051689 202
786 3300005578 Ga0068854_100111674 Ga0068854_1001116742 202
787 3300005578 Ga0068854_100459358 Ga0068854_1004593582 202
788 3300005618 Ga0068864_100248084 Ga0068864_1002480843 202
789 3300005834 Ga0068851_10206900 Ga0068851_102069002 202
790 3300006237 Ga0097621_100052565 Ga0097621_1000525653 202
791 3300006358 Ga0068871_100143810 Ga0068871_1001438103 202
792 3300006881 Ga0068865_100085871 Ga0068865_1000858713 202
793 3300013296 Ga0157374_10571637 Ga0157374_105716373 202
794 3300013297 Ga0157378_10252643 Ga0157378_102526433 202
795 3300013306 Ga0163162_10148095 Ga0163162_101480955 202
796 3300013308 Ga0157375_10143413 Ga0157375_101434133 202
797 3300014326 Ga0157380_11221444 Ga0157380_112214441 202
798 3300014969 Ga0157376_10292276 Ga0157376_102922763 202
799 3300017792 Ga0163161_10021384 Ga0163161_100213843 202
800 3300025298 Ga0209050_1001120 Ga0209050_100112025 202
801 3300025303 Ga0209051_1000018 Ga0209051_100001857 202
802 3300025304 Ga0209257_1000324 Ga0209257_100032457 202
803 3300025315 Ga0207697_10011905 Ga0207697_100119054 202
804 3300025893 Ga0207682_10011022 Ga0207682_100110223 202
805 3300025903 Ga0207680_10186033 Ga0207680_101860333 202
806 3300025907 Ga0207645_10037665 Ga0207645_100376653 202
807 3300025907 Ga0207645_10098849 Ga0207645_100988493 202
808 3300025910 Ga0207684_10245880 Ga0207684_102458803 202
809 3300025923 Ga0207681_10035624 Ga0207681_100356243 202
810 3300025925 Ga0207650_10017584 Ga0207650_100175844 202
811 3300025925 Ga0207650_10168936 Ga0207650_101689362 202
812 3300025926 Ga0207659_10001102 Ga0207659_100011023 202
813 3300025931 Ga0207644_10000537 Ga0207644_1000053724 202
814 3300025937 Ga0207669_10076629 Ga0207669_100766293 202
815 3300025940 Ga0207691_10002343 Ga0207691_1000234321 202
816 3300025960 Ga0207651_10099185 Ga0207651_100991852 202
817 3300025981 Ga0207640_10336679 Ga0207640_103366792 202
818 3300025981 Ga0207640_10380766 Ga0207640_103807662 202
819 3300025986 Ga0207658_10060560 Ga0207658_100605603 202
820 3300026023 Ga0207677_10114502 Ga0207677_101145023 202
821 3300026067 Ga0207678_10000644 Ga0207678_100006449 202
822 3300026088 Ga0207641_10052852 Ga0207641_100528521 202
823 3300026089 Ga0207648_10013271 Ga0207648_1001327110 202
824 3300026089 Ga0207648_10158469 Ga0207648_101584693 202
825 3300026095 Ga0207676_10041554 Ga0207676_100415543 202
826 3300026142 Ga0207698_10388720 Ga0207698_103887202 202
827 3300028379 Ga0268266_10316773 Ga0268266_103167732 202
828 3300031730 Ga0307516_10185772 Ga0307516_101857723 202
829 3300033180 Ga0307510_10150256 Ga0307510_101502563 202
830 3300037471 Ga0395905_0036695 Ga0395905_0036695_944_1567 202
831 3300006195 Ga0075366_10014699 Ga0075366_100146993 203
832 3300027395 Ga0209996_1001287 Ga0209996_10012873 203
833 3300027526 Ga0209968_1000086 Ga0209968_100008614 203
834 3300027695 Ga0209966_1000084 Ga0209966_10000849 203
835 3300031456 Ga0307513_10181687 Ga0307513_101816873 203
836 3300042876 Ga0451577_0512282 Ga0451577_0512282_301_921 203
837 3300044712 Ga0453684_0006584 Ga0453684_0006584_20131_20754 203
838 3300044712 Ga0453684_0150188 Ga0453684_0150188_1697_2317 203
839 3300044712 Ga0453684_1041258 Ga0453684_1041258_15_635 203
840 3300006195 Ga0075366_10006604 Ga0075366_100066048 204
841 3300009148 Ga0105243_10035553 Ga0105243_100355533 204
842 3300014745 Ga0157377_10076280 Ga0157377_100762803 204
843 3300025935 Ga0207709_10018759 Ga0207709_100187595 204
844 3300026089 Ga0207648_10012148 Ga0207648_100121483 204
845 3300006195 Ga0075366_10001953 Ga0075366_100019533 205
846 3300050493 nmdc:mga0k408_642_c1 nmdc:mga0k408_642_c1_17716_18354 205
847 3300032004 Ga0307414_10068509 Ga0307414_100685093 207
848 3300005339 Ga0070660_100291310 Ga0070660_1002913102 209
849 3300001979 JGI24740J21852_10003715 JGI24740J21852_100037155 216
850 3300026142 Ga0207698_10108356 Ga0207698_101083563 216

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04442

CtaG_Cox11

Cytochrome c oxidase assembly protein CtaG/Cox11

50

197

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1sp0-assembly1.cif.gz_A solution structure of apocox11 0.7742 78 189
4o65-assembly1.cif.gz_A crystal structure of the cupredoxin domain of amob from nitrosocaldus yellowstonii 0.749 112 171
3v4v-assembly2.cif.gz_C crystal structure of a4b7 headpiece complexed with fab act-1 and ro0505376 0.7103 112 191
7p4l-assembly1.cif.gz_C crystal structure of the trimeric ectodomain of archaeal fusexin1 (fsx1) 0.7079 109 172
7p4l-assembly1.cif.gz_B crystal structure of the trimeric ectodomain of archaeal fusexin1 (fsx1) 0.7055 109 172
ID Description Score Start End Superfamily
af_Q4DEH9_91_226_2.60.370.10 Mainly Beta;Sandwich;Ctag/Cox11 (Pfam 04442);Ctag/Cox11 0.9044 82 192 2.60.370.10
af_A0A1D6L299_106_203_2.60.370.10 Mainly Beta;Sandwich;Ctag/Cox11 (Pfam 04442);Ctag/Cox11 0.8909 74 169 2.60.370.10
af_A3KNN8_122_254_2.60.370.10 Mainly Beta;Sandwich;Ctag/Cox11 (Pfam 04442);Ctag/Cox11 0.8889 82 196 2.60.370.10
af_A0A1D6L299_106_203_2.60.370.10 Mainly Beta;Sandwich;Ctag/Cox11 (Pfam 04442);Ctag/Cox11 0.8476 74 169 2.60.370.10
af_Q8GWR0_141_281_2.60.370.10 Mainly Beta;Sandwich;Ctag/Cox11 (Pfam 04442);Ctag/Cox11 0.7921 82 216 2.60.370.10
ID Description Score Start End GO Terms
AF-A0A1Q7FZM9-F1-model_v4 Cytochrome c oxidase assembly protein CtaG 0.9449 83 190 GO:0005507
GO:0005886
AF-A0A534NF70-F1-model_v4 Cytochrome c oxidase assembly protein CtaG 0.9322 81 191 GO:0005507
GO:0005886
AF-A0A7C3JTF0-F1-model_v4 Cytochrome c oxidase assembly protein CtaG 0.9288 81 191 GO:0005507
GO:0005886
AF-A0A836QME0-F1-model_v4 Cytochrome c oxidase assembly protein CtaG 0.9249 77 193 GO:0005507
GO:0005886
AF-A0A7V3UMW2-F1-model_v4 Cytochrome c oxidase assembly protein CtaG 0.9233 83 191 GO:0005507
GO:0005886

Feature Viewer

pLDDT pTM Quality
76.35 0.56 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map