F483420
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 850 | 438 | 818 | 202 |
Family's Representative Sequence
| Representative Sequence | 3300005339|Ga0070660_100291310|Ga0070660_1002913102 |
| Length | 222 |
| Sequence | VKAALLPPASETSTMAPPTDDALALRRDNRRMLGKLAVIAALMFGFAYGLASMYNQICQALGINVLALSEAGGAVGERGPVNTQVDASRTITVEFDANAHGPWEFKPALRSLEVHPGELATVMYEFRNVQNRTMAAQAIPSYAPQQAMSHFNKIECFCFSEHTLKPGESKQWPVVFVIDAKLPKDVKTITLSYTFFEVGGKTPPAPDGAHAAGDPLAAGKAS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 2 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 3 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 4 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 5 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 6 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 7 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 8 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 9 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 10 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 11 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 12 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 13 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 14 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 15 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 16 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 17 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 18 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 19 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 20 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 21 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 22 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 23 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 24 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 25 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 26 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 27 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 28 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 29 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 30 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 31 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 32 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 33 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 34 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 35 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 36 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 37 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 38 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 39 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 40 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 41 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 42 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 43 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 44 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 45 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 46 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 47 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 48 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 49 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 50 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 51 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 52 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 53 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 54 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 55 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 56 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 57 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 58 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 59 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 60 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 61 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 62 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 63 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 64 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 65 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 66 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 67 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 70 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 73 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 89 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 90 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 91 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 92 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 93 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 94 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 97 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 99 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 100 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 101 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 102 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 103 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 104 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 105 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 106 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 107 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 108 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 109 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 110 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 111 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 112 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 113 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 114 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 115 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 117 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 118 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 119 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 120 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 121 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 122 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 123 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 124 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 125 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 126 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Metagenome | Rhizosphere |
| 137 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 138 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 148 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 152 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 153 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 154 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 156 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 157 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 163 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 164 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 166 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 167 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 168 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 171 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 173 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 176 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 179 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 229 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 231 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 243 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 244 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 245 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 246 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 247 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 248 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 249 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 250 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 251 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 252 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 253 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 254 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 255 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 256 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 257 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 258 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 259 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 260 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 261 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 262 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 263 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 264 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 265 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 266 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 267 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 268 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 269 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 270 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 271 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 272 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 273 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 274 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 275 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 276 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 277 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 278 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 279 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 280 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 281 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 282 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 283 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 284 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 285 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 286 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 287 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 288 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 289 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 290 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 291 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 292 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 293 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 294 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 295 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 296 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 297 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 298 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 299 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 300 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 301 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 302 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 303 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 304 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 305 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 306 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 307 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 308 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 309 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 310 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 311 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 312 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 313 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 314 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 315 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 316 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 317 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 318 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 319 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 320 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 321 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 322 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 323 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 324 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 325 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 326 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 327 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 328 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 329 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 330 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 331 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 332 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 333 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 359 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 360 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 361 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 362 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 363 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 364 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 365 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 366 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 367 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 368 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 369 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 370 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 371 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 372 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 373 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 374 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 375 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 376 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 377 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 378 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 379 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 389 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 390 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 391 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 393 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 394 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 395 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 396 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 398 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 399 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 400 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 401 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 402 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 403 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 404 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 407 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 408 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 410 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 411 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 412 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 413 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 414 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 415 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 416 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 417 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 418 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 419 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 420 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 421 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 422 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 423 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 424 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 425 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 426 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 427 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 428 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 429 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 430 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 431 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 432 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 433 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 434 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 435 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 436 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 437 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 438 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96 |
| Metatranscriptomes | 0.24 |
| Isolates | 3.76 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 27.65 |
| Nodule | 1.18 |
| Rhizoplane | 4.24 |
| Rhizosphere | 55.29 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.65 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10003715 | 3300001979 | Bacteria | 6644 |
| 2 | JGI25155J39150_1000264 | 3300002704 | Bacteria | 19417 |
| 3 | JGI25156J39149_1000010 | 3300002705 | Bacteria | 200080 |
| 4 | JGI25156J39149_1014497 | 3300002705 | Bacteria | 1622 |
| 5 | JGI25156J39149_1020981 | 3300002705 | Bacteria | 1137 |
| 6 | JGI25154J39366_1000027 | 3300002738 | Bacteria | 200075 |
| 7 | JGI25154J39366_1003058 | 3300002738 | Bacteria | 3774 |
| 8 | JGI25157J39369_1000021 | 3300002741 | Bacteria | 163907 |
| 9 | JGI25157J39369_1000146 | 3300002741 | Bacteria | 59929 |
| 10 | JGI25157J39369_1000351 | 3300002741 | Bacteria | 32381 |
| 11 | JGI25152J39213_1000752 | 3300002773 | Bacteria | 16498 |
| 12 | JGI25150J39212_1004196 | 3300002774 | Bacteria | 3243 |
| 13 | JGI25150J39212_1004919 | 3300002774 | Bacteria | 2909 |
| 14 | JGI25150J39212_1006810 | 3300002774 | Bacteria | 2332 |
| 15 | JGI25159J45721_1000445 | 3300002987 | Bacteria | 19077 |
| 16 | JGI25159J45721_1002455 | 3300002987 | Bacteria | 7032 |
| 17 | JGI25159J45721_1014855 | 3300002987 | Bacteria | 1734 |
| 18 | JGI25151J46595_10052728 | 3300003187 | Bacteria | 1365 |
| 19 | JGI25151J46595_10062909 | 3300003187 | Bacteria | 1170 |
| 20 | JGI25151J46595_10062969 | 3300003187 | Bacteria | 1169 |
| 21 | JGI25153J46596_10014796 | 3300003215 | Bacteria | 3221 |
| 22 | rootH1_10029887 | 3300003316 | Bacteria | 1403 |
| 23 | rootH1_10029888 | 3300003316 | Bacteria | 1582 |
| 24 | rootH1_10083951 | 3300003316 | Bacteria | 1149 |
| 25 | rootL2_10000579 | 3300003322 | Bacteria | 16628 |
| 26 | rootL2_10014092 | 3300003322 | Bacteria | 1333 |
| 27 | rootL2_10051303 | 3300003322 | Bacteria | 1414 |
| 28 | rootH1_10016701 | 3300003323 | Bacteria | 1920 |
| 29 | rootH1_10042174 | 3300003323 | Bacteria | 1582 |
| 30 | rootH1_10049916 | 3300003323 | Bacteria | 1560 |
| 31 | JGI25160J50197_1000129 | 3300003354 | Bacteria | 68068 |
| 32 | JGI25160J50197_1024830 | 3300003354 | Bacteria | 1691 |
| 33 | JGI25161J50226_1000080 | 3300003374 | Bacteria | 79971 |
| 34 | Ga0055539_1000651 | 3300003752 | Bacteria | 9229 |
| 35 | Ga0055539_1009683 | 3300003752 | Bacteria | 1194 |
| 36 | Ga0055533_1000033 | 3300003756 | Bacteria | 265716 |
| 37 | Ga0055525_1000767 | 3300003759 | Bacteria | 10537 |
| 38 | Ga0055535_1000307 | 3300003761 | Bacteria | 49806 |
| 39 | Ga0055529_1000488 | 3300003763 | Bacteria | 36464 |
| 40 | Ga0055526_1007400 | 3300003771 | Bacteria | 5717 |
| 41 | Ga0055526_1009134 | 3300003771 | Bacteria | 4823 |
| 42 | Ga0055537_1007693 | 3300003773 | Bacteria | 2569 |
| 43 | Ga0055524_1000120 | 3300003775 | Bacteria | 91299 |
| 44 | Ga0055524_1000146 | 3300003775 | Bacteria | 84190 |
| 45 | Ga0055524_1000733 | 3300003775 | Bacteria | 22506 |
| 46 | Ga0055524_1005494 | 3300003775 | Bacteria | 5643 |
| 47 | Ga0055536_1007145 | 3300003781 | Bacteria | 5055 |
| 48 | Ga0055534_1005931 | 3300003784 | Bacteria | 3171 |
| 49 | Ga0055534_1024493 | 3300003784 | Bacteria | 977 |
| 50 | Ga0055528_1002282 | 3300003790 | Bacteria | 10398 |
| 51 | Ga0055528_1056769 | 3300003790 | Bacteria | 758 |
| 52 | Ga0055530_10006485 | 3300003791 | Bacteria | 5212 |
| 53 | Ga0055530_10007449 | 3300003791 | Bacteria | 4602 |
| 54 | Ga0055530_10026894 | 3300003791 | Bacteria | 1580 |
| 55 | Ga0055540_1000001 | 3300003792 | Bacteria | 466834 |
| 56 | Ga0055540_1000067 | 3300003792 | Bacteria | 122108 |
| 57 | Ga0055540_1004852 | 3300003792 | Bacteria | 5893 |
| 58 | Ga0055540_1008475 | 3300003792 | Bacteria | 3698 |
| 59 | Ga0055531_10000480 | 3300003794 | Bacteria | 36934 |
| 60 | Ga0055531_10001273 | 3300003794 | Bacteria | 19046 |
| 61 | Ga0055531_10002124 | 3300003794 | Bacteria | 13597 |
| 62 | Ga0055531_10007153 | 3300003794 | Bacteria | 6154 |
| 63 | Ga0055531_10021663 | 3300003794 | Bacteria | 2482 |
| 64 | Ga0055543_1000239 | 3300004625 | Bacteria | 42667 |
| 65 | Ga0055543_1001806 | 3300004625 | Bacteria | 7883 |
| 66 | Ga0065165_1000016 | 3300005262 | Bacteria | 286248 |
| 67 | Ga0065165_1000295 | 3300005262 | Bacteria | 84323 |
| 68 | Ga0065165_1001501 | 3300005262 | Bacteria | 24680 |
| 69 | Ga0065165_1055090 | 3300005262 | Bacteria | 1111 |
| 70 | Ga0065714_10150799 | 3300005288 | Bacteria | 1099 |
| 71 | Ga0065704_10082029 | 3300005289 | Bacteria | 3665 |
| 72 | Ga0065715_10098707 | 3300005293 | Bacteria | 3498 |
| 73 | Ga0070658_10055164 | 3300005327 | Bacteria | 3228 |
| 74 | Ga0070658_10131358 | 3300005327 | Bacteria | 2087 |
| 75 | Ga0070658_10192649 | 3300005327 | Bacteria | 1719 |
| 76 | Ga0070676_10075764 | 3300005328 | Bacteria | 2029 |
| 77 | Ga0070676_10123452 | 3300005328 | Bacteria | 1628 |
| 78 | Ga0070690_100045265 | 3300005330 | Bacteria | 2795 |
| 79 | Ga0070690_100171827 | 3300005330 | Bacteria | 1492 |
| 80 | Ga0070670_100213738 | 3300005331 | Bacteria | 1677 |
| 81 | Ga0070670_100219080 | 3300005331 | Bacteria | 1655 |
| 82 | Ga0070677_10008129 | 3300005333 | Bacteria | 3522 |
| 83 | Ga0068869_100006901 | 3300005334 | Bacteria | 7225 |
| 84 | Ga0068869_100462883 | 3300005334 | Bacteria | 1053 |
| 85 | Ga0070666_10308493 | 3300005335 | Bacteria | 1128 |
| 86 | Ga0070682_100304596 | 3300005337 | Bacteria | 1171 |
| 87 | Ga0070660_100096947 | 3300005339 | Bacteria | 2332 |
| 88 | Ga0070660_100178681 | 3300005339 | Bacteria | 1717 |
| 89 | Ga0070660_100291310 | 3300005339 | Bacteria | 1337 |
| 90 | Ga0070661_100007719 | 3300005344 | Bacteria | 7431 |
| 91 | Ga0070668_100063350 | 3300005347 | Bacteria | 2866 |
| 92 | Ga0070669_100026644 | 3300005353 | Bacteria | 4160 |
| 93 | Ga0070669_100093224 | 3300005353 | Bacteria | 2261 |
| 94 | Ga0070669_100239421 | 3300005353 | Bacteria | 1441 |
| 95 | Ga0070675_100315206 | 3300005354 | Bacteria | 1381 |
| 96 | Ga0070675_100358761 | 3300005354 | Bacteria | 1294 |
| 97 | Ga0070671_100007158 | 3300005355 | Bacteria | 8919 |
| 98 | Ga0070671_100009262 | 3300005355 | Bacteria | 7910 |
| 99 | Ga0070671_100405534 | 3300005355 | Bacteria | 1166 |
| 100 | Ga0070671_100728386 | 3300005355 | Bacteria | 861 |
| 101 | Ga0070674_100075398 | 3300005356 | Bacteria | 2395 |
| 102 | Ga0070674_100394874 | 3300005356 | Bacteria | 1129 |
| 103 | Ga0070673_100105779 | 3300005364 | Bacteria | 2325 |
| 104 | Ga0070673_100111483 | 3300005364 | Bacteria | 2269 |
| 105 | Ga0070673_100159226 | 3300005364 | Bacteria | 1919 |
| 106 | Ga0070673_100650071 | 3300005364 | Bacteria | 965 |
| 107 | Ga0070659_100001726 | 3300005366 | Bacteria | 15700 |
| 108 | Ga0070667_100010858 | 3300005367 | Bacteria | 7530 |
| 109 | Ga0070667_100134776 | 3300005367 | Bacteria | 2159 |
| 110 | Ga0070667_100761789 | 3300005367 | Bacteria | 898 |
| 111 | Ga0070708_100110016 | 3300005445 | Bacteria | 2531 |
| 112 | Ga0070663_100000226 | 3300005455 | Bacteria | 28442 |
| 113 | Ga0070678_100004379 | 3300005456 | Bacteria | 7998 |
| 114 | Ga0070678_100446201 | 3300005456 | Bacteria | 1132 |
| 115 | Ga0070681_10374680 | 3300005458 | Bacteria | 1334 |
| 116 | Ga0068867_100001941 | 3300005459 | Bacteria | 14401 |
| 117 | Ga0068867_100173038 | 3300005459 | Bacteria | 1711 |
| 118 | Ga0068867_100415805 | 3300005459 | Bacteria | 1138 |
| 119 | Ga0070707_100617116 | 3300005468 | Bacteria | 1047 |
| 120 | Ga0070679_100230208 | 3300005530 | Bacteria | 1813 |
| 121 | Ga0070684_100369827 | 3300005535 | Bacteria | 1320 |
| 122 | Ga0068853_100142484 | 3300005539 | Bacteria | 2152 |
| 123 | Ga0068853_100852996 | 3300005539 | Bacteria | 874 |
| 124 | Ga0070672_100005168 | 3300005543 | Bacteria | 8627 |
| 125 | Ga0070665_100300282 | 3300005548 | Bacteria | 1609 |
| 126 | Ga0068855_100095565 | 3300005563 | Bacteria | 3425 |
| 127 | Ga0068855_100306943 | 3300005563 | Bacteria | 1756 |
| 128 | Ga0068855_100809919 | 3300005563 | Bacteria | 995 |
| 129 | Ga0070664_100476314 | 3300005564 | Bacteria | 1148 |
| 130 | Ga0068857_100035461 | 3300005577 | Bacteria | 4418 |
| 131 | Ga0068857_100155748 | 3300005577 | Bacteria | 2072 |
| 132 | Ga0068854_100111674 | 3300005578 | Bacteria | 2062 |
| 133 | Ga0068854_100459358 | 3300005578 | Bacteria | 1065 |
| 134 | Ga0068856_100016853 | 3300005614 | Bacteria | 7081 |
| 135 | Ga0068856_100020989 | 3300005614 | Bacteria | 6346 |
| 136 | Ga0068864_100137148 | 3300005618 | Bacteria | 2204 |
| 137 | Ga0068864_100248084 | 3300005618 | Bacteria | 1652 |
| 138 | Ga0068861_100324978 | 3300005719 | Bacteria | 1341 |
| 139 | Ga0068851_10206900 | 3300005834 | Bacteria | 1097 |
| 140 | Ga0068863_100282268 | 3300005841 | Bacteria | 1609 |
| 141 | Ga0068860_100225833 | 3300005843 | Bacteria | 1819 |
| 142 | Ga0075365_10166779 | 3300006038 | Bacteria | 1536 |
| 143 | Ga0075368_10048243 | 3300006042 | Bacteria | 1687 |
| 144 | Ga0075363_100048837 | 3300006048 | Bacteria | 2251 |
| 145 | Ga0075363_100091748 | 3300006048 | Bacteria | 1672 |
| 146 | Ga0075363_100125655 | 3300006048 | Bacteria | 1436 |
| 147 | Ga0075363_100347380 | 3300006048 | Bacteria | 866 |
| 148 | Ga0075364_10100907 | 3300006051 | Bacteria | 1921 |
| 149 | Ga0075364_10161643 | 3300006051 | Bacteria | 1512 |
| 150 | Ga0075432_10062450 | 3300006058 | Bacteria | 1328 |
| 151 | Ga0075362_10032080 | 3300006177 | Bacteria | 2277 |
| 152 | Ga0075362_10043209 | 3300006177 | Bacteria | 1995 |
| 153 | Ga0075362_10052090 | 3300006177 | Bacteria | 1833 |
| 154 | Ga0075362_10052668 | 3300006177 | Bacteria | 1825 |
| 155 | Ga0075362_10090415 | 3300006177 | Bacteria | 1420 |
| 156 | Ga0075362_10172671 | 3300006177 | Bacteria | 1045 |
| 157 | Ga0075367_10050981 | 3300006178 | Bacteria | 2445 |
| 158 | Ga0075369_10024698 | 3300006186 | Bacteria | 2493 |
| 159 | Ga0075369_10222545 | 3300006186 | Bacteria | 874 |
| 160 | Ga0075366_10001953 | 3300006195 | Bacteria | 10427 |
| 161 | Ga0075366_10006604 | 3300006195 | Bacteria | 6364 |
| 162 | Ga0075366_10014699 | 3300006195 | Bacteria | 4474 |
| 163 | Ga0075366_10036060 | 3300006195 | Bacteria | 2915 |
| 164 | Ga0075366_10039564 | 3300006195 | Bacteria | 2787 |
| 165 | Ga0075366_10058904 | 3300006195 | Bacteria | 2282 |
| 166 | Ga0075366_10063663 | 3300006195 | Bacteria | 2192 |
| 167 | Ga0075366_10066059 | 3300006195 | Bacteria | 2151 |
| 168 | Ga0075366_10066159 | 3300006195 | Bacteria | 2150 |
| 169 | Ga0075366_10090117 | 3300006195 | Bacteria | 1836 |
| 170 | Ga0075366_10092421 | 3300006195 | Bacteria | 1813 |
| 171 | Ga0075366_10098875 | 3300006195 | Bacteria | 1750 |
| 172 | Ga0075366_10129493 | 3300006195 | Bacteria | 1523 |
| 173 | Ga0075366_10180326 | 3300006195 | Bacteria | 1283 |
| 174 | Ga0075366_10333389 | 3300006195 | Bacteria | 930 |
| 175 | Ga0075366_10454251 | 3300006195 | Bacteria | 791 |
| 176 | Ga0097621_100052565 | 3300006237 | Bacteria | 3319 |
| 177 | Ga0075370_10000954 | 3300006353 | Bacteria | 11903 |
| 178 | Ga0075370_10001826 | 3300006353 | Bacteria | 9524 |
| 179 | Ga0075370_10002711 | 3300006353 | Bacteria | 8289 |
| 180 | Ga0075370_10031240 | 3300006353 | Bacteria | 2972 |
| 181 | Ga0075370_10050514 | 3300006353 | Bacteria | 2359 |
| 182 | Ga0075370_10102663 | 3300006353 | Bacteria | 1656 |
| 183 | Ga0068871_100143810 | 3300006358 | Bacteria | 2029 |
| 184 | Ga0075428_100408943 | 3300006844 | Bacteria | 1454 |
| 185 | Ga0075430_100342555 | 3300006846 | Bacteria | 1235 |
| 186 | Ga0075429_100428302 | 3300006880 | Bacteria | 1159 |
| 187 | Ga0068865_100085871 | 3300006881 | Bacteria | 2271 |
| 188 | Ga0099824_1030030 | 3300006942 | Bacteria | 2231 |
| 189 | Ga0099823_1000101 | 3300006944 | Bacteria | 41834 |
| 190 | Ga0079104_1000001 | 3300006946 | Bacteria | 521847 |
| 191 | Ga0079104_1000072 | 3300006946 | Bacteria | 152567 |
| 192 | Ga0079104_1028202 | 3300006946 | Bacteria | 1429 |
| 193 | Ga0099826_10141023 | 3300006948 | Bacteria | 1392 |
| 194 | Ga0105244_10063490 | 3300009036 | Bacteria | 1855 |
| 195 | Ga0105250_10000680 | 3300009092 | Bacteria | 21348 |
| 196 | Ga0105240_10171884 | 3300009093 | Bacteria | 2566 |
| 197 | Ga0105240_10314240 | 3300009093 | Bacteria | 1788 |
| 198 | Ga0105240_10331162 | 3300009093 | Bacteria | 1733 |
| 199 | Ga0105240_10880735 | 3300009093 | Bacteria | 964 |
| 200 | Ga0105240_10962580 | 3300009093 | Bacteria | 915 |
| 201 | Ga0114129_10478674 | 3300009147 | Bacteria | 1629 |
| 202 | Ga0105243_10002347 | 3300009148 | Bacteria | 15835 |
| 203 | Ga0105243_10035553 | 3300009148 | Bacteria | 3863 |
| 204 | Ga0105243_10965989 | 3300009148 | Bacteria | 852 |
| 205 | Ga0105242_10012979 | 3300009176 | Bacteria | 6423 |
| 206 | Ga0105242_10211390 | 3300009176 | Bacteria | 1729 |
| 207 | Ga0105248_10007163 | 3300009177 | Bacteria | 12236 |
| 208 | Ga0105248_10214122 | 3300009177 | Bacteria | 2170 |
| 209 | Ga0105248_10540780 | 3300009177 | Bacteria | 1314 |
| 210 | Ga0105248_11260356 | 3300009177 | Bacteria | 836 |
| 211 | Ga0105237_10001471 | 3300009545 | Bacteria | 31034 |
| 212 | Ga0105237_10487407 | 3300009545 | Bacteria | 1239 |
| 213 | Ga0105238_10053658 | 3300009551 | Bacteria | 4050 |
| 214 | Ga0105238_10467434 | 3300009551 | Bacteria | 1260 |
| 215 | Ga0105239_10003011 | 3300010375 | Bacteria | 20996 |
| 216 | Ga0105239_10020553 | 3300010375 | Bacteria | 7284 |
| 217 | Ga0157317_1000388 | 3300012475 | Bacteria | 1808 |
| 218 | Ga0157319_1000015 | 3300012497 | Bacteria | 130857 |
| 219 | Ga0157370_10370307 | 3300013104 | Bacteria | 1320 |
| 220 | Ga0157369_10055954 | 3300013105 | Bacteria | 4257 |
| 221 | Ga0157369_10817373 | 3300013105 | Bacteria | 957 |
| 222 | Ga0157374_10016697 | 3300013296 | Bacteria | 6457 |
| 223 | Ga0157374_10571637 | 3300013296 | Bacteria | 1139 |
| 224 | Ga0157378_10252643 | 3300013297 | Bacteria | 1688 |
| 225 | Ga0157378_11103912 | 3300013297 | Bacteria | 830 |
| 226 | Ga0163162_10148095 | 3300013306 | Bacteria | 2464 |
| 227 | Ga0163162_10149785 | 3300013306 | Bacteria | 2450 |
| 228 | Ga0157372_11019184 | 3300013307 | Bacteria | 959 |
| 229 | Ga0157375_10143413 | 3300013308 | Bacteria | 2517 |
| 230 | Ga0163163_10469441 | 3300014325 | Bacteria | 1319 |
| 231 | Ga0163163_11028806 | 3300014325 | Bacteria | 887 |
| 232 | Ga0157380_10476896 | 3300014326 | Bacteria | 1205 |
| 233 | Ga0157380_11221444 | 3300014326 | Bacteria | 796 |
| 234 | Ga0182008_10003510 | 3300014497 | Bacteria | 9451 |
| 235 | Ga0182008_10018684 | 3300014497 | Bacteria | 3587 |
| 236 | Ga0182008_10075392 | 3300014497 | Bacteria | 1659 |
| 237 | Ga0157377_10076280 | 3300014745 | Bacteria | 1949 |
| 238 | Ga0157379_10369461 | 3300014968 | Bacteria | 1315 |
| 239 | Ga0157379_10655909 | 3300014968 | Bacteria | 983 |
| 240 | Ga0157376_10292276 | 3300014969 | Bacteria | 1539 |
| 241 | Ga0182007_10009603 | 3300015262 | Bacteria | 3887 |
| 242 | Ga0182005_1021523 | 3300015265 | Bacteria | 1768 |
| 243 | Ga0183362_10005 | 3300015683 | Bacteria | 437616 |
| 244 | Ga0163161_10021384 | 3300017792 | Bacteria | 4547 |
| 245 | Ga0163161_10141927 | 3300017792 | Bacteria | 1819 |
| 246 | Ga0213872_10000068 | 3300021361 | Bacteria | 91693 |
| 247 | Ga0213872_10000132 | 3300021361 | Bacteria | 67609 |
| 248 | Ga0213872_10023786 | 3300021361 | Bacteria | 2818 |
| 249 | Ga0209435_100003 | 3300025206 | Bacteria | 669534 |
| 250 | Ga0209674_100064 | 3300025226 | Bacteria | 265769 |
| 251 | Ga0209563_100099 | 3300025230 | Bacteria | 153336 |
| 252 | Ga0209563_114383 | 3300025230 | Bacteria | 1017 |
| 253 | Ga0207427_101039 | 3300025231 | Bacteria | 11567 |
| 254 | Ga0209258_100319 | 3300025242 | Bacteria | 74569 |
| 255 | Ga0209258_100699 | 3300025242 | Bacteria | 22932 |
| 256 | Ga0207425_1002311 | 3300025245 | Bacteria | 6842 |
| 257 | Ga0207425_1003440 | 3300025245 | Bacteria | 5070 |
| 258 | Ga0207425_1005823 | 3300025245 | Bacteria | 3456 |
| 259 | Ga0209646_1000008 | 3300025246 | Bacteria | 669534 |
| 260 | Ga0209646_1000060 | 3300025246 | Bacteria | 256386 |
| 261 | Ga0209026_1000007 | 3300025250 | Bacteria | 669534 |
| 262 | Ga0209026_1000049 | 3300025250 | Bacteria | 255273 |
| 263 | Ga0209026_1035999 | 3300025250 | Bacteria | 725 |
| 264 | Ga0209677_100175 | 3300025253 | Bacteria | 55052 |
| 265 | Ga0209677_100782 | 3300025253 | Bacteria | 16014 |
| 266 | Ga0209759_1000019 | 3300025256 | Bacteria | 357908 |
| 267 | Ga0209759_1000069 | 3300025256 | Bacteria | 182437 |
| 268 | Ga0209759_1001175 | 3300025256 | Bacteria | 16458 |
| 269 | Ga0209759_1002013 | 3300025256 | Bacteria | 9668 |
| 270 | Ga0209759_1004778 | 3300025256 | Bacteria | 4945 |
| 271 | Ga0209759_1021590 | 3300025256 | Bacteria | 1460 |
| 272 | Ga0209759_1037604 | 3300025256 | Bacteria | 869 |
| 273 | Ga0209129_1000062 | 3300025258 | Bacteria | 240655 |
| 274 | Ga0209565_1000116 | 3300025263 | Bacteria | 114340 |
| 275 | Ga0209565_1001214 | 3300025263 | Bacteria | 12172 |
| 276 | Ga0209565_1017359 | 3300025263 | Bacteria | 1579 |
| 277 | Ga0207666_1003182 | 3300025271 | Bacteria | 2006 |
| 278 | Ga0209455_1000157 | 3300025272 | Bacteria | 119719 |
| 279 | Ga0209673_1001210 | 3300025273 | Bacteria | 27444 |
| 280 | Ga0209673_1013829 | 3300025273 | Bacteria | 3163 |
| 281 | Ga0209673_1022830 | 3300025273 | Bacteria | 2146 |
| 282 | Ga0209673_1028406 | 3300025273 | Bacteria | 1801 |
| 283 | Ga0209130_1000095 | 3300025284 | Bacteria | 145126 |
| 284 | Ga0209130_1000134 | 3300025284 | Bacteria | 119102 |
| 285 | Ga0209675_1000373 | 3300025291 | Bacteria | 38099 |
| 286 | Ga0209675_1005068 | 3300025291 | Bacteria | 5630 |
| 287 | Ga0209675_1045089 | 3300025291 | Bacteria | 940 |
| 288 | Ga0209676_1000145 | 3300025292 | Bacteria | 174391 |
| 289 | Ga0209676_1008763 | 3300025292 | Bacteria | 4458 |
| 290 | Ga0209676_1031787 | 3300025292 | Bacteria | 1595 |
| 291 | Ga0209025_1007514 | 3300025294 | Bacteria | 8096 |
| 292 | Ga0209025_1018512 | 3300025294 | Bacteria | 3938 |
| 293 | Ga0209025_1021495 | 3300025294 | Bacteria | 3472 |
| 294 | Ga0209025_1041211 | 3300025294 | Bacteria | 1981 |
| 295 | Ga0209564_1000008 | 3300025295 | Bacteria | 953227 |
| 296 | Ga0209564_1000176 | 3300025295 | Bacteria | 152363 |
| 297 | Ga0209564_1004068 | 3300025295 | Bacteria | 9222 |
| 298 | Ga0209564_1006206 | 3300025295 | Bacteria | 6529 |
| 299 | Ga0209758_1000129 | 3300025297 | Bacteria | 185022 |
| 300 | Ga0209758_1000327 | 3300025297 | Bacteria | 89663 |
| 301 | Ga0209758_1016925 | 3300025297 | Bacteria | 3669 |
| 302 | Ga0209758_1096062 | 3300025297 | Bacteria | 855 |
| 303 | Ga0209050_1000023 | 3300025298 | Bacteria | 537172 |
| 304 | Ga0209050_1000118 | 3300025298 | Bacteria | 202586 |
| 305 | Ga0209050_1001120 | 3300025298 | Bacteria | 32400 |
| 306 | Ga0209050_1002654 | 3300025298 | Bacteria | 14636 |
| 307 | Ga0209050_1010700 | 3300025298 | Bacteria | 4477 |
| 308 | Ga0209050_1017603 | 3300025298 | Bacteria | 2834 |
| 309 | Ga0209256_1000003 | 3300025299 | Bacteria | 1661127 |
| 310 | Ga0209256_1000015 | 3300025299 | Bacteria | 622953 |
| 311 | Ga0209256_1005979 | 3300025299 | Bacteria | 6687 |
| 312 | Ga0209256_1008383 | 3300025299 | Bacteria | 4810 |
| 313 | Ga0207426_1000397 | 3300025302 | Bacteria | 73966 |
| 314 | Ga0207426_1031894 | 3300025302 | Bacteria | 1715 |
| 315 | Ga0209051_1000017 | 3300025303 | Bacteria | 537172 |
| 316 | Ga0209051_1000018 | 3300025303 | Bacteria | 527061 |
| 317 | Ga0209051_1000456 | 3300025303 | Bacteria | 54000 |
| 318 | Ga0209051_1002067 | 3300025303 | Bacteria | 15222 |
| 319 | Ga0209051_1002891 | 3300025303 | Bacteria | 11797 |
| 320 | Ga0209051_1046473 | 3300025303 | Bacteria | 1493 |
| 321 | Ga0209257_1000015 | 3300025304 | Bacteria | 908141 |
| 322 | Ga0209257_1000041 | 3300025304 | Bacteria | 537172 |
| 323 | Ga0209257_1000324 | 3300025304 | Bacteria | 100144 |
| 324 | Ga0209257_1002253 | 3300025304 | Bacteria | 19751 |
| 325 | Ga0209257_1003886 | 3300025304 | Bacteria | 12194 |
| 326 | Ga0209257_1056523 | 3300025304 | Bacteria | 1083 |
| 327 | Ga0207697_10011905 | 3300025315 | Bacteria | 3664 |
| 328 | Ga0207696_1002009 | 3300025711 | Bacteria | 10296 |
| 329 | Ga0207682_10011022 | 3300025893 | Bacteria | 3538 |
| 330 | Ga0207642_10085586 | 3300025899 | Bacteria | 1543 |
| 331 | Ga0207688_10070573 | 3300025901 | Bacteria | 1981 |
| 332 | Ga0207680_10186033 | 3300025903 | Bacteria | 1407 |
| 333 | Ga0207645_10037665 | 3300025907 | Bacteria | 3103 |
| 334 | Ga0207645_10098849 | 3300025907 | Bacteria | 1882 |
| 335 | Ga0207705_10119401 | 3300025909 | Bacteria | 1955 |
| 336 | Ga0207705_10364619 | 3300025909 | Bacteria | 1114 |
| 337 | Ga0207684_10245880 | 3300025910 | Bacteria | 1544 |
| 338 | Ga0207654_10069835 | 3300025911 | Bacteria | 2083 |
| 339 | Ga0207707_10631970 | 3300025912 | Bacteria | 904 |
| 340 | Ga0207695_10009579 | 3300025913 | Bacteria | 11969 |
| 341 | Ga0207695_10016584 | 3300025913 | Bacteria | 8611 |
| 342 | Ga0207695_10196087 | 3300025913 | Bacteria | 1935 |
| 343 | Ga0207671_10013202 | 3300025914 | Bacteria | 6592 |
| 344 | Ga0207671_10318775 | 3300025914 | Bacteria | 1230 |
| 345 | Ga0207657_10216323 | 3300025919 | Bacteria | 1536 |
| 346 | Ga0207649_10002028 | 3300025920 | Bacteria | 11519 |
| 347 | Ga0207652_10057081 | 3300025921 | Bacteria | 3362 |
| 348 | Ga0207646_10404822 | 3300025922 | Bacteria | 1232 |
| 349 | Ga0207681_10035624 | 3300025923 | Bacteria | 3280 |
| 350 | Ga0207694_10021765 | 3300025924 | Bacteria | 4859 |
| 351 | Ga0207694_10274909 | 3300025924 | Bacteria | 1382 |
| 352 | Ga0207650_10017584 | 3300025925 | Bacteria | 5007 |
| 353 | Ga0207650_10168936 | 3300025925 | Bacteria | 1737 |
| 354 | Ga0207659_10001102 | 3300025926 | Bacteria | 16008 |
| 355 | Ga0207644_10000537 | 3300025931 | Bacteria | 24617 |
| 356 | Ga0207644_10106468 | 3300025931 | Bacteria | 2114 |
| 357 | Ga0207690_10002544 | 3300025932 | Bacteria | 11021 |
| 358 | Ga0207690_10157275 | 3300025932 | Bacteria | 1691 |
| 359 | Ga0207706_10620741 | 3300025933 | Bacteria | 927 |
| 360 | Ga0207686_10010264 | 3300025934 | Bacteria | 5095 |
| 361 | Ga0207686_10410455 | 3300025934 | Bacteria | 1034 |
| 362 | Ga0207709_10000132 | 3300025935 | Bacteria | 109578 |
| 363 | Ga0207709_10018759 | 3300025935 | Bacteria | 3879 |
| 364 | Ga0207709_10175770 | 3300025935 | Bacteria | 1507 |
| 365 | Ga0207669_10076629 | 3300025937 | Bacteria | 2123 |
| 366 | Ga0207669_10083862 | 3300025937 | Bacteria | 2051 |
| 367 | Ga0207669_10457492 | 3300025937 | Bacteria | 1013 |
| 368 | Ga0207691_10002343 | 3300025940 | Bacteria | 18561 |
| 369 | Ga0207711_10045155 | 3300025941 | Bacteria | 3764 |
| 370 | Ga0207689_10006852 | 3300025942 | Bacteria | 10021 |
| 371 | Ga0207679_10000647 | 3300025945 | Bacteria | 23264 |
| 372 | Ga0207679_10691594 | 3300025945 | Bacteria | 925 |
| 373 | Ga0207667_10133371 | 3300025949 | Bacteria | 2558 |
| 374 | Ga0207667_10372014 | 3300025949 | Bacteria | 1456 |
| 375 | Ga0207651_10009684 | 3300025960 | Bacteria | 5295 |
| 376 | Ga0207651_10099185 | 3300025960 | Bacteria | 2156 |
| 377 | Ga0207640_10082829 | 3300025981 | Bacteria | 2198 |
| 378 | Ga0207640_10336679 | 3300025981 | Bacteria | 1207 |
| 379 | Ga0207640_10380766 | 3300025981 | Bacteria | 1143 |
| 380 | Ga0207658_10060560 | 3300025986 | Bacteria | 2825 |
| 381 | Ga0207658_10127736 | 3300025986 | Bacteria | 2037 |
| 382 | Ga0207677_10114502 | 3300026023 | Bacteria | 2015 |
| 383 | Ga0207639_10203670 | 3300026041 | Bacteria | 1699 |
| 384 | Ga0207639_10217663 | 3300026041 | Bacteria | 1647 |
| 385 | Ga0207639_10427923 | 3300026041 | Bacteria | 1198 |
| 386 | Ga0207678_10000644 | 3300026067 | Bacteria | 32105 |
| 387 | Ga0207702_10005245 | 3300026078 | Bacteria | 11378 |
| 388 | Ga0207702_10039951 | 3300026078 | Bacteria | 3933 |
| 389 | Ga0207641_10052852 | 3300026088 | Bacteria | 3442 |
| 390 | Ga0207641_10245768 | 3300026088 | Bacteria | 1669 |
| 391 | Ga0207648_10012148 | 3300026089 | Bacteria | 8071 |
| 392 | Ga0207648_10013271 | 3300026089 | Bacteria | 7676 |
| 393 | Ga0207648_10158469 | 3300026089 | Bacteria | 1999 |
| 394 | Ga0207648_10211078 | 3300026089 | Bacteria | 1723 |
| 395 | Ga0207676_10041554 | 3300026095 | Bacteria | 3531 |
| 396 | Ga0207676_10120268 | 3300026095 | Bacteria | 2213 |
| 397 | Ga0207674_10126161 | 3300026116 | Bacteria | 2525 |
| 398 | Ga0207674_10703547 | 3300026116 | Bacteria | 975 |
| 399 | Ga0207675_100199947 | 3300026118 | Bacteria | 1919 |
| 400 | Ga0207683_10102933 | 3300026121 | Bacteria | 2550 |
| 401 | Ga0207683_10162030 | 3300026121 | Bacteria | 2022 |
| 402 | Ga0207698_10108356 | 3300026142 | Bacteria | 2322 |
| 403 | Ga0207698_10223884 | 3300026142 | Bacteria | 1702 |
| 404 | Ga0207698_10388720 | 3300026142 | Bacteria | 1330 |
| 405 | Ga0209281_1000002 | 3300027111 | Bacteria | 1924012 |
| 406 | Ga0209281_1000151 | 3300027111 | Bacteria | 167268 |
| 407 | Ga0209973_1005543 | 3300027252 | Bacteria | 1347 |
| 408 | Ga0209389_1001650 | 3300027296 | Bacteria | 16043 |
| 409 | Ga0209371_1005027 | 3300027312 | Bacteria | 5450 |
| 410 | Ga0209996_1001287 | 3300027395 | Bacteria | 3012 |
| 411 | Ga0209984_1000927 | 3300027424 | Bacteria | 3136 |
| 412 | Ga0209968_1000086 | 3300027526 | Bacteria | 16448 |
| 413 | Ga0209999_1035045 | 3300027543 | Bacteria | 935 |
| 414 | Ga0209970_1000061 | 3300027614 | Bacteria | 14543 |
| 415 | Ga0209983_1010179 | 3300027665 | Bacteria | 1921 |
| 416 | Ga0209983_1038061 | 3300027665 | Bacteria | 1037 |
| 417 | Ga0209971_1000817 | 3300027682 | Bacteria | 8001 |
| 418 | Ga0209966_1000084 | 3300027695 | Bacteria | 40899 |
| 419 | Ga0209974_10002610 | 3300027876 | Bacteria | 6539 |
| 420 | Ga0209974_10013714 | 3300027876 | Bacteria | 2700 |
| 421 | Ga0268266_10055366 | 3300028379 | Bacteria | 3410 |
| 422 | Ga0268266_10178609 | 3300028379 | Bacteria | 1931 |
| 423 | Ga0268266_10316773 | 3300028379 | Bacteria | 1459 |
| 424 | Ga0268266_10844590 | 3300028379 | Bacteria | 885 |
| 425 | Ga0265334_10057688 | 3300028573 | Bacteria | 1471 |
| 426 | Ga0265336_10000040 | 3300028666 | Bacteria | 138266 |
| 427 | Ga0307517_10001975 | 3300028786 | Bacteria | 33407 |
| 428 | Ga0307515_10005119 | 3300028794 | Bacteria | 26636 |
| 429 | Ga0307515_10044865 | 3300028794 | Bacteria | 6812 |
| 430 | Ga0307515_10053971 | 3300028794 | Bacteria | 5911 |
| 431 | Ga0307515_10064108 | 3300028794 | Bacteria | 5143 |
| 432 | Ga0307515_10264829 | 3300028794 | Bacteria | 1449 |
| 433 | Ga0265324_10004950 | 3300029957 | Bacteria | 5856 |
| 434 | Ga0268256_1004264 | 3300030500 | Bacteria | 6002 |
| 435 | Ga0307511_10000144 | 3300030521 | Bacteria | 66850 |
| 436 | Ga0307512_10084973 | 3300030522 | Bacteria | 2246 |
| 437 | Ga0307512_10095143 | 3300030522 | Bacteria | 2051 |
| 438 | Ga0307512_10095711 | 3300030522 | Bacteria | 2041 |
| 439 | Ga0307512_10198141 | 3300030522 | Bacteria | 1093 |
| 440 | Ga0265330_10000110 | 3300031235 | Bacteria | 68461 |
| 441 | Ga0265332_10000011 | 3300031238 | Bacteria | 284299 |
| 442 | Ga0265332_10000027 | 3300031238 | Bacteria | 190796 |
| 443 | Ga0265332_10003699 | 3300031238 | Bacteria | 7320 |
| 444 | Ga0265328_10029761 | 3300031239 | Bacteria | 2037 |
| 445 | Ga0265340_10134722 | 3300031247 | Bacteria | 1131 |
| 446 | Ga0265331_10008263 | 3300031250 | Bacteria | 5932 |
| 447 | Ga0265327_10000042 | 3300031251 | Bacteria | 287487 |
| 448 | Ga0265327_10000158 | 3300031251 | Bacteria | 145905 |
| 449 | Ga0265327_10006235 | 3300031251 | Bacteria | 9607 |
| 450 | Ga0265316_10325976 | 3300031344 | Bacteria | 1115 |
| 451 | Ga0307513_10000104 | 3300031456 | Bacteria | 119239 |
| 452 | Ga0307513_10014677 | 3300031456 | Bacteria | 9536 |
| 453 | Ga0307513_10103621 | 3300031456 | Bacteria | 2861 |
| 454 | Ga0307513_10181687 | 3300031456 | Bacteria | 1966 |
| 455 | Ga0307509_10009555 | 3300031507 | Bacteria | 12087 |
| 456 | Ga0307509_10237953 | 3300031507 | Bacteria | 1616 |
| 457 | Ga0307509_10457598 | 3300031507 | Bacteria | 969 |
| 458 | Ga0307509_10534446 | 3300031507 | Bacteria | 852 |
| 459 | Ga0307408_100000131 | 3300031548 | Bacteria | 83295 |
| 460 | Ga0307408_100038396 | 3300031548 | Bacteria | 3379 |
| 461 | Ga0307408_100198707 | 3300031548 | Bacteria | 1621 |
| 462 | Ga0307408_100882047 | 3300031548 | Bacteria | 817 |
| 463 | Ga0307408_100962614 | 3300031548 | Bacteria | 785 |
| 464 | Ga0307508_10000271 | 3300031616 | Bacteria | 63576 |
| 465 | Ga0307508_10003497 | 3300031616 | Bacteria | 15837 |
| 466 | Ga0307508_10259716 | 3300031616 | Bacteria | 1332 |
| 467 | Ga0307508_10391419 | 3300031616 | Bacteria | 981 |
| 468 | Ga0307514_10000558 | 3300031649 | Bacteria | 71090 |
| 469 | Ga0307514_10004100 | 3300031649 | Bacteria | 13518 |
| 470 | Ga0265314_10000026 | 3300031711 | Bacteria | 284299 |
| 471 | Ga0265314_10004418 | 3300031711 | Bacteria | 13056 |
| 472 | Ga0265314_10179414 | 3300031711 | Bacteria | 1271 |
| 473 | Ga0307516_10003164 | 3300031730 | Bacteria | 21417 |
| 474 | Ga0307516_10089269 | 3300031730 | Bacteria | 2913 |
| 475 | Ga0307516_10126387 | 3300031730 | Bacteria | 2341 |
| 476 | Ga0307516_10185772 | 3300031730 | Bacteria | 1809 |
| 477 | Ga0307516_10211370 | 3300031730 | Bacteria | 1654 |
| 478 | Ga0307516_10306335 | 3300031730 | Bacteria | 1263 |
| 479 | Ga0307413_10369239 | 3300031824 | Bacteria | 1114 |
| 480 | Ga0307410_10095895 | 3300031852 | Bacteria | 2116 |
| 481 | Ga0307406_10007581 | 3300031901 | Bacteria | 6025 |
| 482 | Ga0307406_10121124 | 3300031901 | Bacteria | 1819 |
| 483 | Ga0307406_10140648 | 3300031901 | Bacteria | 1708 |
| 484 | Ga0307412_10246354 | 3300031911 | Bacteria | 1385 |
| 485 | Ga0307412_10335494 | 3300031911 | Bacteria | 1208 |
| 486 | Ga0307412_10345613 | 3300031911 | Bacteria | 1192 |
| 487 | Ga0307412_10347407 | 3300031911 | Bacteria | 1190 |
| 488 | Ga0307412_10540681 | 3300031911 | Bacteria | 977 |
| 489 | Ga0307416_100208100 | 3300032002 | Bacteria | 1863 |
| 490 | Ga0307416_100290074 | 3300032002 | Bacteria | 1619 |
| 491 | Ga0307416_100454592 | 3300032002 | Bacteria | 1334 |
| 492 | Ga0307416_100509776 | 3300032002 | Bacteria | 1269 |
| 493 | Ga0307414_10068509 | 3300032004 | Bacteria | 2547 |
| 494 | Ga0307411_10226646 | 3300032005 | Bacteria | 1454 |
| 495 | Ga0307507_10132512 | 3300033179 | Bacteria | 1944 |
| 496 | Ga0307510_10029427 | 3300033180 | Bacteria | 6252 |
| 497 | Ga0307510_10041455 | 3300033180 | Bacteria | 5032 |
| 498 | Ga0307510_10150256 | 3300033180 | Bacteria | 1950 |
| 499 | Ga0373934_0169026 | 3300035086 | Bacteria | 897 |
| 500 | Ga0373931_0015954 | 3300035691 | Bacteria | 3691 |
| 501 | Ga0373937_0127620 | 3300036401 | Bacteria | 2374 |
| 502 | Ga0395899_0010279 | 3300037312 | Bacteria | 7174 |
| 503 | Ga0395899_0135733 | 3300037312 | Bacteria | 1754 |
| 504 | Ga0395899_0251091 | 3300037312 | Bacteria | 1214 |
| 505 | Ga0395900_0000058 | 3300037418 | Bacteria | 206785 |
| 506 | Ga0395900_0138988 | 3300037418 | Bacteria | 2488 |
| 507 | Ga0395900_0380144 | 3300037418 | Bacteria | 1380 |
| 508 | Ga0395900_0775401 | 3300037418 | Bacteria | 888 |
| 509 | Ga0395898_0000283 | 3300037466 | Bacteria | 122630 |
| 510 | Ga0395898_0025536 | 3300037466 | Bacteria | 5951 |
| 511 | Ga0395898_0365130 | 3300037466 | Bacteria | 1377 |
| 512 | Ga0395898_0755809 | 3300037466 | Bacteria | 913 |
| 513 | Ga0395905_0000212 | 3300037471 | Bacteria | 89838 |
| 514 | Ga0395905_0000672 | 3300037471 | Bacteria | 45490 |
| 515 | Ga0395905_0001350 | 3300037471 | Bacteria | 29884 |
| 516 | Ga0395905_0035342 | 3300037471 | Bacteria | 4692 |
| 517 | Ga0395905_0036695 | 3300037471 | Bacteria | 4604 |
| 518 | Ga0395905_0051508 | 3300037471 | Bacteria | 3856 |
| 519 | Ga0395905_0078432 | 3300037471 | Bacteria | 3095 |
| 520 | Ga0395905_0081944 | 3300037471 | Bacteria | 3023 |
| 521 | Ga0395905_0131971 | 3300037471 | Bacteria | 2349 |
| 522 | Ga0395905_0153417 | 3300037471 | Bacteria | 2166 |
| 523 | Ga0395905_0188487 | 3300037471 | Bacteria | 1935 |
| 524 | Ga0395905_0190268 | 3300037471 | Bacteria | 1925 |
| 525 | Ga0395905_0214672 | 3300037471 | Bacteria | 1802 |
| 526 | Ga0395905_0219376 | 3300037471 | Bacteria | 1780 |
| 527 | Ga0395905_0369071 | 3300037471 | Bacteria | 1328 |
| 528 | Ga0395905_0676674 | 3300037471 | Bacteria | 934 |
| 529 | Ga0395905_0789584 | 3300037471 | Bacteria | 852 |
| 530 | Ga0395901_0003173 | 3300038443 | Bacteria | 16538 |
| 531 | Ga0395901_0037127 | 3300038443 | Bacteria | 5039 |
| 532 | Ga0395901_0059598 | 3300038443 | Bacteria | 3971 |
| 533 | Ga0395901_0080774 | 3300038443 | Bacteria | 3395 |
| 534 | Ga0395901_0276095 | 3300038443 | Bacteria | 1747 |
| 535 | Ga0395901_0449369 | 3300038443 | Bacteria | 1318 |
| 536 | Ga0395901_0558458 | 3300038443 | Bacteria | 1159 |
| 537 | Ga0242420_010152 | 3300038996 | Bacteria | 1559 |
| 538 | Ga0436361_0144777 | 3300039447 | Bacteria | 2492 |
| 539 | Ga0436361_0793297 | 3300039447 | Bacteria | 22989 |
| 540 | Ga0436361_1206467 | 3300039447 | Bacteria | 80244 |
| 541 | Ga0439436_0045552 | 3300041404 | Bacteria | 1248 |
| 542 | Ga0439438_051623 | 3300041405 | Bacteria | 1044 |
| 543 | Ga0439438_057224 | 3300041405 | Bacteria | 981 |
| 544 | Ga0451787_558123 | 3300041441 | Bacteria | 1436 |
| 545 | Ga0451797_0055608 | 3300041453 | Bacteria | 1105 |
| 546 | Ga0451798_0677714 | 3300041458 | Bacteria | 2400 |
| 547 | Ga0451800_0260100 | 3300041459 | Bacteria | 2393 |
| 548 | Ga0451800_0550407 | 3300041459 | Bacteria | 989 |
| 549 | Ga0451802_0380592 | 3300041460 | Bacteria | 1270 |
| 550 | Ga0451802_1761845 | 3300041460 | Bacteria | 2765 |
| 551 | Ga0451804_0372939 | 3300041463 | Bacteria | 770 |
| 552 | Ga0451804_0450657 | 3300041463 | Bacteria | 2037 |
| 553 | Ga0451804_1107278 | 3300041463 | Bacteria | 794 |
| 554 | Ga0451807_0033591 | 3300041486 | Bacteria | 1054 |
| 555 | Ga0451807_0378624 | 3300041486 | Bacteria | 2224 |
| 556 | Ga0451807_0511307 | 3300041486 | Bacteria | 1698 |
| 557 | Ga0451833_0440785 | 3300041491 | Bacteria | 737 |
| 558 | Ga0451837_0311690 | 3300041494 | Bacteria | 836 |
| 559 | Ga0451845_0484302 | 3300041501 | Bacteria | 1134 |
| 560 | Ga0451847_0563971 | 3300041503 | Bacteria | 869 |
| 561 | Ga0451851_0371223 | 3300041507 | Bacteria | 862 |
| 562 | Ga0451853_2273887 | 3300041512 | Bacteria | 2106 |
| 563 | Ga0439433_0010034 | 3300041999 | Bacteria | 2067 |
| 564 | Ga0439433_0059453 | 3300041999 | Bacteria | 910 |
| 565 | Ga0439442_017630 | 3300042002 | Bacteria | 1474 |
| 566 | Ga0439449_0011120 | 3300042007 | Bacteria | 3392 |
| 567 | Ga0439449_0014829 | 3300042007 | Bacteria | 2929 |
| 568 | Ga0439455_0036044 | 3300042012 | Bacteria | 1250 |
| 569 | Ga0439462_0027913 | 3300042015 | Bacteria | 1491 |
| 570 | Ga0450919_000087 | 3300042121 | Bacteria | 9017 |
| 571 | Ga0450920_047060 | 3300042122 | Bacteria | 862 |
| 572 | Ga0450923_021693 | 3300042125 | Bacteria | 1254 |
| 573 | Ga0450890_004502 | 3300042127 | Bacteria | 1820 |
| 574 | Ga0450898_006055 | 3300042134 | Bacteria | 1846 |
| 575 | Ga0450898_007978 | 3300042134 | Bacteria | 1660 |
| 576 | Ga0450906_015933 | 3300042145 | Bacteria | 1363 |
| 577 | Ga0439446_0019867 | 3300042156 | Bacteria | 1889 |
| 578 | Ga0439444_0060284 | 3300042437 | Bacteria | 791 |
| 579 | Ga0439459_0001722 | 3300042438 | Bacteria | 3270 |
| 580 | Ga0439464_0001997 | 3300042439 | Bacteria | 4945 |
| 581 | Ga0439464_0028968 | 3300042439 | Bacteria | 1545 |
| 582 | Ga0450918_000012 | 3300042531 | Bacteria | 36451 |
| 583 | Ga0450893_0007476 | 3300042532 | Bacteria | 1775 |
| 584 | Ga0450893_0011256 | 3300042532 | Bacteria | 1477 |
| 585 | Ga0451577_0000166 | 3300042876 | Bacteria | 145166 |
| 586 | Ga0451577_0000697 | 3300042876 | Bacteria | 52454 |
| 587 | Ga0451577_0011783 | 3300042876 | Bacteria | 8252 |
| 588 | Ga0451577_0098069 | 3300042876 | Bacteria | 2617 |
| 589 | Ga0451577_0421926 | 3300042876 | Bacteria | 1211 |
| 590 | Ga0451577_0512282 | 3300042876 | Bacteria | 1089 |
| 591 | Ga0451577_0706583 | 3300042876 | Bacteria | 913 |
| 592 | Ga0451577_0779031 | 3300042876 | Bacteria | 864 |
| 593 | Ga0466969_0017099 | 3300044656 | Bacteria | 3790 |
| 594 | Ga0466969_0038862 | 3300044656 | Bacteria | 2392 |
| 595 | Ga0466969_0058084 | 3300044656 | Bacteria | 1884 |
| 596 | Ga0453683_0014521 | 3300044673 | Bacteria | 5110 |
| 597 | Ga0466965_0003310 | 3300044683 | Bacteria | 7053 |
| 598 | Ga0466965_0229814 | 3300044683 | Bacteria | 990 |
| 599 | Ga0466966_0009059 | 3300044684 | Bacteria | 6593 |
| 600 | Ga0466966_0018660 | 3300044684 | Bacteria | 4571 |
| 601 | Ga0466966_0054691 | 3300044684 | Bacteria | 2528 |
| 602 | Ga0466961_0025989 | 3300044693 | Bacteria | 3763 |
| 603 | Ga0466961_0028342 | 3300044693 | Bacteria | 3600 |
| 604 | Ga0466961_0152181 | 3300044693 | Bacteria | 1444 |
| 605 | Ga0466961_0188658 | 3300044693 | Bacteria | 1278 |
| 606 | Ga0466963_0182023 | 3300044694 | Bacteria | 1467 |
| 607 | Ga0466963_0550571 | 3300044694 | Bacteria | 815 |
| 608 | Ga0466964_0004084 | 3300044706 | Bacteria | 5371 |
| 609 | Ga0453684_0000187 | 3300044712 | Bacteria | 272378 |
| 610 | Ga0453684_0006584 | 3300044712 | Bacteria | 21971 |
| 611 | Ga0453684_0150188 | 3300044712 | Bacteria | 2770 |
| 612 | Ga0453684_0347160 | 3300044712 | Bacteria | 1674 |
| 613 | Ga0453684_0427163 | 3300044712 | Bacteria | 1479 |
| 614 | Ga0453684_0504607 | 3300044712 | Bacteria | 1339 |
| 615 | Ga0453684_0795806 | 3300044712 | Bacteria | 1020 |
| 616 | Ga0453684_0804517 | 3300044712 | Bacteria | 1013 |
| 617 | Ga0453684_0965221 | 3300044712 | Bacteria | 909 |
| 618 | Ga0453684_1041258 | 3300044712 | Bacteria | 868 |
| 619 | Ga0466971_0004547 | 3300044719 | Bacteria | 6000 |
| 620 | Ga0466968_0034015 | 3300044735 | Bacteria | 2125 |
| 621 | Ga0466970_0030835 | 3300044765 | Bacteria | 2829 |
| 622 | Ga0466970_0037204 | 3300044765 | Bacteria | 2579 |
| 623 | Ga0466957_0073116 | 3300044842 | Bacteria | 2124 |
| 624 | Ga0466957_0125583 | 3300044842 | Bacteria | 1639 |
| 625 | Ga0466957_0483597 | 3300044842 | Bacteria | 856 |
| 626 | Ga0466960_0020598 | 3300044901 | Bacteria | 2923 |
| 627 | Ga0466960_0044930 | 3300044901 | Bacteria | 2108 |
| 628 | Ga0466959_0011390 | 3300045049 | Bacteria | 6388 |
| 629 | Ga0466959_0026708 | 3300045049 | Bacteria | 4280 |
| 630 | Ga0466959_0130992 | 3300045049 | Bacteria | 1777 |
| 631 | Ga0466959_0141375 | 3300045049 | Bacteria | 1701 |
| 632 | Ga0451576_0011722 | 3300045051 | Bacteria | 9930 |
| 633 | Ga0451576_0218089 | 3300045051 | Bacteria | 1992 |
| 634 | Ga0451576_0499886 | 3300045051 | Bacteria | 1277 |
| 635 | Ga0466958_0007306 | 3300045836 | Bacteria | 6067 |
| 636 | Ga0466958_0147366 | 3300045836 | Bacteria | 1484 |
| 637 | Ga0466958_0588797 | 3300045836 | Bacteria | 723 |
| 638 | Ga0466967_0299334 | 3300045976 | Bacteria | 1547 |
| 639 | Ga0466967_0656883 | 3300045976 | Bacteria | 1037 |
| 640 | Ga0466967_1411330 | 3300045976 | Bacteria | 693 |
| 641 | Ga0495592_0000153 | 3300046454 | Bacteria | 60062 |
| 642 | Ga0495638_0053127 | 3300046460 | Bacteria | 2522 |
| 643 | Ga0495638_0069218 | 3300046460 | Bacteria | 2163 |
| 644 | Ga0495650_0028496 | 3300046471 | Bacteria | 2562 |
| 645 | Ga0495650_0030946 | 3300046471 | Bacteria | 2416 |
| 646 | Ga0495639_0018532 | 3300046475 | Bacteria | 3032 |
| 647 | Ga0495639_0046029 | 3300046475 | Bacteria | 1974 |
| 648 | Ga0495585_0025055 | 3300046492 | Bacteria | 3419 |
| 649 | Ga0495583_0000046 | 3300046506 | Bacteria | 218059 |
| 650 | Ga0495606_0017068 | 3300046507 | Bacteria | 5505 |
| 651 | Ga0495606_0167199 | 3300046507 | Bacteria | 1279 |
| 652 | Ga0495620_0048512 | 3300046515 | Bacteria | 1822 |
| 653 | Ga0495620_0113570 | 3300046515 | Bacteria | 1072 |
| 654 | Ga0495628_0743506 | 3300046516 | Bacteria | 690 |
| 655 | Ga0495632_0008733 | 3300046519 | Bacteria | 6178 |
| 656 | Ga0495632_0009624 | 3300046519 | Bacteria | 5804 |
| 657 | Ga0495643_0074601 | 3300046522 | Bacteria | 1776 |
| 658 | Ga0495643_0083424 | 3300046522 | Bacteria | 1659 |
| 659 | Ga0495648_0125340 | 3300046524 | Bacteria | 1374 |
| 660 | Ga0495642_0043618 | 3300046528 | Bacteria | 1829 |
| 661 | Ga0495642_0046766 | 3300046528 | Bacteria | 1770 |
| 662 | Ga0495656_0004207 | 3300046615 | Bacteria | 4914 |
| 663 | Ga0495656_0043700 | 3300046615 | Bacteria | 1883 |
| 664 | Ga0495656_0059450 | 3300046615 | Bacteria | 1663 |
| 665 | Ga0495625_0002511 | 3300046660 | Bacteria | 19764 |
| 666 | Ga0495625_0107219 | 3300046660 | Bacteria | 1912 |
| 667 | Ga0495625_0136444 | 3300046660 | Bacteria | 1658 |
| 668 | Ga0495588_0072015 | 3300046674 | Bacteria | 1798 |
| 669 | Ga0495599_0202936 | 3300046678 | Bacteria | 1218 |
| 670 | Ga0495669_0007695 | 3300046684 | Bacteria | 4522 |
| 671 | Ga0495670_0047547 | 3300046691 | Bacteria | 2145 |
| 672 | Ga0495649_0000548 | 3300046694 | Bacteria | 31877 |
| 673 | Ga0495589_0007530 | 3300046794 | Bacteria | 5704 |
| 674 | Ga0495660_0029299 | 3300046810 | Bacteria | 3107 |
| 675 | Ga0495581_0056860 | 3300047315 | Bacteria | 2258 |
| 676 | Ga0495636_0058997 | 3300047318 | Bacteria | 1619 |
| 677 | Ga0495673_0160256 | 3300047469 | Bacteria | 864 |
| 678 | Ga0496100_0015801 | 3300048903 | Bacteria | 4415 |
| 679 | Ga0496102_0006927 | 3300048905 | Bacteria | 9670 |
| 680 | Ga0496102_0007775 | 3300048905 | Bacteria | 9163 |
| 681 | Ga0496102_0350529 | 3300048905 | Bacteria | 1390 |
| 682 | Ga0496104_0003316 | 3300048907 | Bacteria | 13888 |
| 683 | Ga0496104_0303203 | 3300048907 | Bacteria | 1510 |
| 684 | Ga0496104_0332905 | 3300048907 | Bacteria | 1431 |
| 685 | Ga0496105_0033011 | 3300048908 | Bacteria | 4249 |
| 686 | Ga0496105_0139762 | 3300048908 | Bacteria | 1994 |
| 687 | Ga0496106_0120152 | 3300048909 | Bacteria | 2053 |
| 688 | Ga0496107_0243422 | 3300048910 | Bacteria | 1338 |
| 689 | Ga0496108_0120778 | 3300048911 | Bacteria | 2247 |
| 690 | Ga0496108_0340009 | 3300048911 | Bacteria | 1309 |
| 691 | Ga0496109_0060340 | 3300048912 | Bacteria | 3466 |
| 692 | Ga0496109_1103316 | 3300048912 | Bacteria | 730 |
| 693 | Ga0496110_0081564 | 3300048913 | Bacteria | 2883 |
| 694 | Ga0496110_0219634 | 3300048913 | Bacteria | 1728 |
| 695 | Ga0496110_0688911 | 3300048913 | Bacteria | 923 |
| 696 | Ga0496110_1008096 | 3300048913 | Bacteria | 740 |
| 697 | Ga0496111_0354222 | 3300048914 | Bacteria | 1086 |
| 698 | Ga0496112_0011790 | 3300048915 | Bacteria | 8002 |
| 699 | Ga0496113_0016666 | 3300048916 | Bacteria | 5080 |
| 700 | Ga0496114_0004146 | 3300048917 | Bacteria | 11214 |
| 701 | Ga0496122_0003759 | 3300048925 | Bacteria | 19568 |
| 702 | Ga0496123_0097421 | 3300048926 | Bacteria | 1723 |
| 703 | Ga0496124_0124076 | 3300048927 | Bacteria | 2060 |
| 704 | Ga0496124_0125855 | 3300048927 | Bacteria | 2042 |
| 705 | Ga0496124_0153862 | 3300048927 | Bacteria | 1801 |
| 706 | Ga0496125_0003024 | 3300048928 | Bacteria | 21033 |
| 707 | Ga0496125_0136353 | 3300048928 | Bacteria | 1716 |
| 708 | Ga0496126_0094457 | 3300048929 | Bacteria | 2624 |
| 709 | Ga0501292_003271 | 3300049515 | Bacteria | 2158 |
| 710 | Ga0501313_025191 | 3300049529 | Bacteria | 752 |
| 711 | Ga0501320_031279 | 3300049536 | Bacteria | 663 |
| 712 | Ga0501032_0092027 | 3300049569 | Bacteria | 2012 |
| 713 | Ga0501034_0215211 | 3300049571 | Bacteria | 1875 |
| 714 | Ga0501034_0539668 | 3300049571 | Bacteria | 1076 |
| 715 | Ga0501038_0197511 | 3300049574 | Bacteria | 1616 |
| 716 | Ga0501042_0377135 | 3300049578 | Bacteria | 1027 |
| 717 | Ga0501043_0175748 | 3300049579 | Bacteria | 1669 |
| 718 | Ga0501046_0032960 | 3300049580 | Bacteria | 4191 |
| 719 | Ga0501047_0060409 | 3300049581 | Bacteria | 3658 |
| 720 | Ga0501071_0523602 | 3300049587 | Bacteria | 910 |
| 721 | Ga0501073_0133203 | 3300049589 | Bacteria | 1723 |
| 722 | Ga0501199_002565 | 3300049650 | Bacteria | 1705 |
| 723 | Ga0501223_031134 | 3300049663 | Bacteria | 1037 |
| 724 | Ga0501257_026227 | 3300049686 | Bacteria | 1390 |
| 725 | Ga0501257_070510 | 3300049686 | Bacteria | 893 |
| 726 | Ga0501080_0085913 | 3300049742 | Bacteria | 2923 |
| 727 | Ga0501265_001527 | 3300049762 | Bacteria | 2605 |
| 728 | Ga0501266_000273 | 3300049763 | Bacteria | 6788 |
| 729 | Ga0501279_040283 | 3300049775 | Bacteria | 715 |
| 730 | Ga0501280_007909 | 3300049776 | Bacteria | 1485 |
| 731 | Ga0501035_0154779 | 3300049822 | Bacteria | 1987 |
| 732 | nmdc:mga03683_126512_c1 | 3300050489 | Bacteria | 1140 |
| 733 | nmdc:mga03683_158783_c1 | 3300050489 | Bacteria | 1023 |
| 734 | nmdc:mga03683_34515_c1 | 3300050489 | Bacteria | 2047 |
| 735 | nmdc:mga03683_70266_c1 | 3300050489 | Bacteria | 1496 |
| 736 | nmdc:mga03683_75353_c1 | 3300050489 | Bacteria | 1449 |
| 737 | nmdc:mga03n38_115787_c1 | 3300050490 | Bacteria | 1311 |
| 738 | nmdc:mga03n38_83260_c1 | 3300050490 | Bacteria | 1508 |
| 739 | nmdc:mga00v17_147229_c1 | 3300050491 | Bacteria | 1512 |
| 740 | nmdc:mga0yw44_192448_c1 | 3300050492 | Bacteria | 1346 |
| 741 | nmdc:mga0yw44_604602_c1 | 3300050492 | Bacteria | 745 |
| 742 | nmdc:mga0k408_130854_c1 | 3300050493 | Bacteria | 1490 |
| 743 | nmdc:mga0k408_148640_c1 | 3300050493 | Bacteria | 1395 |
| 744 | nmdc:mga0k408_175268_c1 | 3300050493 | Bacteria | 1278 |
| 745 | nmdc:mga0k408_186897_c1 | 3300050493 | Bacteria | 1236 |
| 746 | nmdc:mga0k408_189563_c1 | 3300050493 | Bacteria | 1227 |
| 747 | nmdc:mga0k408_189842_c1 | 3300050493 | Bacteria | 1226 |
| 748 | nmdc:mga0k408_267989_c1 | 3300050493 | Bacteria | 1020 |
| 749 | nmdc:mga0k408_474819_c1 | 3300050493 | Bacteria | 742 |
| 750 | nmdc:mga0k408_51943_c1 | 3300050493 | Bacteria | 2375 |
| 751 | nmdc:mga0k408_55538_c1 | 3300050493 | Bacteria | 2296 |
| 752 | nmdc:mga0k408_58092_c1 | 3300050493 | Bacteria | 2247 |
| 753 | nmdc:mga0k408_642_c1 | 3300050493 | Bacteria | 19227 |
| 754 | nmdc:mga0k408_87958_c1 | 3300050493 | Bacteria | 1825 |
| 755 | nmdc:mga06z11_206669_c1 | 3300050494 | Bacteria | 1142 |
| 756 | nmdc:mga06z11_67145_c1 | 3300050494 | Bacteria | 1887 |
| 757 | nmdc:mga07m45_14447_c1 | 3300050496 | Bacteria | 4205 |
| 758 | nmdc:mga07m45_2243_c2 | 3300050496 | Bacteria | 8377 |
| 759 | nmdc:mga07m45_271171_c1 | 3300050496 | Bacteria | 987 |
| 760 | nmdc:mga07m45_2723_c1 | 3300050496 | Bacteria | 8330 |
| 761 | nmdc:mga07m45_61642_c1 | 3300050496 | Bacteria | 2125 |
| 762 | nmdc:mga07m45_6665_c1 | 3300050496 | Bacteria | 5856 |
| 763 | nmdc:mga05p37_389871_c1 | 3300050507 | Bacteria | 1629 |
| 764 | nmdc:mga0qj67_241261_c1 | 3300050509 | Bacteria | 1466 |
| 765 | nmdc:mga0sz30_13115_c2 | 3300050516 | Bacteria | 2488 |
| 766 | nmdc:mga0sz30_248349_c1 | 3300050516 | Bacteria | 792 |
| 767 | Ga0500635_0000113 | 3300053080 | Bacteria | 49202 |
| 768 | Ga0495619_0848922 | 3300053085 | Bacteria | 616 |
| 769 | Ga0500578_0000079 | 3300053086 | Bacteria | 107137 |
| 770 | Ga0500643_058178 | 3300053087 | Bacteria | 1090 |
| 771 | Ga0500644_0011166 | 3300053088 | Bacteria | 2449 |
| 772 | Ga0500644_0023838 | 3300053088 | Bacteria | 1863 |
| 773 | Ga0500644_0026762 | 3300053088 | Bacteria | 1787 |
| 774 | Ga0500644_0033629 | 3300053088 | Bacteria | 1647 |
| 775 | Ga0500644_0143738 | 3300053088 | Bacteria | 950 |
| 776 | Ga0500646_0020684 | 3300053090 | Bacteria | 1749 |
| 777 | Ga0500583_0114963 | 3300053092 | Bacteria | 1328 |
| 778 | Ga0500583_0161084 | 3300053092 | Bacteria | 1117 |
| 779 | Ga0500651_0045939 | 3300053093 | Bacteria | 2746 |
| 780 | Ga0500651_0059147 | 3300053093 | Bacteria | 2396 |
| 781 | Ga0500566_0094384 | 3300053094 | Bacteria | 1649 |
| 782 | Ga0500641_0042497 | 3300053096 | Bacteria | 1842 |
| 783 | Ga0500562_044402 | 3300053108 | Bacteria | 1183 |
| 784 | Ga0500569_006494 | 3300053109 | Bacteria | 2571 |
| 785 | Ga0500593_004453 | 3300053117 | Bacteria | 5424 |
| 786 | Ga0500593_005843 | 3300053117 | Bacteria | 4885 |
| 787 | Ga0500594_0005906 | 3300053118 | Bacteria | 2728 |
| 788 | Ga0500608_066183 | 3300053122 | Bacteria | 1723 |
| 789 | Ga0500642_0040098 | 3300053130 | Bacteria | 2017 |
| 790 | Ga0500642_0082410 | 3300053130 | Bacteria | 1479 |
| 791 | Ga0500652_000857 | 3300053131 | Bacteria | 10055 |
| 792 | Ga0500655_007327 | 3300053133 | Bacteria | 1985 |
| 793 | Ga0500655_019792 | 3300053133 | Bacteria | 1255 |
| 794 | Ga0500559_0000494 | 3300053136 | Bacteria | 27657 |
| 795 | Ga0500559_0008544 | 3300053136 | Bacteria | 4481 |
| 796 | Ga0500561_0030841 | 3300053137 | Bacteria | 1350 |
| 797 | Ga0500568_0010029 | 3300053139 | Bacteria | 4465 |
| 798 | Ga0500568_0055429 | 3300053139 | Bacteria | 1547 |
| 799 | Ga0500577_0064048 | 3300053142 | Bacteria | 1423 |
| 800 | Ga0500604_0026411 | 3300053151 | Bacteria | 1674 |
| 801 | Ga0500604_0026847 | 3300053151 | Bacteria | 1663 |
| 802 | Ga0500604_0098325 | 3300053151 | Bacteria | 962 |
| 803 | Ga0500620_119950 | 3300053155 | Bacteria | 922 |
| 804 | Ga0500622_0000053 | 3300053156 | Bacteria | 145070 |
| 805 | Ga0500622_0007498 | 3300053156 | Bacteria | 6192 |
| 806 | Ga0500622_0035639 | 3300053156 | Bacteria | 2603 |
| 807 | Ga0500622_0049996 | 3300053156 | Bacteria | 2154 |
| 808 | Ga0500634_0112788 | 3300053161 | Bacteria | 1338 |
| 809 | Ga0500636_0025438 | 3300053177 | Bacteria | 3498 |
| 810 | Ga0500637_0105294 | 3300053178 | Bacteria | 1636 |
| 811 | Ga0500570_095197 | 3300053724 | Bacteria | 1278 |
| 812 | Ga0500570_151845 | 3300053724 | Bacteria | 822 |
| 813 | Ga0500587_003978 | 3300053739 | Bacteria | 2043 |
| 814 | Ga0500587_007084 | 3300053739 | Bacteria | 1469 |
| 815 | Ga0500661_001399 | 3300055283 | Bacteria | 4505 |
| 816 | Ga0500661_030667 | 3300055283 | Bacteria | 949 |
| 817 | Ga0466962_0005278 | 3300061719 | Bacteria | 6207 |
| 818 | Ga0466962_0081674 | 3300061719 | Bacteria | 1546 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300045836 | Ga0466958_0588797 | Ga0466958_0588797_13_519 | 162 |
| 2 | 3300031616 | Ga0307508_10391419 | Ga0307508_103914193 | 171 |
| 3 | 3300006038 | Ga0075365_10166779 | Ga0075365_101667793 | 172 |
| 4 | 3300006177 | Ga0075362_10090415 | Ga0075362_100904152 | 172 |
| 5 | 3300006195 | Ga0075366_10180326 | Ga0075366_101803263 | 172 |
| 6 | 3300005563 | Ga0068855_100306943 | Ga0068855_1003069433 | 174 |
| 7 | 3300025949 | Ga0207667_10133371 | Ga0207667_101333713 | 174 |
| 8 | 3300037471 | Ga0395905_0131971 | Ga0395905_0131971_1140_1682 | 175 |
| 9 | 3300044694 | Ga0466963_0182023 | Ga0466963_0182023_485_1045 | 175 |
| 10 | 3300044842 | Ga0466957_0125583 | Ga0466957_0125583_651_1211 | 175 |
| 11 | 3300045976 | Ga0466967_0299334 | Ga0466967_0299334_554_1114 | 175 |
| 12 | 3300045976 | Ga0466967_1411330 | Ga0466967_1411330_122_679 | 175 |
| 13 | 3300048912 | Ga0496109_1103316 | Ga0496109_1103316_10_555 | 176 |
| 14 | 3300003752 | Ga0055539_1000651 | Ga0055539_10006512 | 177 |
| 15 | 3300003756 | Ga0055533_1000033 | Ga0055533_1000033149 | 177 |
| 16 | 3300003759 | Ga0055525_1000767 | Ga0055525_10007677 | 177 |
| 17 | 3300025226 | Ga0209674_100064 | Ga0209674_100064100 | 177 |
| 18 | 3300025230 | Ga0209563_100099 | Ga0209563_100099100 | 177 |
| 19 | 3300025253 | Ga0209677_100175 | Ga0209677_10017537 | 177 |
| 20 | 3300044901 | Ga0466960_0044930 | Ga0466960_0044930_222_815 | 177 |
| 21 | 3300025945 | Ga0207679_10691594 | Ga0207679_106915942 | 178 |
| 22 | 3300037312 | Ga0395899_0135733 | Ga0395899_0135733_1181_1744 | 178 |
| 23 | 3300037418 | Ga0395900_0380144 | Ga0395900_0380144_135_695 | 179 |
| 24 | 3300037471 | Ga0395905_0081944 | Ga0395905_0081944_1905_2465 | 179 |
| 25 | 3300041463 | Ga0451804_0372939 | Ga0451804_0372939_202_750 | 179 |
| 26 | 3300042876 | Ga0451577_0421926 | Ga0451577_0421926_440_988 | 179 |
| 27 | 3300044712 | Ga0453684_0965221 | Ga0453684_0965221_180_728 | 179 |
| 28 | 3300050492 | nmdc:mga0yw44_604602_c1 | nmdc:mga0yw44_604602_c1_166_723 | 179 |
| 29 | 3300003316 | rootH1_10029887 | rootH1_100298873 | 180 |
| 30 | 3300003322 | rootL2_10051303 | rootL2_100513032 | 180 |
| 31 | 3300003323 | rootH1_10049916 | rootH1_100499163 | 180 |
| 32 | 3300005564 | Ga0070664_100476314 | Ga0070664_1004763142 | 180 |
| 33 | 3300021361 | Ga0213872_10000132 | Ga0213872_1000013228 | 180 |
| 34 | 3300039447 | Ga0436361_1206467 | Ga0436361_1206467_36222_36806 | 180 |
| 35 | 3300044842 | Ga0466957_0073116 | Ga0466957_0073116_538_1098 | 180 |
| 36 | 3300005339 | Ga0070660_100178681 | Ga0070660_1001786813 | 181 |
| 37 | 3300005344 | Ga0070661_100007719 | Ga0070661_10000771910 | 181 |
| 38 | 3300005366 | Ga0070659_100001726 | Ga0070659_1000017269 | 181 |
| 39 | 3300009093 | Ga0105240_10314240 | Ga0105240_103142402 | 181 |
| 40 | 3300013105 | Ga0157369_10817373 | Ga0157369_108173732 | 181 |
| 41 | 3300025231 | Ga0207427_101039 | Ga0207427_10103910 | 181 |
| 42 | 3300025913 | Ga0207695_10196087 | Ga0207695_101960873 | 181 |
| 43 | 3300025919 | Ga0207657_10216323 | Ga0207657_102163233 | 181 |
| 44 | 3300031548 | Ga0307408_100962614 | Ga0307408_1009626142 | 181 |
| 45 | 3300031911 | Ga0307412_10540681 | Ga0307412_105406811 | 181 |
| 46 | 3300037418 | Ga0395900_0000058 | Ga0395900_0000058_163482_164069 | 181 |
| 47 | 3300037466 | Ga0395898_0000283 | Ga0395898_0000283_111874_112461 | 181 |
| 48 | 3300037466 | Ga0395898_0365130 | Ga0395898_0365130_175_786 | 181 |
| 49 | 3300037471 | Ga0395905_0188487 | Ga0395905_0188487_845_1456 | 181 |
| 50 | 3300038443 | Ga0395901_0558458 | Ga0395901_0558458_418_1029 | 181 |
| 51 | 3300049581 | Ga0501047_0060409 | Ga0501047_0060409_3084_3647 | 181 |
| 52 | 3300006186 | Ga0075369_10024698 | Ga0075369_100246981 | 182 |
| 53 | 3300006844 | Ga0075428_100408943 | Ga0075428_1004089433 | 182 |
| 54 | 3300006846 | Ga0075430_100342555 | Ga0075430_1003425552 | 182 |
| 55 | 3300006880 | Ga0075429_100428302 | Ga0075429_1004283023 | 182 |
| 56 | 3300025250 | Ga0209026_1035999 | Ga0209026_10359992 | 182 |
| 57 | 3300030521 | Ga0307511_10000144 | Ga0307511_100001443 | 182 |
| 58 | 3300038443 | Ga0395901_0449369 | Ga0395901_0449369_16_582 | 182 |
| 59 | 3300050509 | nmdc:mga0qj67_241261_c1 | nmdc:mga0qj67_241261_c1_553_1119 | 182 |
| 60 | 3300050516 | nmdc:mga0sz30_13115_c2 | nmdc:mga0sz30_13115_c2_1852_2439 | 182 |
| 61 | 3300053092 | Ga0500583_0161084 | Ga0500583_0161084_267_854 | 182 |
| 62 | 3300053133 | Ga0500655_019792 | Ga0500655_019792_576_1163 | 182 |
| 63 | 3300053151 | Ga0500604_0098325 | Ga0500604_0098325_212_799 | 182 |
| 64 | 3300053155 | Ga0500620_119950 | Ga0500620_119950_238_804 | 182 |
| 65 | 3300005354 | Ga0070675_100358761 | Ga0070675_1003587612 | 183 |
| 66 | 3300005355 | Ga0070671_100728386 | Ga0070671_1007283861 | 183 |
| 67 | 3300005364 | Ga0070673_100159226 | Ga0070673_1001592262 | 183 |
| 68 | 3300025273 | Ga0209673_1028406 | Ga0209673_10284063 | 183 |
| 69 | 3300025937 | Ga0207669_10457492 | Ga0207669_104574923 | 183 |
| 70 | 3300031250 | Ga0265331_10008263 | Ga0265331_100082634 | 183 |
| 71 | 3300031251 | Ga0265327_10000042 | Ga0265327_10000042264 | 183 |
| 72 | 3300031852 | Ga0307410_10095895 | Ga0307410_100958953 | 183 |
| 73 | 3300031911 | Ga0307412_10335494 | Ga0307412_103354943 | 183 |
| 74 | 3300031911 | Ga0307412_10347407 | Ga0307412_103474072 | 183 |
| 75 | 3300038443 | Ga0395901_0276095 | Ga0395901_0276095_57_626 | 183 |
| 76 | 3300038996 | Ga0242420_010152 | Ga0242420_010152_509_1066 | 183 |
| 77 | 3300049686 | Ga0501257_026227 | Ga0501257_026227_15_575 | 183 |
| 78 | 3300049775 | Ga0501279_040283 | Ga0501279_040283_100_675 | 183 |
| 79 | 3300005288 | Ga0065714_10150799 | Ga0065714_101507991 | 184 |
| 80 | 3300005458 | Ga0070681_10374680 | Ga0070681_103746803 | 184 |
| 81 | 3300005530 | Ga0070679_100230208 | Ga0070679_1002302083 | 184 |
| 82 | 3300006195 | Ga0075366_10066159 | Ga0075366_100661592 | 184 |
| 83 | 3300025921 | Ga0207652_10057081 | Ga0207652_100570813 | 184 |
| 84 | 3300025935 | Ga0207709_10175770 | Ga0207709_101757703 | 184 |
| 85 | 3300031238 | Ga0265332_10000027 | Ga0265332_1000002710 | 184 |
| 86 | 3300035086 | Ga0373934_0169026 | Ga0373934_0169026_121_750 | 184 |
| 87 | 3300041405 | Ga0439438_057224 | Ga0439438_057224_42_605 | 184 |
| 88 | 3300044694 | Ga0466963_0550571 | Ga0466963_0550571_33_605 | 184 |
| 89 | 3300050493 | nmdc:mga0k408_55538_c1 | nmdc:mga0k408_55538_c1_1152_1745 | 184 |
| 90 | 3300053080 | Ga0500635_0000113 | Ga0500635_0000113_34122_34751 | 184 |
| 91 | iso_pu_bacteria | 2886848708 | 2886849888 | 184 |
| 92 | 3300002705 | JGI25156J39149_1020981 | JGI25156J39149_10209812 | 185 |
| 93 | 3300005334 | Ga0068869_100462883 | Ga0068869_1004628832 | 185 |
| 94 | 3300006195 | Ga0075366_10092421 | Ga0075366_100924213 | 185 |
| 95 | 3300009177 | Ga0105248_10007163 | Ga0105248_100071639 | 185 |
| 96 | 3300025256 | Ga0209759_1002013 | Ga0209759_10020136 | 185 |
| 97 | 3300025932 | Ga0207690_10157275 | Ga0207690_101572753 | 185 |
| 98 | 3300026142 | Ga0207698_10223884 | Ga0207698_102238843 | 185 |
| 99 | 3300042876 | Ga0451577_0779031 | Ga0451577_0779031_196_792 | 185 |
| 100 | 3300044712 | Ga0453684_0504607 | Ga0453684_0504607_105_710 | 185 |
| 101 | 3300044712 | Ga0453684_0804517 | Ga0453684_0804517_329_904 | 185 |
| 102 | 3300045051 | Ga0451576_0218089 | Ga0451576_0218089_1292_1888 | 185 |
| 103 | 3300046615 | Ga0495656_0043700 | Ga0495656_0043700_685_1263 | 185 |
| 104 | 3300048905 | Ga0496102_0350529 | Ga0496102_0350529_358_936 | 185 |
| 105 | 3300048917 | Ga0496114_0004146 | Ga0496114_0004146_369_935 | 185 |
| 106 | 3300048928 | Ga0496125_0136353 | Ga0496125_0136353_1123_1701 | 185 |
| 107 | 3300049587 | Ga0501071_0523602 | Ga0501071_0523602_304_870 | 185 |
| 108 | 3300050489 | nmdc:mga03683_126512_c1 | nmdc:mga03683_126512_c1_245_841 | 185 |
| 109 | 3300050493 | nmdc:mga0k408_51943_c1 | nmdc:mga0k408_51943_c1_500_1132 | 185 |
| 110 | 3300050494 | nmdc:mga06z11_206669_c1 | nmdc:mga06z11_206669_c1_77_673 | 185 |
| 111 | iso_pu_bacteria | 2881101125 | 2881102612 | 185 |
| 112 | 3300003322 | rootL2_10000579 | rootL2_1000057919 | 186 |
| 113 | 3300003323 | rootH1_10016701 | rootH1_100167013 | 186 |
| 114 | 3300003771 | Ga0055526_1007400 | Ga0055526_10074004 | 186 |
| 115 | 3300003775 | Ga0055524_1005494 | Ga0055524_10054947 | 186 |
| 116 | 3300003794 | Ga0055531_10021663 | Ga0055531_100216633 | 186 |
| 117 | 3300004625 | Ga0055543_1001806 | Ga0055543_100180610 | 186 |
| 118 | 3300005262 | Ga0065165_1000016 | Ga0065165_1000016161 | 186 |
| 119 | 3300005339 | Ga0070660_100096947 | Ga0070660_1000969472 | 186 |
| 120 | 3300006942 | Ga0099824_1030030 | Ga0099824_10300302 | 186 |
| 121 | 3300006944 | Ga0099823_1000101 | Ga0099823_100010110 | 186 |
| 122 | 3300025295 | Ga0209564_1000008 | Ga0209564_1000008382 | 186 |
| 123 | 3300025298 | Ga0209050_1010700 | Ga0209050_10107003 | 186 |
| 124 | 3300025299 | Ga0209256_1008383 | Ga0209256_10083833 | 186 |
| 125 | 3300025303 | Ga0209051_1002891 | Ga0209051_10028914 | 186 |
| 126 | 3300025304 | Ga0209257_1003886 | Ga0209257_10038864 | 186 |
| 127 | 3300025909 | Ga0207705_10119401 | Ga0207705_101194013 | 186 |
| 128 | 3300027296 | Ga0209389_1001650 | Ga0209389_10016506 | 186 |
| 129 | 3300048927 | Ga0496124_0125855 | Ga0496124_0125855_783_1391 | 186 |
| 130 | 3300050496 | nmdc:mga07m45_61642_c1 | nmdc:mga07m45_61642_c1_847_1416 | 186 |
| 131 | 3300053085 | Ga0495619_0848922 | Ga0495619_0848922_29_598 | 186 |
| 132 | 3300005445 | Ga0070708_100110016 | Ga0070708_1001100162 | 187 |
| 133 | 3300005539 | Ga0068853_100852996 | Ga0068853_1008529961 | 187 |
| 134 | 3300006195 | Ga0075366_10454251 | Ga0075366_104542512 | 187 |
| 135 | 3300009147 | Ga0114129_10478674 | Ga0114129_104786743 | 187 |
| 136 | 3300021361 | Ga0213872_10000068 | Ga0213872_1000006838 | 187 |
| 137 | 3300021361 | Ga0213872_10023786 | Ga0213872_100237864 | 187 |
| 138 | 3300026041 | Ga0207639_10427923 | Ga0207639_104279233 | 187 |
| 139 | 3300039447 | Ga0436361_0144777 | Ga0436361_0144777_866_1480 | 187 |
| 140 | 3300039447 | Ga0436361_0793297 | Ga0436361_0793297_21516_22130 | 187 |
| 141 | 3300041999 | Ga0439433_0059453 | Ga0439433_0059453_118_705 | 187 |
| 142 | 3300042007 | Ga0439449_0011120 | Ga0439449_0011120_2771_3364 | 187 |
| 143 | 3300042015 | Ga0439462_0027913 | Ga0439462_0027913_432_1019 | 187 |
| 144 | 3300042145 | Ga0450906_015933 | Ga0450906_015933_29_622 | 187 |
| 145 | 3300042439 | Ga0439464_0001997 | Ga0439464_0001997_1338_1934 | 187 |
| 146 | 3300046691 | Ga0495670_0047547 | Ga0495670_0047547_722_1348 | 187 |
| 147 | 3300049578 | Ga0501042_0377135 | Ga0501042_0377135_298_882 | 187 |
| 148 | 3300050507 | nmdc:mga05p37_389871_c1 | nmdc:mga05p37_389871_c1_589_1158 | 187 |
| 149 | 3300053156 | Ga0500622_0035639 | Ga0500622_0035639_606_1232 | 187 |
| 150 | 3300053178 | Ga0500637_0105294 | Ga0500637_0105294_753_1355 | 187 |
| 151 | iso_pu_bacteria | 2585428057 | 2587728036 | 187 |
| 152 | iso_pu_bacteria | 2585428058 | 2587731100 | 187 |
| 153 | iso_pu_bacteria | 2585428062 | 2587754147 | 187 |
| 154 | iso_pu_bacteria | 2588253510 | 2588289852 | 187 |
| 155 | iso_pu_bacteria | 2643221592 | 2643972349 | 187 |
| 156 | iso_pu_bacteria | 2643221625 | 2644141540 | 187 |
| 157 | iso_pu_bacteria | 2643221648 | 2644275689 | 187 |
| 158 | 3300003316 | rootH1_10029888 | rootH1_100298883 | 188 |
| 159 | 3300003775 | Ga0055524_1000733 | Ga0055524_100073320 | 188 |
| 160 | 3300003792 | Ga0055540_1004852 | Ga0055540_10048528 | 188 |
| 161 | 3300003794 | Ga0055531_10002124 | Ga0055531_1000212412 | 188 |
| 162 | 3300003794 | Ga0055531_10007153 | Ga0055531_100071532 | 188 |
| 163 | 3300006195 | Ga0075366_10039564 | Ga0075366_100395643 | 188 |
| 164 | 3300006353 | Ga0075370_10000954 | Ga0075370_1000095410 | 188 |
| 165 | 3300012475 | Ga0157317_1000388 | Ga0157317_10003883 | 188 |
| 166 | 3300012497 | Ga0157319_1000015 | Ga0157319_1000015117 | 188 |
| 167 | 3300013307 | Ga0157372_11019184 | Ga0157372_110191843 | 188 |
| 168 | 3300025273 | Ga0209673_1022830 | Ga0209673_10228303 | 188 |
| 169 | 3300025299 | Ga0209256_1005979 | Ga0209256_10059793 | 188 |
| 170 | 3300025303 | Ga0209051_1000456 | Ga0209051_100045633 | 188 |
| 171 | 3300025304 | Ga0209257_1000015 | Ga0209257_1000015807 | 188 |
| 172 | 3300025304 | Ga0209257_1002253 | Ga0209257_10022533 | 188 |
| 173 | 3300025909 | Ga0207705_10364619 | Ga0207705_103646192 | 188 |
| 174 | 3300027312 | Ga0209371_1005027 | Ga0209371_10050273 | 188 |
| 175 | 3300030500 | Ga0268256_1004264 | Ga0268256_10042647 | 188 |
| 176 | 3300031548 | Ga0307408_100038396 | Ga0307408_1000383965 | 188 |
| 177 | 3300031711 | Ga0265314_10179414 | Ga0265314_101794143 | 188 |
| 178 | 3300031730 | Ga0307516_10306335 | Ga0307516_103063351 | 188 |
| 179 | 3300031911 | Ga0307412_10345613 | Ga0307412_103456132 | 188 |
| 180 | 3300032002 | Ga0307416_100290074 | Ga0307416_1002900743 | 188 |
| 181 | 3300035691 | Ga0373931_0015954 | Ga0373931_0015954_2451_3044 | 188 |
| 182 | 3300037471 | Ga0395905_0676674 | Ga0395905_0676674_50_631 | 188 |
| 183 | 3300041494 | Ga0451837_0311690 | Ga0451837_0311690_123_719 | 188 |
| 184 | 3300041999 | Ga0439433_0010034 | Ga0439433_0010034_1107_1694 | 188 |
| 185 | 3300042007 | Ga0439449_0014829 | Ga0439449_0014829_1848_2435 | 188 |
| 186 | 3300042127 | Ga0450890_004502 | Ga0450890_004502_764_1384 | 188 |
| 187 | 3300042134 | Ga0450898_006055 | Ga0450898_006055_1081_1668 | 188 |
| 188 | 3300042438 | Ga0439459_0001722 | Ga0439459_0001722_1831_2451 | 188 |
| 189 | 3300042532 | Ga0450893_0007476 | Ga0450893_0007476_649_1251 | 188 |
| 190 | 3300042532 | Ga0450893_0011256 | Ga0450893_0011256_225_815 | 188 |
| 191 | 3300044656 | Ga0466969_0058084 | Ga0466969_0058084_1018_1599 | 188 |
| 192 | 3300044673 | Ga0453683_0014521 | Ga0453683_0014521_1031_1621 | 188 |
| 193 | 3300044693 | Ga0466961_0152181 | Ga0466961_0152181_719_1300 | 188 |
| 194 | 3300044842 | Ga0466957_0483597 | Ga0466957_0483597_16_597 | 188 |
| 195 | 3300045049 | Ga0466959_0141375 | Ga0466959_0141375_290_871 | 188 |
| 196 | 3300045051 | Ga0451576_0011722 | Ga0451576_0011722_358_948 | 188 |
| 197 | 3300045836 | Ga0466958_0147366 | Ga0466958_0147366_315_896 | 188 |
| 198 | 3300046528 | Ga0495642_0043618 | Ga0495642_0043618_525_1121 | 188 |
| 199 | 3300046615 | Ga0495656_0004207 | Ga0495656_0004207_2734_3330 | 188 |
| 200 | 3300046674 | Ga0495588_0072015 | Ga0495588_0072015_266_862 | 188 |
| 201 | 3300047318 | Ga0495636_0058997 | Ga0495636_0058997_493_1089 | 188 |
| 202 | 3300049529 | Ga0501313_025191 | Ga0501313_025191_130_732 | 188 |
| 203 | 3300049686 | Ga0501257_070510 | Ga0501257_070510_117_701 | 188 |
| 204 | 3300050493 | nmdc:mga0k408_267989_c1 | nmdc:mga0k408_267989_c1_158_778 | 188 |
| 205 | 3300061719 | Ga0466962_0081674 | Ga0466962_0081674_920_1501 | 188 |
| 206 | 3300005262 | Ga0065165_1000295 | Ga0065165_100029524 | 189 |
| 207 | 3300005327 | Ga0070658_10055164 | Ga0070658_100551642 | 189 |
| 208 | 3300031238 | Ga0265332_10003699 | Ga0265332_100036993 | 189 |
| 209 | 3300031344 | Ga0265316_10325976 | Ga0265316_103259763 | 189 |
| 210 | 3300031711 | Ga0265314_10004418 | Ga0265314_100044184 | 189 |
| 211 | 3300037312 | Ga0395899_0010279 | Ga0395899_0010279_2531_3121 | 189 |
| 212 | 3300037312 | Ga0395899_0251091 | Ga0395899_0251091_235_828 | 189 |
| 213 | 3300037418 | Ga0395900_0775401 | Ga0395900_0775401_49_642 | 189 |
| 214 | 3300037471 | Ga0395905_0000212 | Ga0395905_0000212_87765_88358 | 189 |
| 215 | 3300037471 | Ga0395905_0000672 | Ga0395905_0000672_44204_44797 | 189 |
| 216 | 3300037471 | Ga0395905_0051508 | Ga0395905_0051508_1071_1661 | 189 |
| 217 | 3300037471 | Ga0395905_0078432 | Ga0395905_0078432_1588_2178 | 189 |
| 218 | 3300037471 | Ga0395905_0219376 | Ga0395905_0219376_861_1448 | 189 |
| 219 | 3300037471 | Ga0395905_0369071 | Ga0395905_0369071_367_960 | 189 |
| 220 | 3300038443 | Ga0395901_0080774 | Ga0395901_0080774_1373_1963 | 189 |
| 221 | 3300041463 | Ga0451804_1107278 | Ga0451804_1107278_32_655 | 189 |
| 222 | 3300042439 | Ga0439464_0028968 | Ga0439464_0028968_295_885 | 189 |
| 223 | 3300045051 | Ga0451576_0499886 | Ga0451576_0499886_520_1125 | 189 |
| 224 | 3300049569 | Ga0501032_0092027 | Ga0501032_0092027_57_647 | 189 |
| 225 | 3300049571 | Ga0501034_0215211 | Ga0501034_0215211_590_1180 | 189 |
| 226 | 3300049574 | Ga0501038_0197511 | Ga0501038_0197511_591_1181 | 189 |
| 227 | 3300049579 | Ga0501043_0175748 | Ga0501043_0175748_739_1329 | 189 |
| 228 | 3300049580 | Ga0501046_0032960 | Ga0501046_0032960_2503_3093 | 189 |
| 229 | 3300049589 | Ga0501073_0133203 | Ga0501073_0133203_772_1362 | 189 |
| 230 | 3300049742 | Ga0501080_0085913 | Ga0501080_0085913_1710_2300 | 189 |
| 231 | 3300049822 | Ga0501035_0154779 | Ga0501035_0154779_706_1296 | 189 |
| 232 | 3300050493 | nmdc:mga0k408_175268_c1 | nmdc:mga0k408_175268_c1_521_1102 | 189 |
| 233 | iso_pu_bacteria | 2511231002 | 2511242779 | 189 |
| 234 | 3300005289 | Ga0065704_10082029 | Ga0065704_100820291 | 190 |
| 235 | 3300005330 | Ga0070690_100045265 | Ga0070690_1000452652 | 190 |
| 236 | 3300005334 | Ga0068869_100006901 | Ga0068869_1000069012 | 190 |
| 237 | 3300005337 | Ga0070682_100304596 | Ga0070682_1003045962 | 190 |
| 238 | 3300005353 | Ga0070669_100239421 | Ga0070669_1002394213 | 190 |
| 239 | 3300005364 | Ga0070673_100650071 | Ga0070673_1006500711 | 190 |
| 240 | 3300005535 | Ga0070684_100369827 | Ga0070684_1003698273 | 190 |
| 241 | 3300005719 | Ga0068861_100324978 | Ga0068861_1003249783 | 190 |
| 242 | 3300006042 | Ga0075368_10048243 | Ga0075368_100482432 | 190 |
| 243 | 3300006177 | Ga0075362_10032080 | Ga0075362_100320803 | 190 |
| 244 | 3300006946 | Ga0079104_1028202 | Ga0079104_10282021 | 190 |
| 245 | 3300006948 | Ga0099826_10141023 | Ga0099826_101410233 | 190 |
| 246 | 3300009177 | Ga0105248_10214122 | Ga0105248_102141223 | 190 |
| 247 | 3300009545 | Ga0105237_10487407 | Ga0105237_104874073 | 190 |
| 248 | 3300010375 | Ga0105239_10020553 | Ga0105239_100205533 | 190 |
| 249 | 3300014325 | Ga0163163_11028806 | Ga0163163_110288062 | 190 |
| 250 | 3300025230 | Ga0209563_114383 | Ga0209563_1143832 | 190 |
| 251 | 3300025242 | Ga0209258_100699 | Ga0209258_1006996 | 190 |
| 252 | 3300025914 | Ga0207671_10318775 | Ga0207671_103187753 | 190 |
| 253 | 3300025924 | Ga0207694_10274909 | Ga0207694_102749092 | 190 |
| 254 | 3300025934 | Ga0207686_10410455 | Ga0207686_104104552 | 190 |
| 255 | 3300025942 | Ga0207689_10006852 | Ga0207689_100068525 | 190 |
| 256 | 3300026088 | Ga0207641_10245768 | Ga0207641_102457683 | 190 |
| 257 | 3300026118 | Ga0207675_100199947 | Ga0207675_1001999473 | 190 |
| 258 | 3300028794 | Ga0307515_10064108 | Ga0307515_100641087 | 190 |
| 259 | 3300031730 | Ga0307516_10089269 | Ga0307516_100892693 | 190 |
| 260 | 3300032002 | Ga0307416_100509776 | Ga0307416_1005097762 | 190 |
| 261 | 3300041404 | Ga0439436_0045552 | Ga0439436_0045552_271_873 | 190 |
| 262 | 3300042134 | Ga0450898_007978 | Ga0450898_007978_781_1383 | 190 |
| 263 | 3300042156 | Ga0439446_0019867 | Ga0439446_0019867_596_1198 | 190 |
| 264 | 3300042437 | Ga0439444_0060284 | Ga0439444_0060284_95_706 | 190 |
| 265 | 3300044656 | Ga0466969_0017099 | Ga0466969_0017099_2366_2959 | 190 |
| 266 | 3300044683 | Ga0466965_0229814 | Ga0466965_0229814_27_623 | 190 |
| 267 | 3300044684 | Ga0466966_0054691 | Ga0466966_0054691_1101_1694 | 190 |
| 268 | 3300044693 | Ga0466961_0028342 | Ga0466961_0028342_2351_2944 | 190 |
| 269 | 3300044765 | Ga0466970_0030835 | Ga0466970_0030835_1220_1813 | 190 |
| 270 | 3300045049 | Ga0466959_0130992 | Ga0466959_0130992_549_1142 | 190 |
| 271 | 3300046492 | Ga0495585_0025055 | Ga0495585_0025055_348_947 | 190 |
| 272 | 3300046507 | Ga0495606_0167199 | Ga0495606_0167199_268_867 | 190 |
| 273 | 3300048925 | Ga0496122_0003759 | Ga0496122_0003759_18371_18964 | 190 |
| 274 | 3300048926 | Ga0496123_0097421 | Ga0496123_0097421_767_1357 | 190 |
| 275 | 3300048927 | Ga0496124_0153862 | Ga0496124_0153862_571_1164 | 190 |
| 276 | 3300048928 | Ga0496125_0003024 | Ga0496125_0003024_19483_20076 | 190 |
| 277 | 3300048929 | Ga0496126_0094457 | Ga0496126_0094457_1104_1697 | 190 |
| 278 | 3300049536 | Ga0501320_031279 | Ga0501320_031279_47_652 | 190 |
| 279 | iso_pu_bacteria | 2919704043 | 2919706348 | 190 |
| 280 | iso_pu_bacteria | 2939631187 | 2939635718 | 190 |
| 281 | 3300002704 | JGI25155J39150_1000264 | JGI25155J39150_100026417 | 191 |
| 282 | 3300002705 | JGI25156J39149_1000010 | JGI25156J39149_1000010120 | 191 |
| 283 | 3300002738 | JGI25154J39366_1000027 | JGI25154J39366_1000027120 | 191 |
| 284 | 3300002741 | JGI25157J39369_1000146 | JGI25157J39369_100014614 | 191 |
| 285 | 3300002774 | JGI25150J39212_1004919 | JGI25150J39212_10049192 | 191 |
| 286 | 3300002774 | JGI25150J39212_1006810 | JGI25150J39212_10068103 | 191 |
| 287 | 3300002987 | JGI25159J45721_1000445 | JGI25159J45721_100044521 | 191 |
| 288 | 3300002987 | JGI25159J45721_1002455 | JGI25159J45721_10024552 | 191 |
| 289 | 3300003187 | JGI25151J46595_10052728 | JGI25151J46595_100527282 | 191 |
| 290 | 3300003187 | JGI25151J46595_10062909 | JGI25151J46595_100629093 | 191 |
| 291 | 3300003187 | JGI25151J46595_10062969 | JGI25151J46595_100629693 | 191 |
| 292 | 3300003354 | JGI25160J50197_1000129 | JGI25160J50197_100012971 | 191 |
| 293 | 3300003354 | JGI25160J50197_1024830 | JGI25160J50197_10248302 | 191 |
| 294 | 3300003374 | JGI25161J50226_1000080 | JGI25161J50226_100008090 | 191 |
| 295 | 3300003773 | Ga0055537_1007693 | Ga0055537_10076933 | 191 |
| 296 | 3300003775 | Ga0055524_1000120 | Ga0055524_10001203 | 191 |
| 297 | 3300003781 | Ga0055536_1007145 | Ga0055536_10071453 | 191 |
| 298 | 3300003784 | Ga0055534_1005931 | Ga0055534_10059313 | 191 |
| 299 | 3300003784 | Ga0055534_1024493 | Ga0055534_10244931 | 191 |
| 300 | 3300003790 | Ga0055528_1002282 | Ga0055528_10022821 | 191 |
| 301 | 3300003791 | Ga0055530_10007449 | Ga0055530_100074496 | 191 |
| 302 | 3300003791 | Ga0055530_10026894 | Ga0055530_100268943 | 191 |
| 303 | 3300003792 | Ga0055540_1000067 | Ga0055540_100006733 | 191 |
| 304 | 3300003794 | Ga0055531_10000480 | Ga0055531_1000048016 | 191 |
| 305 | 3300004625 | Ga0055543_1000239 | Ga0055543_10002398 | 191 |
| 306 | 3300005262 | Ga0065165_1001501 | Ga0065165_100150116 | 191 |
| 307 | 3300005262 | Ga0065165_1055090 | Ga0065165_10550902 | 191 |
| 308 | 3300005841 | Ga0068863_100282268 | Ga0068863_1002822682 | 191 |
| 309 | 3300006048 | Ga0075363_100048837 | Ga0075363_1000488373 | 191 |
| 310 | 3300006048 | Ga0075363_100091748 | Ga0075363_1000917482 | 191 |
| 311 | 3300006048 | Ga0075363_100125655 | Ga0075363_1001256553 | 191 |
| 312 | 3300006051 | Ga0075364_10100907 | Ga0075364_101009072 | 191 |
| 313 | 3300006051 | Ga0075364_10161643 | Ga0075364_101616433 | 191 |
| 314 | 3300006058 | Ga0075432_10062450 | Ga0075432_100624502 | 191 |
| 315 | 3300006177 | Ga0075362_10043209 | Ga0075362_100432093 | 191 |
| 316 | 3300006178 | Ga0075367_10050981 | Ga0075367_100509813 | 191 |
| 317 | 3300006353 | Ga0075370_10001826 | Ga0075370_1000182610 | 191 |
| 318 | 3300013296 | Ga0157374_10016697 | Ga0157374_100166978 | 191 |
| 319 | 3300025206 | Ga0209435_100003 | Ga0209435_100003398 | 191 |
| 320 | 3300025245 | Ga0207425_1002311 | Ga0207425_10023114 | 191 |
| 321 | 3300025245 | Ga0207425_1005823 | Ga0207425_10058235 | 191 |
| 322 | 3300025246 | Ga0209646_1000008 | Ga0209646_1000008398 | 191 |
| 323 | 3300025250 | Ga0209026_1000007 | Ga0209026_1000007398 | 191 |
| 324 | 3300025256 | Ga0209759_1000019 | Ga0209759_1000019119 | 191 |
| 325 | 3300025263 | Ga0209565_1000116 | Ga0209565_10001164 | 191 |
| 326 | 3300025263 | Ga0209565_1001214 | Ga0209565_10012143 | 191 |
| 327 | 3300025273 | Ga0209673_1001210 | Ga0209673_100121032 | 191 |
| 328 | 3300025284 | Ga0209130_1000095 | Ga0209130_100009566 | 191 |
| 329 | 3300025284 | Ga0209130_1000134 | Ga0209130_10001343 | 191 |
| 330 | 3300025291 | Ga0209675_1000373 | Ga0209675_100037317 | 191 |
| 331 | 3300025291 | Ga0209675_1005068 | Ga0209675_10050687 | 191 |
| 332 | 3300025291 | Ga0209675_1045089 | Ga0209675_10450892 | 191 |
| 333 | 3300025292 | Ga0209676_1000145 | Ga0209676_1000145144 | 191 |
| 334 | 3300025292 | Ga0209676_1008763 | Ga0209676_10087633 | 191 |
| 335 | 3300025294 | Ga0209025_1007514 | Ga0209025_10075144 | 191 |
| 336 | 3300025294 | Ga0209025_1018512 | Ga0209025_10185123 | 191 |
| 337 | 3300025294 | Ga0209025_1021495 | Ga0209025_10214953 | 191 |
| 338 | 3300025294 | Ga0209025_1041211 | Ga0209025_10412113 | 191 |
| 339 | 3300025295 | Ga0209564_1004068 | Ga0209564_10040689 | 191 |
| 340 | 3300025295 | Ga0209564_1006206 | Ga0209564_10062069 | 191 |
| 341 | 3300025297 | Ga0209758_1016925 | Ga0209758_10169253 | 191 |
| 342 | 3300025297 | Ga0209758_1096062 | Ga0209758_10960622 | 191 |
| 343 | 3300025298 | Ga0209050_1000023 | Ga0209050_100002333 | 191 |
| 344 | 3300025298 | Ga0209050_1000118 | Ga0209050_100011827 | 191 |
| 345 | 3300025298 | Ga0209050_1002654 | Ga0209050_10026543 | 191 |
| 346 | 3300025298 | Ga0209050_1017603 | Ga0209050_10176033 | 191 |
| 347 | 3300025299 | Ga0209256_1000003 | Ga0209256_1000003767 | 191 |
| 348 | 3300025302 | Ga0207426_1000397 | Ga0207426_100039792 | 191 |
| 349 | 3300025302 | Ga0207426_1031894 | Ga0207426_10318943 | 191 |
| 350 | 3300025303 | Ga0209051_1000017 | Ga0209051_100001733 | 191 |
| 351 | 3300025303 | Ga0209051_1046473 | Ga0209051_10464733 | 191 |
| 352 | 3300025304 | Ga0209257_1000041 | Ga0209257_100004133 | 191 |
| 353 | 3300025304 | Ga0209257_1056523 | Ga0209257_10565232 | 191 |
| 354 | 3300027614 | Ga0209970_1000061 | Ga0209970_100006114 | 191 |
| 355 | 3300027665 | Ga0209983_1010179 | Ga0209983_10101793 | 191 |
| 356 | 3300027876 | Ga0209974_10013714 | Ga0209974_100137143 | 191 |
| 357 | 3300028794 | Ga0307515_10044865 | Ga0307515_100448659 | 191 |
| 358 | 3300028794 | Ga0307515_10053971 | Ga0307515_100539718 | 191 |
| 359 | 3300030522 | Ga0307512_10095143 | Ga0307512_100951433 | 191 |
| 360 | 3300030522 | Ga0307512_10095711 | Ga0307512_100957113 | 191 |
| 361 | 3300031456 | Ga0307513_10000104 | Ga0307513_1000010429 | 191 |
| 362 | 3300031456 | Ga0307513_10014677 | Ga0307513_100146773 | 191 |
| 363 | 3300031548 | Ga0307408_100882047 | Ga0307408_1008820472 | 191 |
| 364 | 3300031616 | Ga0307508_10000271 | Ga0307508_1000027149 | 191 |
| 365 | 3300031730 | Ga0307516_10126387 | Ga0307516_101263873 | 191 |
| 366 | 3300031824 | Ga0307413_10369239 | Ga0307413_103692393 | 191 |
| 367 | 3300031901 | Ga0307406_10121124 | Ga0307406_101211242 | 191 |
| 368 | 3300033179 | Ga0307507_10132512 | Ga0307507_101325123 | 191 |
| 369 | 3300037471 | Ga0395905_0035342 | Ga0395905_0035342_2891_3490 | 191 |
| 370 | 3300041441 | Ga0451787_558123 | Ga0451787_558123_123_707 | 191 |
| 371 | 3300041453 | Ga0451797_0055608 | Ga0451797_0055608_505_1089 | 191 |
| 372 | 3300041459 | Ga0451800_0550407 | Ga0451800_0550407_183_767 | 191 |
| 373 | 3300041486 | Ga0451807_0033591 | Ga0451807_0033591_248_832 | 191 |
| 374 | 3300041491 | Ga0451833_0440785 | Ga0451833_0440785_41_625 | 191 |
| 375 | 3300041503 | Ga0451847_0563971 | Ga0451847_0563971_258_842 | 191 |
| 376 | 3300041507 | Ga0451851_0371223 | Ga0451851_0371223_116_700 | 191 |
| 377 | 3300041512 | Ga0451853_2273887 | Ga0451853_2273887_254_838 | 191 |
| 378 | 3300042876 | Ga0451577_0706583 | Ga0451577_0706583_184_783 | 191 |
| 379 | 3300044684 | Ga0466966_0018660 | Ga0466966_0018660_1281_1904 | 191 |
| 380 | 3300044693 | Ga0466961_0188658 | Ga0466961_0188658_554_1177 | 191 |
| 381 | 3300045049 | Ga0466959_0011390 | Ga0466959_0011390_956_1579 | 191 |
| 382 | 3300046519 | Ga0495632_0008733 | Ga0495632_0008733_4940_5524 | 191 |
| 383 | 3300046519 | Ga0495632_0009624 | Ga0495632_0009624_4630_5214 | 191 |
| 384 | 3300046522 | Ga0495643_0074601 | Ga0495643_0074601_1163_1747 | 191 |
| 385 | 3300046660 | Ga0495625_0002511 | Ga0495625_0002511_18249_18833 | 191 |
| 386 | 3300050489 | nmdc:mga03683_34515_c1 | nmdc:mga03683_34515_c1_180_779 | 191 |
| 387 | 3300050489 | nmdc:mga03683_70266_c1 | nmdc:mga03683_70266_c1_151_735 | 191 |
| 388 | 3300050490 | nmdc:mga03n38_115787_c1 | nmdc:mga03n38_115787_c1_222_833 | 191 |
| 389 | 3300050490 | nmdc:mga03n38_83260_c1 | nmdc:mga03n38_83260_c1_294_893 | 191 |
| 390 | 3300050491 | nmdc:mga00v17_147229_c1 | nmdc:mga00v17_147229_c1_344_955 | 191 |
| 391 | 3300050493 | nmdc:mga0k408_148640_c1 | nmdc:mga0k408_148640_c1_381_992 | 191 |
| 392 | 3300050493 | nmdc:mga0k408_58092_c1 | nmdc:mga0k408_58092_c1_718_1317 | 191 |
| 393 | 3300050494 | nmdc:mga06z11_67145_c1 | nmdc:mga06z11_67145_c1_510_1094 | 191 |
| 394 | 3300050496 | nmdc:mga07m45_14447_c1 | nmdc:mga07m45_14447_c1_2869_3468 | 191 |
| 395 | 3300050496 | nmdc:mga07m45_271171_c1 | nmdc:mga07m45_271171_c1_240_851 | 191 |
| 396 | 3300053086 | Ga0500578_0000079 | Ga0500578_0000079_105857_106456 | 191 |
| 397 | 3300053088 | Ga0500644_0011166 | Ga0500644_0011166_229_840 | 191 |
| 398 | 3300053088 | Ga0500644_0143738 | Ga0500644_0143738_316_900 | 191 |
| 399 | 3300053094 | Ga0500566_0094384 | Ga0500566_0094384_994_1605 | 191 |
| 400 | 3300053117 | Ga0500593_005843 | Ga0500593_005843_554_1165 | 191 |
| 401 | 3300053130 | Ga0500642_0082410 | Ga0500642_0082410_854_1453 | 191 |
| 402 | 3300053137 | Ga0500561_0030841 | Ga0500561_0030841_455_1054 | 191 |
| 403 | 3300053139 | Ga0500568_0010029 | Ga0500568_0010029_3478_4062 | 191 |
| 404 | 3300053151 | Ga0500604_0026847 | Ga0500604_0026847_459_1070 | 191 |
| 405 | 3300053156 | Ga0500622_0049996 | Ga0500622_0049996_951_1550 | 191 |
| 406 | 3300053724 | Ga0500570_151845 | Ga0500570_151845_68_652 | 191 |
| 407 | 3300053739 | Ga0500587_003978 | Ga0500587_003978_496_1080 | 191 |
| 408 | 3300055283 | Ga0500661_001399 | Ga0500661_001399_332_943 | 191 |
| 409 | iso_pu_bacteria | 2721755523 | 2722885524 | 191 |
| 410 | iso_pu_bacteria | 2839138175 | 2839142297 | 191 |
| 411 | iso_pu_bacteria | 2974320154 | 2974320552 | 191 |
| 412 | 3300003792 | Ga0055540_1008475 | Ga0055540_10084753 | 192 |
| 413 | 3300005468 | Ga0070707_100617116 | Ga0070707_1006171162 | 192 |
| 414 | 3300005563 | Ga0068855_100095565 | Ga0068855_1000955652 | 192 |
| 415 | 3300009093 | Ga0105240_10880735 | Ga0105240_108807352 | 192 |
| 416 | 3300009177 | Ga0105248_11260356 | Ga0105248_112603562 | 192 |
| 417 | 3300025303 | Ga0209051_1002067 | Ga0209051_100206710 | 192 |
| 418 | 3300025922 | Ga0207646_10404822 | Ga0207646_104048222 | 192 |
| 419 | 3300027252 | Ga0209973_1005543 | Ga0209973_10055433 | 192 |
| 420 | 3300031507 | Ga0307509_10534446 | Ga0307509_105344461 | 192 |
| 421 | 3300037418 | Ga0395900_0138988 | Ga0395900_0138988_1418_2020 | 192 |
| 422 | 3300037466 | Ga0395898_0025536 | Ga0395898_0025536_3807_4409 | 192 |
| 423 | 3300037471 | Ga0395905_0153417 | Ga0395905_0153417_1379_1981 | 192 |
| 424 | 3300037471 | Ga0395905_0190268 | Ga0395905_0190268_968_1570 | 192 |
| 425 | 3300038443 | Ga0395901_0037127 | Ga0395901_0037127_1181_1783 | 192 |
| 426 | 3300038443 | Ga0395901_0059598 | Ga0395901_0059598_1360_1962 | 192 |
| 427 | 3300042012 | Ga0439455_0036044 | Ga0439455_0036044_369_1004 | 192 |
| 428 | 3300042876 | Ga0451577_0000166 | Ga0451577_0000166_36553_37167 | 192 |
| 429 | 3300044712 | Ga0453684_0000187 | Ga0453684_0000187_231702_232316 | 192 |
| 430 | 3300044712 | Ga0453684_0347160 | Ga0453684_0347160_459_1064 | 192 |
| 431 | 3300044901 | Ga0466960_0020598 | Ga0466960_0020598_951_1553 | 192 |
| 432 | iso_pu_bacteria | 2738543012 | 2739240940 | 192 |
| 433 | iso_pu_bacteria | 2816332133 | 2816471982 | 192 |
| 434 | iso_pu_bacteria | 2928115317 | 2928119328 | 192 |
| 435 | 3300005353 | Ga0070669_100093224 | Ga0070669_1000932242 | 193 |
| 436 | 3300005577 | Ga0068857_100155748 | Ga0068857_1001557483 | 193 |
| 437 | 3300006177 | Ga0075362_10052668 | Ga0075362_100526683 | 193 |
| 438 | 3300006177 | Ga0075362_10172671 | Ga0075362_101726712 | 193 |
| 439 | 3300006195 | Ga0075366_10036060 | Ga0075366_100360604 | 193 |
| 440 | 3300006195 | Ga0075366_10063663 | Ga0075366_100636633 | 193 |
| 441 | 3300006195 | Ga0075366_10129493 | Ga0075366_101294933 | 193 |
| 442 | 3300006195 | Ga0075366_10333389 | Ga0075366_103333891 | 193 |
| 443 | 3300006946 | Ga0079104_1000072 | Ga0079104_1000072137 | 193 |
| 444 | 3300009036 | Ga0105244_10063490 | Ga0105244_100634902 | 193 |
| 445 | 3300009092 | Ga0105250_10000680 | Ga0105250_100006808 | 193 |
| 446 | 3300009148 | Ga0105243_10002347 | Ga0105243_100023479 | 193 |
| 447 | 3300009148 | Ga0105243_10965989 | Ga0105243_109659891 | 193 |
| 448 | 3300009176 | Ga0105242_10012979 | Ga0105242_100129796 | 193 |
| 449 | 3300025711 | Ga0207696_1002009 | Ga0207696_100200911 | 193 |
| 450 | 3300025934 | Ga0207686_10010264 | Ga0207686_100102645 | 193 |
| 451 | 3300025935 | Ga0207709_10000132 | Ga0207709_1000013226 | 193 |
| 452 | 3300027111 | Ga0209281_1000002 | Ga0209281_1000002988 | 193 |
| 453 | 3300028794 | Ga0307515_10005119 | Ga0307515_1000511921 | 193 |
| 454 | 3300031456 | Ga0307513_10103621 | Ga0307513_101036213 | 193 |
| 455 | 3300031649 | Ga0307514_10004100 | Ga0307514_1000410015 | 193 |
| 456 | 3300031901 | Ga0307406_10140648 | Ga0307406_101406483 | 193 |
| 457 | 3300031911 | Ga0307412_10246354 | Ga0307412_102463541 | 193 |
| 458 | 3300037466 | Ga0395898_0755809 | Ga0395898_0755809_251_847 | 193 |
| 459 | 3300037471 | Ga0395905_0001350 | Ga0395905_0001350_20042_20638 | 193 |
| 460 | 3300037471 | Ga0395905_0789584 | Ga0395905_0789584_43_639 | 193 |
| 461 | 3300046810 | Ga0495660_0029299 | Ga0495660_0029299_1845_2444 | 193 |
| 462 | 3300049763 | Ga0501266_000273 | Ga0501266_000273_437_1057 | 193 |
| 463 | 3300050489 | nmdc:mga03683_158783_c1 | nmdc:mga03683_158783_c1_67_687 | 193 |
| 464 | 3300050493 | nmdc:mga0k408_130854_c1 | nmdc:mga0k408_130854_c1_490_1110 | 193 |
| 465 | 3300050493 | nmdc:mga0k408_474819_c1 | nmdc:mga0k408_474819_c1_66_674 | 193 |
| 466 | 3300053088 | Ga0500644_0033629 | Ga0500644_0033629_641_1267 | 193 |
| 467 | 3300053108 | Ga0500562_044402 | Ga0500562_044402_185_811 | 193 |
| 468 | 3300053142 | Ga0500577_0064048 | Ga0500577_0064048_248_871 | 193 |
| 469 | iso_pu_bacteria | 2643221609 | 2644059419 | 193 |
| 470 | iso_pu_bacteria | 2643221611 | 2644074188 | 193 |
| 471 | iso_pu_bacteria | 2738543013 | 2739249563 | 193 |
| 472 | iso_pu_bacteria | 2842718218 | 2842718574 | 193 |
| 473 | iso_pu_bacteria | 2885192300 | 2885193001 | 193 |
| 474 | 3300005354 | Ga0070675_100315206 | Ga0070675_1003152063 | 194 |
| 475 | 3300005356 | Ga0070674_100394874 | Ga0070674_1003948743 | 194 |
| 476 | 3300006048 | Ga0075363_100347380 | Ga0075363_1003473802 | 194 |
| 477 | 3300006353 | Ga0075370_10031240 | Ga0075370_100312403 | 194 |
| 478 | 3300027424 | Ga0209984_1000927 | Ga0209984_10009275 | 194 |
| 479 | 3300027543 | Ga0209999_1035045 | Ga0209999_10350453 | 194 |
| 480 | 3300027665 | Ga0209983_1038061 | Ga0209983_10380613 | 194 |
| 481 | 3300027682 | Ga0209971_1000817 | Ga0209971_100081711 | 194 |
| 482 | 3300031235 | Ga0265330_10000110 | Ga0265330_1000011013 | 194 |
| 483 | 3300031238 | Ga0265332_10000011 | Ga0265332_1000001112 | 194 |
| 484 | 3300031247 | Ga0265340_10134722 | Ga0265340_101347223 | 194 |
| 485 | 3300031711 | Ga0265314_10000026 | Ga0265314_10000026256 | 194 |
| 486 | 3300042876 | Ga0451577_0098069 | Ga0451577_0098069_623_1243 | 194 |
| 487 | 3300044712 | Ga0453684_0795806 | Ga0453684_0795806_335_955 | 194 |
| 488 | 3300049650 | Ga0501199_002565 | Ga0501199_002565_747_1358 | 194 |
| 489 | 3300049663 | Ga0501223_031134 | Ga0501223_031134_335_946 | 194 |
| 490 | 3300049776 | Ga0501280_007909 | Ga0501280_007909_434_1045 | 194 |
| 491 | 3300050492 | nmdc:mga0yw44_192448_c1 | nmdc:mga0yw44_192448_c1_123_746 | 194 |
| 492 | 3300050496 | nmdc:mga07m45_2723_c1 | nmdc:mga07m45_2723_c1_745_1359 | 194 |
| 493 | 3300053161 | Ga0500634_0112788 | Ga0500634_0112788_618_1235 | 194 |
| 494 | iso_pu_bacteria | 2547132374 | 2548497673 | 194 |
| 495 | iso_pu_bacteria | 2643221570 | 2643867124 | 194 |
| 496 | iso_pu_bacteria | 2643221596 | 2643990064 | 194 |
| 497 | iso_pu_bacteria | 2643221652 | 2644295545 | 194 |
| 498 | iso_pu_bacteria | 2643221717 | 2644645080 | 194 |
| 499 | iso_pu_bacteria | 2894023352 | 2894027233 | 194 |
| 500 | iso_pu_bacteria | 2990710928 | 2990711281 | 194 |
| 501 | 3300002987 | JGI25159J45721_1014855 | JGI25159J45721_10148552 | 195 |
| 502 | 3300003316 | rootH1_10083951 | rootH1_100839512 | 195 |
| 503 | 3300003322 | rootL2_10014092 | rootL2_100140923 | 195 |
| 504 | 3300003323 | rootH1_10042174 | rootH1_100421742 | 195 |
| 505 | 3300005614 | Ga0068856_100016853 | Ga0068856_1000168538 | 195 |
| 506 | 3300025256 | Ga0209759_1037604 | Ga0209759_10376042 | 195 |
| 507 | 3300025912 | Ga0207707_10631970 | Ga0207707_106319702 | 195 |
| 508 | 3300026078 | Ga0207702_10039951 | Ga0207702_100399513 | 195 |
| 509 | 3300027876 | Ga0209974_10002610 | Ga0209974_100026105 | 195 |
| 510 | 3300028573 | Ga0265334_10057688 | Ga0265334_100576883 | 195 |
| 511 | 3300031548 | Ga0307408_100000131 | Ga0307408_10000013113 | 195 |
| 512 | 3300031649 | Ga0307514_10000558 | Ga0307514_1000055832 | 195 |
| 513 | 3300031901 | Ga0307406_10007581 | Ga0307406_100075818 | 195 |
| 514 | 3300032005 | Ga0307411_10226646 | Ga0307411_102266463 | 195 |
| 515 | 3300036401 | Ga0373937_0127620 | Ga0373937_0127620_425_1054 | 195 |
| 516 | 3300041460 | Ga0451802_1761845 | Ga0451802_1761845_207_812 | 195 |
| 517 | 3300041486 | Ga0451807_0378624 | Ga0451807_0378624_715_1320 | 195 |
| 518 | 3300042125 | Ga0450923_021693 | Ga0450923_021693_263_898 | 195 |
| 519 | 3300044656 | Ga0466969_0038862 | Ga0466969_0038862_1356_2000 | 195 |
| 520 | 3300044683 | Ga0466965_0003310 | Ga0466965_0003310_1815_2459 | 195 |
| 521 | 3300044684 | Ga0466966_0009059 | Ga0466966_0009059_4195_4839 | 195 |
| 522 | 3300044693 | Ga0466961_0025989 | Ga0466961_0025989_2727_3371 | 195 |
| 523 | 3300044706 | Ga0466964_0004084 | Ga0466964_0004084_545_1189 | 195 |
| 524 | 3300044719 | Ga0466971_0004547 | Ga0466971_0004547_4516_5160 | 195 |
| 525 | 3300044735 | Ga0466968_0034015 | Ga0466968_0034015_642_1286 | 195 |
| 526 | 3300044765 | Ga0466970_0037204 | Ga0466970_0037204_278_922 | 195 |
| 527 | 3300045049 | Ga0466959_0026708 | Ga0466959_0026708_1245_1889 | 195 |
| 528 | 3300045836 | Ga0466958_0007306 | Ga0466958_0007306_1631_2275 | 195 |
| 529 | 3300045976 | Ga0466967_0656883 | Ga0466967_0656883_225_869 | 195 |
| 530 | 3300053136 | Ga0500559_0008544 | Ga0500559_0008544_3337_3954 | 195 |
| 531 | 3300061719 | Ga0466962_0005278 | Ga0466962_0005278_2709_3353 | 195 |
| 532 | 3300005327 | Ga0070658_10192649 | Ga0070658_101926492 | 196 |
| 533 | 3300005331 | Ga0070670_100213738 | Ga0070670_1002137383 | 196 |
| 534 | 3300005335 | Ga0070666_10308493 | Ga0070666_103084931 | 196 |
| 535 | 3300005347 | Ga0070668_100063350 | Ga0070668_1000633505 | 196 |
| 536 | 3300005367 | Ga0070667_100010858 | Ga0070667_1000108583 | 196 |
| 537 | 3300005456 | Ga0070678_100446201 | Ga0070678_1004462012 | 196 |
| 538 | 3300006177 | Ga0075362_10052090 | Ga0075362_100520902 | 196 |
| 539 | 3300006186 | Ga0075369_10222545 | Ga0075369_102225452 | 196 |
| 540 | 3300006195 | Ga0075366_10098875 | Ga0075366_100988753 | 196 |
| 541 | 3300006353 | Ga0075370_10102663 | Ga0075370_101026632 | 196 |
| 542 | 3300013104 | Ga0157370_10370307 | Ga0157370_103703073 | 196 |
| 543 | 3300013297 | Ga0157378_11103912 | Ga0157378_111039122 | 196 |
| 544 | 3300013306 | Ga0163162_10149785 | Ga0163162_101497853 | 196 |
| 545 | 3300014325 | Ga0163163_10469441 | Ga0163163_104694412 | 196 |
| 546 | 3300014326 | Ga0157380_10476896 | Ga0157380_104768963 | 196 |
| 547 | 3300014497 | Ga0182008_10003510 | Ga0182008_100035103 | 196 |
| 548 | 3300014497 | Ga0182008_10018684 | Ga0182008_100186843 | 196 |
| 549 | 3300014497 | Ga0182008_10075392 | Ga0182008_100753923 | 196 |
| 550 | 3300014968 | Ga0157379_10655909 | Ga0157379_106559092 | 196 |
| 551 | 3300015262 | Ga0182007_10009603 | Ga0182007_100096035 | 196 |
| 552 | 3300015265 | Ga0182005_1021523 | Ga0182005_10215233 | 196 |
| 553 | 3300015683 | Ga0183362_10005 | Ga0183362_10005275 | 196 |
| 554 | 3300017792 | Ga0163161_10141927 | Ga0163161_101419273 | 196 |
| 555 | 3300025271 | Ga0207666_1003182 | Ga0207666_10031822 | 196 |
| 556 | 3300025292 | Ga0209676_1031787 | Ga0209676_10317873 | 196 |
| 557 | 3300025937 | Ga0207669_10083862 | Ga0207669_100838623 | 196 |
| 558 | 3300025986 | Ga0207658_10127736 | Ga0207658_101277363 | 196 |
| 559 | 3300026041 | Ga0207639_10203670 | Ga0207639_102036702 | 196 |
| 560 | 3300026089 | Ga0207648_10211078 | Ga0207648_102110783 | 196 |
| 561 | 3300026116 | Ga0207674_10703547 | Ga0207674_107035472 | 196 |
| 562 | 3300026121 | Ga0207683_10102933 | Ga0207683_101029332 | 196 |
| 563 | 3300028379 | Ga0268266_10178609 | Ga0268266_101786093 | 196 |
| 564 | 3300028379 | Ga0268266_10844590 | Ga0268266_108445902 | 196 |
| 565 | 3300031251 | Ga0265327_10006235 | Ga0265327_100062359 | 196 |
| 566 | 3300042002 | Ga0439442_017630 | Ga0439442_017630_269_901 | 196 |
| 567 | 3300046471 | Ga0495650_0030946 | Ga0495650_0030946_388_1014 | 196 |
| 568 | 3300046475 | Ga0495639_0046029 | Ga0495639_0046029_1019_1651 | 196 |
| 569 | 3300046522 | Ga0495643_0083424 | Ga0495643_0083424_697_1320 | 196 |
| 570 | 3300046528 | Ga0495642_0046766 | Ga0495642_0046766_1122_1754 | 196 |
| 571 | 3300046615 | Ga0495656_0059450 | Ga0495656_0059450_733_1365 | 196 |
| 572 | 3300046678 | Ga0495599_0202936 | Ga0495599_0202936_141_773 | 196 |
| 573 | 3300047315 | Ga0495581_0056860 | Ga0495581_0056860_475_1107 | 196 |
| 574 | 3300047469 | Ga0495673_0160256 | Ga0495673_0160256_55_654 | 196 |
| 575 | 3300048903 | Ga0496100_0015801 | Ga0496100_0015801_478_1110 | 196 |
| 576 | 3300048905 | Ga0496102_0006927 | Ga0496102_0006927_665_1297 | 196 |
| 577 | 3300048907 | Ga0496104_0003316 | Ga0496104_0003316_13240_13872 | 196 |
| 578 | 3300048907 | Ga0496104_0303203 | Ga0496104_0303203_427_1050 | 196 |
| 579 | 3300048908 | Ga0496105_0033011 | Ga0496105_0033011_2741_3373 | 196 |
| 580 | 3300048909 | Ga0496106_0120152 | Ga0496106_0120152_786_1418 | 196 |
| 581 | 3300048910 | Ga0496107_0243422 | Ga0496107_0243422_213_845 | 196 |
| 582 | 3300048911 | Ga0496108_0120778 | Ga0496108_0120778_690_1322 | 196 |
| 583 | 3300048911 | Ga0496108_0340009 | Ga0496108_0340009_394_1026 | 196 |
| 584 | 3300048912 | Ga0496109_0060340 | Ga0496109_0060340_2020_2652 | 196 |
| 585 | 3300048913 | Ga0496110_0081564 | Ga0496110_0081564_1474_2106 | 196 |
| 586 | 3300048914 | Ga0496111_0354222 | Ga0496111_0354222_427_1059 | 196 |
| 587 | 3300050489 | nmdc:mga03683_75353_c1 | nmdc:mga03683_75353_c1_626_1258 | 196 |
| 588 | 3300050493 | nmdc:mga0k408_87958_c1 | nmdc:mga0k408_87958_c1_893_1525 | 196 |
| 589 | 3300050496 | nmdc:mga07m45_6665_c1 | nmdc:mga07m45_6665_c1_633_1265 | 196 |
| 590 | 3300050516 | nmdc:mga0sz30_248349_c1 | nmdc:mga0sz30_248349_c1_20_652 | 196 |
| 591 | 3300002773 | JGI25152J39213_1000752 | JGI25152J39213_100075212 | 197 |
| 592 | 3300002774 | JGI25150J39212_1004196 | JGI25150J39212_10041962 | 197 |
| 593 | 3300003215 | JGI25153J46596_10014796 | JGI25153J46596_100147965 | 197 |
| 594 | 3300003771 | Ga0055526_1009134 | Ga0055526_10091342 | 197 |
| 595 | 3300003790 | Ga0055528_1056769 | Ga0055528_10567691 | 197 |
| 596 | 3300009176 | Ga0105242_10211390 | Ga0105242_102113901 | 197 |
| 597 | 3300025245 | Ga0207425_1003440 | Ga0207425_10034403 | 197 |
| 598 | 3300025258 | Ga0209129_1000062 | Ga0209129_1000062166 | 197 |
| 599 | 3300025273 | Ga0209673_1013829 | Ga0209673_10138295 | 197 |
| 600 | 3300025295 | Ga0209564_1000176 | Ga0209564_100017686 | 197 |
| 601 | 3300025297 | Ga0209758_1000129 | Ga0209758_10001293 | 197 |
| 602 | 3300048913 | Ga0496110_0219634 | Ga0496110_0219634_464_1066 | 197 |
| 603 | 3300048913 | Ga0496110_1008096 | Ga0496110_1008096_94_696 | 197 |
| 604 | 3300048927 | Ga0496124_0124076 | Ga0496124_0124076_360_971 | 197 |
| 605 | 3300049571 | Ga0501034_0539668 | Ga0501034_0539668_171_797 | 197 |
| 606 | 3300002705 | JGI25156J39149_1014497 | JGI25156J39149_10144973 | 198 |
| 607 | 3300002738 | JGI25154J39366_1003058 | JGI25154J39366_10030582 | 198 |
| 608 | 3300002741 | JGI25157J39369_1000021 | JGI25157J39369_100002114 | 198 |
| 609 | 3300002741 | JGI25157J39369_1000351 | JGI25157J39369_10003513 | 198 |
| 610 | 3300003752 | Ga0055539_1009683 | Ga0055539_10096831 | 198 |
| 611 | 3300003761 | Ga0055535_1000307 | Ga0055535_100030726 | 198 |
| 612 | 3300003763 | Ga0055529_1000488 | Ga0055529_100048822 | 198 |
| 613 | 3300005355 | Ga0070671_100009262 | Ga0070671_1000092629 | 198 |
| 614 | 3300005364 | Ga0070673_100111483 | Ga0070673_1001114833 | 198 |
| 615 | 3300005459 | Ga0068867_100415805 | Ga0068867_1004158052 | 198 |
| 616 | 3300005539 | Ga0068853_100142484 | Ga0068853_1001424842 | 198 |
| 617 | 3300005548 | Ga0070665_100300282 | Ga0070665_1003002823 | 198 |
| 618 | 3300005577 | Ga0068857_100035461 | Ga0068857_1000354616 | 198 |
| 619 | 3300005614 | Ga0068856_100020989 | Ga0068856_1000209893 | 198 |
| 620 | 3300005618 | Ga0068864_100137148 | Ga0068864_1001371483 | 198 |
| 621 | 3300006353 | Ga0075370_10002711 | Ga0075370_100027116 | 198 |
| 622 | 3300009093 | Ga0105240_10171884 | Ga0105240_101718843 | 198 |
| 623 | 3300009093 | Ga0105240_10331162 | Ga0105240_103311623 | 198 |
| 624 | 3300009093 | Ga0105240_10962580 | Ga0105240_109625801 | 198 |
| 625 | 3300009545 | Ga0105237_10001471 | Ga0105237_1000147110 | 198 |
| 626 | 3300009551 | Ga0105238_10053658 | Ga0105238_100536585 | 198 |
| 627 | 3300009551 | Ga0105238_10467434 | Ga0105238_104674342 | 198 |
| 628 | 3300010375 | Ga0105239_10003011 | Ga0105239_100030113 | 198 |
| 629 | 3300013105 | Ga0157369_10055954 | Ga0157369_100559543 | 198 |
| 630 | 3300014968 | Ga0157379_10369461 | Ga0157379_103694612 | 198 |
| 631 | 3300025242 | Ga0209258_100319 | Ga0209258_10031952 | 198 |
| 632 | 3300025246 | Ga0209646_1000060 | Ga0209646_1000060144 | 198 |
| 633 | 3300025250 | Ga0209026_1000049 | Ga0209026_1000049142 | 198 |
| 634 | 3300025253 | Ga0209677_100782 | Ga0209677_10078212 | 198 |
| 635 | 3300025256 | Ga0209759_1000069 | Ga0209759_1000069142 | 198 |
| 636 | 3300025256 | Ga0209759_1001175 | Ga0209759_10011759 | 198 |
| 637 | 3300025256 | Ga0209759_1004778 | Ga0209759_10047783 | 198 |
| 638 | 3300025256 | Ga0209759_1021590 | Ga0209759_10215902 | 198 |
| 639 | 3300025272 | Ga0209455_1000157 | Ga0209455_100015791 | 198 |
| 640 | 3300025901 | Ga0207688_10070573 | Ga0207688_100705733 | 198 |
| 641 | 3300025911 | Ga0207654_10069835 | Ga0207654_100698353 | 198 |
| 642 | 3300025913 | Ga0207695_10009579 | Ga0207695_100095794 | 198 |
| 643 | 3300025913 | Ga0207695_10016584 | Ga0207695_1001658412 | 198 |
| 644 | 3300025914 | Ga0207671_10013202 | Ga0207671_100132028 | 198 |
| 645 | 3300025920 | Ga0207649_10002028 | Ga0207649_1000202811 | 198 |
| 646 | 3300025924 | Ga0207694_10021765 | Ga0207694_100217653 | 198 |
| 647 | 3300025931 | Ga0207644_10106468 | Ga0207644_101064683 | 198 |
| 648 | 3300025932 | Ga0207690_10002544 | Ga0207690_1000254413 | 198 |
| 649 | 3300025933 | Ga0207706_10620741 | Ga0207706_106207412 | 198 |
| 650 | 3300025941 | Ga0207711_10045155 | Ga0207711_100451555 | 198 |
| 651 | 3300025945 | Ga0207679_10000647 | Ga0207679_100006479 | 198 |
| 652 | 3300025949 | Ga0207667_10372014 | Ga0207667_103720143 | 198 |
| 653 | 3300025960 | Ga0207651_10009684 | Ga0207651_100096843 | 198 |
| 654 | 3300025981 | Ga0207640_10082829 | Ga0207640_100828293 | 198 |
| 655 | 3300026041 | Ga0207639_10217663 | Ga0207639_102176633 | 198 |
| 656 | 3300026078 | Ga0207702_10005245 | Ga0207702_1000524510 | 198 |
| 657 | 3300026095 | Ga0207676_10120268 | Ga0207676_101202683 | 198 |
| 658 | 3300026116 | Ga0207674_10126161 | Ga0207674_101261613 | 198 |
| 659 | 3300026121 | Ga0207683_10162030 | Ga0207683_101620303 | 198 |
| 660 | 3300028379 | Ga0268266_10055366 | Ga0268266_100553663 | 198 |
| 661 | 3300028666 | Ga0265336_10000040 | Ga0265336_1000004033 | 198 |
| 662 | 3300029957 | Ga0265324_10004950 | Ga0265324_100049502 | 198 |
| 663 | 3300031507 | Ga0307509_10457598 | Ga0307509_104575983 | 198 |
| 664 | 3300031730 | Ga0307516_10003164 | Ga0307516_1000316426 | 198 |
| 665 | 3300037471 | Ga0395905_0214672 | Ga0395905_0214672_1125_1757 | 198 |
| 666 | 3300038443 | Ga0395901_0003173 | Ga0395901_0003173_6041_6673 | 198 |
| 667 | 3300041458 | Ga0451798_0677714 | Ga0451798_0677714_727_1335 | 198 |
| 668 | 3300041459 | Ga0451800_0260100 | Ga0451800_0260100_1409_2017 | 198 |
| 669 | 3300041460 | Ga0451802_0380592 | Ga0451802_0380592_150_758 | 198 |
| 670 | 3300041463 | Ga0451804_0450657 | Ga0451804_0450657_875_1483 | 198 |
| 671 | 3300041486 | Ga0451807_0511307 | Ga0451807_0511307_324_932 | 198 |
| 672 | 3300041501 | Ga0451845_0484302 | Ga0451845_0484302_466_1074 | 198 |
| 673 | 3300042876 | Ga0451577_0000697 | Ga0451577_0000697_464_1093 | 198 |
| 674 | 3300046460 | Ga0495638_0069218 | Ga0495638_0069218_618_1226 | 198 |
| 675 | 3300046471 | Ga0495650_0028496 | Ga0495650_0028496_796_1425 | 198 |
| 676 | 3300046475 | Ga0495639_0018532 | Ga0495639_0018532_1866_2495 | 198 |
| 677 | 3300046506 | Ga0495583_0000046 | Ga0495583_0000046_67531_68163 | 198 |
| 678 | 3300046507 | Ga0495606_0017068 | Ga0495606_0017068_1310_1942 | 198 |
| 679 | 3300046515 | Ga0495620_0048512 | Ga0495620_0048512_837_1445 | 198 |
| 680 | 3300046660 | Ga0495625_0107219 | Ga0495625_0107219_555_1187 | 198 |
| 681 | 3300046684 | Ga0495669_0007695 | Ga0495669_0007695_3334_3966 | 198 |
| 682 | 3300046694 | Ga0495649_0000548 | Ga0495649_0000548_29888_30520 | 198 |
| 683 | 3300046794 | Ga0495589_0007530 | Ga0495589_0007530_1050_1682 | 198 |
| 684 | 3300048907 | Ga0496104_0332905 | Ga0496104_0332905_318_947 | 198 |
| 685 | 3300048908 | Ga0496105_0139762 | Ga0496105_0139762_525_1154 | 198 |
| 686 | 3300048913 | Ga0496110_0688911 | Ga0496110_0688911_241_870 | 198 |
| 687 | 3300048915 | Ga0496112_0011790 | Ga0496112_0011790_2701_3330 | 198 |
| 688 | 3300048916 | Ga0496113_0016666 | Ga0496113_0016666_949_1578 | 198 |
| 689 | 3300050496 | nmdc:mga07m45_2243_c2 | nmdc:mga07m45_2243_c2_2736_3368 | 198 |
| 690 | 3300053087 | Ga0500643_058178 | Ga0500643_058178_273_881 | 198 |
| 691 | 3300053088 | Ga0500644_0023838 | Ga0500644_0023838_642_1250 | 198 |
| 692 | 3300053090 | Ga0500646_0020684 | Ga0500646_0020684_301_909 | 198 |
| 693 | 3300053093 | Ga0500651_0045939 | Ga0500651_0045939_1484_2092 | 198 |
| 694 | 3300053096 | Ga0500641_0042497 | Ga0500641_0042497_238_846 | 198 |
| 695 | 3300053109 | Ga0500569_006494 | Ga0500569_006494_1563_2171 | 198 |
| 696 | 3300053122 | Ga0500608_066183 | Ga0500608_066183_919_1551 | 198 |
| 697 | 3300053130 | Ga0500642_0040098 | Ga0500642_0040098_819_1427 | 198 |
| 698 | 3300053131 | Ga0500652_000857 | Ga0500652_000857_1156_1764 | 198 |
| 699 | 3300053133 | Ga0500655_007327 | Ga0500655_007327_972_1580 | 198 |
| 700 | 3300053151 | Ga0500604_0026411 | Ga0500604_0026411_561_1169 | 198 |
| 701 | 3300053156 | Ga0500622_0000053 | Ga0500622_0000053_5001_5609 | 198 |
| 702 | 3300053177 | Ga0500636_0025438 | Ga0500636_0025438_335_967 | 198 |
| 703 | 3300053724 | Ga0500570_095197 | Ga0500570_095197_558_1166 | 198 |
| 704 | 3300055283 | Ga0500661_030667 | Ga0500661_030667_216_848 | 198 |
| 705 | 3300005327 | Ga0070658_10131358 | Ga0070658_101313582 | 199 |
| 706 | 3300005330 | Ga0070690_100171827 | Ga0070690_1001718273 | 199 |
| 707 | 3300005367 | Ga0070667_100761789 | Ga0070667_1007617891 | 199 |
| 708 | 3300005563 | Ga0068855_100809919 | Ga0068855_1008099192 | 199 |
| 709 | 3300006195 | Ga0075366_10058904 | Ga0075366_100589043 | 199 |
| 710 | 3300006195 | Ga0075366_10066059 | Ga0075366_100660593 | 199 |
| 711 | 3300006353 | Ga0075370_10050514 | Ga0075370_100505143 | 199 |
| 712 | 3300030522 | Ga0307512_10084973 | Ga0307512_100849732 | 199 |
| 713 | 3300031239 | Ga0265328_10029761 | Ga0265328_100297613 | 199 |
| 714 | 3300031251 | Ga0265327_10000158 | Ga0265327_10000158101 | 199 |
| 715 | 3300031507 | Ga0307509_10009555 | Ga0307509_1000955512 | 199 |
| 716 | 3300031507 | Ga0307509_10237953 | Ga0307509_102379533 | 199 |
| 717 | 3300031616 | Ga0307508_10259716 | Ga0307508_102597162 | 199 |
| 718 | 3300033180 | Ga0307510_10029427 | Ga0307510_100294273 | 199 |
| 719 | 3300033180 | Ga0307510_10041455 | Ga0307510_100414557 | 199 |
| 720 | 3300042876 | Ga0451577_0011783 | Ga0451577_0011783_7117_7725 | 199 |
| 721 | 3300044712 | Ga0453684_0427163 | Ga0453684_0427163_299_907 | 199 |
| 722 | 3300046454 | Ga0495592_0000153 | Ga0495592_0000153_649_1257 | 199 |
| 723 | 3300046460 | Ga0495638_0053127 | Ga0495638_0053127_85_693 | 199 |
| 724 | 3300046515 | Ga0495620_0113570 | Ga0495620_0113570_362_970 | 199 |
| 725 | 3300046516 | Ga0495628_0743506 | Ga0495628_0743506_36_644 | 199 |
| 726 | 3300048905 | Ga0496102_0007775 | Ga0496102_0007775_7821_8435 | 199 |
| 727 | 3300050493 | nmdc:mga0k408_189842_c1 | nmdc:mga0k408_189842_c1_522_1130 | 199 |
| 728 | 3300053088 | Ga0500644_0026762 | Ga0500644_0026762_501_1109 | 199 |
| 729 | 3300053093 | Ga0500651_0059147 | Ga0500651_0059147_1243_1851 | 199 |
| 730 | 3300053117 | Ga0500593_004453 | Ga0500593_004453_4462_5073 | 199 |
| 731 | 3300053118 | Ga0500594_0005906 | Ga0500594_0005906_1349_1957 | 199 |
| 732 | 3300053136 | Ga0500559_0000494 | Ga0500559_0000494_1289_1897 | 199 |
| 733 | 3300053139 | Ga0500568_0055429 | Ga0500568_0055429_363_971 | 199 |
| 734 | 3300053156 | Ga0500622_0007498 | Ga0500622_0007498_4431_5039 | 199 |
| 735 | 3300053739 | Ga0500587_007084 | Ga0500587_007084_357_965 | 199 |
| 736 | iso_pu_bacteria | 2643221644 | 2644246917 | 199 |
| 737 | 3300003775 | Ga0055524_1000146 | Ga0055524_100014665 | 200 |
| 738 | 3300005843 | Ga0068860_100225833 | Ga0068860_1002258333 | 200 |
| 739 | 3300006195 | Ga0075366_10090117 | Ga0075366_100901172 | 200 |
| 740 | 3300009177 | Ga0105248_10540780 | Ga0105248_105407803 | 200 |
| 741 | 3300025263 | Ga0209565_1017359 | Ga0209565_10173593 | 200 |
| 742 | 3300025297 | Ga0209758_1000327 | Ga0209758_10003273 | 200 |
| 743 | 3300025299 | Ga0209256_1000015 | Ga0209256_1000015453 | 200 |
| 744 | 3300025899 | Ga0207642_10085586 | Ga0207642_100855863 | 200 |
| 745 | 3300031548 | Ga0307408_100198707 | Ga0307408_1001987072 | 200 |
| 746 | 3300050493 | nmdc:mga0k408_186897_c1 | nmdc:mga0k408_186897_c1_87_701 | 200 |
| 747 | 3300050493 | nmdc:mga0k408_189563_c1 | nmdc:mga0k408_189563_c1_234_869 | 200 |
| 748 | 3300006946 | Ga0079104_1000001 | Ga0079104_1000001365 | 201 |
| 749 | 3300027111 | Ga0209281_1000151 | Ga0209281_100015148 | 201 |
| 750 | 3300028786 | Ga0307517_10001975 | Ga0307517_1000197513 | 201 |
| 751 | 3300028794 | Ga0307515_10264829 | Ga0307515_102648292 | 201 |
| 752 | 3300030522 | Ga0307512_10198141 | Ga0307512_101981413 | 201 |
| 753 | 3300031616 | Ga0307508_10003497 | Ga0307508_1000349716 | 201 |
| 754 | 3300031730 | Ga0307516_10211370 | Ga0307516_102113703 | 201 |
| 755 | 3300032002 | Ga0307416_100208100 | Ga0307416_1002081003 | 201 |
| 756 | 3300032002 | Ga0307416_100454592 | Ga0307416_1004545923 | 201 |
| 757 | 3300041405 | Ga0439438_051623 | Ga0439438_051623_156_797 | 201 |
| 758 | 3300042121 | Ga0450919_000087 | Ga0450919_000087_1625_2251 | 201 |
| 759 | 3300042122 | Ga0450920_047060 | Ga0450920_047060_104_730 | 201 |
| 760 | 3300042531 | Ga0450918_000012 | Ga0450918_000012_20513_21139 | 201 |
| 761 | 3300046524 | Ga0495648_0125340 | Ga0495648_0125340_519_1133 | 201 |
| 762 | 3300046660 | Ga0495625_0136444 | Ga0495625_0136444_575_1189 | 201 |
| 763 | 3300049515 | Ga0501292_003271 | Ga0501292_003271_1055_1669 | 201 |
| 764 | 3300049762 | Ga0501265_001527 | Ga0501265_001527_403_1017 | 201 |
| 765 | 3300053092 | Ga0500583_0114963 | Ga0500583_0114963_174_788 | 201 |
| 766 | iso_pu_bacteria | 2643221660 | 2644338617 | 201 |
| 767 | 3300003791 | Ga0055530_10006485 | Ga0055530_100064856 | 202 |
| 768 | 3300003792 | Ga0055540_1000001 | Ga0055540_1000001397 | 202 |
| 769 | 3300003794 | Ga0055531_10001273 | Ga0055531_100012735 | 202 |
| 770 | 3300005293 | Ga0065715_10098707 | Ga0065715_100987072 | 202 |
| 771 | 3300005328 | Ga0070676_10075764 | Ga0070676_100757643 | 202 |
| 772 | 3300005328 | Ga0070676_10123452 | Ga0070676_101234523 | 202 |
| 773 | 3300005331 | Ga0070670_100219080 | Ga0070670_1002190802 | 202 |
| 774 | 3300005333 | Ga0070677_10008129 | Ga0070677_100081295 | 202 |
| 775 | 3300005353 | Ga0070669_100026644 | Ga0070669_1000266445 | 202 |
| 776 | 3300005355 | Ga0070671_100007158 | Ga0070671_1000071582 | 202 |
| 777 | 3300005355 | Ga0070671_100405534 | Ga0070671_1004055342 | 202 |
| 778 | 3300005356 | Ga0070674_100075398 | Ga0070674_1000753982 | 202 |
| 779 | 3300005364 | Ga0070673_100105779 | Ga0070673_1001057792 | 202 |
| 780 | 3300005367 | Ga0070667_100134776 | Ga0070667_1001347764 | 202 |
| 781 | 3300005455 | Ga0070663_100000226 | Ga0070663_10000022620 | 202 |
| 782 | 3300005456 | Ga0070678_100004379 | Ga0070678_1000043792 | 202 |
| 783 | 3300005459 | Ga0068867_100001941 | Ga0068867_1000019415 | 202 |
| 784 | 3300005459 | Ga0068867_100173038 | Ga0068867_1001730383 | 202 |
| 785 | 3300005543 | Ga0070672_100005168 | Ga0070672_1000051689 | 202 |
| 786 | 3300005578 | Ga0068854_100111674 | Ga0068854_1001116742 | 202 |
| 787 | 3300005578 | Ga0068854_100459358 | Ga0068854_1004593582 | 202 |
| 788 | 3300005618 | Ga0068864_100248084 | Ga0068864_1002480843 | 202 |
| 789 | 3300005834 | Ga0068851_10206900 | Ga0068851_102069002 | 202 |
| 790 | 3300006237 | Ga0097621_100052565 | Ga0097621_1000525653 | 202 |
| 791 | 3300006358 | Ga0068871_100143810 | Ga0068871_1001438103 | 202 |
| 792 | 3300006881 | Ga0068865_100085871 | Ga0068865_1000858713 | 202 |
| 793 | 3300013296 | Ga0157374_10571637 | Ga0157374_105716373 | 202 |
| 794 | 3300013297 | Ga0157378_10252643 | Ga0157378_102526433 | 202 |
| 795 | 3300013306 | Ga0163162_10148095 | Ga0163162_101480955 | 202 |
| 796 | 3300013308 | Ga0157375_10143413 | Ga0157375_101434133 | 202 |
| 797 | 3300014326 | Ga0157380_11221444 | Ga0157380_112214441 | 202 |
| 798 | 3300014969 | Ga0157376_10292276 | Ga0157376_102922763 | 202 |
| 799 | 3300017792 | Ga0163161_10021384 | Ga0163161_100213843 | 202 |
| 800 | 3300025298 | Ga0209050_1001120 | Ga0209050_100112025 | 202 |
| 801 | 3300025303 | Ga0209051_1000018 | Ga0209051_100001857 | 202 |
| 802 | 3300025304 | Ga0209257_1000324 | Ga0209257_100032457 | 202 |
| 803 | 3300025315 | Ga0207697_10011905 | Ga0207697_100119054 | 202 |
| 804 | 3300025893 | Ga0207682_10011022 | Ga0207682_100110223 | 202 |
| 805 | 3300025903 | Ga0207680_10186033 | Ga0207680_101860333 | 202 |
| 806 | 3300025907 | Ga0207645_10037665 | Ga0207645_100376653 | 202 |
| 807 | 3300025907 | Ga0207645_10098849 | Ga0207645_100988493 | 202 |
| 808 | 3300025910 | Ga0207684_10245880 | Ga0207684_102458803 | 202 |
| 809 | 3300025923 | Ga0207681_10035624 | Ga0207681_100356243 | 202 |
| 810 | 3300025925 | Ga0207650_10017584 | Ga0207650_100175844 | 202 |
| 811 | 3300025925 | Ga0207650_10168936 | Ga0207650_101689362 | 202 |
| 812 | 3300025926 | Ga0207659_10001102 | Ga0207659_100011023 | 202 |
| 813 | 3300025931 | Ga0207644_10000537 | Ga0207644_1000053724 | 202 |
| 814 | 3300025937 | Ga0207669_10076629 | Ga0207669_100766293 | 202 |
| 815 | 3300025940 | Ga0207691_10002343 | Ga0207691_1000234321 | 202 |
| 816 | 3300025960 | Ga0207651_10099185 | Ga0207651_100991852 | 202 |
| 817 | 3300025981 | Ga0207640_10336679 | Ga0207640_103366792 | 202 |
| 818 | 3300025981 | Ga0207640_10380766 | Ga0207640_103807662 | 202 |
| 819 | 3300025986 | Ga0207658_10060560 | Ga0207658_100605603 | 202 |
| 820 | 3300026023 | Ga0207677_10114502 | Ga0207677_101145023 | 202 |
| 821 | 3300026067 | Ga0207678_10000644 | Ga0207678_100006449 | 202 |
| 822 | 3300026088 | Ga0207641_10052852 | Ga0207641_100528521 | 202 |
| 823 | 3300026089 | Ga0207648_10013271 | Ga0207648_1001327110 | 202 |
| 824 | 3300026089 | Ga0207648_10158469 | Ga0207648_101584693 | 202 |
| 825 | 3300026095 | Ga0207676_10041554 | Ga0207676_100415543 | 202 |
| 826 | 3300026142 | Ga0207698_10388720 | Ga0207698_103887202 | 202 |
| 827 | 3300028379 | Ga0268266_10316773 | Ga0268266_103167732 | 202 |
| 828 | 3300031730 | Ga0307516_10185772 | Ga0307516_101857723 | 202 |
| 829 | 3300033180 | Ga0307510_10150256 | Ga0307510_101502563 | 202 |
| 830 | 3300037471 | Ga0395905_0036695 | Ga0395905_0036695_944_1567 | 202 |
| 831 | 3300006195 | Ga0075366_10014699 | Ga0075366_100146993 | 203 |
| 832 | 3300027395 | Ga0209996_1001287 | Ga0209996_10012873 | 203 |
| 833 | 3300027526 | Ga0209968_1000086 | Ga0209968_100008614 | 203 |
| 834 | 3300027695 | Ga0209966_1000084 | Ga0209966_10000849 | 203 |
| 835 | 3300031456 | Ga0307513_10181687 | Ga0307513_101816873 | 203 |
| 836 | 3300042876 | Ga0451577_0512282 | Ga0451577_0512282_301_921 | 203 |
| 837 | 3300044712 | Ga0453684_0006584 | Ga0453684_0006584_20131_20754 | 203 |
| 838 | 3300044712 | Ga0453684_0150188 | Ga0453684_0150188_1697_2317 | 203 |
| 839 | 3300044712 | Ga0453684_1041258 | Ga0453684_1041258_15_635 | 203 |
| 840 | 3300006195 | Ga0075366_10006604 | Ga0075366_100066048 | 204 |
| 841 | 3300009148 | Ga0105243_10035553 | Ga0105243_100355533 | 204 |
| 842 | 3300014745 | Ga0157377_10076280 | Ga0157377_100762803 | 204 |
| 843 | 3300025935 | Ga0207709_10018759 | Ga0207709_100187595 | 204 |
| 844 | 3300026089 | Ga0207648_10012148 | Ga0207648_100121483 | 204 |
| 845 | 3300006195 | Ga0075366_10001953 | Ga0075366_100019533 | 205 |
| 846 | 3300050493 | nmdc:mga0k408_642_c1 | nmdc:mga0k408_642_c1_17716_18354 | 205 |
| 847 | 3300032004 | Ga0307414_10068509 | Ga0307414_100685093 | 207 |
| 848 | 3300005339 | Ga0070660_100291310 | Ga0070660_1002913102 | 209 |
| 849 | 3300001979 | JGI24740J21852_10003715 | JGI24740J21852_100037155 | 216 |
| 850 | 3300026142 | Ga0207698_10108356 | Ga0207698_101083563 | 216 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1sp0-assembly1.cif.gz_A | solution structure of apocox11 | 0.7742 | 78 | 189 |
| 4o65-assembly1.cif.gz_A | crystal structure of the cupredoxin domain of amob from nitrosocaldus yellowstonii | 0.749 | 112 | 171 |
| 3v4v-assembly2.cif.gz_C | crystal structure of a4b7 headpiece complexed with fab act-1 and ro0505376 | 0.7103 | 112 | 191 |
| 7p4l-assembly1.cif.gz_C | crystal structure of the trimeric ectodomain of archaeal fusexin1 (fsx1) | 0.7079 | 109 | 172 |
| 7p4l-assembly1.cif.gz_B | crystal structure of the trimeric ectodomain of archaeal fusexin1 (fsx1) | 0.7055 | 109 | 172 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q4DEH9_91_226_2.60.370.10 | Mainly Beta;Sandwich;Ctag/Cox11 (Pfam 04442);Ctag/Cox11 | 0.9044 | 82 | 192 | 2.60.370.10 |
| af_A0A1D6L299_106_203_2.60.370.10 | Mainly Beta;Sandwich;Ctag/Cox11 (Pfam 04442);Ctag/Cox11 | 0.8909 | 74 | 169 | 2.60.370.10 |
| af_A3KNN8_122_254_2.60.370.10 | Mainly Beta;Sandwich;Ctag/Cox11 (Pfam 04442);Ctag/Cox11 | 0.8889 | 82 | 196 | 2.60.370.10 |
| af_A0A1D6L299_106_203_2.60.370.10 | Mainly Beta;Sandwich;Ctag/Cox11 (Pfam 04442);Ctag/Cox11 | 0.8476 | 74 | 169 | 2.60.370.10 |
| af_Q8GWR0_141_281_2.60.370.10 | Mainly Beta;Sandwich;Ctag/Cox11 (Pfam 04442);Ctag/Cox11 | 0.7921 | 82 | 216 | 2.60.370.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q7FZM9-F1-model_v4 | Cytochrome c oxidase assembly protein CtaG | 0.9449 | 83 | 190 |
GO:0005507
GO:0005886 |
| AF-A0A534NF70-F1-model_v4 | Cytochrome c oxidase assembly protein CtaG | 0.9322 | 81 | 191 |
GO:0005507
GO:0005886 |
| AF-A0A7C3JTF0-F1-model_v4 | Cytochrome c oxidase assembly protein CtaG | 0.9288 | 81 | 191 |
GO:0005507
GO:0005886 |
| AF-A0A836QME0-F1-model_v4 | Cytochrome c oxidase assembly protein CtaG | 0.9249 | 77 | 193 |
GO:0005507
GO:0005886 |
| AF-A0A7V3UMW2-F1-model_v4 | Cytochrome c oxidase assembly protein CtaG | 0.9233 | 83 | 191 |
GO:0005507
GO:0005886 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar