F483255
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 845 | 355 | 783 | 371 |
Family's Representative Sequence
| Representative Sequence | 3300028379|Ga0268266_10000102|Ga0268266_1000010245 |
| Length | 364 |
| Sequence | MQKNIVVIEGDGIGPEVTRQAVKVLNAVADHGGHEFTYKYCLMGADAIDKTGTPLPDETIEAALSSDAILFGAIGHPKYDNDPTAKVRPEQGLLKLRKSLQLFANIRPVTTYPALQHLSPLKAKILEDVDFIIFRELTGGIYFGKKETSADGNQAMDDCTYTREEIGRIAHLAFRQLTLVDKANVLETSRLWRKVVQDIAGEYSDVKVDFLFVDNAAMQIILNPKQFDVILTENMFGDILSDEASVISGSLGLLPSASIGKGAALFEPIHGSYPQATGKDIANPLGSILSAAMLLDHFGLHKEAGRVREAANWTLQNGFVTKDIDPVNFYFTSTIGELISDYVGGKIPGDIHKENIELRKSTII |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2511231000 | Chryseobacterium populi CF314 | Isolate | Rhizosphere |
| 3 | 2513020052 | Flavobacterium sp. CF136 | Isolate | Rhizosphere |
| 4 | 2519899754 | Flavobacterium sp. F52 | Isolate | Rhizosphere |
| 5 | 2582581278 | Chryseobacterium sp. CF365 | Isolate | Rhizosphere |
| 6 | 2582581281 | Chryseobacterium sp. CF284 | Isolate | Rhizosphere |
| 7 | 2582581282 | Chryseobacterium sp. CF299 | Isolate | Rhizosphere |
| 8 | 2585428045 | Chryseobacterium sp. OV705 | Isolate | Rhizosphere |
| 9 | 2585428060 | Chryseobacterium sp. OV715 | Isolate | Rhizosphere |
| 10 | 2585428115 | Chryseobacterium sp. YR561 | Isolate | Rhizosphere |
| 11 | 2585428182 | Chryseobacterium sp. YR477 | Isolate | Rhizosphere |
| 12 | 2585428183 | Chryseobacterium sp. YR485 | Isolate | Rhizosphere |
| 13 | 2585428184 | Chryseobacterium sp. YR480 | Isolate | Rhizosphere |
| 14 | 2585428185 | Chryseobacterium sp. YR459 | Isolate | Rhizosphere |
| 15 | 2585428187 | Chryseobacterium sp. YR460 | Isolate | Rhizosphere |
| 16 | 2588253712 | Chryseobacterium sp. OV279 | Isolate | Rhizosphere |
| 17 | 2588254255 | Chryseobacterium sp. YR221 | Isolate | Rhizosphere |
| 18 | 2588254257 | Chryseobacterium sp. YR203 | Isolate | Rhizosphere |
| 19 | 2643221600 | Flavobacterium sp. Root186 | Isolate | Unclassified |
| 20 | 2643221667 | Flavobacterium sp. Root420 | Isolate | Unclassified |
| 21 | 2643221716 | Flavobacterium sp. Root901 | Isolate | Unclassified |
| 22 | 2643221725 | Flavobacterium sp. Root935 | Isolate | Unclassified |
| 23 | 2738541273 | Elizabethkingia sp. YR214 | Isolate | Unclassified |
| 24 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 25 | 2738541279 | Flavobacterium sp. GV069 | Isolate | Unclassified |
| 26 | 2738541285 | Flavobacterium sp. GV030 | Isolate | Unclassified |
| 27 | 2738543007 | Flavobacterium sp. GV063 | Isolate | Unclassified |
| 28 | 2738543014 | Elizabethkingia sp. YR191 | Isolate | Unclassified |
| 29 | 2739367857 | Flavobacterium sp. GV029 | Isolate | Unclassified |
| 30 | 2739367858 | Flavobacterium sp. GV028 | Isolate | Unclassified |
| 31 | 2751185877 | Chryseobacterium artocarpi UTM-3 | Isolate | Rhizosphere |
| 32 | 2765235839 | Chryseobacterium indologenes AA5 | Isolate | Unclassified |
| 33 | 2772190705 | Chryseobacterium contaminans C-26 | Isolate | Rhizosphere |
| 34 | 2802428842 | Flavobacterium sp. S87F.05.LMB.W.Kidney.N | Isolate | Unclassified |
| 35 | 2816332188 | Chryseobacterium aquifrigidense 110 (version 2) | Isolate | Unclassified |
| 36 | 2816332280 | Flavobacterium johnsoniae GSE09 | Isolate | Unclassified |
| 37 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 38 | 2833640130 | Mariniflexile sp. TRM1-10 | Isolate | Rhizosphere |
| 39 | 2842083920 | Chryseobacterium lathyri KCTC 22544 | Isolate | Rhizosphere |
| 40 | 2857613821 | Flavobacterium sp. R-72247 | Isolate | Unclassified |
| 41 | 2857618242 | Flavobacterium sp. R-74482 | Isolate | Unclassified |
| 42 | 2871720351 | Chryseobacterium sp. KLBC 52 | Isolate | Nodule |
| 43 | 2881359912 | Flavobacterium ustbae T13 | Isolate | Rhizosphere |
| 44 | 2889290771 | Chryseobacterium sp. PvR013 | Isolate | Rhizosphere |
| 45 | 2903895155 | Flavobacterium sp. HBTb2-11-1 | Isolate | Rhizosphere |
| 46 | 2904419702 | Flavobacterium sp. 1355 | Isolate | Rhizosphere |
| 47 | 2904555929 | Flavobacterium sp. 1750 | Isolate | Rhizosphere |
| 48 | 2905999023 | Chryseobacterium elymi KCTC 22547 | Isolate | Rhizosphere |
| 49 | 2910245624 | Adhaeribacter radiodurans KUDC8001 | Isolate | Rhizosphere |
| 50 | 2919191525 | Flavobacterium sp. 2755 | Isolate | Rhizosphere |
| 51 | 2919399522 | Chryseobacterium sp. 2987 | Isolate | Unclassified |
| 52 | 2919683626 | Flavobacterium piscis 4129 | Isolate | Unclassified |
| 53 | 2929150217 | Flavobacterium sp. R-74510 Hybrid assembly | Isolate | Unclassified |
| 54 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 55 | 2958458903 | Flavobacterium anhuiense RCM74 | Isolate | Rhizosphere |
| 56 | 2977243572 | Chryseobacterium sp. SORGH_AS 447 | Isolate | Unclassified |
| 57 | 2977268062 | Flavobacterium sp. SORGH_AS 622 | Isolate | Unclassified |
| 58 | 2984572630 | Chryseobacterium sp. SORGH_AS909 | Isolate | Aerial Root |
| 59 | 2984606641 | Chryseobacterium sp. SORGH_AS1175 | Isolate | Aerial Root |
| 60 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 61 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 62 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 63 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 64 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 65 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 66 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 67 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 68 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 69 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 74 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 76 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 77 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 87 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 95 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 96 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 97 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 98 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 99 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 100 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 101 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 105 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 107 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 108 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 109 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 110 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 111 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 112 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 113 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 114 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 115 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 116 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 117 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 118 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 119 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 120 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 121 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 123 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 124 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 125 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 126 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 127 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 128 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 130 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 160 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 161 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 165 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 220 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 221 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 225 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 226 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 227 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 228 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 229 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 230 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 231 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 232 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 233 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 234 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 235 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 236 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 237 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 238 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 239 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 240 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 241 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 242 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 243 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 244 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 245 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 246 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 247 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 248 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 249 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 250 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 251 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 252 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 253 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 254 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 255 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 256 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 257 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 258 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 259 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 260 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 261 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 262 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 263 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 264 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 265 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 266 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 267 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 268 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 269 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 270 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 271 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 272 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 273 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 294 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 295 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 296 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 297 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 298 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 299 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 300 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 301 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 302 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 303 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 304 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 315 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 316 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 317 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 318 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 319 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 320 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 321 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 322 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 324 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 325 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 328 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 329 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 335 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 336 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 337 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 338 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 339 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 340 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 341 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 342 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 343 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 344 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 345 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 346 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 347 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 348 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 349 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 352 | 8054307821 | Flavobacterium soyae SCIV07 | Isolate | Rhizosphere |
| 353 | 8055419101 | Flavobacterium tyrosinilyticum KCTC 42726 | Isolate | Rhizosphere |
| 354 | 8055592153 | Flavobacterium panacis DCY106 | Isolate | Rhizosphere |
| 355 | 8056440228 | Flavobacterium hibisci THG-HG1.4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.66 |
| Metatranscriptomes | 0 |
| Isolates | 7.34 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.24 |
| Bulb | 0 |
| Endosphere | 3.08 |
| Nodule | 0.47 |
| Rhizoplane | 0.24 |
| Rhizosphere | 87.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.28 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_95641 | 2162886007 | Bacteria | 3729 |
| 2 | JGI24736J21556_1006464 | 3300001904 | Bacteria | 1972 |
| 3 | JGI24751J29686_10001178 | 3300002459 | Bacteria | 5569 |
| 4 | rootH1_10062921 | 3300003316 | Bacteria | 3858 |
| 5 | rootH2_10024557 | 3300003320 | Bacteria | 11002 |
| 6 | rootH2_10053942 | 3300003320 | Bacteria | 4275 |
| 7 | rootH2_10104863 | 3300003320 | Bacteria | 3013 |
| 8 | rootH1_10011887 | 3300003323 | Unclassified | 3206 |
| 9 | rootH1_10155400 | 3300003323 | Bacteria | 1699 |
| 10 | JGI25160J50197_1000565 | 3300003354 | Bacteria | 20958 |
| 11 | Ga0065704_10092508 | 3300005289 | Bacteria | 2650 |
| 12 | Ga0065704_10102932 | 3300005289 | Bacteria | 2188 |
| 13 | Ga0065704_10145601 | 3300005289 | Bacteria | 1475 |
| 14 | Ga0065712_10077508 | 3300005290 | Bacteria | 3484 |
| 15 | Ga0065712_10131594 | 3300005290 | Bacteria | 1543 |
| 16 | Ga0065707_10127397 | 3300005295 | Bacteria | 1982 |
| 17 | Ga0065707_10190776 | 3300005295 | Bacteria | 1362 |
| 18 | Ga0070676_10011986 | 3300005328 | Bacteria | 4725 |
| 19 | Ga0070676_10099730 | 3300005328 | Bacteria | 1792 |
| 20 | Ga0070683_100011995 | 3300005329 | Bacteria | 7517 |
| 21 | Ga0070683_100255695 | 3300005329 | Bacteria | 1666 |
| 22 | Ga0070683_100259747 | 3300005329 | Bacteria | 1652 |
| 23 | Ga0070670_100031636 | 3300005331 | Bacteria | 4557 |
| 24 | Ga0070670_100033064 | 3300005331 | Bacteria | 4455 |
| 25 | Ga0070670_100118351 | 3300005331 | Bacteria | 2284 |
| 26 | Ga0070670_100180290 | 3300005331 | Bacteria | 1834 |
| 27 | Ga0070677_10012402 | 3300005333 | Bacteria | 2960 |
| 28 | Ga0070677_10079443 | 3300005333 | Bacteria | 1400 |
| 29 | Ga0068869_100003414 | 3300005334 | Bacteria | 9705 |
| 30 | Ga0068869_100010028 | 3300005334 | Bacteria | 6159 |
| 31 | Ga0068869_100171426 | 3300005334 | Bacteria | 1695 |
| 32 | Ga0070666_10000042 | 3300005335 | Bacteria | 112296 |
| 33 | Ga0070666_10019114 | 3300005335 | Bacteria | 4419 |
| 34 | Ga0070680_100000323 | 3300005336 | Bacteria | 32103 |
| 35 | Ga0070680_100009870 | 3300005336 | Bacteria | 7348 |
| 36 | Ga0070680_100019792 | 3300005336 | Bacteria | 5337 |
| 37 | Ga0070680_100086945 | 3300005336 | Bacteria | 2585 |
| 38 | Ga0070682_100000153 | 3300005337 | Bacteria | 53159 |
| 39 | Ga0070682_100001720 | 3300005337 | Bacteria | 12164 |
| 40 | Ga0070682_100025537 | 3300005337 | Bacteria | 3527 |
| 41 | Ga0070660_100029333 | 3300005339 | Bacteria | 4122 |
| 42 | Ga0070660_100079904 | 3300005339 | Bacteria | 2566 |
| 43 | Ga0070660_100099707 | 3300005339 | Bacteria | 2300 |
| 44 | Ga0070691_10008842 | 3300005341 | Bacteria | 4611 |
| 45 | Ga0070692_10061378 | 3300005345 | Bacteria | 1981 |
| 46 | Ga0070668_100008663 | 3300005347 | Bacteria | 7554 |
| 47 | Ga0070668_100028179 | 3300005347 | Bacteria | 4265 |
| 48 | Ga0070668_100054934 | 3300005347 | Bacteria | 3073 |
| 49 | Ga0070668_100056191 | 3300005347 | Bacteria | 3039 |
| 50 | Ga0070668_100179457 | 3300005347 | Bacteria | 1729 |
| 51 | Ga0070668_100184313 | 3300005347 | Bacteria | 1707 |
| 52 | Ga0070669_100007952 | 3300005353 | Bacteria | 7577 |
| 53 | Ga0070669_100071777 | 3300005353 | Bacteria | 2562 |
| 54 | Ga0070675_100007326 | 3300005354 | Bacteria | 8514 |
| 55 | Ga0070675_100008572 | 3300005354 | Bacteria | 7937 |
| 56 | Ga0070675_100044137 | 3300005354 | Bacteria | 3646 |
| 57 | Ga0070675_100133293 | 3300005354 | Bacteria | 2119 |
| 58 | Ga0070671_100015437 | 3300005355 | Bacteria | 6170 |
| 59 | Ga0070671_100057107 | 3300005355 | Bacteria | 3247 |
| 60 | Ga0070674_100091933 | 3300005356 | Bacteria | 2192 |
| 61 | Ga0070673_100008121 | 3300005364 | Bacteria | 6964 |
| 62 | Ga0070673_100040967 | 3300005364 | Bacteria | 3556 |
| 63 | Ga0070673_100072869 | 3300005364 | Bacteria | 2763 |
| 64 | Ga0070673_100216998 | 3300005364 | Bacteria | 1654 |
| 65 | Ga0070673_100219521 | 3300005364 | Bacteria | 1645 |
| 66 | Ga0070673_100255257 | 3300005364 | Bacteria | 1530 |
| 67 | Ga0070688_100022867 | 3300005365 | Bacteria | 3670 |
| 68 | Ga0070659_100001401 | 3300005366 | Bacteria | 17380 |
| 69 | Ga0070659_100056761 | 3300005366 | Bacteria | 3087 |
| 70 | Ga0070659_100124333 | 3300005366 | Bacteria | 2092 |
| 71 | Ga0070667_100000584 | 3300005367 | Bacteria | 36027 |
| 72 | Ga0070667_100016082 | 3300005367 | Bacteria | 6189 |
| 73 | Ga0070667_100021145 | 3300005367 | Bacteria | 5406 |
| 74 | Ga0070667_100041120 | 3300005367 | Bacteria | 3878 |
| 75 | Ga0070667_100061111 | 3300005367 | Bacteria | 3190 |
| 76 | Ga0070701_10006124 | 3300005438 | Bacteria | 5039 |
| 77 | Ga0070700_100101493 | 3300005441 | Bacteria | 1896 |
| 78 | Ga0070663_100080139 | 3300005455 | Bacteria | 2397 |
| 79 | Ga0070678_100099193 | 3300005456 | Bacteria | 2253 |
| 80 | Ga0070662_100110710 | 3300005457 | Bacteria | 2091 |
| 81 | Ga0070662_100325629 | 3300005457 | Unclassified | 1254 |
| 82 | Ga0070681_10007717 | 3300005458 | Bacteria | 10516 |
| 83 | Ga0070681_10055011 | 3300005458 | Bacteria | 3964 |
| 84 | Ga0070681_10110560 | 3300005458 | Unclassified | 2688 |
| 85 | Ga0070681_10157141 | 3300005458 | Bacteria | 2198 |
| 86 | Ga0070681_10201409 | 3300005458 | Bacteria | 1909 |
| 87 | Ga0068867_100000678 | 3300005459 | Bacteria | 22556 |
| 88 | Ga0068867_100029874 | 3300005459 | Bacteria | 3929 |
| 89 | Ga0068867_100031374 | 3300005459 | Bacteria | 3836 |
| 90 | Ga0068867_100120612 | 3300005459 | Bacteria | 2026 |
| 91 | Ga0068867_100246239 | 3300005459 | Bacteria | 1452 |
| 92 | Ga0070685_10018548 | 3300005466 | Unclassified | 3743 |
| 93 | Ga0070685_10130582 | 3300005466 | Bacteria | 1570 |
| 94 | Ga0070698_100010282 | 3300005471 | Bacteria | 9993 |
| 95 | Ga0070698_100068956 | 3300005471 | Bacteria | 3553 |
| 96 | Ga0070679_100000397 | 3300005530 | Bacteria | 37025 |
| 97 | Ga0070679_100000454 | 3300005530 | Bacteria | 34670 |
| 98 | Ga0070679_100008694 | 3300005530 | Bacteria | 9572 |
| 99 | Ga0070679_100027779 | 3300005530 | Bacteria | 5573 |
| 100 | Ga0070679_100077176 | 3300005530 | Bacteria | 3320 |
| 101 | Ga0070684_100048205 | 3300005535 | Bacteria | 3695 |
| 102 | Ga0070684_100213747 | 3300005535 | Bacteria | 1758 |
| 103 | Ga0068853_100002716 | 3300005539 | Bacteria | 13356 |
| 104 | Ga0068853_100059071 | 3300005539 | Bacteria | 3312 |
| 105 | Ga0068853_100100644 | 3300005539 | Bacteria | 2555 |
| 106 | Ga0068853_100149590 | 3300005539 | Bacteria | 2101 |
| 107 | Ga0068853_100231471 | 3300005539 | Bacteria | 1691 |
| 108 | Ga0070672_100000067 | 3300005543 | Bacteria | 47884 |
| 109 | Ga0070672_100011386 | 3300005543 | Bacteria | 6202 |
| 110 | Ga0070672_100023219 | 3300005543 | Bacteria | 4568 |
| 111 | Ga0070672_100149106 | 3300005543 | Bacteria | 1934 |
| 112 | Ga0070672_100232438 | 3300005543 | Bacteria | 1549 |
| 113 | Ga0070672_100346737 | 3300005543 | Bacteria | 1265 |
| 114 | Ga0070672_100350086 | 3300005543 | Bacteria | 1259 |
| 115 | Ga0070693_100034731 | 3300005547 | Bacteria | 2791 |
| 116 | Ga0070665_100000001 | 3300005548 | Bacteria | 1083363 |
| 117 | Ga0070665_100002117 | 3300005548 | Bacteria | 22174 |
| 118 | Ga0070665_100045272 | 3300005548 | Bacteria | 4419 |
| 119 | Ga0068855_100004391 | 3300005563 | Bacteria | 17233 |
| 120 | Ga0068855_100011078 | 3300005563 | Bacteria | 10882 |
| 121 | Ga0068855_100011554 | 3300005563 | Bacteria | 10665 |
| 122 | Ga0068855_100011962 | 3300005563 | Bacteria | 10491 |
| 123 | Ga0068855_100016023 | 3300005563 | Bacteria | 9017 |
| 124 | Ga0068855_100044858 | 3300005563 | Bacteria | 5230 |
| 125 | Ga0068855_100071361 | 3300005563 | Bacteria | 4039 |
| 126 | Ga0068855_100179165 | 3300005563 | Bacteria | 2397 |
| 127 | Ga0070664_100238644 | 3300005564 | Bacteria | 1631 |
| 128 | Ga0068857_100000719 | 3300005577 | Bacteria | 24689 |
| 129 | Ga0068857_100033696 | 3300005577 | Bacteria | 4530 |
| 130 | Ga0068857_100058932 | 3300005577 | Bacteria | 3410 |
| 131 | Ga0068857_100093567 | 3300005577 | Bacteria | 2692 |
| 132 | Ga0068857_100146199 | 3300005577 | Unclassified | 2139 |
| 133 | Ga0068854_100038337 | 3300005578 | Bacteria | 3370 |
| 134 | Ga0068854_100140170 | 3300005578 | Bacteria | 1855 |
| 135 | Ga0068854_100148544 | 3300005578 | Bacteria | 1805 |
| 136 | Ga0068854_100217071 | 3300005578 | Bacteria | 1511 |
| 137 | Ga0068856_100014460 | 3300005614 | Bacteria | 7624 |
| 138 | Ga0068856_100027008 | 3300005614 | Bacteria | 5600 |
| 139 | Ga0068856_100042972 | 3300005614 | Bacteria | 4446 |
| 140 | Ga0068856_100196329 | 3300005614 | Bacteria | 2032 |
| 141 | Ga0068856_100209555 | 3300005614 | Bacteria | 1964 |
| 142 | Ga0068856_100284871 | 3300005614 | Bacteria | 1669 |
| 143 | Ga0068852_100002172 | 3300005616 | Bacteria | 13442 |
| 144 | Ga0068852_100004512 | 3300005616 | Bacteria | 9846 |
| 145 | Ga0068852_100010145 | 3300005616 | Bacteria | 7017 |
| 146 | Ga0068852_100056467 | 3300005616 | Bacteria | 3393 |
| 147 | Ga0068852_100181219 | 3300005616 | Bacteria | 1981 |
| 148 | Ga0068859_100000130 | 3300005617 | Bacteria | 71018 |
| 149 | Ga0068859_100022120 | 3300005617 | Bacteria | 6375 |
| 150 | Ga0068859_100035610 | 3300005617 | Bacteria | 4994 |
| 151 | Ga0068859_100053438 | 3300005617 | Bacteria | 4063 |
| 152 | Ga0068859_100080694 | 3300005617 | Bacteria | 3294 |
| 153 | Ga0068859_100377952 | 3300005617 | Bacteria | 1512 |
| 154 | Ga0068864_100004066 | 3300005618 | Bacteria | 12022 |
| 155 | Ga0068864_100012055 | 3300005618 | Bacteria | 7140 |
| 156 | Ga0068864_100081442 | 3300005618 | Bacteria | 2838 |
| 157 | Ga0068864_100163978 | 3300005618 | Bacteria | 2022 |
| 158 | Ga0068864_100187896 | 3300005618 | Bacteria | 1892 |
| 159 | Ga0068864_100248800 | 3300005618 | Bacteria | 1649 |
| 160 | Ga0068866_10035643 | 3300005718 | Bacteria | 2431 |
| 161 | Ga0068861_100039535 | 3300005719 | Bacteria | 3521 |
| 162 | Ga0068861_100230903 | 3300005719 | Unclassified | 1569 |
| 163 | Ga0068851_10001272 | 3300005834 | Bacteria | 10997 |
| 164 | Ga0068870_10001526 | 3300005840 | Bacteria | 9398 |
| 165 | Ga0068870_10009403 | 3300005840 | Bacteria | 4444 |
| 166 | Ga0068863_100002443 | 3300005841 | Bacteria | 18455 |
| 167 | Ga0068863_100033987 | 3300005841 | Bacteria | 4857 |
| 168 | Ga0068858_100043889 | 3300005842 | Bacteria | 4145 |
| 169 | Ga0068858_100084912 | 3300005842 | Bacteria | 2945 |
| 170 | Ga0068860_100000241 | 3300005843 | Bacteria | 83429 |
| 171 | Ga0068860_100001682 | 3300005843 | Bacteria | 23632 |
| 172 | Ga0068860_100003389 | 3300005843 | Bacteria | 16396 |
| 173 | Ga0068860_100006618 | 3300005843 | Bacteria | 11635 |
| 174 | Ga0068860_100018807 | 3300005843 | Bacteria | 6712 |
| 175 | Ga0068860_100036214 | 3300005843 | Bacteria | 4730 |
| 176 | Ga0068860_100039626 | 3300005843 | Bacteria | 4506 |
| 177 | Ga0068860_100120239 | 3300005843 | Bacteria | 2515 |
| 178 | Ga0068860_100167036 | 3300005843 | Bacteria | 2124 |
| 179 | Ga0068862_100019788 | 3300005844 | Bacteria | 5622 |
| 180 | Ga0068862_100052004 | 3300005844 | Bacteria | 3504 |
| 181 | Ga0068862_100089205 | 3300005844 | Bacteria | 2683 |
| 182 | Ga0081540_1015256 | 3300005983 | Bacteria | 4871 |
| 183 | Ga0097621_100000027 | 3300006237 | Bacteria | 71873 |
| 184 | Ga0097621_100008505 | 3300006237 | Bacteria | 7390 |
| 185 | Ga0097621_100095018 | 3300006237 | Bacteria | 2500 |
| 186 | Ga0097621_100144339 | 3300006237 | Bacteria | 2036 |
| 187 | Ga0068871_100000338 | 3300006358 | Bacteria | 32447 |
| 188 | Ga0068871_100010999 | 3300006358 | Bacteria | 6629 |
| 189 | Ga0068871_100077667 | 3300006358 | Bacteria | 2744 |
| 190 | Ga0075428_100007732 | 3300006844 | Bacteria | 11913 |
| 191 | Ga0075428_100046413 | 3300006844 | Bacteria | 4772 |
| 192 | Ga0075430_100000836 | 3300006846 | Bacteria | 24090 |
| 193 | Ga0075431_100000860 | 3300006847 | Bacteria | 26641 |
| 194 | Ga0075431_100034296 | 3300006847 | Bacteria | 5229 |
| 195 | Ga0075429_100001604 | 3300006880 | Bacteria | 18651 |
| 196 | Ga0068865_100113023 | 3300006881 | Bacteria | 2007 |
| 197 | Ga0097620_100000130 | 3300006931 | Bacteria | 71018 |
| 198 | Ga0097620_100022120 | 3300006931 | Bacteria | 6375 |
| 199 | Ga0097620_100035610 | 3300006931 | Bacteria | 4994 |
| 200 | Ga0097620_100053441 | 3300006931 | Bacteria | 4063 |
| 201 | Ga0097620_100080693 | 3300006931 | Bacteria | 3294 |
| 202 | Ga0097620_100377983 | 3300006931 | Bacteria | 1512 |
| 203 | Ga0099826_10007777 | 3300006948 | Bacteria | 7933 |
| 204 | Ga0105244_10000063 | 3300009036 | Bacteria | 122746 |
| 205 | Ga0105244_10000261 | 3300009036 | Bacteria | 53251 |
| 206 | Ga0105240_10000205 | 3300009093 | Bacteria | 120767 |
| 207 | Ga0105240_10001268 | 3300009093 | Bacteria | 43714 |
| 208 | Ga0105240_10008514 | 3300009093 | Bacteria | 14663 |
| 209 | Ga0105240_10010263 | 3300009093 | Bacteria | 13184 |
| 210 | Ga0105240_10015424 | 3300009093 | Bacteria | 10388 |
| 211 | Ga0105240_10017211 | 3300009093 | Bacteria | 9751 |
| 212 | Ga0105240_10019561 | 3300009093 | Bacteria | 9044 |
| 213 | Ga0105240_10019796 | 3300009093 | Bacteria | 8989 |
| 214 | Ga0105240_10052481 | 3300009093 | Bacteria | 5125 |
| 215 | Ga0105240_10056043 | 3300009093 | Bacteria | 4933 |
| 216 | Ga0105240_10102910 | 3300009093 | Bacteria | 3470 |
| 217 | Ga0105240_10145538 | 3300009093 | Bacteria | 2828 |
| 218 | Ga0105240_10181706 | 3300009093 | Bacteria | 2481 |
| 219 | Ga0105240_10305433 | 3300009093 | Unclassified | 1819 |
| 220 | Ga0111539_10014218 | 3300009094 | Bacteria | 9939 |
| 221 | Ga0111539_10048431 | 3300009094 | Bacteria | 5074 |
| 222 | Ga0111539_10183079 | 3300009094 | Bacteria | 2447 |
| 223 | Ga0105245_10120415 | 3300009098 | Bacteria | 2451 |
| 224 | Ga0105247_10006925 | 3300009101 | Bacteria | 6981 |
| 225 | Ga0105247_10090314 | 3300009101 | Bacteria | 1943 |
| 226 | Ga0114129_10006547 | 3300009147 | Bacteria | 16528 |
| 227 | Ga0114129_10017693 | 3300009147 | Bacteria | 10147 |
| 228 | Ga0114129_10139020 | 3300009147 | Bacteria | 3331 |
| 229 | Ga0105243_10000564 | 3300009148 | Bacteria | 37436 |
| 230 | Ga0105241_10000105 | 3300009174 | Bacteria | 60020 |
| 231 | Ga0105241_10041934 | 3300009174 | Bacteria | 3460 |
| 232 | Ga0105241_10092089 | 3300009174 | Bacteria | 2393 |
| 233 | Ga0105241_10097353 | 3300009174 | Bacteria | 2332 |
| 234 | Ga0105242_10024370 | 3300009176 | Bacteria | 4778 |
| 235 | Ga0105242_10061535 | 3300009176 | Bacteria | 3088 |
| 236 | Ga0105242_10144251 | 3300009176 | Unclassified | 2069 |
| 237 | Ga0105242_10291643 | 3300009176 | Unclassified | 1486 |
| 238 | Ga0105248_10054545 | 3300009177 | Bacteria | 4483 |
| 239 | Ga0105248_10085742 | 3300009177 | Bacteria | 3544 |
| 240 | Ga0105237_10005965 | 3300009545 | Bacteria | 13649 |
| 241 | Ga0105237_10010855 | 3300009545 | Bacteria | 9665 |
| 242 | Ga0105237_10013031 | 3300009545 | Bacteria | 8730 |
| 243 | Ga0105237_10016201 | 3300009545 | Bacteria | 7752 |
| 244 | Ga0105237_10019274 | 3300009545 | Bacteria | 7048 |
| 245 | Ga0105237_10044194 | 3300009545 | Bacteria | 4486 |
| 246 | Ga0105237_10048637 | 3300009545 | Bacteria | 4262 |
| 247 | Ga0105238_10005460 | 3300009551 | Bacteria | 12561 |
| 248 | Ga0105238_10027147 | 3300009551 | Bacteria | 5835 |
| 249 | Ga0105249_10013227 | 3300009553 | Bacteria | 7283 |
| 250 | Ga0105249_10032721 | 3300009553 | Bacteria | 4705 |
| 251 | Ga0105249_10033891 | 3300009553 | Bacteria | 4625 |
| 252 | Ga0105249_10047478 | 3300009553 | Bacteria | 3913 |
| 253 | Ga0105249_10099402 | 3300009553 | Bacteria | 2734 |
| 254 | Ga0105249_10250219 | 3300009553 | Bacteria | 1757 |
| 255 | Ga0105249_10276048 | 3300009553 | Bacteria | 1676 |
| 256 | Ga0105249_10414786 | 3300009553 | Bacteria | 1379 |
| 257 | Ga0105239_10000015 | 3300010375 | Bacteria | 319892 |
| 258 | Ga0105239_10000169 | 3300010375 | Bacteria | 93659 |
| 259 | Ga0105239_10004544 | 3300010375 | Bacteria | 16539 |
| 260 | Ga0105239_10005225 | 3300010375 | Bacteria | 15279 |
| 261 | Ga0105239_10012852 | 3300010375 | Bacteria | 9314 |
| 262 | Ga0105239_10036577 | 3300010375 | Bacteria | 5390 |
| 263 | Ga0105239_10057993 | 3300010375 | Bacteria | 4247 |
| 264 | Ga0105239_10443450 | 3300010375 | Bacteria | 1472 |
| 265 | Ga0105246_10051112 | 3300011119 | Bacteria | 2837 |
| 266 | Ga0157373_10008001 | 3300013100 | Bacteria | 7861 |
| 267 | Ga0157373_10017187 | 3300013100 | Bacteria | 5267 |
| 268 | Ga0157373_10027272 | 3300013100 | Bacteria | 4121 |
| 269 | Ga0157373_10028771 | 3300013100 | Bacteria | 4007 |
| 270 | Ga0157371_10001203 | 3300013102 | Bacteria | 27690 |
| 271 | Ga0157371_10001756 | 3300013102 | Bacteria | 21976 |
| 272 | Ga0157371_10005877 | 3300013102 | Bacteria | 10253 |
| 273 | Ga0157371_10011977 | 3300013102 | Bacteria | 6650 |
| 274 | Ga0157371_10013531 | 3300013102 | Bacteria | 6193 |
| 275 | Ga0157371_10013976 | 3300013102 | Bacteria | 6078 |
| 276 | Ga0157371_10041880 | 3300013102 | Bacteria | 3267 |
| 277 | Ga0157371_10053664 | 3300013102 | Bacteria | 2862 |
| 278 | Ga0157371_10072114 | 3300013102 | Bacteria | 2445 |
| 279 | Ga0157371_10108147 | 3300013102 | Bacteria | 1973 |
| 280 | Ga0157370_10000703 | 3300013104 | Bacteria | 41837 |
| 281 | Ga0157370_10000712 | 3300013104 | Bacteria | 41700 |
| 282 | Ga0157370_10001268 | 3300013104 | Bacteria | 31549 |
| 283 | Ga0157370_10001336 | 3300013104 | Bacteria | 30640 |
| 284 | Ga0157370_10004625 | 3300013104 | Bacteria | 15740 |
| 285 | Ga0157370_10006253 | 3300013104 | Bacteria | 13183 |
| 286 | Ga0157370_10038169 | 3300013104 | Bacteria | 4647 |
| 287 | Ga0157370_10059792 | 3300013104 | Bacteria | 3620 |
| 288 | Ga0157370_10068257 | 3300013104 | Bacteria | 3360 |
| 289 | Ga0157370_10126898 | 3300013104 | Bacteria | 2381 |
| 290 | Ga0157370_10296340 | 3300013104 | Bacteria | 1493 |
| 291 | Ga0157369_10000224 | 3300013105 | Bacteria | 78178 |
| 292 | Ga0157369_10001138 | 3300013105 | Bacteria | 33208 |
| 293 | Ga0157369_10031531 | 3300013105 | Bacteria | 5835 |
| 294 | Ga0157369_10034972 | 3300013105 | Bacteria | 5510 |
| 295 | Ga0157369_10044874 | 3300013105 | Bacteria | 4809 |
| 296 | Ga0157369_10051082 | 3300013105 | Bacteria | 4475 |
| 297 | Ga0157369_10051098 | 3300013105 | Bacteria | 4474 |
| 298 | Ga0157369_10053731 | 3300013105 | Bacteria | 4352 |
| 299 | Ga0157369_10105452 | 3300013105 | Bacteria | 3001 |
| 300 | Ga0157369_10119569 | 3300013105 | Bacteria | 2796 |
| 301 | Ga0157374_10000001 | 3300013296 | Bacteria | 1077351 |
| 302 | Ga0157374_10010176 | 3300013296 | Bacteria | 8085 |
| 303 | Ga0157374_10073566 | 3300013296 | Bacteria | 3226 |
| 304 | Ga0157374_10079610 | 3300013296 | Bacteria | 3106 |
| 305 | Ga0157378_10009809 | 3300013297 | Bacteria | 8348 |
| 306 | Ga0157378_10020236 | 3300013297 | Bacteria | 5853 |
| 307 | Ga0157378_10021231 | 3300013297 | Bacteria | 5711 |
| 308 | Ga0157378_10042364 | 3300013297 | Bacteria | 4041 |
| 309 | Ga0157378_10069761 | 3300013297 | Bacteria | 3154 |
| 310 | Ga0163162_10000437 | 3300013306 | Bacteria | 38437 |
| 311 | Ga0163162_10000445 | 3300013306 | Bacteria | 38232 |
| 312 | Ga0163162_10000699 | 3300013306 | Bacteria | 30970 |
| 313 | Ga0163162_10011686 | 3300013306 | Bacteria | 8562 |
| 314 | Ga0163162_10016883 | 3300013306 | Bacteria | 7137 |
| 315 | Ga0163162_10073353 | 3300013306 | Bacteria | 3478 |
| 316 | Ga0163162_10090642 | 3300013306 | Bacteria | 3139 |
| 317 | Ga0163162_10152854 | 3300013306 | Bacteria | 2426 |
| 318 | Ga0163162_10273427 | 3300013306 | Bacteria | 1821 |
| 319 | Ga0157372_10001013 | 3300013307 | Bacteria | 30741 |
| 320 | Ga0157372_10015310 | 3300013307 | Bacteria | 8217 |
| 321 | Ga0157372_10016165 | 3300013307 | Bacteria | 8007 |
| 322 | Ga0157372_10047470 | 3300013307 | Bacteria | 4772 |
| 323 | Ga0157372_10110049 | 3300013307 | Bacteria | 3155 |
| 324 | Ga0157372_10162152 | 3300013307 | Bacteria | 2584 |
| 325 | Ga0157372_10192326 | 3300013307 | Bacteria | 2363 |
| 326 | Ga0157372_10220682 | 3300013307 | Bacteria | 2197 |
| 327 | Ga0157372_10225364 | 3300013307 | Bacteria | 2173 |
| 328 | Ga0157372_10345657 | 3300013307 | Bacteria | 1733 |
| 329 | Ga0157372_10402538 | 3300013307 | Bacteria | 1595 |
| 330 | Ga0157372_10526126 | 3300013307 | Bacteria | 1378 |
| 331 | Ga0157375_10020011 | 3300013308 | Bacteria | 6104 |
| 332 | Ga0163163_10000193 | 3300014325 | Bacteria | 62699 |
| 333 | Ga0163163_10133191 | 3300014325 | Bacteria | 2525 |
| 334 | Ga0157380_10008991 | 3300014326 | Bacteria | 7137 |
| 335 | Ga0157380_10017582 | 3300014326 | Bacteria | 5291 |
| 336 | Ga0157380_10020669 | 3300014326 | Bacteria | 4923 |
| 337 | Ga0157380_10034213 | 3300014326 | Bacteria | 3918 |
| 338 | Ga0157380_10137890 | 3300014326 | Bacteria | 2091 |
| 339 | Ga0157380_10274458 | 3300014326 | Bacteria | 1539 |
| 340 | Ga0157377_10063586 | 3300014745 | Bacteria | 2114 |
| 341 | Ga0157377_10111515 | 3300014745 | Bacteria | 1645 |
| 342 | Ga0157379_10021712 | 3300014968 | Bacteria | 5685 |
| 343 | Ga0157379_10022058 | 3300014968 | Bacteria | 5643 |
| 344 | Ga0157379_10061632 | 3300014968 | Bacteria | 3354 |
| 345 | Ga0157379_10105014 | 3300014968 | Bacteria | 2535 |
| 346 | Ga0157379_10351996 | 3300014968 | Bacteria | 1348 |
| 347 | Ga0157376_10000808 | 3300014969 | Bacteria | 20515 |
| 348 | Ga0157376_10013444 | 3300014969 | Bacteria | 6108 |
| 349 | Ga0157376_10034855 | 3300014969 | Bacteria | 4066 |
| 350 | Ga0157376_10091171 | 3300014969 | Bacteria | 2639 |
| 351 | Ga0157376_10151472 | 3300014969 | Bacteria | 2092 |
| 352 | Ga0157376_10450428 | 3300014969 | Bacteria | 1255 |
| 353 | Ga0157376_10450430 | 3300014969 | Bacteria | 1255 |
| 354 | Ga0182006_1001549 | 3300015261 | Bacteria | 13729 |
| 355 | Ga0182005_1033393 | 3300015265 | Bacteria | 1400 |
| 356 | Ga0163161_10000012 | 3300017792 | Bacteria | 264639 |
| 357 | Ga0163161_10027148 | 3300017792 | Bacteria | 4060 |
| 358 | Ga0163161_10034726 | 3300017792 | Bacteria | 3608 |
| 359 | Ga0209233_1000685 | 3300025261 | Bacteria | 16074 |
| 360 | Ga0207666_1002853 | 3300025271 | Bacteria | 2102 |
| 361 | Ga0209675_1000033 | 3300025291 | Bacteria | 271576 |
| 362 | Ga0207426_1000132 | 3300025302 | Bacteria | 209623 |
| 363 | Ga0207655_1000008 | 3300025728 | Bacteria | 734289 |
| 364 | Ga0207655_1002095 | 3300025728 | Bacteria | 16723 |
| 365 | Ga0207682_10004723 | 3300025893 | Bacteria | 5651 |
| 366 | Ga0207642_10021042 | 3300025899 | Bacteria | 2560 |
| 367 | Ga0207642_10046154 | 3300025899 | Bacteria | 1939 |
| 368 | Ga0207688_10073525 | 3300025901 | Bacteria | 1943 |
| 369 | Ga0207680_10000135 | 3300025903 | Bacteria | 34875 |
| 370 | Ga0207680_10031567 | 3300025903 | Bacteria | 3001 |
| 371 | Ga0207680_10049520 | 3300025903 | Bacteria | 2501 |
| 372 | Ga0207680_10186009 | 3300025903 | Bacteria | 1407 |
| 373 | Ga0207647_10000206 | 3300025904 | Bacteria | 48374 |
| 374 | Ga0207647_10014917 | 3300025904 | Bacteria | 5340 |
| 375 | Ga0207647_10040181 | 3300025904 | Bacteria | 2947 |
| 376 | Ga0207647_10125898 | 3300025904 | Bacteria | 1508 |
| 377 | Ga0207645_10000306 | 3300025907 | Bacteria | 41222 |
| 378 | Ga0207645_10000776 | 3300025907 | Bacteria | 26656 |
| 379 | Ga0207645_10025857 | 3300025907 | Bacteria | 3796 |
| 380 | Ga0207645_10126601 | 3300025907 | Bacteria | 1660 |
| 381 | Ga0207643_10038760 | 3300025908 | Bacteria | 2678 |
| 382 | Ga0207705_10006335 | 3300025909 | Bacteria | 8783 |
| 383 | Ga0207705_10041667 | 3300025909 | Bacteria | 3294 |
| 384 | Ga0207705_10165136 | 3300025909 | Bacteria | 1665 |
| 385 | Ga0207654_10001533 | 3300025911 | Bacteria | 12162 |
| 386 | Ga0207654_10103154 | 3300025911 | Bacteria | 1761 |
| 387 | Ga0207707_10000205 | 3300025912 | Bacteria | 62610 |
| 388 | Ga0207707_10026673 | 3300025912 | Bacteria | 5050 |
| 389 | Ga0207707_10100014 | 3300025912 | Bacteria | 2534 |
| 390 | Ga0207707_10122218 | 3300025912 | Bacteria | 2277 |
| 391 | Ga0207695_10000232 | 3300025913 | Bacteria | 147559 |
| 392 | Ga0207695_10000962 | 3300025913 | Bacteria | 51331 |
| 393 | Ga0207695_10001367 | 3300025913 | Bacteria | 41365 |
| 394 | Ga0207695_10002931 | 3300025913 | Bacteria | 24635 |
| 395 | Ga0207695_10003840 | 3300025913 | Bacteria | 20797 |
| 396 | Ga0207695_10018994 | 3300025913 | Bacteria | 7927 |
| 397 | Ga0207695_10022165 | 3300025913 | Bacteria | 7223 |
| 398 | Ga0207695_10065272 | 3300025913 | Bacteria | 3743 |
| 399 | Ga0207695_10101320 | 3300025913 | Bacteria | 2874 |
| 400 | Ga0207695_10324150 | 3300025913 | Bacteria | 1430 |
| 401 | Ga0207671_10003343 | 3300025914 | Bacteria | 16099 |
| 402 | Ga0207671_10005449 | 3300025914 | Bacteria | 11714 |
| 403 | Ga0207671_10007213 | 3300025914 | Bacteria | 9683 |
| 404 | Ga0207671_10012002 | 3300025914 | Bacteria | 7001 |
| 405 | Ga0207671_10015938 | 3300025914 | Bacteria | 5860 |
| 406 | Ga0207660_10009183 | 3300025917 | Bacteria | 6402 |
| 407 | Ga0207660_10169115 | 3300025917 | Bacteria | 1691 |
| 408 | Ga0207662_10051559 | 3300025918 | Bacteria | 2448 |
| 409 | Ga0207657_10001302 | 3300025919 | Bacteria | 26488 |
| 410 | Ga0207657_10038219 | 3300025919 | Bacteria | 4276 |
| 411 | Ga0207657_10041644 | 3300025919 | Bacteria | 4059 |
| 412 | Ga0207657_10059567 | 3300025919 | Bacteria | 3279 |
| 413 | Ga0207657_10114358 | 3300025919 | Bacteria | 2225 |
| 414 | Ga0207657_10135652 | 3300025919 | Bacteria | 2014 |
| 415 | Ga0207649_10149210 | 3300025920 | Bacteria | 1608 |
| 416 | Ga0207652_10000064 | 3300025921 | Bacteria | 111997 |
| 417 | Ga0207652_10000186 | 3300025921 | Bacteria | 65493 |
| 418 | Ga0207652_10000967 | 3300025921 | Bacteria | 26823 |
| 419 | Ga0207652_10005809 | 3300025921 | Bacteria | 10009 |
| 420 | Ga0207652_10019337 | 3300025921 | Bacteria | 5601 |
| 421 | Ga0207652_10095599 | 3300025921 | Bacteria | 2617 |
| 422 | Ga0207681_10038689 | 3300025923 | Bacteria | 3162 |
| 423 | Ga0207681_10079998 | 3300025923 | Bacteria | 2304 |
| 424 | Ga0207694_10013495 | 3300025924 | Bacteria | 6153 |
| 425 | Ga0207694_10265998 | 3300025924 | Bacteria | 1406 |
| 426 | Ga0207650_10027725 | 3300025925 | Bacteria | 4056 |
| 427 | Ga0207650_10089938 | 3300025925 | Bacteria | 2344 |
| 428 | Ga0207650_10100631 | 3300025925 | Bacteria | 2224 |
| 429 | Ga0207650_10105170 | 3300025925 | Bacteria | 2178 |
| 430 | Ga0207650_10106315 | 3300025925 | Bacteria | 2167 |
| 431 | Ga0207650_10190430 | 3300025925 | Bacteria | 1639 |
| 432 | Ga0207659_10050044 | 3300025926 | Bacteria | 2966 |
| 433 | Ga0207659_10128071 | 3300025926 | Bacteria | 1955 |
| 434 | Ga0207659_10243401 | 3300025926 | Bacteria | 1456 |
| 435 | Ga0207644_10004809 | 3300025931 | Bacteria | 8797 |
| 436 | Ga0207644_10023199 | 3300025931 | Bacteria | 4247 |
| 437 | Ga0207644_10072359 | 3300025931 | Bacteria | 2525 |
| 438 | Ga0207690_10004179 | 3300025932 | Bacteria | 8527 |
| 439 | Ga0207690_10075384 | 3300025932 | Bacteria | 2339 |
| 440 | Ga0207706_10005978 | 3300025933 | Bacteria | 11316 |
| 441 | Ga0207706_10086259 | 3300025933 | Bacteria | 2760 |
| 442 | Ga0207706_10090397 | 3300025933 | Bacteria | 2692 |
| 443 | Ga0207706_10111115 | 3300025933 | Bacteria | 2411 |
| 444 | Ga0207686_10004001 | 3300025934 | Bacteria | 7911 |
| 445 | Ga0207709_10000462 | 3300025935 | Bacteria | 37449 |
| 446 | Ga0207670_10188820 | 3300025936 | Bacteria | 1558 |
| 447 | Ga0207669_10129805 | 3300025937 | Bacteria | 1729 |
| 448 | Ga0207669_10143778 | 3300025937 | Bacteria | 1660 |
| 449 | Ga0207704_10086365 | 3300025938 | Bacteria | 2046 |
| 450 | Ga0207691_10002208 | 3300025940 | Bacteria | 19051 |
| 451 | Ga0207691_10007147 | 3300025940 | Bacteria | 10773 |
| 452 | Ga0207691_10009060 | 3300025940 | Bacteria | 9550 |
| 453 | Ga0207691_10174223 | 3300025940 | Bacteria | 1883 |
| 454 | Ga0207691_10180542 | 3300025940 | Bacteria | 1844 |
| 455 | Ga0207711_10084963 | 3300025941 | Bacteria | 2772 |
| 456 | Ga0207689_10001865 | 3300025942 | Bacteria | 19957 |
| 457 | Ga0207689_10002862 | 3300025942 | Bacteria | 15908 |
| 458 | Ga0207689_10006619 | 3300025942 | Bacteria | 10219 |
| 459 | Ga0207689_10030127 | 3300025942 | Bacteria | 4522 |
| 460 | Ga0207689_10050628 | 3300025942 | Bacteria | 3424 |
| 461 | Ga0207661_10032567 | 3300025944 | Bacteria | 4039 |
| 462 | Ga0207661_10062710 | 3300025944 | Bacteria | 3008 |
| 463 | Ga0207661_10081685 | 3300025944 | Bacteria | 2670 |
| 464 | Ga0207661_10214131 | 3300025944 | Bacteria | 1699 |
| 465 | Ga0207667_10000111 | 3300025949 | Bacteria | 131758 |
| 466 | Ga0207667_10000549 | 3300025949 | Bacteria | 49364 |
| 467 | Ga0207667_10001284 | 3300025949 | Bacteria | 31480 |
| 468 | Ga0207667_10004600 | 3300025949 | Bacteria | 16926 |
| 469 | Ga0207667_10021040 | 3300025949 | Bacteria | 7235 |
| 470 | Ga0207667_10021551 | 3300025949 | Bacteria | 7139 |
| 471 | Ga0207667_10026519 | 3300025949 | Bacteria | 6328 |
| 472 | Ga0207667_10079673 | 3300025949 | Bacteria | 3394 |
| 473 | Ga0207651_10000296 | 3300025960 | Bacteria | 21316 |
| 474 | Ga0207651_10015067 | 3300025960 | Bacteria | 4482 |
| 475 | Ga0207651_10022198 | 3300025960 | Bacteria | 3875 |
| 476 | Ga0207651_10057536 | 3300025960 | Bacteria | 2682 |
| 477 | Ga0207651_10195781 | 3300025960 | Bacteria | 1616 |
| 478 | Ga0207712_10015650 | 3300025961 | Bacteria | 4897 |
| 479 | Ga0207712_10024861 | 3300025961 | Bacteria | 3973 |
| 480 | Ga0207712_10025025 | 3300025961 | Bacteria | 3962 |
| 481 | Ga0207712_10046020 | 3300025961 | Bacteria | 3023 |
| 482 | Ga0207712_10165644 | 3300025961 | Bacteria | 1723 |
| 483 | Ga0207668_10000272 | 3300025972 | Bacteria | 34458 |
| 484 | Ga0207668_10037291 | 3300025972 | Bacteria | 3252 |
| 485 | Ga0207640_10050642 | 3300025981 | Bacteria | 2696 |
| 486 | Ga0207640_10207129 | 3300025981 | Bacteria | 1491 |
| 487 | Ga0207658_10003314 | 3300025986 | Bacteria | 11430 |
| 488 | Ga0207658_10009745 | 3300025986 | Bacteria | 6523 |
| 489 | Ga0207658_10010955 | 3300025986 | Bacteria | 6174 |
| 490 | Ga0207658_10040515 | 3300025986 | Bacteria | 3368 |
| 491 | Ga0207658_10124603 | 3300025986 | Bacteria | 2060 |
| 492 | Ga0207677_10188252 | 3300026023 | Bacteria | 1630 |
| 493 | Ga0207703_10005679 | 3300026035 | Bacteria | 10015 |
| 494 | Ga0207703_10058478 | 3300026035 | Bacteria | 3147 |
| 495 | Ga0207703_10087464 | 3300026035 | Bacteria | 2613 |
| 496 | Ga0207639_10005538 | 3300026041 | Bacteria | 8537 |
| 497 | Ga0207639_10023583 | 3300026041 | Bacteria | 4443 |
| 498 | Ga0207639_10038237 | 3300026041 | Bacteria | 3569 |
| 499 | Ga0207639_10059996 | 3300026041 | Bacteria | 2933 |
| 500 | Ga0207639_10080302 | 3300026041 | Bacteria | 2579 |
| 501 | Ga0207639_10180841 | 3300026041 | Bacteria | 1794 |
| 502 | Ga0207639_10194961 | 3300026041 | Unclassified | 1733 |
| 503 | Ga0207678_10131516 | 3300026067 | Unclassified | 2135 |
| 504 | Ga0207708_10081894 | 3300026075 | Bacteria | 2481 |
| 505 | Ga0207708_10137759 | 3300026075 | Bacteria | 1912 |
| 506 | Ga0207702_10019126 | 3300026078 | Bacteria | 5668 |
| 507 | Ga0207702_10061481 | 3300026078 | Bacteria | 3204 |
| 508 | Ga0207702_10066409 | 3300026078 | Bacteria | 3092 |
| 509 | Ga0207702_10084699 | 3300026078 | Bacteria | 2761 |
| 510 | Ga0207702_10158519 | 3300026078 | Bacteria | 2065 |
| 511 | Ga0207702_10220671 | 3300026078 | Bacteria | 1767 |
| 512 | Ga0207702_10419214 | 3300026078 | Bacteria | 1294 |
| 513 | Ga0207641_10000158 | 3300026088 | Bacteria | 96378 |
| 514 | Ga0207641_10001128 | 3300026088 | Bacteria | 26838 |
| 515 | Ga0207641_10003749 | 3300026088 | Bacteria | 13360 |
| 516 | Ga0207641_10092034 | 3300026088 | Bacteria | 2655 |
| 517 | Ga0207641_10347976 | 3300026088 | Bacteria | 1412 |
| 518 | Ga0207648_10000653 | 3300026089 | Bacteria | 38843 |
| 519 | Ga0207648_10000786 | 3300026089 | Bacteria | 35737 |
| 520 | Ga0207648_10003171 | 3300026089 | Bacteria | 17337 |
| 521 | Ga0207648_10011997 | 3300026089 | Bacteria | 8132 |
| 522 | Ga0207648_10081603 | 3300026089 | Bacteria | 2821 |
| 523 | Ga0207648_10133982 | 3300026089 | Bacteria | 2181 |
| 524 | Ga0207676_10001574 | 3300026095 | Bacteria | 16766 |
| 525 | Ga0207676_10072025 | 3300026095 | Bacteria | 2776 |
| 526 | Ga0207676_10109171 | 3300026095 | Bacteria | 2311 |
| 527 | Ga0207674_10001723 | 3300026116 | Bacteria | 27962 |
| 528 | Ga0207674_10019660 | 3300026116 | Bacteria | 7313 |
| 529 | Ga0207674_10028397 | 3300026116 | Bacteria | 5906 |
| 530 | Ga0207674_10122746 | 3300026116 | Bacteria | 2564 |
| 531 | Ga0207675_100004088 | 3300026118 | Bacteria | 14122 |
| 532 | Ga0207675_100074599 | 3300026118 | Bacteria | 3174 |
| 533 | Ga0207675_100090583 | 3300026118 | Bacteria | 2876 |
| 534 | Ga0207675_100191537 | 3300026118 | Unclassified | 1961 |
| 535 | Ga0207675_100236489 | 3300026118 | Unclassified | 1764 |
| 536 | Ga0207683_10004426 | 3300026121 | Bacteria | 12145 |
| 537 | Ga0207683_10132651 | 3300026121 | Bacteria | 2241 |
| 538 | Ga0207683_10324489 | 3300026121 | Bacteria | 1411 |
| 539 | Ga0207698_10002758 | 3300026142 | Bacteria | 10480 |
| 540 | Ga0207698_10026494 | 3300026142 | Bacteria | 4102 |
| 541 | Ga0207698_10168610 | 3300026142 | Bacteria | 1925 |
| 542 | Ga0207698_10215309 | 3300026142 | Unclassified | 1731 |
| 543 | Ga0209281_1000244 | 3300027111 | Bacteria | 109979 |
| 544 | Ga0209489_115968 | 3300027361 | Bacteria | 4280 |
| 545 | Ga0268266_10000102 | 3300028379 | Bacteria | 179754 |
| 546 | Ga0268266_10002971 | 3300028379 | Bacteria | 17479 |
| 547 | Ga0268265_10053903 | 3300028380 | Bacteria | 3048 |
| 548 | Ga0268264_10000011 | 3300028381 | Bacteria | 580884 |
| 549 | Ga0268264_10001129 | 3300028381 | Bacteria | 26168 |
| 550 | Ga0268264_10001678 | 3300028381 | Bacteria | 20388 |
| 551 | Ga0268264_10006613 | 3300028381 | Bacteria | 9749 |
| 552 | Ga0268264_10025484 | 3300028381 | Bacteria | 4832 |
| 553 | Ga0268264_10032292 | 3300028381 | Bacteria | 4295 |
| 554 | Ga0268264_10089204 | 3300028381 | Bacteria | 2655 |
| 555 | Ga0307517_10007333 | 3300028786 | Bacteria | 16104 |
| 556 | Ga0307517_10141613 | 3300028786 | Bacteria | 1686 |
| 557 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 558 | Ga0307515_10000074 | 3300028794 | Bacteria | 229874 |
| 559 | Ga0265338_10065504 | 3300028800 | Bacteria | 3151 |
| 560 | Ga0307511_10000673 | 3300030521 | Bacteria | 36415 |
| 561 | Ga0307512_10166470 | 3300030522 | Bacteria | 1276 |
| 562 | Ga0265340_10000049 | 3300031247 | Bacteria | 54735 |
| 563 | Ga0265339_10036450 | 3300031249 | Bacteria | 2753 |
| 564 | Ga0265331_10045401 | 3300031250 | Bacteria | 2121 |
| 565 | Ga0265327_10000152 | 3300031251 | Bacteria | 149065 |
| 566 | Ga0265327_10000440 | 3300031251 | Bacteria | 75453 |
| 567 | Ga0265327_10033388 | 3300031251 | Bacteria | 2868 |
| 568 | Ga0307513_10091590 | 3300031456 | Bacteria | 3098 |
| 569 | Ga0307509_10037992 | 3300031507 | Bacteria | 5257 |
| 570 | Ga0307509_10165614 | 3300031507 | Bacteria | 2100 |
| 571 | Ga0307509_10186612 | 3300031507 | Bacteria | 1931 |
| 572 | Ga0307408_100217521 | 3300031548 | Bacteria | 1557 |
| 573 | Ga0307508_10001210 | 3300031616 | Bacteria | 29576 |
| 574 | Ga0316576_10018872 | 3300031727 | Bacteria | 4717 |
| 575 | Ga0316576_10054425 | 3300031727 | Bacteria | 2919 |
| 576 | Ga0307516_10002603 | 3300031730 | Bacteria | 23956 |
| 577 | Ga0307516_10119609 | 3300031730 | Bacteria | 2427 |
| 578 | Ga0307405_10099571 | 3300031731 | Bacteria | 1946 |
| 579 | Ga0307413_10002944 | 3300031824 | Bacteria | 7041 |
| 580 | Ga0307413_10192730 | 3300031824 | Bacteria | 1465 |
| 581 | Ga0307413_10279812 | 3300031824 | Bacteria | 1254 |
| 582 | Ga0307410_10000067 | 3300031852 | Bacteria | 37092 |
| 583 | Ga0307410_10003887 | 3300031852 | Bacteria | 7599 |
| 584 | Ga0307406_10000035 | 3300031901 | Bacteria | 82953 |
| 585 | Ga0307416_100000639 | 3300032002 | Bacteria | 18075 |
| 586 | Ga0307416_100018966 | 3300032002 | Bacteria | 4863 |
| 587 | Ga0307414_10000063 | 3300032004 | Bacteria | 107710 |
| 588 | Ga0307414_10095338 | 3300032004 | Bacteria | 2223 |
| 589 | Ga0307414_10199913 | 3300032004 | Bacteria | 1625 |
| 590 | Ga0307411_10000001 | 3300032005 | Bacteria | 931810 |
| 591 | Ga0307510_10133750 | 3300033180 | Bacteria | 2144 |
| 592 | Ga0373937_0101686 | 3300036401 | Bacteria | 2668 |
| 593 | Ga0373937_0176297 | 3300036401 | Bacteria | 2007 |
| 594 | Ga0316584_0046497 | 3300036712 | Bacteria | 3242 |
| 595 | Ga0395899_0008094 | 3300037312 | Bacteria | 8096 |
| 596 | Ga0395899_0024335 | 3300037312 | Bacteria | 4578 |
| 597 | Ga0395899_0053919 | 3300037312 | Bacteria | 2976 |
| 598 | Ga0395899_0076878 | 3300037312 | Bacteria | 2436 |
| 599 | Ga0395899_0089406 | 3300037312 | Bacteria | 2234 |
| 600 | Ga0395899_0109418 | 3300037312 | Bacteria | 1988 |
| 601 | Ga0395900_0004748 | 3300037418 | Bacteria | 14328 |
| 602 | Ga0395900_0004811 | 3300037418 | Bacteria | 14227 |
| 603 | Ga0395900_0052346 | 3300037418 | Bacteria | 4202 |
| 604 | Ga0395900_0075560 | 3300037418 | Bacteria | 3464 |
| 605 | Ga0395900_0144408 | 3300037418 | Bacteria | 2434 |
| 606 | Ga0395900_0211801 | 3300037418 | Bacteria | 1956 |
| 607 | Ga0395898_0002029 | 3300037466 | Bacteria | 25368 |
| 608 | Ga0395898_0019287 | 3300037466 | Bacteria | 6943 |
| 609 | Ga0395898_0067190 | 3300037466 | Bacteria | 3471 |
| 610 | Ga0395898_0091877 | 3300037466 | Bacteria | 2919 |
| 611 | Ga0395898_0124969 | 3300037466 | Bacteria | 2464 |
| 612 | Ga0395905_0019861 | 3300037471 | Bacteria | 6368 |
| 613 | Ga0395905_0236900 | 3300037471 | Bacteria | 1706 |
| 614 | Ga0395901_0016383 | 3300038443 | Bacteria | 7547 |
| 615 | Ga0395901_0129613 | 3300038443 | Bacteria | 2650 |
| 616 | Ga0395901_0220309 | 3300038443 | Bacteria | 1983 |
| 617 | Ga0395901_0232373 | 3300038443 | Bacteria | 1925 |
| 618 | Ga0400489_48763 | 3300039093 | Bacteria | 9194 |
| 619 | Ga0436365_1499396 | 3300039437 | Bacteria | 2179 |
| 620 | Ga0436365_1861098 | 3300039437 | Bacteria | 2409 |
| 621 | Ga0436365_1879596 | 3300039437 | Bacteria | 24111 |
| 622 | Ga0439439_0003744 | 3300041406 | Bacteria | 3376 |
| 623 | Ga0439447_004758 | 3300041407 | Bacteria | 4624 |
| 624 | Ga0439466_0002720 | 3300041411 | Bacteria | 6928 |
| 625 | Ga0451798_0554964 | 3300041458 | Bacteria | 2314 |
| 626 | Ga0439441_003884 | 3300042001 | Bacteria | 2232 |
| 627 | Ga0439449_0011541 | 3300042007 | Bacteria | 3323 |
| 628 | Ga0439449_0011855 | 3300042007 | Bacteria | 3276 |
| 629 | Ga0439449_0033163 | 3300042007 | Bacteria | 1925 |
| 630 | Ga0439457_000620 | 3300042014 | Bacteria | 10490 |
| 631 | Ga0450923_007092 | 3300042125 | Bacteria | 1882 |
| 632 | Ga0451577_0000467 | 3300042876 | Bacteria | 70229 |
| 633 | Ga0451577_0013457 | 3300042876 | Bacteria | 7655 |
| 634 | Ga0451577_0022760 | 3300042876 | Bacteria | 5721 |
| 635 | Ga0466969_0000778 | 3300044656 | Bacteria | 17395 |
| 636 | Ga0466969_0020141 | 3300044656 | Bacteria | 3458 |
| 637 | Ga0466972_0000004 | 3300044658 | Bacteria | 314413 |
| 638 | Ga0466972_0000095 | 3300044658 | Bacteria | 77981 |
| 639 | Ga0466972_0000579 | 3300044658 | Bacteria | 17790 |
| 640 | Ga0453683_0000005 | 3300044673 | Bacteria | 741657 |
| 641 | Ga0453683_0000557 | 3300044673 | Bacteria | 41344 |
| 642 | Ga0453683_0094524 | 3300044673 | Bacteria | 1875 |
| 643 | Ga0453683_0109068 | 3300044673 | Bacteria | 1740 |
| 644 | Ga0453683_0142553 | 3300044673 | Bacteria | 1513 |
| 645 | Ga0453684_0000008 | 3300044712 | Bacteria | 1200052 |
| 646 | Ga0453684_0000219 | 3300044712 | Bacteria | 250149 |
| 647 | Ga0453684_0000628 | 3300044712 | Bacteria | 128416 |
| 648 | Ga0453684_0005576 | 3300044712 | Bacteria | 24800 |
| 649 | Ga0453684_0005691 | 3300044712 | Bacteria | 24420 |
| 650 | Ga0453684_0018325 | 3300044712 | Bacteria | 10759 |
| 651 | Ga0453684_0018954 | 3300044712 | Bacteria | 10516 |
| 652 | Ga0453684_0021771 | 3300044712 | Bacteria | 9553 |
| 653 | Ga0453684_0334649 | 3300044712 | Unclassified | 1711 |
| 654 | Ga0453684_0382805 | 3300044712 | Bacteria | 1579 |
| 655 | Ga0466970_0000518 | 3300044765 | Bacteria | 18999 |
| 656 | Ga0466970_0014415 | 3300044765 | Bacteria | 4059 |
| 657 | Ga0466957_0015823 | 3300044842 | Bacteria | 4407 |
| 658 | Ga0466959_0000125 | 3300045049 | Bacteria | 49909 |
| 659 | Ga0466959_0032625 | 3300045049 | Bacteria | 3854 |
| 660 | Ga0451576_0000010 | 3300045051 | Bacteria | 679007 |
| 661 | Ga0451576_0000244 | 3300045051 | Bacteria | 133298 |
| 662 | Ga0451576_0000568 | 3300045051 | Bacteria | 78861 |
| 663 | Ga0451576_0002036 | 3300045051 | Bacteria | 31915 |
| 664 | Ga0451576_0008258 | 3300045051 | Bacteria | 12241 |
| 665 | Ga0451576_0035003 | 3300045051 | Bacteria | 5331 |
| 666 | Ga0451576_0044412 | 3300045051 | Bacteria | 4684 |
| 667 | Ga0495627_000003 | 3300046453 | Bacteria | 704557 |
| 668 | Ga0495627_004497 | 3300046453 | Bacteria | 5823 |
| 669 | Ga0495638_0053431 | 3300046460 | Bacteria | 2514 |
| 670 | Ga0495638_0058491 | 3300046460 | Bacteria | 2388 |
| 671 | Ga0495650_0033358 | 3300046471 | Bacteria | 2292 |
| 672 | Ga0495582_0010257 | 3300046473 | Bacteria | 5156 |
| 673 | Ga0495596_0000277 | 3300046500 | Bacteria | 34046 |
| 674 | Ga0495606_0003492 | 3300046507 | Bacteria | 16646 |
| 675 | Ga0495606_0014393 | 3300046507 | Bacteria | 6180 |
| 676 | Ga0495610_0000001 | 3300046512 | Bacteria | 1620061 |
| 677 | Ga0495632_0005413 | 3300046519 | Bacteria | 8444 |
| 678 | Ga0495648_0002020 | 3300046524 | Bacteria | 19235 |
| 679 | Ga0495663_0003000 | 3300046525 | Bacteria | 4960 |
| 680 | Ga0495654_0000001 | 3300046530 | Bacteria | 1513197 |
| 681 | Ga0495633_0000008 | 3300046558 | Bacteria | 301830 |
| 682 | Ga0495633_0004847 | 3300046558 | Bacteria | 8422 |
| 683 | Ga0495667_0159750 | 3300046559 | Bacteria | 1450 |
| 684 | Ga0495668_0013929 | 3300046616 | Bacteria | 4727 |
| 685 | Ga0495611_0000385 | 3300046648 | Bacteria | 28165 |
| 686 | Ga0495625_0001823 | 3300046660 | Bacteria | 24391 |
| 687 | Ga0495674_0025349 | 3300047319 | Bacteria | 5439 |
| 688 | Ga0495672_0116695 | 3300047320 | Bacteria | 1425 |
| 689 | Ga0495687_000001 | 3300047443 | Bacteria | 1215582 |
| 690 | Ga0495686_0000004 | 3300047472 | Bacteria | 869019 |
| 691 | Ga0495686_0000118 | 3300047472 | Bacteria | 165897 |
| 692 | Ga0495686_0000772 | 3300047472 | Bacteria | 42035 |
| 693 | Ga0495686_0003005 | 3300047472 | Bacteria | 14986 |
| 694 | Ga0495686_0022322 | 3300047472 | Bacteria | 4189 |
| 695 | Ga0496109_0015035 | 3300048912 | Bacteria | 6736 |
| 696 | Ga0496116_0000032 | 3300048919 | Bacteria | 419997 |
| 697 | Ga0496116_0000053 | 3300048919 | Bacteria | 291837 |
| 698 | Ga0496117_0000089 | 3300048920 | Bacteria | 210551 |
| 699 | Ga0496118_0001078 | 3300048921 | Bacteria | 42588 |
| 700 | Ga0496118_0138928 | 3300048921 | Bacteria | 1544 |
| 701 | Ga0496119_0000038 | 3300048922 | Bacteria | 209546 |
| 702 | Ga0496121_0008699 | 3300048924 | Bacteria | 11854 |
| 703 | Ga0496121_0056645 | 3300048924 | Bacteria | 3254 |
| 704 | Ga0496122_0000118 | 3300048925 | Bacteria | 182789 |
| 705 | Ga0496122_0001213 | 3300048925 | Bacteria | 43728 |
| 706 | Ga0496122_0009811 | 3300048925 | Bacteria | 9999 |
| 707 | Ga0496122_0019641 | 3300048925 | Bacteria | 6160 |
| 708 | Ga0496123_0002780 | 3300048926 | Bacteria | 20856 |
| 709 | Ga0496124_0001056 | 3300048927 | Bacteria | 43505 |
| 710 | Ga0496124_0023852 | 3300048927 | Bacteria | 5574 |
| 711 | Ga0496124_0209759 | 3300048927 | Bacteria | 1475 |
| 712 | Ga0496125_0000059 | 3300048928 | Bacteria | 264149 |
| 713 | Ga0496125_0008819 | 3300048928 | Bacteria | 10487 |
| 714 | Ga0496125_0009663 | 3300048928 | Bacteria | 9859 |
| 715 | Ga0496126_0009798 | 3300048929 | Bacteria | 10145 |
| 716 | Ga0496126_0023187 | 3300048929 | Bacteria | 6017 |
| 717 | Ga0501033_0172930 | 3300049570 | Bacteria | 1551 |
| 718 | Ga0501034_0035681 | 3300049571 | Bacteria | 5040 |
| 719 | Ga0501034_0059558 | 3300049571 | Bacteria | 3835 |
| 720 | Ga0501034_0167483 | 3300049571 | Bacteria | 2165 |
| 721 | Ga0501034_0329152 | 3300049571 | Bacteria | 1459 |
| 722 | Ga0501036_0127246 | 3300049572 | Bacteria | 2151 |
| 723 | Ga0501036_0172190 | 3300049572 | Bacteria | 1824 |
| 724 | Ga0501037_0099530 | 3300049573 | Bacteria | 2100 |
| 725 | Ga0501038_0057852 | 3300049574 | Bacteria | 3327 |
| 726 | Ga0501038_0070304 | 3300049574 | Bacteria | 2972 |
| 727 | Ga0501039_0022019 | 3300049575 | Bacteria | 4891 |
| 728 | Ga0501043_0015022 | 3300049579 | Bacteria | 6064 |
| 729 | Ga0501043_0015230 | 3300049579 | Bacteria | 6022 |
| 730 | Ga0501047_0006024 | 3300049581 | Bacteria | 11399 |
| 731 | Ga0501047_0047360 | 3300049581 | Bacteria | 4154 |
| 732 | Ga0501047_0048551 | 3300049581 | Bacteria | 4099 |
| 733 | Ga0501047_0091860 | 3300049581 | Bacteria | 2914 |
| 734 | Ga0501048_0010094 | 3300049582 | Bacteria | 7066 |
| 735 | Ga0501068_0013638 | 3300049584 | Bacteria | 4628 |
| 736 | Ga0501207_000601 | 3300049654 | Bacteria | 4141 |
| 737 | Ga0501223_000421 | 3300049663 | Bacteria | 10268 |
| 738 | Ga0501238_000316 | 3300049671 | Bacteria | 6328 |
| 739 | Ga0501249_000009 | 3300049679 | Bacteria | 173938 |
| 740 | Ga0501259_000442 | 3300049688 | Bacteria | 6569 |
| 741 | Ga0501219_000479 | 3300049703 | Bacteria | 6266 |
| 742 | Ga0501225_0007958 | 3300049705 | Bacteria | 3055 |
| 743 | Ga0501234_001054 | 3300049707 | Bacteria | 4353 |
| 744 | Ga0501080_0280286 | 3300049742 | Bacteria | 1516 |
| 745 | Ga0501266_000039 | 3300049763 | Bacteria | 26126 |
| 746 | Ga0501280_001414 | 3300049776 | Bacteria | 4462 |
| 747 | Ga0501035_0192114 | 3300049822 | Bacteria | 1755 |
| 748 | Ga0501044_0009540 | 3300049823 | Bacteria | 10569 |
| 749 | Ga0501044_0056559 | 3300049823 | Bacteria | 4028 |
| 750 | Ga0501044_0126547 | 3300049823 | Bacteria | 2552 |
| 751 | Ga0501044_0290186 | 3300049823 | Bacteria | 1567 |
| 752 | Ga0501284_00027 | 3300050005 | Bacteria | 76239 |
| 753 | nmdc:mga0k408_63900_c1 | 3300050493 | Bacteria | 2141 |
| 754 | nmdc:mga05p37_160084_c1 | 3300050507 | Bacteria | 2750 |
| 755 | nmdc:mga05p37_54171_c1 | 3300050507 | Bacteria | 4935 |
| 756 | nmdc:mga09592_10171_c1 | 3300050508 | Bacteria | 7657 |
| 757 | nmdc:mga0qj67_146183_c1 | 3300050509 | Bacteria | 1917 |
| 758 | nmdc:mga06r32_8029_c1 | 3300050510 | Bacteria | 9493 |
| 759 | nmdc:mga08y16_153255_c1 | 3300050511 | Bacteria | 2395 |
| 760 | Ga0500635_0005585 | 3300053080 | Bacteria | 3309 |
| 761 | Ga0500646_0008363 | 3300053090 | Bacteria | 2646 |
| 762 | Ga0500583_0000010 | 3300053092 | Bacteria | 160546 |
| 763 | Ga0500583_0006837 | 3300053092 | Bacteria | 3961 |
| 764 | Ga0500641_0000017 | 3300053096 | Bacteria | 132678 |
| 765 | Ga0500641_0001009 | 3300053096 | Bacteria | 10014 |
| 766 | Ga0500562_000062 | 3300053108 | Bacteria | 53042 |
| 767 | Ga0500658_0000003 | 3300053134 | Bacteria | 512506 |
| 768 | Ga0500559_0011905 | 3300053136 | Bacteria | 3708 |
| 769 | Ga0500559_0038292 | 3300053136 | Bacteria | 2082 |
| 770 | Ga0500568_0000236 | 3300053139 | Bacteria | 47278 |
| 771 | Ga0500568_0018122 | 3300053139 | Bacteria | 3090 |
| 772 | Ga0500573_0109930 | 3300053140 | Bacteria | 1543 |
| 773 | Ga0500604_0007716 | 3300053151 | Bacteria | 2851 |
| 774 | Ga0500616_0015900 | 3300053153 | Bacteria | 4294 |
| 775 | Ga0500616_0082282 | 3300053153 | Bacteria | 1615 |
| 776 | Ga0500622_0002122 | 3300053156 | Bacteria | 14765 |
| 777 | Ga0500622_0090723 | 3300053156 | Bacteria | 1516 |
| 778 | Ga0500611_000006 | 3300053727 | Bacteria | 226069 |
| 779 | Ga0500645_025283 | 3300053730 | Bacteria | 1812 |
| 780 | Ga0500587_007103 | 3300053739 | Bacteria | 1466 |
| 781 | Ga0501084_0014972 | 3300054114 | Bacteria | 6430 |
| 782 | Ga0501082_0026906 | 3300060353 | Bacteria | 4955 |
| 783 | Ga0466962_0013673 | 3300061719 | Bacteria | 3907 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300045051 | Ga0451576_0008258 | Ga0451576_0008258_10357_11421 | 343 |
| 2 | iso_pu_bacteria | 2910245624 | 2910246562 | 345 |
| 3 | 3300025904 | Ga0207647_10125898 | Ga0207647_101258981 | 349 |
| 4 | 3300026121 | Ga0207683_10324489 | Ga0207683_103244891 | 349 |
| 5 | 3300028800 | Ga0265338_10065504 | Ga0265338_100655043 | 349 |
| 6 | 3300042876 | Ga0451577_0013457 | Ga0451577_0013457_5774_6829 | 349 |
| 7 | 3300044712 | Ga0453684_0000008 | Ga0453684_0000008_226686_227741 | 349 |
| 8 | 3300001904 | JGI24736J21556_1006464 | JGI24736J21556_10064642 | 350 |
| 9 | 3300005366 | Ga0070659_100001401 | Ga0070659_1000014016 | 350 |
| 10 | 3300005577 | Ga0068857_100058932 | Ga0068857_1000589322 | 350 |
| 11 | 3300010375 | Ga0105239_10000015 | Ga0105239_10000015245 | 350 |
| 12 | 3300013100 | Ga0157373_10028771 | Ga0157373_100287711 | 350 |
| 13 | 3300013104 | Ga0157370_10126898 | Ga0157370_101268982 | 350 |
| 14 | 3300013105 | Ga0157369_10119569 | Ga0157369_101195691 | 350 |
| 15 | 3300013307 | Ga0157372_10015310 | Ga0157372_100153108 | 350 |
| 16 | 3300025261 | Ga0209233_1000685 | Ga0209233_100068510 | 350 |
| 17 | 3300025904 | Ga0207647_10000206 | Ga0207647_1000020650 | 350 |
| 18 | 3300025919 | Ga0207657_10041644 | Ga0207657_100416444 | 350 |
| 19 | 3300025932 | Ga0207690_10004179 | Ga0207690_100041795 | 350 |
| 20 | 3300025949 | Ga0207667_10079673 | Ga0207667_100796733 | 350 |
| 21 | 3300032004 | Ga0307414_10095338 | Ga0307414_100953382 | 350 |
| 22 | 3300038443 | Ga0395901_0232373 | Ga0395901_0232373_815_1873 | 350 |
| 23 | 3300042876 | Ga0451577_0000467 | Ga0451577_0000467_489_1547 | 350 |
| 24 | 3300044673 | Ga0453683_0000557 | Ga0453683_0000557_24396_25454 | 350 |
| 25 | 3300044712 | Ga0453684_0000219 | Ga0453684_0000219_226755_227813 | 350 |
| 26 | 3300044712 | Ga0453684_0005691 | Ga0453684_0005691_4996_6087 | 350 |
| 27 | 3300045051 | Ga0451576_0000010 | Ga0451576_0000010_404299_405357 | 350 |
| 28 | 3300045051 | Ga0451576_0002036 | Ga0451576_0002036_8707_9798 | 350 |
| 29 | 3300047472 | Ga0495686_0003005 | Ga0495686_0003005_11443_12501 | 350 |
| 30 | 3300053080 | Ga0500635_0005585 | Ga0500635_0005585_1322_2380 | 350 |
| 31 | 3300031247 | Ga0265340_10000049 | Ga0265340_1000004963 | 351 |
| 32 | 3300031249 | Ga0265339_10036450 | Ga0265339_100364503 | 351 |
| 33 | 3300042876 | Ga0451577_0022760 | Ga0451577_0022760_779_1843 | 352 |
| 34 | 3300044673 | Ga0453683_0000005 | Ga0453683_0000005_693834_694898 | 352 |
| 35 | 3300044673 | Ga0453683_0094524 | Ga0453683_0094524_788_1852 | 352 |
| 36 | 3300044673 | Ga0453683_0109068 | Ga0453683_0109068_384_1448 | 352 |
| 37 | 3300044712 | Ga0453684_0000628 | Ga0453684_0000628_108188_109252 | 352 |
| 38 | 3300044712 | Ga0453684_0005576 | Ga0453684_0005576_17425_18489 | 352 |
| 39 | 3300044712 | Ga0453684_0334649 | Ga0453684_0334649_176_1240 | 352 |
| 40 | 3300044712 | Ga0453684_0382805 | Ga0453684_0382805_93_1157 | 352 |
| 41 | 3300045051 | Ga0451576_0000568 | Ga0451576_0000568_71493_72557 | 352 |
| 42 | 3300045051 | Ga0451576_0044412 | Ga0451576_0044412_512_1576 | 352 |
| 43 | 3300039093 | Ga0400489_48763 | Ga0400489_48763_2818_3879 | 353 |
| 44 | 3300044712 | Ga0453684_0018325 | Ga0453684_0018325_2616_3689 | 353 |
| 45 | 3300044712 | Ga0453684_0018954 | Ga0453684_0018954_5050_6123 | 353 |
| 46 | 3300045051 | Ga0451576_0000244 | Ga0451576_0000244_67011_68078 | 353 |
| 47 | 3300045051 | Ga0451576_0035003 | Ga0451576_0035003_2556_3629 | 353 |
| 48 | 3300025920 | Ga0207649_10149210 | Ga0207649_101492101 | 356 |
| 49 | 3300005543 | Ga0070672_100346737 | Ga0070672_1003467371 | 357 |
| 50 | 3300031616 | Ga0307508_10001210 | Ga0307508_100012106 | 357 |
| 51 | 3300031456 | Ga0307513_10091590 | Ga0307513_100915901 | 360 |
| 52 | 3300031507 | Ga0307509_10165614 | Ga0307509_101656142 | 360 |
| 53 | 3300031507 | Ga0307509_10186612 | Ga0307509_101866122 | 360 |
| 54 | 3300005548 | Ga0070665_100000001 | Ga0070665_100000001321 | 363 |
| 55 | 3300028379 | Ga0268266_10000102 | Ga0268266_1000010245 | 363 |
| 56 | iso_pu_bacteria | 2818991444 | 2819590798 | 365 |
| 57 | iso_pu_bacteria | 2929154850 | 2929157832 | 365 |
| 58 | iso_pu_bacteria | 2738541278 | 2738728996 | 366 |
| 59 | iso_pu_bacteria | 2833640130 | 2833642271 | 366 |
| 60 | 3300049571 | Ga0501034_0329152 | Ga0501034_0329152_196_1302 | 367 |
| 61 | 3300049823 | Ga0501044_0056559 | Ga0501044_0056559_2180_3286 | 367 |
| 62 | iso_pu_bacteria | 2513020052 | 2513236367 | 367 |
| 63 | iso_pu_bacteria | 2519899754 | 2520879418 | 367 |
| 64 | iso_pu_bacteria | 2643221600 | 2644013049 | 367 |
| 65 | iso_pu_bacteria | 2643221667 | 2644372364 | 367 |
| 66 | iso_pu_bacteria | 2643221716 | 2644642623 | 367 |
| 67 | iso_pu_bacteria | 2643221725 | 2644684841 | 367 |
| 68 | iso_pu_bacteria | 2738541279 | 2738732476 | 367 |
| 69 | iso_pu_bacteria | 2738541285 | 2738765041 | 367 |
| 70 | iso_pu_bacteria | 2738543007 | 2739214056 | 367 |
| 71 | iso_pu_bacteria | 2739367857 | 2740001339 | 367 |
| 72 | iso_pu_bacteria | 2739367858 | 2740006155 | 367 |
| 73 | iso_pu_bacteria | 2802428842 | 2802653763 | 367 |
| 74 | iso_pu_bacteria | 2816332280 | 2817416286 | 367 |
| 75 | iso_pu_bacteria | 2857613821 | 2857614968 | 367 |
| 76 | iso_pu_bacteria | 2857618242 | 2857618671 | 367 |
| 77 | iso_pu_bacteria | 2881359912 | 2881363178 | 367 |
| 78 | iso_pu_bacteria | 2903895155 | 2903896880 | 367 |
| 79 | iso_pu_bacteria | 2904419702 | 2904422806 | 367 |
| 80 | iso_pu_bacteria | 2904555929 | 2904557084 | 367 |
| 81 | iso_pu_bacteria | 2919191525 | 2919195292 | 367 |
| 82 | iso_pu_bacteria | 2919683626 | 2919687634 | 367 |
| 83 | iso_pu_bacteria | 2929150217 | 2929153575 | 367 |
| 84 | iso_pu_bacteria | 2958458903 | 2958461128 | 367 |
| 85 | iso_pu_bacteria | 2977268062 | 2977270238 | 367 |
| 86 | iso_pu_bacteria | 8054307821 | 8054310071 | 367 |
| 87 | iso_pu_bacteria | 8055419101 | 8055421946 | 367 |
| 88 | iso_pu_bacteria | 8055592153 | 8055593412 | 367 |
| 89 | iso_pu_bacteria | 8056440228 | 8056441893 | 367 |
| 90 | iso_pu_bacteria | 2738541273 | 2738700364 | 368 |
| 91 | iso_pu_bacteria | 2738543014 | 2739254113 | 368 |
| 92 | 3300039437 | Ga0436365_1861098 | Ga0436365_1861098_759_1871 | 369 |
| 93 | 3300044673 | Ga0453683_0142553 | Ga0453683_0142553_232_1344 | 369 |
| 94 | 3300048927 | Ga0496124_0209759 | Ga0496124_0209759_102_1214 | 369 |
| 95 | iso_pu_bacteria | 2585428115 | 2587942901 | 369 |
| 96 | iso_pu_bacteria | 2585428187 | 2588233462 | 369 |
| 97 | iso_pu_bacteria | 2977243572 | 2977246195 | 369 |
| 98 | 3300002459 | JGI24751J29686_10001178 | JGI24751J29686_100011784 | 370 |
| 99 | 3300003316 | rootH1_10062921 | rootH1_100629213 | 370 |
| 100 | 3300003320 | rootH2_10024557 | rootH2_100245578 | 370 |
| 101 | 3300003320 | rootH2_10053942 | rootH2_100539425 | 370 |
| 102 | 3300003320 | rootH2_10104863 | rootH2_101048632 | 370 |
| 103 | 3300003323 | rootH1_10011887 | rootH1_100118872 | 370 |
| 104 | 3300003354 | JGI25160J50197_1000565 | JGI25160J50197_10005656 | 370 |
| 105 | 3300005289 | Ga0065704_10102932 | Ga0065704_101029323 | 370 |
| 106 | 3300005289 | Ga0065704_10145601 | Ga0065704_101456012 | 370 |
| 107 | 3300005290 | Ga0065712_10077508 | Ga0065712_100775083 | 370 |
| 108 | 3300005290 | Ga0065712_10131594 | Ga0065712_101315942 | 370 |
| 109 | 3300005295 | Ga0065707_10127397 | Ga0065707_101273972 | 370 |
| 110 | 3300005295 | Ga0065707_10190776 | Ga0065707_101907761 | 370 |
| 111 | 3300005328 | Ga0070676_10099730 | Ga0070676_100997302 | 370 |
| 112 | 3300005329 | Ga0070683_100255695 | Ga0070683_1002556952 | 370 |
| 113 | 3300005329 | Ga0070683_100259747 | Ga0070683_1002597471 | 370 |
| 114 | 3300005331 | Ga0070670_100031636 | Ga0070670_1000316362 | 370 |
| 115 | 3300005331 | Ga0070670_100033064 | Ga0070670_1000330641 | 370 |
| 116 | 3300005331 | Ga0070670_100118351 | Ga0070670_1001183513 | 370 |
| 117 | 3300005331 | Ga0070670_100180290 | Ga0070670_1001802902 | 370 |
| 118 | 3300005333 | Ga0070677_10012402 | Ga0070677_100124021 | 370 |
| 119 | 3300005333 | Ga0070677_10079443 | Ga0070677_100794431 | 370 |
| 120 | 3300005334 | Ga0068869_100003414 | Ga0068869_1000034143 | 370 |
| 121 | 3300005334 | Ga0068869_100171426 | Ga0068869_1001714261 | 370 |
| 122 | 3300005335 | Ga0070666_10000042 | Ga0070666_1000004249 | 370 |
| 123 | 3300005336 | Ga0070680_100009870 | Ga0070680_1000098704 | 370 |
| 124 | 3300005336 | Ga0070680_100019792 | Ga0070680_1000197922 | 370 |
| 125 | 3300005336 | Ga0070680_100086945 | Ga0070680_1000869453 | 370 |
| 126 | 3300005337 | Ga0070682_100025537 | Ga0070682_1000255372 | 370 |
| 127 | 3300005339 | Ga0070660_100029333 | Ga0070660_1000293333 | 370 |
| 128 | 3300005339 | Ga0070660_100079904 | Ga0070660_1000799042 | 370 |
| 129 | 3300005339 | Ga0070660_100099707 | Ga0070660_1000997073 | 370 |
| 130 | 3300005345 | Ga0070692_10061378 | Ga0070692_100613781 | 370 |
| 131 | 3300005347 | Ga0070668_100008663 | Ga0070668_1000086633 | 370 |
| 132 | 3300005347 | Ga0070668_100028179 | Ga0070668_1000281793 | 370 |
| 133 | 3300005347 | Ga0070668_100056191 | Ga0070668_1000561913 | 370 |
| 134 | 3300005347 | Ga0070668_100179457 | Ga0070668_1001794572 | 370 |
| 135 | 3300005347 | Ga0070668_100184313 | Ga0070668_1001843131 | 370 |
| 136 | 3300005353 | Ga0070669_100007952 | Ga0070669_1000079522 | 370 |
| 137 | 3300005353 | Ga0070669_100071777 | Ga0070669_1000717773 | 370 |
| 138 | 3300005354 | Ga0070675_100007326 | Ga0070675_1000073264 | 370 |
| 139 | 3300005354 | Ga0070675_100008572 | Ga0070675_1000085725 | 370 |
| 140 | 3300005354 | Ga0070675_100044137 | Ga0070675_1000441372 | 370 |
| 141 | 3300005354 | Ga0070675_100133293 | Ga0070675_1001332932 | 370 |
| 142 | 3300005355 | Ga0070671_100015437 | Ga0070671_1000154372 | 370 |
| 143 | 3300005355 | Ga0070671_100057107 | Ga0070671_1000571075 | 370 |
| 144 | 3300005356 | Ga0070674_100091933 | Ga0070674_1000919333 | 370 |
| 145 | 3300005364 | Ga0070673_100008121 | Ga0070673_1000081214 | 370 |
| 146 | 3300005364 | Ga0070673_100040967 | Ga0070673_1000409672 | 370 |
| 147 | 3300005364 | Ga0070673_100072869 | Ga0070673_1000728692 | 370 |
| 148 | 3300005364 | Ga0070673_100216998 | Ga0070673_1002169982 | 370 |
| 149 | 3300005364 | Ga0070673_100219521 | Ga0070673_1002195211 | 370 |
| 150 | 3300005364 | Ga0070673_100255257 | Ga0070673_1002552572 | 370 |
| 151 | 3300005365 | Ga0070688_100022867 | Ga0070688_1000228671 | 370 |
| 152 | 3300005366 | Ga0070659_100056761 | Ga0070659_1000567613 | 370 |
| 153 | 3300005367 | Ga0070667_100016082 | Ga0070667_1000160825 | 370 |
| 154 | 3300005367 | Ga0070667_100021145 | Ga0070667_1000211455 | 370 |
| 155 | 3300005367 | Ga0070667_100041120 | Ga0070667_1000411203 | 370 |
| 156 | 3300005367 | Ga0070667_100061111 | Ga0070667_1000611113 | 370 |
| 157 | 3300005438 | Ga0070701_10006124 | Ga0070701_100061242 | 370 |
| 158 | 3300005441 | Ga0070700_100101493 | Ga0070700_1001014932 | 370 |
| 159 | 3300005455 | Ga0070663_100080139 | Ga0070663_1000801391 | 370 |
| 160 | 3300005456 | Ga0070678_100099193 | Ga0070678_1000991932 | 370 |
| 161 | 3300005457 | Ga0070662_100110710 | Ga0070662_1001107102 | 370 |
| 162 | 3300005458 | Ga0070681_10055011 | Ga0070681_100550111 | 370 |
| 163 | 3300005458 | Ga0070681_10110560 | Ga0070681_101105601 | 370 |
| 164 | 3300005458 | Ga0070681_10157141 | Ga0070681_101571412 | 370 |
| 165 | 3300005458 | Ga0070681_10201409 | Ga0070681_102014092 | 370 |
| 166 | 3300005459 | Ga0068867_100029874 | Ga0068867_1000298743 | 370 |
| 167 | 3300005459 | Ga0068867_100031374 | Ga0068867_1000313742 | 370 |
| 168 | 3300005459 | Ga0068867_100120612 | Ga0068867_1001206122 | 370 |
| 169 | 3300005459 | Ga0068867_100246239 | Ga0068867_1002462392 | 370 |
| 170 | 3300005466 | Ga0070685_10018548 | Ga0070685_100185482 | 370 |
| 171 | 3300005466 | Ga0070685_10130582 | Ga0070685_101305822 | 370 |
| 172 | 3300005471 | Ga0070698_100010282 | Ga0070698_1000102825 | 370 |
| 173 | 3300005471 | Ga0070698_100068956 | Ga0070698_1000689562 | 370 |
| 174 | 3300005530 | Ga0070679_100000454 | Ga0070679_10000045432 | 370 |
| 175 | 3300005530 | Ga0070679_100008694 | Ga0070679_1000086944 | 370 |
| 176 | 3300005530 | Ga0070679_100027779 | Ga0070679_1000277793 | 370 |
| 177 | 3300005530 | Ga0070679_100077176 | Ga0070679_1000771764 | 370 |
| 178 | 3300005535 | Ga0070684_100048205 | Ga0070684_1000482053 | 370 |
| 179 | 3300005535 | Ga0070684_100213747 | Ga0070684_1002137472 | 370 |
| 180 | 3300005539 | Ga0068853_100059071 | Ga0068853_1000590713 | 370 |
| 181 | 3300005539 | Ga0068853_100100644 | Ga0068853_1001006442 | 370 |
| 182 | 3300005539 | Ga0068853_100231471 | Ga0068853_1002314712 | 370 |
| 183 | 3300005543 | Ga0070672_100011386 | Ga0070672_1000113865 | 370 |
| 184 | 3300005543 | Ga0070672_100023219 | Ga0070672_1000232193 | 370 |
| 185 | 3300005543 | Ga0070672_100149106 | Ga0070672_1001491062 | 370 |
| 186 | 3300005543 | Ga0070672_100232438 | Ga0070672_1002324382 | 370 |
| 187 | 3300005543 | Ga0070672_100350086 | Ga0070672_1003500861 | 370 |
| 188 | 3300005548 | Ga0070665_100045272 | Ga0070665_1000452724 | 370 |
| 189 | 3300005563 | Ga0068855_100004391 | Ga0068855_1000043917 | 370 |
| 190 | 3300005563 | Ga0068855_100011078 | Ga0068855_1000110786 | 370 |
| 191 | 3300005563 | Ga0068855_100011554 | Ga0068855_1000115548 | 370 |
| 192 | 3300005563 | Ga0068855_100011962 | Ga0068855_1000119624 | 370 |
| 193 | 3300005563 | Ga0068855_100016023 | Ga0068855_1000160235 | 370 |
| 194 | 3300005563 | Ga0068855_100044858 | Ga0068855_1000448581 | 370 |
| 195 | 3300005563 | Ga0068855_100179165 | Ga0068855_1001791652 | 370 |
| 196 | 3300005564 | Ga0070664_100238644 | Ga0070664_1002386441 | 370 |
| 197 | 3300005577 | Ga0068857_100000719 | Ga0068857_1000007195 | 370 |
| 198 | 3300005577 | Ga0068857_100033696 | Ga0068857_1000336963 | 370 |
| 199 | 3300005577 | Ga0068857_100093567 | Ga0068857_1000935672 | 370 |
| 200 | 3300005577 | Ga0068857_100146199 | Ga0068857_1001461992 | 370 |
| 201 | 3300005578 | Ga0068854_100038337 | Ga0068854_1000383373 | 370 |
| 202 | 3300005578 | Ga0068854_100140170 | Ga0068854_1001401702 | 370 |
| 203 | 3300005578 | Ga0068854_100148544 | Ga0068854_1001485441 | 370 |
| 204 | 3300005578 | Ga0068854_100217071 | Ga0068854_1002170712 | 370 |
| 205 | 3300005614 | Ga0068856_100014460 | Ga0068856_1000144604 | 370 |
| 206 | 3300005614 | Ga0068856_100027008 | Ga0068856_1000270083 | 370 |
| 207 | 3300005614 | Ga0068856_100042972 | Ga0068856_1000429722 | 370 |
| 208 | 3300005614 | Ga0068856_100196329 | Ga0068856_1001963292 | 370 |
| 209 | 3300005614 | Ga0068856_100209555 | Ga0068856_1002095552 | 370 |
| 210 | 3300005614 | Ga0068856_100284871 | Ga0068856_1002848712 | 370 |
| 211 | 3300005616 | Ga0068852_100002172 | Ga0068852_1000021729 | 370 |
| 212 | 3300005616 | Ga0068852_100004512 | Ga0068852_1000045123 | 370 |
| 213 | 3300005616 | Ga0068852_100010145 | Ga0068852_1000101455 | 370 |
| 214 | 3300005616 | Ga0068852_100056467 | Ga0068852_1000564671 | 370 |
| 215 | 3300005616 | Ga0068852_100181219 | Ga0068852_1001812192 | 370 |
| 216 | 3300005617 | Ga0068859_100000130 | Ga0068859_10000013012 | 370 |
| 217 | 3300005617 | Ga0068859_100022120 | Ga0068859_1000221205 | 370 |
| 218 | 3300005617 | Ga0068859_100035610 | Ga0068859_1000356102 | 370 |
| 219 | 3300005617 | Ga0068859_100053438 | Ga0068859_1000534384 | 370 |
| 220 | 3300005617 | Ga0068859_100080694 | Ga0068859_1000806943 | 370 |
| 221 | 3300005617 | Ga0068859_100377952 | Ga0068859_1003779522 | 370 |
| 222 | 3300005618 | Ga0068864_100004066 | Ga0068864_1000040668 | 370 |
| 223 | 3300005618 | Ga0068864_100081442 | Ga0068864_1000814423 | 370 |
| 224 | 3300005618 | Ga0068864_100163978 | Ga0068864_1001639782 | 370 |
| 225 | 3300005618 | Ga0068864_100187896 | Ga0068864_1001878962 | 370 |
| 226 | 3300005618 | Ga0068864_100248800 | Ga0068864_1002488002 | 370 |
| 227 | 3300005718 | Ga0068866_10035643 | Ga0068866_100356434 | 370 |
| 228 | 3300005719 | Ga0068861_100039535 | Ga0068861_1000395352 | 370 |
| 229 | 3300005840 | Ga0068870_10001526 | Ga0068870_100015264 | 370 |
| 230 | 3300005840 | Ga0068870_10009403 | Ga0068870_100094032 | 370 |
| 231 | 3300005841 | Ga0068863_100033987 | Ga0068863_1000339872 | 370 |
| 232 | 3300005842 | Ga0068858_100043889 | Ga0068858_1000438894 | 370 |
| 233 | 3300005842 | Ga0068858_100084912 | Ga0068858_1000849123 | 370 |
| 234 | 3300005843 | Ga0068860_100000241 | Ga0068860_1000002418 | 370 |
| 235 | 3300005843 | Ga0068860_100001682 | Ga0068860_1000016828 | 370 |
| 236 | 3300005843 | Ga0068860_100006618 | Ga0068860_10000661811 | 370 |
| 237 | 3300005843 | Ga0068860_100018807 | Ga0068860_1000188076 | 370 |
| 238 | 3300005843 | Ga0068860_100036214 | Ga0068860_1000362143 | 370 |
| 239 | 3300005843 | Ga0068860_100120239 | Ga0068860_1001202393 | 370 |
| 240 | 3300005843 | Ga0068860_100167036 | Ga0068860_1001670362 | 370 |
| 241 | 3300005844 | Ga0068862_100019788 | Ga0068862_1000197885 | 370 |
| 242 | 3300005844 | Ga0068862_100089205 | Ga0068862_1000892052 | 370 |
| 243 | 3300005983 | Ga0081540_1015256 | Ga0081540_10152564 | 370 |
| 244 | 3300006237 | Ga0097621_100000027 | Ga0097621_10000002740 | 370 |
| 245 | 3300006237 | Ga0097621_100008505 | Ga0097621_1000085051 | 370 |
| 246 | 3300006237 | Ga0097621_100095018 | Ga0097621_1000950183 | 370 |
| 247 | 3300006237 | Ga0097621_100144339 | Ga0097621_1001443392 | 370 |
| 248 | 3300006358 | Ga0068871_100000338 | Ga0068871_10000033816 | 370 |
| 249 | 3300006358 | Ga0068871_100010999 | Ga0068871_1000109994 | 370 |
| 250 | 3300006358 | Ga0068871_100077667 | Ga0068871_1000776672 | 370 |
| 251 | 3300006844 | Ga0075428_100007732 | Ga0075428_10000773211 | 370 |
| 252 | 3300006844 | Ga0075428_100046413 | Ga0075428_1000464132 | 370 |
| 253 | 3300006846 | Ga0075430_100000836 | Ga0075430_1000008364 | 370 |
| 254 | 3300006847 | Ga0075431_100000860 | Ga0075431_1000008604 | 370 |
| 255 | 3300006847 | Ga0075431_100034296 | Ga0075431_1000342963 | 370 |
| 256 | 3300006880 | Ga0075429_100001604 | Ga0075429_10000160419 | 370 |
| 257 | 3300006881 | Ga0068865_100113023 | Ga0068865_1001130231 | 370 |
| 258 | 3300006931 | Ga0097620_100000130 | Ga0097620_10000013056 | 370 |
| 259 | 3300006931 | Ga0097620_100022120 | Ga0097620_1000221203 | 370 |
| 260 | 3300006931 | Ga0097620_100035610 | Ga0097620_1000356102 | 370 |
| 261 | 3300006931 | Ga0097620_100053441 | Ga0097620_1000534414 | 370 |
| 262 | 3300006931 | Ga0097620_100080693 | Ga0097620_1000806933 | 370 |
| 263 | 3300006931 | Ga0097620_100377983 | Ga0097620_1003779832 | 370 |
| 264 | 3300009093 | Ga0105240_10000205 | Ga0105240_1000020528 | 370 |
| 265 | 3300009093 | Ga0105240_10001268 | Ga0105240_1000126826 | 370 |
| 266 | 3300009093 | Ga0105240_10008514 | Ga0105240_100085149 | 370 |
| 267 | 3300009093 | Ga0105240_10010263 | Ga0105240_100102637 | 370 |
| 268 | 3300009093 | Ga0105240_10015424 | Ga0105240_100154248 | 370 |
| 269 | 3300009093 | Ga0105240_10017211 | Ga0105240_100172113 | 370 |
| 270 | 3300009093 | Ga0105240_10019561 | Ga0105240_100195616 | 370 |
| 271 | 3300009093 | Ga0105240_10052481 | Ga0105240_100524811 | 370 |
| 272 | 3300009093 | Ga0105240_10056043 | Ga0105240_100560434 | 370 |
| 273 | 3300009093 | Ga0105240_10102910 | Ga0105240_101029101 | 370 |
| 274 | 3300009093 | Ga0105240_10145538 | Ga0105240_101455382 | 370 |
| 275 | 3300009093 | Ga0105240_10181706 | Ga0105240_101817062 | 370 |
| 276 | 3300009094 | Ga0111539_10014218 | Ga0111539_100142184 | 370 |
| 277 | 3300009094 | Ga0111539_10048431 | Ga0111539_100484314 | 370 |
| 278 | 3300009094 | Ga0111539_10183079 | Ga0111539_101830792 | 370 |
| 279 | 3300009098 | Ga0105245_10120415 | Ga0105245_101204153 | 370 |
| 280 | 3300009101 | Ga0105247_10006925 | Ga0105247_100069256 | 370 |
| 281 | 3300009147 | Ga0114129_10006547 | Ga0114129_100065474 | 370 |
| 282 | 3300009147 | Ga0114129_10017693 | Ga0114129_100176937 | 370 |
| 283 | 3300009147 | Ga0114129_10139020 | Ga0114129_101390202 | 370 |
| 284 | 3300009174 | Ga0105241_10041934 | Ga0105241_100419341 | 370 |
| 285 | 3300009174 | Ga0105241_10092089 | Ga0105241_100920892 | 370 |
| 286 | 3300009174 | Ga0105241_10097353 | Ga0105241_100973533 | 370 |
| 287 | 3300009176 | Ga0105242_10024370 | Ga0105242_100243704 | 370 |
| 288 | 3300009176 | Ga0105242_10061535 | Ga0105242_100615353 | 370 |
| 289 | 3300009176 | Ga0105242_10291643 | Ga0105242_102916431 | 370 |
| 290 | 3300009177 | Ga0105248_10085742 | Ga0105248_100857423 | 370 |
| 291 | 3300009545 | Ga0105237_10005965 | Ga0105237_100059654 | 370 |
| 292 | 3300009545 | Ga0105237_10010855 | Ga0105237_100108554 | 370 |
| 293 | 3300009545 | Ga0105237_10013031 | Ga0105237_100130317 | 370 |
| 294 | 3300009545 | Ga0105237_10016201 | Ga0105237_100162014 | 370 |
| 295 | 3300009545 | Ga0105237_10019274 | Ga0105237_100192745 | 370 |
| 296 | 3300009545 | Ga0105237_10044194 | Ga0105237_100441942 | 370 |
| 297 | 3300009551 | Ga0105238_10005460 | Ga0105238_100054607 | 370 |
| 298 | 3300009551 | Ga0105238_10027147 | Ga0105238_100271474 | 370 |
| 299 | 3300009553 | Ga0105249_10013227 | Ga0105249_100132275 | 370 |
| 300 | 3300009553 | Ga0105249_10032721 | Ga0105249_100327214 | 370 |
| 301 | 3300009553 | Ga0105249_10047478 | Ga0105249_100474783 | 370 |
| 302 | 3300009553 | Ga0105249_10099402 | Ga0105249_100994023 | 370 |
| 303 | 3300009553 | Ga0105249_10250219 | Ga0105249_102502192 | 370 |
| 304 | 3300009553 | Ga0105249_10276048 | Ga0105249_102760481 | 370 |
| 305 | 3300009553 | Ga0105249_10414786 | Ga0105249_104147861 | 370 |
| 306 | 3300010375 | Ga0105239_10000169 | Ga0105239_1000016924 | 370 |
| 307 | 3300010375 | Ga0105239_10004544 | Ga0105239_100045448 | 370 |
| 308 | 3300010375 | Ga0105239_10005225 | Ga0105239_100052253 | 370 |
| 309 | 3300010375 | Ga0105239_10012852 | Ga0105239_100128523 | 370 |
| 310 | 3300010375 | Ga0105239_10036577 | Ga0105239_100365772 | 370 |
| 311 | 3300010375 | Ga0105239_10057993 | Ga0105239_100579932 | 370 |
| 312 | 3300010375 | Ga0105239_10443450 | Ga0105239_104434501 | 370 |
| 313 | 3300013100 | Ga0157373_10008001 | Ga0157373_100080017 | 370 |
| 314 | 3300013100 | Ga0157373_10017187 | Ga0157373_100171875 | 370 |
| 315 | 3300013100 | Ga0157373_10027272 | Ga0157373_100272723 | 370 |
| 316 | 3300013102 | Ga0157371_10001203 | Ga0157371_1000120324 | 370 |
| 317 | 3300013102 | Ga0157371_10001756 | Ga0157371_100017564 | 370 |
| 318 | 3300013102 | Ga0157371_10011977 | Ga0157371_100119775 | 370 |
| 319 | 3300013102 | Ga0157371_10013531 | Ga0157371_100135313 | 370 |
| 320 | 3300013102 | Ga0157371_10013976 | Ga0157371_100139764 | 370 |
| 321 | 3300013102 | Ga0157371_10041880 | Ga0157371_100418802 | 370 |
| 322 | 3300013102 | Ga0157371_10053664 | Ga0157371_100536642 | 370 |
| 323 | 3300013102 | Ga0157371_10072114 | Ga0157371_100721142 | 370 |
| 324 | 3300013102 | Ga0157371_10108147 | Ga0157371_101081473 | 370 |
| 325 | 3300013104 | Ga0157370_10000712 | Ga0157370_1000071233 | 370 |
| 326 | 3300013104 | Ga0157370_10001268 | Ga0157370_100012681 | 370 |
| 327 | 3300013104 | Ga0157370_10001336 | Ga0157370_100013364 | 370 |
| 328 | 3300013104 | Ga0157370_10006253 | Ga0157370_100062535 | 370 |
| 329 | 3300013104 | Ga0157370_10038169 | Ga0157370_100381693 | 370 |
| 330 | 3300013104 | Ga0157370_10296340 | Ga0157370_102963402 | 370 |
| 331 | 3300013105 | Ga0157369_10031531 | Ga0157369_100315314 | 370 |
| 332 | 3300013105 | Ga0157369_10034972 | Ga0157369_100349722 | 370 |
| 333 | 3300013105 | Ga0157369_10044874 | Ga0157369_100448742 | 370 |
| 334 | 3300013105 | Ga0157369_10051082 | Ga0157369_100510822 | 370 |
| 335 | 3300013105 | Ga0157369_10051098 | Ga0157369_100510984 | 370 |
| 336 | 3300013105 | Ga0157369_10053731 | Ga0157369_100537312 | 370 |
| 337 | 3300013296 | Ga0157374_10000001 | Ga0157374_10000001491 | 370 |
| 338 | 3300013296 | Ga0157374_10010176 | Ga0157374_100101765 | 370 |
| 339 | 3300013296 | Ga0157374_10073566 | Ga0157374_100735663 | 370 |
| 340 | 3300013296 | Ga0157374_10079610 | Ga0157374_100796103 | 370 |
| 341 | 3300013297 | Ga0157378_10009809 | Ga0157378_100098093 | 370 |
| 342 | 3300013297 | Ga0157378_10020236 | Ga0157378_100202361 | 370 |
| 343 | 3300013297 | Ga0157378_10021231 | Ga0157378_100212314 | 370 |
| 344 | 3300013297 | Ga0157378_10042364 | Ga0157378_100423643 | 370 |
| 345 | 3300013306 | Ga0163162_10000437 | Ga0163162_100004375 | 370 |
| 346 | 3300013306 | Ga0163162_10000445 | Ga0163162_1000044526 | 370 |
| 347 | 3300013306 | Ga0163162_10000699 | Ga0163162_1000069915 | 370 |
| 348 | 3300013306 | Ga0163162_10016883 | Ga0163162_100168833 | 370 |
| 349 | 3300013306 | Ga0163162_10090642 | Ga0163162_100906423 | 370 |
| 350 | 3300013306 | Ga0163162_10152854 | Ga0163162_101528542 | 370 |
| 351 | 3300013306 | Ga0163162_10273427 | Ga0163162_102734273 | 370 |
| 352 | 3300013307 | Ga0157372_10001013 | Ga0157372_1000101311 | 370 |
| 353 | 3300013307 | Ga0157372_10016165 | Ga0157372_100161655 | 370 |
| 354 | 3300013307 | Ga0157372_10047470 | Ga0157372_100474703 | 370 |
| 355 | 3300013307 | Ga0157372_10162152 | Ga0157372_101621523 | 370 |
| 356 | 3300013307 | Ga0157372_10192326 | Ga0157372_101923262 | 370 |
| 357 | 3300013307 | Ga0157372_10220682 | Ga0157372_102206822 | 370 |
| 358 | 3300013307 | Ga0157372_10225364 | Ga0157372_102253642 | 370 |
| 359 | 3300013307 | Ga0157372_10345657 | Ga0157372_103456572 | 370 |
| 360 | 3300013307 | Ga0157372_10402538 | Ga0157372_104025382 | 370 |
| 361 | 3300013307 | Ga0157372_10526126 | Ga0157372_105261261 | 370 |
| 362 | 3300014325 | Ga0163163_10000193 | Ga0163163_100001939 | 370 |
| 363 | 3300014325 | Ga0163163_10133191 | Ga0163163_101331911 | 370 |
| 364 | 3300014326 | Ga0157380_10008991 | Ga0157380_100089914 | 370 |
| 365 | 3300014326 | Ga0157380_10017582 | Ga0157380_100175823 | 370 |
| 366 | 3300014326 | Ga0157380_10020669 | Ga0157380_100206692 | 370 |
| 367 | 3300014326 | Ga0157380_10034213 | Ga0157380_100342133 | 370 |
| 368 | 3300014326 | Ga0157380_10137890 | Ga0157380_101378901 | 370 |
| 369 | 3300014326 | Ga0157380_10274458 | Ga0157380_102744581 | 370 |
| 370 | 3300014745 | Ga0157377_10063586 | Ga0157377_100635862 | 370 |
| 371 | 3300014745 | Ga0157377_10111515 | Ga0157377_101115152 | 370 |
| 372 | 3300014968 | Ga0157379_10021712 | Ga0157379_100217123 | 370 |
| 373 | 3300014968 | Ga0157379_10105014 | Ga0157379_101050143 | 370 |
| 374 | 3300014968 | Ga0157379_10351996 | Ga0157379_103519961 | 370 |
| 375 | 3300014969 | Ga0157376_10000808 | Ga0157376_100008086 | 370 |
| 376 | 3300014969 | Ga0157376_10013444 | Ga0157376_100134444 | 370 |
| 377 | 3300014969 | Ga0157376_10034855 | Ga0157376_100348553 | 370 |
| 378 | 3300014969 | Ga0157376_10091171 | Ga0157376_100911712 | 370 |
| 379 | 3300014969 | Ga0157376_10151472 | Ga0157376_101514722 | 370 |
| 380 | 3300015265 | Ga0182005_1033393 | Ga0182005_10333932 | 370 |
| 381 | 3300017792 | Ga0163161_10027148 | Ga0163161_100271482 | 370 |
| 382 | 3300025271 | Ga0207666_1002853 | Ga0207666_10028531 | 370 |
| 383 | 3300025302 | Ga0207426_1000132 | Ga0207426_100013255 | 370 |
| 384 | 3300025893 | Ga0207682_10004723 | Ga0207682_100047232 | 370 |
| 385 | 3300025899 | Ga0207642_10021042 | Ga0207642_100210423 | 370 |
| 386 | 3300025899 | Ga0207642_10046154 | Ga0207642_100461541 | 370 |
| 387 | 3300025901 | Ga0207688_10073525 | Ga0207688_100735252 | 370 |
| 388 | 3300025903 | Ga0207680_10000135 | Ga0207680_1000013525 | 370 |
| 389 | 3300025903 | Ga0207680_10049520 | Ga0207680_100495202 | 370 |
| 390 | 3300025903 | Ga0207680_10186009 | Ga0207680_101860091 | 370 |
| 391 | 3300025904 | Ga0207647_10014917 | Ga0207647_100149174 | 370 |
| 392 | 3300025904 | Ga0207647_10040181 | Ga0207647_100401813 | 370 |
| 393 | 3300025907 | Ga0207645_10000306 | Ga0207645_1000030622 | 370 |
| 394 | 3300025907 | Ga0207645_10025857 | Ga0207645_100258572 | 370 |
| 395 | 3300025907 | Ga0207645_10126601 | Ga0207645_101266012 | 370 |
| 396 | 3300025908 | Ga0207643_10038760 | Ga0207643_100387603 | 370 |
| 397 | 3300025909 | Ga0207705_10006335 | Ga0207705_100063358 | 370 |
| 398 | 3300025909 | Ga0207705_10041667 | Ga0207705_100416673 | 370 |
| 399 | 3300025909 | Ga0207705_10165136 | Ga0207705_101651362 | 370 |
| 400 | 3300025911 | Ga0207654_10103154 | Ga0207654_101031542 | 370 |
| 401 | 3300025912 | Ga0207707_10026673 | Ga0207707_100266734 | 370 |
| 402 | 3300025912 | Ga0207707_10100014 | Ga0207707_101000142 | 370 |
| 403 | 3300025912 | Ga0207707_10122218 | Ga0207707_101222183 | 370 |
| 404 | 3300025913 | Ga0207695_10000232 | Ga0207695_1000023250 | 370 |
| 405 | 3300025913 | Ga0207695_10000962 | Ga0207695_100009627 | 370 |
| 406 | 3300025913 | Ga0207695_10001367 | Ga0207695_100013672 | 370 |
| 407 | 3300025913 | Ga0207695_10002931 | Ga0207695_1000293111 | 370 |
| 408 | 3300025913 | Ga0207695_10018994 | Ga0207695_100189944 | 370 |
| 409 | 3300025913 | Ga0207695_10022165 | Ga0207695_100221651 | 370 |
| 410 | 3300025913 | Ga0207695_10065272 | Ga0207695_100652723 | 370 |
| 411 | 3300025913 | Ga0207695_10101320 | Ga0207695_101013202 | 370 |
| 412 | 3300025913 | Ga0207695_10324150 | Ga0207695_103241502 | 370 |
| 413 | 3300025914 | Ga0207671_10003343 | Ga0207671_100033438 | 370 |
| 414 | 3300025914 | Ga0207671_10005449 | Ga0207671_100054494 | 370 |
| 415 | 3300025914 | Ga0207671_10007213 | Ga0207671_100072134 | 370 |
| 416 | 3300025914 | Ga0207671_10012002 | Ga0207671_100120024 | 370 |
| 417 | 3300025914 | Ga0207671_10015938 | Ga0207671_100159385 | 370 |
| 418 | 3300025917 | Ga0207660_10009183 | Ga0207660_100091834 | 370 |
| 419 | 3300025917 | Ga0207660_10169115 | Ga0207660_101691152 | 370 |
| 420 | 3300025918 | Ga0207662_10051559 | Ga0207662_100515592 | 370 |
| 421 | 3300025919 | Ga0207657_10001302 | Ga0207657_100013022 | 370 |
| 422 | 3300025919 | Ga0207657_10038219 | Ga0207657_100382192 | 370 |
| 423 | 3300025919 | Ga0207657_10059567 | Ga0207657_100595672 | 370 |
| 424 | 3300025919 | Ga0207657_10114358 | Ga0207657_101143582 | 370 |
| 425 | 3300025919 | Ga0207657_10135652 | Ga0207657_101356522 | 370 |
| 426 | 3300025921 | Ga0207652_10000064 | Ga0207652_1000006433 | 370 |
| 427 | 3300025921 | Ga0207652_10000967 | Ga0207652_1000096712 | 370 |
| 428 | 3300025921 | Ga0207652_10005809 | Ga0207652_100058096 | 370 |
| 429 | 3300025921 | Ga0207652_10019337 | Ga0207652_100193373 | 370 |
| 430 | 3300025921 | Ga0207652_10095599 | Ga0207652_100955992 | 370 |
| 431 | 3300025923 | Ga0207681_10038689 | Ga0207681_100386893 | 370 |
| 432 | 3300025923 | Ga0207681_10079998 | Ga0207681_100799983 | 370 |
| 433 | 3300025924 | Ga0207694_10013495 | Ga0207694_100134954 | 370 |
| 434 | 3300025924 | Ga0207694_10265998 | Ga0207694_102659982 | 370 |
| 435 | 3300025925 | Ga0207650_10027725 | Ga0207650_100277255 | 370 |
| 436 | 3300025925 | Ga0207650_10089938 | Ga0207650_100899381 | 370 |
| 437 | 3300025925 | Ga0207650_10100631 | Ga0207650_101006312 | 370 |
| 438 | 3300025925 | Ga0207650_10105170 | Ga0207650_101051701 | 370 |
| 439 | 3300025925 | Ga0207650_10106315 | Ga0207650_101063153 | 370 |
| 440 | 3300025926 | Ga0207659_10050044 | Ga0207659_100500443 | 370 |
| 441 | 3300025926 | Ga0207659_10128071 | Ga0207659_101280712 | 370 |
| 442 | 3300025926 | Ga0207659_10243401 | Ga0207659_102434011 | 370 |
| 443 | 3300025931 | Ga0207644_10004809 | Ga0207644_100048096 | 370 |
| 444 | 3300025931 | Ga0207644_10023199 | Ga0207644_100231994 | 370 |
| 445 | 3300025931 | Ga0207644_10072359 | Ga0207644_100723593 | 370 |
| 446 | 3300025932 | Ga0207690_10075384 | Ga0207690_100753843 | 370 |
| 447 | 3300025933 | Ga0207706_10005978 | Ga0207706_100059783 | 370 |
| 448 | 3300025933 | Ga0207706_10090397 | Ga0207706_100903972 | 370 |
| 449 | 3300025933 | Ga0207706_10111115 | Ga0207706_101111151 | 370 |
| 450 | 3300025934 | Ga0207686_10004001 | Ga0207686_100040014 | 370 |
| 451 | 3300025936 | Ga0207670_10188820 | Ga0207670_101888202 | 370 |
| 452 | 3300025937 | Ga0207669_10129805 | Ga0207669_101298051 | 370 |
| 453 | 3300025937 | Ga0207669_10143778 | Ga0207669_101437782 | 370 |
| 454 | 3300025938 | Ga0207704_10086365 | Ga0207704_100863652 | 370 |
| 455 | 3300025940 | Ga0207691_10007147 | Ga0207691_100071476 | 370 |
| 456 | 3300025940 | Ga0207691_10009060 | Ga0207691_100090604 | 370 |
| 457 | 3300025940 | Ga0207691_10174223 | Ga0207691_101742231 | 370 |
| 458 | 3300025940 | Ga0207691_10180542 | Ga0207691_101805422 | 370 |
| 459 | 3300025942 | Ga0207689_10001865 | Ga0207689_100018654 | 370 |
| 460 | 3300025942 | Ga0207689_10002862 | Ga0207689_100028623 | 370 |
| 461 | 3300025942 | Ga0207689_10006619 | Ga0207689_100066195 | 370 |
| 462 | 3300025942 | Ga0207689_10050628 | Ga0207689_100506282 | 370 |
| 463 | 3300025944 | Ga0207661_10032567 | Ga0207661_100325673 | 370 |
| 464 | 3300025944 | Ga0207661_10062710 | Ga0207661_100627102 | 370 |
| 465 | 3300025944 | Ga0207661_10214131 | Ga0207661_102141311 | 370 |
| 466 | 3300025949 | Ga0207667_10000111 | Ga0207667_1000011151 | 370 |
| 467 | 3300025949 | Ga0207667_10000549 | Ga0207667_1000054920 | 370 |
| 468 | 3300025949 | Ga0207667_10001284 | Ga0207667_1000128411 | 370 |
| 469 | 3300025949 | Ga0207667_10004600 | Ga0207667_1000460010 | 370 |
| 470 | 3300025949 | Ga0207667_10021040 | Ga0207667_100210403 | 370 |
| 471 | 3300025949 | Ga0207667_10021551 | Ga0207667_100215517 | 370 |
| 472 | 3300025949 | Ga0207667_10026519 | Ga0207667_100265193 | 370 |
| 473 | 3300025960 | Ga0207651_10015067 | Ga0207651_100150673 | 370 |
| 474 | 3300025960 | Ga0207651_10022198 | Ga0207651_100221983 | 370 |
| 475 | 3300025960 | Ga0207651_10057536 | Ga0207651_100575362 | 370 |
| 476 | 3300025960 | Ga0207651_10195781 | Ga0207651_101957812 | 370 |
| 477 | 3300025961 | Ga0207712_10015650 | Ga0207712_100156503 | 370 |
| 478 | 3300025961 | Ga0207712_10024861 | Ga0207712_100248613 | 370 |
| 479 | 3300025961 | Ga0207712_10025025 | Ga0207712_100250253 | 370 |
| 480 | 3300025961 | Ga0207712_10046020 | Ga0207712_100460203 | 370 |
| 481 | 3300025961 | Ga0207712_10165644 | Ga0207712_101656442 | 370 |
| 482 | 3300025972 | Ga0207668_10037291 | Ga0207668_100372914 | 370 |
| 483 | 3300025981 | Ga0207640_10050642 | Ga0207640_100506423 | 370 |
| 484 | 3300025981 | Ga0207640_10207129 | Ga0207640_102071292 | 370 |
| 485 | 3300025986 | Ga0207658_10003314 | Ga0207658_100033142 | 370 |
| 486 | 3300025986 | Ga0207658_10009745 | Ga0207658_100097455 | 370 |
| 487 | 3300025986 | Ga0207658_10010955 | Ga0207658_100109552 | 370 |
| 488 | 3300025986 | Ga0207658_10040515 | Ga0207658_100405153 | 370 |
| 489 | 3300025986 | Ga0207658_10124603 | Ga0207658_101246032 | 370 |
| 490 | 3300026023 | Ga0207677_10188252 | Ga0207677_101882521 | 370 |
| 491 | 3300026035 | Ga0207703_10005679 | Ga0207703_100056799 | 370 |
| 492 | 3300026035 | Ga0207703_10087464 | Ga0207703_100874642 | 370 |
| 493 | 3300026041 | Ga0207639_10023583 | Ga0207639_100235834 | 370 |
| 494 | 3300026041 | Ga0207639_10038237 | Ga0207639_100382373 | 370 |
| 495 | 3300026041 | Ga0207639_10059996 | Ga0207639_100599963 | 370 |
| 496 | 3300026041 | Ga0207639_10080302 | Ga0207639_100803022 | 370 |
| 497 | 3300026041 | Ga0207639_10180841 | Ga0207639_101808412 | 370 |
| 498 | 3300026075 | Ga0207708_10081894 | Ga0207708_100818943 | 370 |
| 499 | 3300026075 | Ga0207708_10137759 | Ga0207708_101377591 | 370 |
| 500 | 3300026078 | Ga0207702_10019126 | Ga0207702_100191262 | 370 |
| 501 | 3300026078 | Ga0207702_10061481 | Ga0207702_100614812 | 370 |
| 502 | 3300026078 | Ga0207702_10066409 | Ga0207702_100664092 | 370 |
| 503 | 3300026078 | Ga0207702_10084699 | Ga0207702_100846992 | 370 |
| 504 | 3300026078 | Ga0207702_10158519 | Ga0207702_101585192 | 370 |
| 505 | 3300026078 | Ga0207702_10220671 | Ga0207702_102206712 | 370 |
| 506 | 3300026078 | Ga0207702_10419214 | Ga0207702_104192141 | 370 |
| 507 | 3300026088 | Ga0207641_10000158 | Ga0207641_1000015857 | 370 |
| 508 | 3300026088 | Ga0207641_10001128 | Ga0207641_100011284 | 370 |
| 509 | 3300026088 | Ga0207641_10092034 | Ga0207641_100920341 | 370 |
| 510 | 3300026088 | Ga0207641_10347976 | Ga0207641_103479761 | 370 |
| 511 | 3300026089 | Ga0207648_10000653 | Ga0207648_100006532 | 370 |
| 512 | 3300026089 | Ga0207648_10003171 | Ga0207648_100031717 | 370 |
| 513 | 3300026089 | Ga0207648_10011997 | Ga0207648_100119975 | 370 |
| 514 | 3300026089 | Ga0207648_10081603 | Ga0207648_100816033 | 370 |
| 515 | 3300026089 | Ga0207648_10133982 | Ga0207648_101339822 | 370 |
| 516 | 3300026095 | Ga0207676_10072025 | Ga0207676_100720254 | 370 |
| 517 | 3300026095 | Ga0207676_10109171 | Ga0207676_101091712 | 370 |
| 518 | 3300026116 | Ga0207674_10001723 | Ga0207674_1000172318 | 370 |
| 519 | 3300026116 | Ga0207674_10019660 | Ga0207674_100196607 | 370 |
| 520 | 3300026116 | Ga0207674_10028397 | Ga0207674_100283976 | 370 |
| 521 | 3300026116 | Ga0207674_10122746 | Ga0207674_101227462 | 370 |
| 522 | 3300026118 | Ga0207675_100004088 | Ga0207675_1000040884 | 370 |
| 523 | 3300026118 | Ga0207675_100074599 | Ga0207675_1000745992 | 370 |
| 524 | 3300026118 | Ga0207675_100090583 | Ga0207675_1000905832 | 370 |
| 525 | 3300026118 | Ga0207675_100191537 | Ga0207675_1001915372 | 370 |
| 526 | 3300026121 | Ga0207683_10004426 | Ga0207683_100044264 | 370 |
| 527 | 3300026121 | Ga0207683_10132651 | Ga0207683_101326512 | 370 |
| 528 | 3300026142 | Ga0207698_10002758 | Ga0207698_100027588 | 370 |
| 529 | 3300026142 | Ga0207698_10026494 | Ga0207698_100264943 | 370 |
| 530 | 3300026142 | Ga0207698_10168610 | Ga0207698_101686102 | 370 |
| 531 | 3300028380 | Ga0268265_10053903 | Ga0268265_100539034 | 370 |
| 532 | 3300028381 | Ga0268264_10000011 | Ga0268264_10000011424 | 370 |
| 533 | 3300028381 | Ga0268264_10001129 | Ga0268264_1000112916 | 370 |
| 534 | 3300028381 | Ga0268264_10001678 | Ga0268264_100016787 | 370 |
| 535 | 3300028381 | Ga0268264_10025484 | Ga0268264_100254844 | 370 |
| 536 | 3300028381 | Ga0268264_10089204 | Ga0268264_100892042 | 370 |
| 537 | 3300028786 | Ga0307517_10007333 | Ga0307517_100073333 | 370 |
| 538 | 3300028786 | Ga0307517_10141613 | Ga0307517_101416132 | 370 |
| 539 | 3300028794 | Ga0307515_10000001 | Ga0307515_100000011334 | 370 |
| 540 | 3300028794 | Ga0307515_10000074 | Ga0307515_10000074155 | 370 |
| 541 | 3300030521 | Ga0307511_10000673 | Ga0307511_100006735 | 370 |
| 542 | 3300030522 | Ga0307512_10166470 | Ga0307512_101664701 | 370 |
| 543 | 3300031250 | Ga0265331_10045401 | Ga0265331_100454012 | 370 |
| 544 | 3300031251 | Ga0265327_10000152 | Ga0265327_1000015258 | 370 |
| 545 | 3300031251 | Ga0265327_10000440 | Ga0265327_1000044047 | 370 |
| 546 | 3300031251 | Ga0265327_10033388 | Ga0265327_100333882 | 370 |
| 547 | 3300031507 | Ga0307509_10037992 | Ga0307509_100379922 | 370 |
| 548 | 3300031548 | Ga0307408_100217521 | Ga0307408_1002175212 | 370 |
| 549 | 3300031730 | Ga0307516_10002603 | Ga0307516_100026033 | 370 |
| 550 | 3300031730 | Ga0307516_10119609 | Ga0307516_101196092 | 370 |
| 551 | 3300031731 | Ga0307405_10099571 | Ga0307405_100995712 | 370 |
| 552 | 3300031824 | Ga0307413_10279812 | Ga0307413_102798121 | 370 |
| 553 | 3300031852 | Ga0307410_10003887 | Ga0307410_100038873 | 370 |
| 554 | 3300032002 | Ga0307416_100018966 | Ga0307416_1000189663 | 370 |
| 555 | 3300032004 | Ga0307414_10199913 | Ga0307414_101999132 | 370 |
| 556 | 3300036401 | Ga0373937_0176297 | Ga0373937_0176297_667_1782 | 370 |
| 557 | 3300037312 | Ga0395899_0008094 | Ga0395899_0008094_2601_3716 | 370 |
| 558 | 3300037312 | Ga0395899_0024335 | Ga0395899_0024335_3085_4200 | 370 |
| 559 | 3300037312 | Ga0395899_0053919 | Ga0395899_0053919_1597_2712 | 370 |
| 560 | 3300037312 | Ga0395899_0076878 | Ga0395899_0076878_65_1180 | 370 |
| 561 | 3300037312 | Ga0395899_0089406 | Ga0395899_0089406_851_1966 | 370 |
| 562 | 3300037312 | Ga0395899_0109418 | Ga0395899_0109418_163_1278 | 370 |
| 563 | 3300037418 | Ga0395900_0004748 | Ga0395900_0004748_11907_13022 | 370 |
| 564 | 3300037418 | Ga0395900_0004811 | Ga0395900_0004811_4992_6107 | 370 |
| 565 | 3300037418 | Ga0395900_0052346 | Ga0395900_0052346_1590_2705 | 370 |
| 566 | 3300037418 | Ga0395900_0075560 | Ga0395900_0075560_452_1567 | 370 |
| 567 | 3300037418 | Ga0395900_0144408 | Ga0395900_0144408_91_1206 | 370 |
| 568 | 3300037418 | Ga0395900_0211801 | Ga0395900_0211801_101_1216 | 370 |
| 569 | 3300037466 | Ga0395898_0002029 | Ga0395898_0002029_14734_15849 | 370 |
| 570 | 3300037466 | Ga0395898_0019287 | Ga0395898_0019287_2447_3562 | 370 |
| 571 | 3300037466 | Ga0395898_0067190 | Ga0395898_0067190_1256_2371 | 370 |
| 572 | 3300037466 | Ga0395898_0091877 | Ga0395898_0091877_1574_2689 | 370 |
| 573 | 3300037466 | Ga0395898_0124969 | Ga0395898_0124969_93_1208 | 370 |
| 574 | 3300037471 | Ga0395905_0019861 | Ga0395905_0019861_3138_4253 | 370 |
| 575 | 3300037471 | Ga0395905_0236900 | Ga0395905_0236900_319_1434 | 370 |
| 576 | 3300038443 | Ga0395901_0016383 | Ga0395901_0016383_2255_3370 | 370 |
| 577 | 3300038443 | Ga0395901_0129613 | Ga0395901_0129613_61_1176 | 370 |
| 578 | 3300038443 | Ga0395901_0220309 | Ga0395901_0220309_93_1208 | 370 |
| 579 | 3300039437 | Ga0436365_1499396 | Ga0436365_1499396_666_1781 | 370 |
| 580 | 3300039437 | Ga0436365_1879596 | Ga0436365_1879596_4105_5220 | 370 |
| 581 | 3300041406 | Ga0439439_0003744 | Ga0439439_0003744_1226_2386 | 370 |
| 582 | 3300041458 | Ga0451798_0554964 | Ga0451798_0554964_979_2094 | 370 |
| 583 | 3300042001 | Ga0439441_003884 | Ga0439441_003884_75_1190 | 370 |
| 584 | 3300042007 | Ga0439449_0011541 | Ga0439449_0011541_1671_2798 | 370 |
| 585 | 3300042007 | Ga0439449_0011855 | Ga0439449_0011855_1086_2246 | 370 |
| 586 | 3300042007 | Ga0439449_0033163 | Ga0439449_0033163_429_1544 | 370 |
| 587 | 3300042014 | Ga0439457_000620 | Ga0439457_000620_9072_10232 | 370 |
| 588 | 3300042125 | Ga0450923_007092 | Ga0450923_007092_259_1374 | 370 |
| 589 | 3300044656 | Ga0466969_0000778 | Ga0466969_0000778_9391_10506 | 370 |
| 590 | 3300044656 | Ga0466969_0020141 | Ga0466969_0020141_113_1228 | 370 |
| 591 | 3300044658 | Ga0466972_0000004 | Ga0466972_0000004_298071_299186 | 370 |
| 592 | 3300044658 | Ga0466972_0000095 | Ga0466972_0000095_75453_76568 | 370 |
| 593 | 3300044658 | Ga0466972_0000579 | Ga0466972_0000579_12696_13811 | 370 |
| 594 | 3300044712 | Ga0453684_0021771 | Ga0453684_0021771_1856_2971 | 370 |
| 595 | 3300044765 | Ga0466970_0000518 | Ga0466970_0000518_12984_14099 | 370 |
| 596 | 3300044765 | Ga0466970_0014415 | Ga0466970_0014415_1544_2659 | 370 |
| 597 | 3300044842 | Ga0466957_0015823 | Ga0466957_0015823_485_1600 | 370 |
| 598 | 3300045049 | Ga0466959_0000125 | Ga0466959_0000125_32570_33685 | 370 |
| 599 | 3300045049 | Ga0466959_0032625 | Ga0466959_0032625_1136_2251 | 370 |
| 600 | 3300046460 | Ga0495638_0053431 | Ga0495638_0053431_1013_2128 | 370 |
| 601 | 3300046460 | Ga0495638_0058491 | Ga0495638_0058491_1235_2350 | 370 |
| 602 | 3300046471 | Ga0495650_0033358 | Ga0495650_0033358_384_1499 | 370 |
| 603 | 3300046507 | Ga0495606_0003492 | Ga0495606_0003492_60_1175 | 370 |
| 604 | 3300046524 | Ga0495648_0002020 | Ga0495648_0002020_15803_16918 | 370 |
| 605 | 3300046616 | Ga0495668_0013929 | Ga0495668_0013929_3569_4684 | 370 |
| 606 | 3300046648 | Ga0495611_0000385 | Ga0495611_0000385_15637_16752 | 370 |
| 607 | 3300047320 | Ga0495672_0116695 | Ga0495672_0116695_188_1303 | 370 |
| 608 | 3300047443 | Ga0495687_000001 | Ga0495687_000001_850912_852027 | 370 |
| 609 | 3300047472 | Ga0495686_0000004 | Ga0495686_0000004_139783_140898 | 370 |
| 610 | 3300047472 | Ga0495686_0000772 | Ga0495686_0000772_21562_22677 | 370 |
| 611 | 3300049570 | Ga0501033_0172930 | Ga0501033_0172930_278_1393 | 370 |
| 612 | 3300049571 | Ga0501034_0035681 | Ga0501034_0035681_280_1395 | 370 |
| 613 | 3300049571 | Ga0501034_0059558 | Ga0501034_0059558_2119_3234 | 370 |
| 614 | 3300049571 | Ga0501034_0167483 | Ga0501034_0167483_48_1163 | 370 |
| 615 | 3300049572 | Ga0501036_0127246 | Ga0501036_0127246_701_1816 | 370 |
| 616 | 3300049572 | Ga0501036_0172190 | Ga0501036_0172190_61_1176 | 370 |
| 617 | 3300049573 | Ga0501037_0099530 | Ga0501037_0099530_719_1834 | 370 |
| 618 | 3300049574 | Ga0501038_0057852 | Ga0501038_0057852_2004_3119 | 370 |
| 619 | 3300049574 | Ga0501038_0070304 | Ga0501038_0070304_81_1196 | 370 |
| 620 | 3300049575 | Ga0501039_0022019 | Ga0501039_0022019_3534_4649 | 370 |
| 621 | 3300049579 | Ga0501043_0015022 | Ga0501043_0015022_2813_3928 | 370 |
| 622 | 3300049579 | Ga0501043_0015230 | Ga0501043_0015230_4557_5672 | 370 |
| 623 | 3300049581 | Ga0501047_0006024 | Ga0501047_0006024_939_2054 | 370 |
| 624 | 3300049581 | Ga0501047_0047360 | Ga0501047_0047360_1502_2617 | 370 |
| 625 | 3300049581 | Ga0501047_0048551 | Ga0501047_0048551_2119_3234 | 370 |
| 626 | 3300049581 | Ga0501047_0091860 | Ga0501047_0091860_1416_2531 | 370 |
| 627 | 3300049654 | Ga0501207_000601 | Ga0501207_000601_2396_3511 | 370 |
| 628 | 3300049663 | Ga0501223_000421 | Ga0501223_000421_3655_4770 | 370 |
| 629 | 3300049688 | Ga0501259_000442 | Ga0501259_000442_1269_2384 | 370 |
| 630 | 3300049703 | Ga0501219_000479 | Ga0501219_000479_865_1980 | 370 |
| 631 | 3300049705 | Ga0501225_0007958 | Ga0501225_0007958_1497_2612 | 370 |
| 632 | 3300049707 | Ga0501234_001054 | Ga0501234_001054_2513_3628 | 370 |
| 633 | 3300049742 | Ga0501080_0280286 | Ga0501080_0280286_179_1294 | 370 |
| 634 | 3300049822 | Ga0501035_0192114 | Ga0501035_0192114_47_1162 | 370 |
| 635 | 3300049823 | Ga0501044_0009540 | Ga0501044_0009540_3392_4507 | 370 |
| 636 | 3300049823 | Ga0501044_0126547 | Ga0501044_0126547_492_1607 | 370 |
| 637 | 3300049823 | Ga0501044_0290186 | Ga0501044_0290186_324_1439 | 370 |
| 638 | 3300050005 | Ga0501284_00027 | Ga0501284_00027_54583_55698 | 370 |
| 639 | 3300050493 | nmdc:mga0k408_63900_c1 | nmdc:mga0k408_63900_c1_633_1748 | 370 |
| 640 | 3300050507 | nmdc:mga05p37_160084_c1 | nmdc:mga05p37_160084_c1_56_1171 | 370 |
| 641 | 3300050507 | nmdc:mga05p37_54171_c1 | nmdc:mga05p37_54171_c1_846_1961 | 370 |
| 642 | 3300050508 | nmdc:mga09592_10171_c1 | nmdc:mga09592_10171_c1_3655_4770 | 370 |
| 643 | 3300050509 | nmdc:mga0qj67_146183_c1 | nmdc:mga0qj67_146183_c1_197_1312 | 370 |
| 644 | 3300050510 | nmdc:mga06r32_8029_c1 | nmdc:mga06r32_8029_c1_4688_5803 | 370 |
| 645 | 3300050511 | nmdc:mga08y16_153255_c1 | nmdc:mga08y16_153255_c1_494_1609 | 370 |
| 646 | 3300053090 | Ga0500646_0008363 | Ga0500646_0008363_492_1607 | 370 |
| 647 | 3300053092 | Ga0500583_0000010 | Ga0500583_0000010_94819_95934 | 370 |
| 648 | 3300053092 | Ga0500583_0006837 | Ga0500583_0006837_514_1629 | 370 |
| 649 | 3300053108 | Ga0500562_000062 | Ga0500562_000062_14436_15551 | 370 |
| 650 | 3300053136 | Ga0500559_0038292 | Ga0500559_0038292_245_1360 | 370 |
| 651 | 3300053139 | Ga0500568_0000236 | Ga0500568_0000236_42617_43732 | 370 |
| 652 | 3300053139 | Ga0500568_0018122 | Ga0500568_0018122_1278_2393 | 370 |
| 653 | 3300053151 | Ga0500604_0007716 | Ga0500604_0007716_1621_2736 | 370 |
| 654 | 3300053153 | Ga0500616_0015900 | Ga0500616_0015900_885_2000 | 370 |
| 655 | 3300053153 | Ga0500616_0082282 | Ga0500616_0082282_384_1499 | 370 |
| 656 | 3300053156 | Ga0500622_0002122 | Ga0500622_0002122_269_1384 | 370 |
| 657 | 3300053156 | Ga0500622_0090723 | Ga0500622_0090723_167_1282 | 370 |
| 658 | 3300053727 | Ga0500611_000006 | Ga0500611_000006_75550_76665 | 370 |
| 659 | 3300053730 | Ga0500645_025283 | Ga0500645_025283_250_1365 | 370 |
| 660 | 3300053739 | Ga0500587_007103 | Ga0500587_007103_239_1354 | 370 |
| 661 | 3300061719 | Ga0466962_0013673 | Ga0466962_0013673_221_1336 | 370 |
| 662 | iso_pu_bacteria | 2511231000 | 2511231344 | 370 |
| 663 | iso_pu_bacteria | 2582581278 | 2585143499 | 370 |
| 664 | iso_pu_bacteria | 2582581281 | 2585156806 | 370 |
| 665 | iso_pu_bacteria | 2582581282 | 2585160891 | 370 |
| 666 | iso_pu_bacteria | 2585428045 | 2587680560 | 370 |
| 667 | iso_pu_bacteria | 2585428060 | 2587749568 | 370 |
| 668 | iso_pu_bacteria | 2585428182 | 2588208218 | 370 |
| 669 | iso_pu_bacteria | 2585428183 | 2588213218 | 370 |
| 670 | iso_pu_bacteria | 2585428184 | 2588219831 | 370 |
| 671 | iso_pu_bacteria | 2585428185 | 2588223896 | 370 |
| 672 | iso_pu_bacteria | 2588253712 | 2588446466 | 370 |
| 673 | iso_pu_bacteria | 2588254255 | 2590600812 | 370 |
| 674 | iso_pu_bacteria | 2588254257 | 2590611923 | 370 |
| 675 | iso_pu_bacteria | 2751185877 | 2753672652 | 370 |
| 676 | iso_pu_bacteria | 2765235839 | 2765572600 | 370 |
| 677 | iso_pu_bacteria | 2772190705 | 2772607101 | 370 |
| 678 | iso_pu_bacteria | 2816332188 | 2816872949 | 370 |
| 679 | iso_pu_bacteria | 2842083920 | 2842084204 | 370 |
| 680 | iso_pu_bacteria | 2871720351 | 2871723752 | 370 |
| 681 | iso_pu_bacteria | 2889290771 | 2889291675 | 370 |
| 682 | iso_pu_bacteria | 2905999023 | 2906000788 | 370 |
| 683 | iso_pu_bacteria | 2919399522 | 2919402915 | 370 |
| 684 | iso_pu_bacteria | 2984572630 | 2984575992 | 370 |
| 685 | iso_pu_bacteria | 2984606641 | 2984609447 | 370 |
| 686 | 3300005328 | Ga0070676_10011986 | Ga0070676_100119864 | 371 |
| 687 | 3300005334 | Ga0068869_100010028 | Ga0068869_1000100283 | 371 |
| 688 | 3300005335 | Ga0070666_10019114 | Ga0070666_100191142 | 371 |
| 689 | 3300005336 | Ga0070680_100000323 | Ga0070680_1000003236 | 371 |
| 690 | 3300005337 | Ga0070682_100001720 | Ga0070682_1000017206 | 371 |
| 691 | 3300005341 | Ga0070691_10008842 | Ga0070691_100088423 | 371 |
| 692 | 3300005347 | Ga0070668_100054934 | Ga0070668_1000549342 | 371 |
| 693 | 3300005366 | Ga0070659_100124333 | Ga0070659_1001243332 | 371 |
| 694 | 3300005367 | Ga0070667_100000584 | Ga0070667_1000005842 | 371 |
| 695 | 3300005457 | Ga0070662_100325629 | Ga0070662_1003256291 | 371 |
| 696 | 3300005458 | Ga0070681_10007717 | Ga0070681_100077172 | 371 |
| 697 | 3300005459 | Ga0068867_100000678 | Ga0068867_1000006783 | 371 |
| 698 | 3300005530 | Ga0070679_100000397 | Ga0070679_10000039710 | 371 |
| 699 | 3300005539 | Ga0068853_100002716 | Ga0068853_1000027168 | 371 |
| 700 | 3300005539 | Ga0068853_100149590 | Ga0068853_1001495902 | 371 |
| 701 | 3300005543 | Ga0070672_100000067 | Ga0070672_10000006712 | 371 |
| 702 | 3300005547 | Ga0070693_100034731 | Ga0070693_1000347313 | 371 |
| 703 | 3300005548 | Ga0070665_100002117 | Ga0070665_1000021177 | 371 |
| 704 | 3300005563 | Ga0068855_100071361 | Ga0068855_1000713613 | 371 |
| 705 | 3300005618 | Ga0068864_100012055 | Ga0068864_1000120552 | 371 |
| 706 | 3300005719 | Ga0068861_100230903 | Ga0068861_1002309032 | 371 |
| 707 | 3300005834 | Ga0068851_10001272 | Ga0068851_100012721 | 371 |
| 708 | 3300005841 | Ga0068863_100002443 | Ga0068863_1000024433 | 371 |
| 709 | 3300005843 | Ga0068860_100039626 | Ga0068860_1000396263 | 371 |
| 710 | 3300006948 | Ga0099826_10007777 | Ga0099826_100077774 | 371 |
| 711 | 3300009036 | Ga0105244_10000063 | Ga0105244_1000006333 | 371 |
| 712 | 3300009093 | Ga0105240_10019796 | Ga0105240_100197965 | 371 |
| 713 | 3300009093 | Ga0105240_10305433 | Ga0105240_103054332 | 371 |
| 714 | 3300009101 | Ga0105247_10090314 | Ga0105247_100903142 | 371 |
| 715 | 3300009174 | Ga0105241_10000105 | Ga0105241_1000010529 | 371 |
| 716 | 3300009176 | Ga0105242_10144251 | Ga0105242_101442512 | 371 |
| 717 | 3300009177 | Ga0105248_10054545 | Ga0105248_100545454 | 371 |
| 718 | 3300009545 | Ga0105237_10048637 | Ga0105237_100486373 | 371 |
| 719 | 3300009553 | Ga0105249_10033891 | Ga0105249_100338913 | 371 |
| 720 | 3300011119 | Ga0105246_10051112 | Ga0105246_100511122 | 371 |
| 721 | 3300013102 | Ga0157371_10005877 | Ga0157371_100058774 | 371 |
| 722 | 3300013104 | Ga0157370_10000703 | Ga0157370_100007033 | 371 |
| 723 | 3300013104 | Ga0157370_10059792 | Ga0157370_100597922 | 371 |
| 724 | 3300013104 | Ga0157370_10068257 | Ga0157370_100682572 | 371 |
| 725 | 3300013105 | Ga0157369_10001138 | Ga0157369_100011386 | 371 |
| 726 | 3300013105 | Ga0157369_10105452 | Ga0157369_101054523 | 371 |
| 727 | 3300013297 | Ga0157378_10069761 | Ga0157378_100697613 | 371 |
| 728 | 3300013306 | Ga0163162_10011686 | Ga0163162_100116867 | 371 |
| 729 | 3300013306 | Ga0163162_10073353 | Ga0163162_100733534 | 371 |
| 730 | 3300013307 | Ga0157372_10110049 | Ga0157372_101100493 | 371 |
| 731 | 3300013308 | Ga0157375_10020011 | Ga0157375_100200113 | 371 |
| 732 | 3300014968 | Ga0157379_10022058 | Ga0157379_100220586 | 371 |
| 733 | 3300014968 | Ga0157379_10061632 | Ga0157379_100616321 | 371 |
| 734 | 3300014969 | Ga0157376_10450428 | Ga0157376_104504281 | 371 |
| 735 | 3300014969 | Ga0157376_10450430 | Ga0157376_104504301 | 371 |
| 736 | 3300015261 | Ga0182006_1001549 | Ga0182006_10015496 | 371 |
| 737 | 3300017792 | Ga0163161_10000012 | Ga0163161_1000001234 | 371 |
| 738 | 3300017792 | Ga0163161_10034726 | Ga0163161_100347262 | 371 |
| 739 | 3300025728 | Ga0207655_1000008 | Ga0207655_1000008620 | 371 |
| 740 | 3300025903 | Ga0207680_10031567 | Ga0207680_100315673 | 371 |
| 741 | 3300025907 | Ga0207645_10000776 | Ga0207645_100007762 | 371 |
| 742 | 3300025911 | Ga0207654_10001533 | Ga0207654_100015333 | 371 |
| 743 | 3300025912 | Ga0207707_10000205 | Ga0207707_1000020520 | 371 |
| 744 | 3300025913 | Ga0207695_10003840 | Ga0207695_1000384010 | 371 |
| 745 | 3300025921 | Ga0207652_10000186 | Ga0207652_1000018643 | 371 |
| 746 | 3300025933 | Ga0207706_10086259 | Ga0207706_100862592 | 371 |
| 747 | 3300025940 | Ga0207691_10002208 | Ga0207691_100022084 | 371 |
| 748 | 3300025941 | Ga0207711_10084963 | Ga0207711_100849632 | 371 |
| 749 | 3300025942 | Ga0207689_10030127 | Ga0207689_100301274 | 371 |
| 750 | 3300025960 | Ga0207651_10000296 | Ga0207651_100002967 | 371 |
| 751 | 3300025972 | Ga0207668_10000272 | Ga0207668_1000027215 | 371 |
| 752 | 3300026035 | Ga0207703_10058478 | Ga0207703_100584783 | 371 |
| 753 | 3300026041 | Ga0207639_10005538 | Ga0207639_100055386 | 371 |
| 754 | 3300026041 | Ga0207639_10194961 | Ga0207639_101949612 | 371 |
| 755 | 3300026067 | Ga0207678_10131516 | Ga0207678_101315162 | 371 |
| 756 | 3300026088 | Ga0207641_10003749 | Ga0207641_100037497 | 371 |
| 757 | 3300026089 | Ga0207648_10000786 | Ga0207648_100007867 | 371 |
| 758 | 3300026095 | Ga0207676_10001574 | Ga0207676_1000157410 | 371 |
| 759 | 3300026118 | Ga0207675_100236489 | Ga0207675_1002364892 | 371 |
| 760 | 3300026142 | Ga0207698_10215309 | Ga0207698_102153092 | 371 |
| 761 | 3300027111 | Ga0209281_1000244 | Ga0209281_1000244107 | 371 |
| 762 | 3300027361 | Ga0209489_115968 | Ga0209489_1159683 | 371 |
| 763 | 3300028379 | Ga0268266_10002971 | Ga0268266_100029713 | 371 |
| 764 | 3300028381 | Ga0268264_10032292 | Ga0268264_100322922 | 371 |
| 765 | 3300031727 | Ga0316576_10054425 | Ga0316576_100544253 | 371 |
| 766 | 3300031824 | Ga0307413_10002944 | Ga0307413_100029442 | 371 |
| 767 | 3300031824 | Ga0307413_10192730 | Ga0307413_101927301 | 371 |
| 768 | 3300031852 | Ga0307410_10000067 | Ga0307410_1000006719 | 371 |
| 769 | 3300031901 | Ga0307406_10000035 | Ga0307406_1000003559 | 371 |
| 770 | 3300032002 | Ga0307416_100000639 | Ga0307416_10000063914 | 371 |
| 771 | 3300032004 | Ga0307414_10000063 | Ga0307414_1000006346 | 371 |
| 772 | 3300032005 | Ga0307411_10000001 | Ga0307411_10000001434 | 371 |
| 773 | 3300033180 | Ga0307510_10133750 | Ga0307510_101337502 | 371 |
| 774 | 3300036401 | Ga0373937_0101686 | Ga0373937_0101686_1260_2378 | 371 |
| 775 | 3300036712 | Ga0316584_0046497 | Ga0316584_0046497_1451_2569 | 371 |
| 776 | 3300041407 | Ga0439447_004758 | Ga0439447_004758_1357_2475 | 371 |
| 777 | 3300041411 | Ga0439466_0002720 | Ga0439466_0002720_4485_5603 | 371 |
| 778 | 3300046473 | Ga0495582_0010257 | Ga0495582_0010257_1205_2323 | 371 |
| 779 | 3300046559 | Ga0495667_0159750 | Ga0495667_0159750_167_1285 | 371 |
| 780 | 3300047319 | Ga0495674_0025349 | Ga0495674_0025349_2355_3473 | 371 |
| 781 | 3300048912 | Ga0496109_0015035 | Ga0496109_0015035_2771_3889 | 371 |
| 782 | 3300048919 | Ga0496116_0000032 | Ga0496116_0000032_130561_131679 | 371 |
| 783 | 3300048924 | Ga0496121_0008699 | Ga0496121_0008699_4333_5451 | 371 |
| 784 | 3300048927 | Ga0496124_0023852 | Ga0496124_0023852_2859_3977 | 371 |
| 785 | 3300048928 | Ga0496125_0000059 | Ga0496125_0000059_128139_129257 | 371 |
| 786 | 3300048929 | Ga0496126_0023187 | Ga0496126_0023187_3388_4506 | 371 |
| 787 | 3300049582 | Ga0501048_0010094 | Ga0501048_0010094_1110_2228 | 371 |
| 788 | 3300049584 | Ga0501068_0013638 | Ga0501068_0013638_426_1544 | 371 |
| 789 | 3300049671 | Ga0501238_000316 | Ga0501238_000316_173_1291 | 371 |
| 790 | 3300049679 | Ga0501249_000009 | Ga0501249_000009_23007_24125 | 371 |
| 791 | 3300049763 | Ga0501266_000039 | Ga0501266_000039_21495_22613 | 371 |
| 792 | 3300049776 | Ga0501280_001414 | Ga0501280_001414_190_1308 | 371 |
| 793 | 3300053096 | Ga0500641_0000017 | Ga0500641_0000017_126137_127255 | 371 |
| 794 | 3300053096 | Ga0500641_0001009 | Ga0500641_0001009_7045_8163 | 371 |
| 795 | 3300053134 | Ga0500658_0000003 | Ga0500658_0000003_179643_180761 | 371 |
| 796 | 3300053136 | Ga0500559_0011905 | Ga0500559_0011905_596_1714 | 371 |
| 797 | 3300053140 | Ga0500573_0109930 | Ga0500573_0109930_301_1419 | 371 |
| 798 | 3300054114 | Ga0501084_0014972 | Ga0501084_0014972_3065_4183 | 371 |
| 799 | 3300060353 | Ga0501082_0026906 | Ga0501082_0026906_133_1251 | 371 |
| 800 | 3300005843 | Ga0068860_100003389 | Ga0068860_10000338915 | 372 |
| 801 | 3300005844 | Ga0068862_100052004 | Ga0068862_1000520043 | 372 |
| 802 | 3300025925 | Ga0207650_10190430 | Ga0207650_101904301 | 372 |
| 803 | 3300028381 | Ga0268264_10006613 | Ga0268264_100066138 | 372 |
| 804 | 3300031727 | Ga0316576_10018872 | Ga0316576_100188722 | 372 |
| 805 | 2162886007 | SwRhRL2b_contig_95641 | SwRhRL2b_0542.00005230 | 373 |
| 806 | 3300003323 | rootH1_10155400 | rootH1_101554002 | 373 |
| 807 | 3300005289 | Ga0065704_10092508 | Ga0065704_100925083 | 373 |
| 808 | 3300005329 | Ga0070683_100011995 | Ga0070683_1000119951 | 373 |
| 809 | 3300005337 | Ga0070682_100000153 | Ga0070682_10000015321 | 373 |
| 810 | 3300009036 | Ga0105244_10000261 | Ga0105244_1000026110 | 373 |
| 811 | 3300009148 | Ga0105243_10000564 | Ga0105243_1000056427 | 373 |
| 812 | 3300013104 | Ga0157370_10004625 | Ga0157370_1000462519 | 373 |
| 813 | 3300013105 | Ga0157369_10000224 | Ga0157369_100002243 | 373 |
| 814 | 3300025291 | Ga0209675_1000033 | Ga0209675_100003339 | 373 |
| 815 | 3300025728 | Ga0207655_1002095 | Ga0207655_10020959 | 373 |
| 816 | 3300025935 | Ga0207709_10000462 | Ga0207709_1000046227 | 373 |
| 817 | 3300025944 | Ga0207661_10081685 | Ga0207661_100816851 | 373 |
| 818 | 3300046453 | Ga0495627_000003 | Ga0495627_000003_363191_364312 | 373 |
| 819 | 3300046453 | Ga0495627_004497 | Ga0495627_004497_250_1371 | 373 |
| 820 | 3300046500 | Ga0495596_0000277 | Ga0495596_0000277_16666_17790 | 373 |
| 821 | 3300046507 | Ga0495606_0014393 | Ga0495606_0014393_434_1558 | 373 |
| 822 | 3300046512 | Ga0495610_0000001 | Ga0495610_0000001_1473637_1474761 | 373 |
| 823 | 3300046519 | Ga0495632_0005413 | Ga0495632_0005413_2836_3957 | 373 |
| 824 | 3300046525 | Ga0495663_0003000 | Ga0495663_0003000_3536_4660 | 373 |
| 825 | 3300046530 | Ga0495654_0000001 | Ga0495654_0000001_756518_757639 | 373 |
| 826 | 3300046558 | Ga0495633_0000008 | Ga0495633_0000008_188860_189981 | 373 |
| 827 | 3300046558 | Ga0495633_0004847 | Ga0495633_0004847_5684_6805 | 373 |
| 828 | 3300046660 | Ga0495625_0001823 | Ga0495625_0001823_7466_8587 | 373 |
| 829 | 3300047472 | Ga0495686_0000118 | Ga0495686_0000118_147990_149111 | 373 |
| 830 | 3300047472 | Ga0495686_0022322 | Ga0495686_0022322_637_1758 | 373 |
| 831 | 3300048919 | Ga0496116_0000053 | Ga0496116_0000053_133818_134942 | 373 |
| 832 | 3300048920 | Ga0496117_0000089 | Ga0496117_0000089_21726_22850 | 373 |
| 833 | 3300048921 | Ga0496118_0001078 | Ga0496118_0001078_23566_24690 | 373 |
| 834 | 3300048921 | Ga0496118_0138928 | Ga0496118_0138928_109_1230 | 373 |
| 835 | 3300048922 | Ga0496119_0000038 | Ga0496119_0000038_21719_22843 | 373 |
| 836 | 3300048924 | Ga0496121_0056645 | Ga0496121_0056645_1098_2222 | 373 |
| 837 | 3300048925 | Ga0496122_0000118 | Ga0496122_0000118_24780_25904 | 373 |
| 838 | 3300048925 | Ga0496122_0001213 | Ga0496122_0001213_17617_18741 | 373 |
| 839 | 3300048925 | Ga0496122_0009811 | Ga0496122_0009811_2045_3169 | 373 |
| 840 | 3300048925 | Ga0496122_0019641 | Ga0496122_0019641_3003_4127 | 373 |
| 841 | 3300048926 | Ga0496123_0002780 | Ga0496123_0002780_8899_10023 | 373 |
| 842 | 3300048927 | Ga0496124_0001056 | Ga0496124_0001056_37461_38585 | 373 |
| 843 | 3300048928 | Ga0496125_0008819 | Ga0496125_0008819_1890_3014 | 373 |
| 844 | 3300048928 | Ga0496125_0009663 | Ga0496125_0009663_2053_3177 | 373 |
| 845 | 3300048929 | Ga0496126_0009798 | Ga0496126_0009798_5626_6750 | 373 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1a05-assembly1.cif.gz_B | crystal structure of the complex of 3-isopropylmalate dehydrogenase from thiobacillus ferrooxidans with 3-isopropylmalate | 0.9638 | 5 | 354 |
| 5j33-assembly3.cif.gz_F | isopropylmalate dehydrogenase in complex with nad+ | 0.9609 | 3 | 352 |
| 4wuo-assembly1.cif.gz_B | structure of the e270a mutant isopropylmalate dehydrogenase from thermus thermophilus in complex with ipm, mn and nadh | 0.9581 | 6 | 352 |
| 6xxy-assembly1.cif.gz_B | crystal structure of haemophilus influenzae 3-isopropylmalate dehydrogenase in complex with o-isobutenyl oxalylhydroxamate. | 0.9577 | 3 | 350 |
| 3wzy-assembly1.cif.gz_A-2 | s266a mutant 3-isopropylmalate dehydrogenase from shewanella oneidensis mr-1 at 580mpa - complex with ipm and mg | 0.9559 | 3 | 353 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5hn5A00 | Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase | 0.953 | 5 | 353 | 3.40.718.10 |
| 5hn5A00 | Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase | 0.928 | 5 | 353 | 3.40.718.10 |
| 3u1hA00 | Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase | 0.9273 | 6 | 372 | 3.40.718.10 |
| af_A0A1D6Q461_5_211_3.40.718.10 | Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase | 0.9226 | 162 | 352 | 3.40.718.10 |
| 3u1hA00 | Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase | 0.9222 | 6 | 372 | 3.40.718.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5N9E846-F1-model_v4 | Isopropylmalate dehydrogenase-like domain-containing protein | 0.9948 | 4 | 81 |
GO:0003862
GO:0005829 GO:0009098 GO:0046872 |
| AF-X1TLG0-F1-model_v4 | Isopropylmalate dehydrogenase-like domain-containing protein | 0.9943 | 3 | 77 |
GO:0003862
GO:0005829 GO:0009098 GO:0046872 |
| AF-A0A1B6DTA9-F1-model_v4 | 3-isopropylmalate dehydrogenase (EC 1.1.1.85) | 0.9924 | 3 | 313 |
GO:0000287
GO:0003862 GO:0005829 GO:0006099 GO:0009098 GO:0051287 |
| AF-A0A3D5S8N2-F1-model_v4 | 3-isopropylmalate dehydrogenase | 0.9895 | 4 | 230 |
GO:0003862
GO:0005829 GO:0009098 GO:0046872 |
| AF-A0A399YM76-F1-model_v4 | 3-isopropylmalate dehydrogenase | 0.9893 | 3 | 76 |
GO:0003862
GO:0005829 GO:0009098 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar