F483255

General Info

Members Datasets Scaffolds Average Seq Length
845 355 783 371

Family's Representative Sequence

Representative Sequence 3300028379|Ga0268266_10000102|Ga0268266_1000010245
Length 364
Sequence MQKNIVVIEGDGIGPEVTRQAVKVLNAVADHGGHEFTYKYCLMGADAIDKTGTPLPDETIEAALSSDAILFGAIGHPKYDNDPTAKVRPEQGLLKLRKSLQLFANIRPVTTYPALQHLSPLKAKILEDVDFIIFRELTGGIYFGKKETSADGNQAMDDCTYTREEIGRIAHLAFRQLTLVDKANVLETSRLWRKVVQDIAGEYSDVKVDFLFVDNAAMQIILNPKQFDVILTENMFGDILSDEASVISGSLGLLPSASIGKGAALFEPIHGSYPQATGKDIANPLGSILSAAMLLDHFGLHKEAGRVREAANWTLQNGFVTKDIDPVNFYFTSTIGELISDYVGGKIPGDIHKENIELRKSTII

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
3 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
4 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
5 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
6 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
7 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
8 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
9 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
10 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
11 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
12 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
13 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
14 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
15 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
16 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
17 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
18 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
19 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
20 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
21 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
22 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
23 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
24 2738541278 Niastella sp. CF465 Isolate Unclassified
25 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
26 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
27 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
28 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
29 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
30 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
31 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
32 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
33 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
34 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
35 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
36 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
37 2818991444 Filimonas endophytica 3197 Isolate Unclassified
38 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
39 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
40 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
41 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
42 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
43 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
44 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
45 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
46 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
47 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
48 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
49 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
50 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
51 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
52 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
53 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
54 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
55 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
56 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
57 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
58 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
59 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
60 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
61 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
62 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
63 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
64 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
65 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
66 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
67 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
68 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
69 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
70 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
71 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
72 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
73 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
74 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
75 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
76 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
77 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
78 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
79 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
80 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
81 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
82 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
83 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
84 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
85 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
86 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
87 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
88 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
89 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
90 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
91 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
92 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
93 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
94 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
95 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
96 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
97 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
98 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
99 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
100 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
101 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
102 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
103 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
104 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
105 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
106 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
107 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
108 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
109 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
110 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
111 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
112 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
113 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
114 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
115 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
116 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
117 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
118 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
119 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
120 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
121 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
122 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
123 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
124 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
125 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
126 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
127 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
128 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
129 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
130 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
131 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
132 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
133 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
134 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
135 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
136 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
137 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
138 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
139 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
140 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
141 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
142 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
143 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
144 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
145 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
146 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
147 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
148 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
149 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
150 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
151 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
152 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
153 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
154 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
155 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
156 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
157 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
158 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
159 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
160 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
161 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
162 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
163 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
166 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
220 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
221 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
225 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
226 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
227 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
228 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
229 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
230 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
231 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
232 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
233 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
234 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
235 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
236 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
237 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
238 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
239 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
240 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
241 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
242 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
243 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
244 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
245 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
246 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
247 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
248 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
249 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
250 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
251 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
252 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
253 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
254 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
255 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
256 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
257 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
258 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
259 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
260 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
261 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
262 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
263 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
264 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
265 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
266 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
267 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
268 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
269 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
270 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
271 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
272 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
273 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
274 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
275 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
276 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
277 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
278 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
279 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
280 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
281 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
282 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
283 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
284 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
285 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
286 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
287 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
288 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
289 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
290 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
291 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
292 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
293 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
294 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
295 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
296 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
297 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
298 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
299 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
300 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
301 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
302 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
303 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
304 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
314 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
315 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
316 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
317 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
318 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
319 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
320 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
321 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
322 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
323 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
324 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
325 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
327 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
328 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
329 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
330 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
331 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
332 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
333 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
334 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
335 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
336 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
337 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
338 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
339 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
340 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
341 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
342 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
343 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
344 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
345 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
346 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
347 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
348 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
349 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
350 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
351 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
352 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
353 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
354 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
355 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.66
Metatranscriptomes 0
Isolates 7.34

Biome Distribution

Category Percentage (%)
Aerial Root 0.24
Bulb 0
Endosphere 3.08
Nodule 0.47
Rhizoplane 0.24
Rhizosphere 87.69
Stem 0
Stem Tuber 0
Unclassified 8.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_95641 2162886007 Bacteria 3729
2 JGI24736J21556_1006464 3300001904 Bacteria 1972
3 JGI24751J29686_10001178 3300002459 Bacteria 5569
4 rootH1_10062921 3300003316 Bacteria 3858
5 rootH2_10024557 3300003320 Bacteria 11002
6 rootH2_10053942 3300003320 Bacteria 4275
7 rootH2_10104863 3300003320 Bacteria 3013
8 rootH1_10011887 3300003323 Unclassified 3206
9 rootH1_10155400 3300003323 Bacteria 1699
10 JGI25160J50197_1000565 3300003354 Bacteria 20958
11 Ga0065704_10092508 3300005289 Bacteria 2650
12 Ga0065704_10102932 3300005289 Bacteria 2188
13 Ga0065704_10145601 3300005289 Bacteria 1475
14 Ga0065712_10077508 3300005290 Bacteria 3484
15 Ga0065712_10131594 3300005290 Bacteria 1543
16 Ga0065707_10127397 3300005295 Bacteria 1982
17 Ga0065707_10190776 3300005295 Bacteria 1362
18 Ga0070676_10011986 3300005328 Bacteria 4725
19 Ga0070676_10099730 3300005328 Bacteria 1792
20 Ga0070683_100011995 3300005329 Bacteria 7517
21 Ga0070683_100255695 3300005329 Bacteria 1666
22 Ga0070683_100259747 3300005329 Bacteria 1652
23 Ga0070670_100031636 3300005331 Bacteria 4557
24 Ga0070670_100033064 3300005331 Bacteria 4455
25 Ga0070670_100118351 3300005331 Bacteria 2284
26 Ga0070670_100180290 3300005331 Bacteria 1834
27 Ga0070677_10012402 3300005333 Bacteria 2960
28 Ga0070677_10079443 3300005333 Bacteria 1400
29 Ga0068869_100003414 3300005334 Bacteria 9705
30 Ga0068869_100010028 3300005334 Bacteria 6159
31 Ga0068869_100171426 3300005334 Bacteria 1695
32 Ga0070666_10000042 3300005335 Bacteria 112296
33 Ga0070666_10019114 3300005335 Bacteria 4419
34 Ga0070680_100000323 3300005336 Bacteria 32103
35 Ga0070680_100009870 3300005336 Bacteria 7348
36 Ga0070680_100019792 3300005336 Bacteria 5337
37 Ga0070680_100086945 3300005336 Bacteria 2585
38 Ga0070682_100000153 3300005337 Bacteria 53159
39 Ga0070682_100001720 3300005337 Bacteria 12164
40 Ga0070682_100025537 3300005337 Bacteria 3527
41 Ga0070660_100029333 3300005339 Bacteria 4122
42 Ga0070660_100079904 3300005339 Bacteria 2566
43 Ga0070660_100099707 3300005339 Bacteria 2300
44 Ga0070691_10008842 3300005341 Bacteria 4611
45 Ga0070692_10061378 3300005345 Bacteria 1981
46 Ga0070668_100008663 3300005347 Bacteria 7554
47 Ga0070668_100028179 3300005347 Bacteria 4265
48 Ga0070668_100054934 3300005347 Bacteria 3073
49 Ga0070668_100056191 3300005347 Bacteria 3039
50 Ga0070668_100179457 3300005347 Bacteria 1729
51 Ga0070668_100184313 3300005347 Bacteria 1707
52 Ga0070669_100007952 3300005353 Bacteria 7577
53 Ga0070669_100071777 3300005353 Bacteria 2562
54 Ga0070675_100007326 3300005354 Bacteria 8514
55 Ga0070675_100008572 3300005354 Bacteria 7937
56 Ga0070675_100044137 3300005354 Bacteria 3646
57 Ga0070675_100133293 3300005354 Bacteria 2119
58 Ga0070671_100015437 3300005355 Bacteria 6170
59 Ga0070671_100057107 3300005355 Bacteria 3247
60 Ga0070674_100091933 3300005356 Bacteria 2192
61 Ga0070673_100008121 3300005364 Bacteria 6964
62 Ga0070673_100040967 3300005364 Bacteria 3556
63 Ga0070673_100072869 3300005364 Bacteria 2763
64 Ga0070673_100216998 3300005364 Bacteria 1654
65 Ga0070673_100219521 3300005364 Bacteria 1645
66 Ga0070673_100255257 3300005364 Bacteria 1530
67 Ga0070688_100022867 3300005365 Bacteria 3670
68 Ga0070659_100001401 3300005366 Bacteria 17380
69 Ga0070659_100056761 3300005366 Bacteria 3087
70 Ga0070659_100124333 3300005366 Bacteria 2092
71 Ga0070667_100000584 3300005367 Bacteria 36027
72 Ga0070667_100016082 3300005367 Bacteria 6189
73 Ga0070667_100021145 3300005367 Bacteria 5406
74 Ga0070667_100041120 3300005367 Bacteria 3878
75 Ga0070667_100061111 3300005367 Bacteria 3190
76 Ga0070701_10006124 3300005438 Bacteria 5039
77 Ga0070700_100101493 3300005441 Bacteria 1896
78 Ga0070663_100080139 3300005455 Bacteria 2397
79 Ga0070678_100099193 3300005456 Bacteria 2253
80 Ga0070662_100110710 3300005457 Bacteria 2091
81 Ga0070662_100325629 3300005457 Unclassified 1254
82 Ga0070681_10007717 3300005458 Bacteria 10516
83 Ga0070681_10055011 3300005458 Bacteria 3964
84 Ga0070681_10110560 3300005458 Unclassified 2688
85 Ga0070681_10157141 3300005458 Bacteria 2198
86 Ga0070681_10201409 3300005458 Bacteria 1909
87 Ga0068867_100000678 3300005459 Bacteria 22556
88 Ga0068867_100029874 3300005459 Bacteria 3929
89 Ga0068867_100031374 3300005459 Bacteria 3836
90 Ga0068867_100120612 3300005459 Bacteria 2026
91 Ga0068867_100246239 3300005459 Bacteria 1452
92 Ga0070685_10018548 3300005466 Unclassified 3743
93 Ga0070685_10130582 3300005466 Bacteria 1570
94 Ga0070698_100010282 3300005471 Bacteria 9993
95 Ga0070698_100068956 3300005471 Bacteria 3553
96 Ga0070679_100000397 3300005530 Bacteria 37025
97 Ga0070679_100000454 3300005530 Bacteria 34670
98 Ga0070679_100008694 3300005530 Bacteria 9572
99 Ga0070679_100027779 3300005530 Bacteria 5573
100 Ga0070679_100077176 3300005530 Bacteria 3320
101 Ga0070684_100048205 3300005535 Bacteria 3695
102 Ga0070684_100213747 3300005535 Bacteria 1758
103 Ga0068853_100002716 3300005539 Bacteria 13356
104 Ga0068853_100059071 3300005539 Bacteria 3312
105 Ga0068853_100100644 3300005539 Bacteria 2555
106 Ga0068853_100149590 3300005539 Bacteria 2101
107 Ga0068853_100231471 3300005539 Bacteria 1691
108 Ga0070672_100000067 3300005543 Bacteria 47884
109 Ga0070672_100011386 3300005543 Bacteria 6202
110 Ga0070672_100023219 3300005543 Bacteria 4568
111 Ga0070672_100149106 3300005543 Bacteria 1934
112 Ga0070672_100232438 3300005543 Bacteria 1549
113 Ga0070672_100346737 3300005543 Bacteria 1265
114 Ga0070672_100350086 3300005543 Bacteria 1259
115 Ga0070693_100034731 3300005547 Bacteria 2791
116 Ga0070665_100000001 3300005548 Bacteria 1083363
117 Ga0070665_100002117 3300005548 Bacteria 22174
118 Ga0070665_100045272 3300005548 Bacteria 4419
119 Ga0068855_100004391 3300005563 Bacteria 17233
120 Ga0068855_100011078 3300005563 Bacteria 10882
121 Ga0068855_100011554 3300005563 Bacteria 10665
122 Ga0068855_100011962 3300005563 Bacteria 10491
123 Ga0068855_100016023 3300005563 Bacteria 9017
124 Ga0068855_100044858 3300005563 Bacteria 5230
125 Ga0068855_100071361 3300005563 Bacteria 4039
126 Ga0068855_100179165 3300005563 Bacteria 2397
127 Ga0070664_100238644 3300005564 Bacteria 1631
128 Ga0068857_100000719 3300005577 Bacteria 24689
129 Ga0068857_100033696 3300005577 Bacteria 4530
130 Ga0068857_100058932 3300005577 Bacteria 3410
131 Ga0068857_100093567 3300005577 Bacteria 2692
132 Ga0068857_100146199 3300005577 Unclassified 2139
133 Ga0068854_100038337 3300005578 Bacteria 3370
134 Ga0068854_100140170 3300005578 Bacteria 1855
135 Ga0068854_100148544 3300005578 Bacteria 1805
136 Ga0068854_100217071 3300005578 Bacteria 1511
137 Ga0068856_100014460 3300005614 Bacteria 7624
138 Ga0068856_100027008 3300005614 Bacteria 5600
139 Ga0068856_100042972 3300005614 Bacteria 4446
140 Ga0068856_100196329 3300005614 Bacteria 2032
141 Ga0068856_100209555 3300005614 Bacteria 1964
142 Ga0068856_100284871 3300005614 Bacteria 1669
143 Ga0068852_100002172 3300005616 Bacteria 13442
144 Ga0068852_100004512 3300005616 Bacteria 9846
145 Ga0068852_100010145 3300005616 Bacteria 7017
146 Ga0068852_100056467 3300005616 Bacteria 3393
147 Ga0068852_100181219 3300005616 Bacteria 1981
148 Ga0068859_100000130 3300005617 Bacteria 71018
149 Ga0068859_100022120 3300005617 Bacteria 6375
150 Ga0068859_100035610 3300005617 Bacteria 4994
151 Ga0068859_100053438 3300005617 Bacteria 4063
152 Ga0068859_100080694 3300005617 Bacteria 3294
153 Ga0068859_100377952 3300005617 Bacteria 1512
154 Ga0068864_100004066 3300005618 Bacteria 12022
155 Ga0068864_100012055 3300005618 Bacteria 7140
156 Ga0068864_100081442 3300005618 Bacteria 2838
157 Ga0068864_100163978 3300005618 Bacteria 2022
158 Ga0068864_100187896 3300005618 Bacteria 1892
159 Ga0068864_100248800 3300005618 Bacteria 1649
160 Ga0068866_10035643 3300005718 Bacteria 2431
161 Ga0068861_100039535 3300005719 Bacteria 3521
162 Ga0068861_100230903 3300005719 Unclassified 1569
163 Ga0068851_10001272 3300005834 Bacteria 10997
164 Ga0068870_10001526 3300005840 Bacteria 9398
165 Ga0068870_10009403 3300005840 Bacteria 4444
166 Ga0068863_100002443 3300005841 Bacteria 18455
167 Ga0068863_100033987 3300005841 Bacteria 4857
168 Ga0068858_100043889 3300005842 Bacteria 4145
169 Ga0068858_100084912 3300005842 Bacteria 2945
170 Ga0068860_100000241 3300005843 Bacteria 83429
171 Ga0068860_100001682 3300005843 Bacteria 23632
172 Ga0068860_100003389 3300005843 Bacteria 16396
173 Ga0068860_100006618 3300005843 Bacteria 11635
174 Ga0068860_100018807 3300005843 Bacteria 6712
175 Ga0068860_100036214 3300005843 Bacteria 4730
176 Ga0068860_100039626 3300005843 Bacteria 4506
177 Ga0068860_100120239 3300005843 Bacteria 2515
178 Ga0068860_100167036 3300005843 Bacteria 2124
179 Ga0068862_100019788 3300005844 Bacteria 5622
180 Ga0068862_100052004 3300005844 Bacteria 3504
181 Ga0068862_100089205 3300005844 Bacteria 2683
182 Ga0081540_1015256 3300005983 Bacteria 4871
183 Ga0097621_100000027 3300006237 Bacteria 71873
184 Ga0097621_100008505 3300006237 Bacteria 7390
185 Ga0097621_100095018 3300006237 Bacteria 2500
186 Ga0097621_100144339 3300006237 Bacteria 2036
187 Ga0068871_100000338 3300006358 Bacteria 32447
188 Ga0068871_100010999 3300006358 Bacteria 6629
189 Ga0068871_100077667 3300006358 Bacteria 2744
190 Ga0075428_100007732 3300006844 Bacteria 11913
191 Ga0075428_100046413 3300006844 Bacteria 4772
192 Ga0075430_100000836 3300006846 Bacteria 24090
193 Ga0075431_100000860 3300006847 Bacteria 26641
194 Ga0075431_100034296 3300006847 Bacteria 5229
195 Ga0075429_100001604 3300006880 Bacteria 18651
196 Ga0068865_100113023 3300006881 Bacteria 2007
197 Ga0097620_100000130 3300006931 Bacteria 71018
198 Ga0097620_100022120 3300006931 Bacteria 6375
199 Ga0097620_100035610 3300006931 Bacteria 4994
200 Ga0097620_100053441 3300006931 Bacteria 4063
201 Ga0097620_100080693 3300006931 Bacteria 3294
202 Ga0097620_100377983 3300006931 Bacteria 1512
203 Ga0099826_10007777 3300006948 Bacteria 7933
204 Ga0105244_10000063 3300009036 Bacteria 122746
205 Ga0105244_10000261 3300009036 Bacteria 53251
206 Ga0105240_10000205 3300009093 Bacteria 120767
207 Ga0105240_10001268 3300009093 Bacteria 43714
208 Ga0105240_10008514 3300009093 Bacteria 14663
209 Ga0105240_10010263 3300009093 Bacteria 13184
210 Ga0105240_10015424 3300009093 Bacteria 10388
211 Ga0105240_10017211 3300009093 Bacteria 9751
212 Ga0105240_10019561 3300009093 Bacteria 9044
213 Ga0105240_10019796 3300009093 Bacteria 8989
214 Ga0105240_10052481 3300009093 Bacteria 5125
215 Ga0105240_10056043 3300009093 Bacteria 4933
216 Ga0105240_10102910 3300009093 Bacteria 3470
217 Ga0105240_10145538 3300009093 Bacteria 2828
218 Ga0105240_10181706 3300009093 Bacteria 2481
219 Ga0105240_10305433 3300009093 Unclassified 1819
220 Ga0111539_10014218 3300009094 Bacteria 9939
221 Ga0111539_10048431 3300009094 Bacteria 5074
222 Ga0111539_10183079 3300009094 Bacteria 2447
223 Ga0105245_10120415 3300009098 Bacteria 2451
224 Ga0105247_10006925 3300009101 Bacteria 6981
225 Ga0105247_10090314 3300009101 Bacteria 1943
226 Ga0114129_10006547 3300009147 Bacteria 16528
227 Ga0114129_10017693 3300009147 Bacteria 10147
228 Ga0114129_10139020 3300009147 Bacteria 3331
229 Ga0105243_10000564 3300009148 Bacteria 37436
230 Ga0105241_10000105 3300009174 Bacteria 60020
231 Ga0105241_10041934 3300009174 Bacteria 3460
232 Ga0105241_10092089 3300009174 Bacteria 2393
233 Ga0105241_10097353 3300009174 Bacteria 2332
234 Ga0105242_10024370 3300009176 Bacteria 4778
235 Ga0105242_10061535 3300009176 Bacteria 3088
236 Ga0105242_10144251 3300009176 Unclassified 2069
237 Ga0105242_10291643 3300009176 Unclassified 1486
238 Ga0105248_10054545 3300009177 Bacteria 4483
239 Ga0105248_10085742 3300009177 Bacteria 3544
240 Ga0105237_10005965 3300009545 Bacteria 13649
241 Ga0105237_10010855 3300009545 Bacteria 9665
242 Ga0105237_10013031 3300009545 Bacteria 8730
243 Ga0105237_10016201 3300009545 Bacteria 7752
244 Ga0105237_10019274 3300009545 Bacteria 7048
245 Ga0105237_10044194 3300009545 Bacteria 4486
246 Ga0105237_10048637 3300009545 Bacteria 4262
247 Ga0105238_10005460 3300009551 Bacteria 12561
248 Ga0105238_10027147 3300009551 Bacteria 5835
249 Ga0105249_10013227 3300009553 Bacteria 7283
250 Ga0105249_10032721 3300009553 Bacteria 4705
251 Ga0105249_10033891 3300009553 Bacteria 4625
252 Ga0105249_10047478 3300009553 Bacteria 3913
253 Ga0105249_10099402 3300009553 Bacteria 2734
254 Ga0105249_10250219 3300009553 Bacteria 1757
255 Ga0105249_10276048 3300009553 Bacteria 1676
256 Ga0105249_10414786 3300009553 Bacteria 1379
257 Ga0105239_10000015 3300010375 Bacteria 319892
258 Ga0105239_10000169 3300010375 Bacteria 93659
259 Ga0105239_10004544 3300010375 Bacteria 16539
260 Ga0105239_10005225 3300010375 Bacteria 15279
261 Ga0105239_10012852 3300010375 Bacteria 9314
262 Ga0105239_10036577 3300010375 Bacteria 5390
263 Ga0105239_10057993 3300010375 Bacteria 4247
264 Ga0105239_10443450 3300010375 Bacteria 1472
265 Ga0105246_10051112 3300011119 Bacteria 2837
266 Ga0157373_10008001 3300013100 Bacteria 7861
267 Ga0157373_10017187 3300013100 Bacteria 5267
268 Ga0157373_10027272 3300013100 Bacteria 4121
269 Ga0157373_10028771 3300013100 Bacteria 4007
270 Ga0157371_10001203 3300013102 Bacteria 27690
271 Ga0157371_10001756 3300013102 Bacteria 21976
272 Ga0157371_10005877 3300013102 Bacteria 10253
273 Ga0157371_10011977 3300013102 Bacteria 6650
274 Ga0157371_10013531 3300013102 Bacteria 6193
275 Ga0157371_10013976 3300013102 Bacteria 6078
276 Ga0157371_10041880 3300013102 Bacteria 3267
277 Ga0157371_10053664 3300013102 Bacteria 2862
278 Ga0157371_10072114 3300013102 Bacteria 2445
279 Ga0157371_10108147 3300013102 Bacteria 1973
280 Ga0157370_10000703 3300013104 Bacteria 41837
281 Ga0157370_10000712 3300013104 Bacteria 41700
282 Ga0157370_10001268 3300013104 Bacteria 31549
283 Ga0157370_10001336 3300013104 Bacteria 30640
284 Ga0157370_10004625 3300013104 Bacteria 15740
285 Ga0157370_10006253 3300013104 Bacteria 13183
286 Ga0157370_10038169 3300013104 Bacteria 4647
287 Ga0157370_10059792 3300013104 Bacteria 3620
288 Ga0157370_10068257 3300013104 Bacteria 3360
289 Ga0157370_10126898 3300013104 Bacteria 2381
290 Ga0157370_10296340 3300013104 Bacteria 1493
291 Ga0157369_10000224 3300013105 Bacteria 78178
292 Ga0157369_10001138 3300013105 Bacteria 33208
293 Ga0157369_10031531 3300013105 Bacteria 5835
294 Ga0157369_10034972 3300013105 Bacteria 5510
295 Ga0157369_10044874 3300013105 Bacteria 4809
296 Ga0157369_10051082 3300013105 Bacteria 4475
297 Ga0157369_10051098 3300013105 Bacteria 4474
298 Ga0157369_10053731 3300013105 Bacteria 4352
299 Ga0157369_10105452 3300013105 Bacteria 3001
300 Ga0157369_10119569 3300013105 Bacteria 2796
301 Ga0157374_10000001 3300013296 Bacteria 1077351
302 Ga0157374_10010176 3300013296 Bacteria 8085
303 Ga0157374_10073566 3300013296 Bacteria 3226
304 Ga0157374_10079610 3300013296 Bacteria 3106
305 Ga0157378_10009809 3300013297 Bacteria 8348
306 Ga0157378_10020236 3300013297 Bacteria 5853
307 Ga0157378_10021231 3300013297 Bacteria 5711
308 Ga0157378_10042364 3300013297 Bacteria 4041
309 Ga0157378_10069761 3300013297 Bacteria 3154
310 Ga0163162_10000437 3300013306 Bacteria 38437
311 Ga0163162_10000445 3300013306 Bacteria 38232
312 Ga0163162_10000699 3300013306 Bacteria 30970
313 Ga0163162_10011686 3300013306 Bacteria 8562
314 Ga0163162_10016883 3300013306 Bacteria 7137
315 Ga0163162_10073353 3300013306 Bacteria 3478
316 Ga0163162_10090642 3300013306 Bacteria 3139
317 Ga0163162_10152854 3300013306 Bacteria 2426
318 Ga0163162_10273427 3300013306 Bacteria 1821
319 Ga0157372_10001013 3300013307 Bacteria 30741
320 Ga0157372_10015310 3300013307 Bacteria 8217
321 Ga0157372_10016165 3300013307 Bacteria 8007
322 Ga0157372_10047470 3300013307 Bacteria 4772
323 Ga0157372_10110049 3300013307 Bacteria 3155
324 Ga0157372_10162152 3300013307 Bacteria 2584
325 Ga0157372_10192326 3300013307 Bacteria 2363
326 Ga0157372_10220682 3300013307 Bacteria 2197
327 Ga0157372_10225364 3300013307 Bacteria 2173
328 Ga0157372_10345657 3300013307 Bacteria 1733
329 Ga0157372_10402538 3300013307 Bacteria 1595
330 Ga0157372_10526126 3300013307 Bacteria 1378
331 Ga0157375_10020011 3300013308 Bacteria 6104
332 Ga0163163_10000193 3300014325 Bacteria 62699
333 Ga0163163_10133191 3300014325 Bacteria 2525
334 Ga0157380_10008991 3300014326 Bacteria 7137
335 Ga0157380_10017582 3300014326 Bacteria 5291
336 Ga0157380_10020669 3300014326 Bacteria 4923
337 Ga0157380_10034213 3300014326 Bacteria 3918
338 Ga0157380_10137890 3300014326 Bacteria 2091
339 Ga0157380_10274458 3300014326 Bacteria 1539
340 Ga0157377_10063586 3300014745 Bacteria 2114
341 Ga0157377_10111515 3300014745 Bacteria 1645
342 Ga0157379_10021712 3300014968 Bacteria 5685
343 Ga0157379_10022058 3300014968 Bacteria 5643
344 Ga0157379_10061632 3300014968 Bacteria 3354
345 Ga0157379_10105014 3300014968 Bacteria 2535
346 Ga0157379_10351996 3300014968 Bacteria 1348
347 Ga0157376_10000808 3300014969 Bacteria 20515
348 Ga0157376_10013444 3300014969 Bacteria 6108
349 Ga0157376_10034855 3300014969 Bacteria 4066
350 Ga0157376_10091171 3300014969 Bacteria 2639
351 Ga0157376_10151472 3300014969 Bacteria 2092
352 Ga0157376_10450428 3300014969 Bacteria 1255
353 Ga0157376_10450430 3300014969 Bacteria 1255
354 Ga0182006_1001549 3300015261 Bacteria 13729
355 Ga0182005_1033393 3300015265 Bacteria 1400
356 Ga0163161_10000012 3300017792 Bacteria 264639
357 Ga0163161_10027148 3300017792 Bacteria 4060
358 Ga0163161_10034726 3300017792 Bacteria 3608
359 Ga0209233_1000685 3300025261 Bacteria 16074
360 Ga0207666_1002853 3300025271 Bacteria 2102
361 Ga0209675_1000033 3300025291 Bacteria 271576
362 Ga0207426_1000132 3300025302 Bacteria 209623
363 Ga0207655_1000008 3300025728 Bacteria 734289
364 Ga0207655_1002095 3300025728 Bacteria 16723
365 Ga0207682_10004723 3300025893 Bacteria 5651
366 Ga0207642_10021042 3300025899 Bacteria 2560
367 Ga0207642_10046154 3300025899 Bacteria 1939
368 Ga0207688_10073525 3300025901 Bacteria 1943
369 Ga0207680_10000135 3300025903 Bacteria 34875
370 Ga0207680_10031567 3300025903 Bacteria 3001
371 Ga0207680_10049520 3300025903 Bacteria 2501
372 Ga0207680_10186009 3300025903 Bacteria 1407
373 Ga0207647_10000206 3300025904 Bacteria 48374
374 Ga0207647_10014917 3300025904 Bacteria 5340
375 Ga0207647_10040181 3300025904 Bacteria 2947
376 Ga0207647_10125898 3300025904 Bacteria 1508
377 Ga0207645_10000306 3300025907 Bacteria 41222
378 Ga0207645_10000776 3300025907 Bacteria 26656
379 Ga0207645_10025857 3300025907 Bacteria 3796
380 Ga0207645_10126601 3300025907 Bacteria 1660
381 Ga0207643_10038760 3300025908 Bacteria 2678
382 Ga0207705_10006335 3300025909 Bacteria 8783
383 Ga0207705_10041667 3300025909 Bacteria 3294
384 Ga0207705_10165136 3300025909 Bacteria 1665
385 Ga0207654_10001533 3300025911 Bacteria 12162
386 Ga0207654_10103154 3300025911 Bacteria 1761
387 Ga0207707_10000205 3300025912 Bacteria 62610
388 Ga0207707_10026673 3300025912 Bacteria 5050
389 Ga0207707_10100014 3300025912 Bacteria 2534
390 Ga0207707_10122218 3300025912 Bacteria 2277
391 Ga0207695_10000232 3300025913 Bacteria 147559
392 Ga0207695_10000962 3300025913 Bacteria 51331
393 Ga0207695_10001367 3300025913 Bacteria 41365
394 Ga0207695_10002931 3300025913 Bacteria 24635
395 Ga0207695_10003840 3300025913 Bacteria 20797
396 Ga0207695_10018994 3300025913 Bacteria 7927
397 Ga0207695_10022165 3300025913 Bacteria 7223
398 Ga0207695_10065272 3300025913 Bacteria 3743
399 Ga0207695_10101320 3300025913 Bacteria 2874
400 Ga0207695_10324150 3300025913 Bacteria 1430
401 Ga0207671_10003343 3300025914 Bacteria 16099
402 Ga0207671_10005449 3300025914 Bacteria 11714
403 Ga0207671_10007213 3300025914 Bacteria 9683
404 Ga0207671_10012002 3300025914 Bacteria 7001
405 Ga0207671_10015938 3300025914 Bacteria 5860
406 Ga0207660_10009183 3300025917 Bacteria 6402
407 Ga0207660_10169115 3300025917 Bacteria 1691
408 Ga0207662_10051559 3300025918 Bacteria 2448
409 Ga0207657_10001302 3300025919 Bacteria 26488
410 Ga0207657_10038219 3300025919 Bacteria 4276
411 Ga0207657_10041644 3300025919 Bacteria 4059
412 Ga0207657_10059567 3300025919 Bacteria 3279
413 Ga0207657_10114358 3300025919 Bacteria 2225
414 Ga0207657_10135652 3300025919 Bacteria 2014
415 Ga0207649_10149210 3300025920 Bacteria 1608
416 Ga0207652_10000064 3300025921 Bacteria 111997
417 Ga0207652_10000186 3300025921 Bacteria 65493
418 Ga0207652_10000967 3300025921 Bacteria 26823
419 Ga0207652_10005809 3300025921 Bacteria 10009
420 Ga0207652_10019337 3300025921 Bacteria 5601
421 Ga0207652_10095599 3300025921 Bacteria 2617
422 Ga0207681_10038689 3300025923 Bacteria 3162
423 Ga0207681_10079998 3300025923 Bacteria 2304
424 Ga0207694_10013495 3300025924 Bacteria 6153
425 Ga0207694_10265998 3300025924 Bacteria 1406
426 Ga0207650_10027725 3300025925 Bacteria 4056
427 Ga0207650_10089938 3300025925 Bacteria 2344
428 Ga0207650_10100631 3300025925 Bacteria 2224
429 Ga0207650_10105170 3300025925 Bacteria 2178
430 Ga0207650_10106315 3300025925 Bacteria 2167
431 Ga0207650_10190430 3300025925 Bacteria 1639
432 Ga0207659_10050044 3300025926 Bacteria 2966
433 Ga0207659_10128071 3300025926 Bacteria 1955
434 Ga0207659_10243401 3300025926 Bacteria 1456
435 Ga0207644_10004809 3300025931 Bacteria 8797
436 Ga0207644_10023199 3300025931 Bacteria 4247
437 Ga0207644_10072359 3300025931 Bacteria 2525
438 Ga0207690_10004179 3300025932 Bacteria 8527
439 Ga0207690_10075384 3300025932 Bacteria 2339
440 Ga0207706_10005978 3300025933 Bacteria 11316
441 Ga0207706_10086259 3300025933 Bacteria 2760
442 Ga0207706_10090397 3300025933 Bacteria 2692
443 Ga0207706_10111115 3300025933 Bacteria 2411
444 Ga0207686_10004001 3300025934 Bacteria 7911
445 Ga0207709_10000462 3300025935 Bacteria 37449
446 Ga0207670_10188820 3300025936 Bacteria 1558
447 Ga0207669_10129805 3300025937 Bacteria 1729
448 Ga0207669_10143778 3300025937 Bacteria 1660
449 Ga0207704_10086365 3300025938 Bacteria 2046
450 Ga0207691_10002208 3300025940 Bacteria 19051
451 Ga0207691_10007147 3300025940 Bacteria 10773
452 Ga0207691_10009060 3300025940 Bacteria 9550
453 Ga0207691_10174223 3300025940 Bacteria 1883
454 Ga0207691_10180542 3300025940 Bacteria 1844
455 Ga0207711_10084963 3300025941 Bacteria 2772
456 Ga0207689_10001865 3300025942 Bacteria 19957
457 Ga0207689_10002862 3300025942 Bacteria 15908
458 Ga0207689_10006619 3300025942 Bacteria 10219
459 Ga0207689_10030127 3300025942 Bacteria 4522
460 Ga0207689_10050628 3300025942 Bacteria 3424
461 Ga0207661_10032567 3300025944 Bacteria 4039
462 Ga0207661_10062710 3300025944 Bacteria 3008
463 Ga0207661_10081685 3300025944 Bacteria 2670
464 Ga0207661_10214131 3300025944 Bacteria 1699
465 Ga0207667_10000111 3300025949 Bacteria 131758
466 Ga0207667_10000549 3300025949 Bacteria 49364
467 Ga0207667_10001284 3300025949 Bacteria 31480
468 Ga0207667_10004600 3300025949 Bacteria 16926
469 Ga0207667_10021040 3300025949 Bacteria 7235
470 Ga0207667_10021551 3300025949 Bacteria 7139
471 Ga0207667_10026519 3300025949 Bacteria 6328
472 Ga0207667_10079673 3300025949 Bacteria 3394
473 Ga0207651_10000296 3300025960 Bacteria 21316
474 Ga0207651_10015067 3300025960 Bacteria 4482
475 Ga0207651_10022198 3300025960 Bacteria 3875
476 Ga0207651_10057536 3300025960 Bacteria 2682
477 Ga0207651_10195781 3300025960 Bacteria 1616
478 Ga0207712_10015650 3300025961 Bacteria 4897
479 Ga0207712_10024861 3300025961 Bacteria 3973
480 Ga0207712_10025025 3300025961 Bacteria 3962
481 Ga0207712_10046020 3300025961 Bacteria 3023
482 Ga0207712_10165644 3300025961 Bacteria 1723
483 Ga0207668_10000272 3300025972 Bacteria 34458
484 Ga0207668_10037291 3300025972 Bacteria 3252
485 Ga0207640_10050642 3300025981 Bacteria 2696
486 Ga0207640_10207129 3300025981 Bacteria 1491
487 Ga0207658_10003314 3300025986 Bacteria 11430
488 Ga0207658_10009745 3300025986 Bacteria 6523
489 Ga0207658_10010955 3300025986 Bacteria 6174
490 Ga0207658_10040515 3300025986 Bacteria 3368
491 Ga0207658_10124603 3300025986 Bacteria 2060
492 Ga0207677_10188252 3300026023 Bacteria 1630
493 Ga0207703_10005679 3300026035 Bacteria 10015
494 Ga0207703_10058478 3300026035 Bacteria 3147
495 Ga0207703_10087464 3300026035 Bacteria 2613
496 Ga0207639_10005538 3300026041 Bacteria 8537
497 Ga0207639_10023583 3300026041 Bacteria 4443
498 Ga0207639_10038237 3300026041 Bacteria 3569
499 Ga0207639_10059996 3300026041 Bacteria 2933
500 Ga0207639_10080302 3300026041 Bacteria 2579
501 Ga0207639_10180841 3300026041 Bacteria 1794
502 Ga0207639_10194961 3300026041 Unclassified 1733
503 Ga0207678_10131516 3300026067 Unclassified 2135
504 Ga0207708_10081894 3300026075 Bacteria 2481
505 Ga0207708_10137759 3300026075 Bacteria 1912
506 Ga0207702_10019126 3300026078 Bacteria 5668
507 Ga0207702_10061481 3300026078 Bacteria 3204
508 Ga0207702_10066409 3300026078 Bacteria 3092
509 Ga0207702_10084699 3300026078 Bacteria 2761
510 Ga0207702_10158519 3300026078 Bacteria 2065
511 Ga0207702_10220671 3300026078 Bacteria 1767
512 Ga0207702_10419214 3300026078 Bacteria 1294
513 Ga0207641_10000158 3300026088 Bacteria 96378
514 Ga0207641_10001128 3300026088 Bacteria 26838
515 Ga0207641_10003749 3300026088 Bacteria 13360
516 Ga0207641_10092034 3300026088 Bacteria 2655
517 Ga0207641_10347976 3300026088 Bacteria 1412
518 Ga0207648_10000653 3300026089 Bacteria 38843
519 Ga0207648_10000786 3300026089 Bacteria 35737
520 Ga0207648_10003171 3300026089 Bacteria 17337
521 Ga0207648_10011997 3300026089 Bacteria 8132
522 Ga0207648_10081603 3300026089 Bacteria 2821
523 Ga0207648_10133982 3300026089 Bacteria 2181
524 Ga0207676_10001574 3300026095 Bacteria 16766
525 Ga0207676_10072025 3300026095 Bacteria 2776
526 Ga0207676_10109171 3300026095 Bacteria 2311
527 Ga0207674_10001723 3300026116 Bacteria 27962
528 Ga0207674_10019660 3300026116 Bacteria 7313
529 Ga0207674_10028397 3300026116 Bacteria 5906
530 Ga0207674_10122746 3300026116 Bacteria 2564
531 Ga0207675_100004088 3300026118 Bacteria 14122
532 Ga0207675_100074599 3300026118 Bacteria 3174
533 Ga0207675_100090583 3300026118 Bacteria 2876
534 Ga0207675_100191537 3300026118 Unclassified 1961
535 Ga0207675_100236489 3300026118 Unclassified 1764
536 Ga0207683_10004426 3300026121 Bacteria 12145
537 Ga0207683_10132651 3300026121 Bacteria 2241
538 Ga0207683_10324489 3300026121 Bacteria 1411
539 Ga0207698_10002758 3300026142 Bacteria 10480
540 Ga0207698_10026494 3300026142 Bacteria 4102
541 Ga0207698_10168610 3300026142 Bacteria 1925
542 Ga0207698_10215309 3300026142 Unclassified 1731
543 Ga0209281_1000244 3300027111 Bacteria 109979
544 Ga0209489_115968 3300027361 Bacteria 4280
545 Ga0268266_10000102 3300028379 Bacteria 179754
546 Ga0268266_10002971 3300028379 Bacteria 17479
547 Ga0268265_10053903 3300028380 Bacteria 3048
548 Ga0268264_10000011 3300028381 Bacteria 580884
549 Ga0268264_10001129 3300028381 Bacteria 26168
550 Ga0268264_10001678 3300028381 Bacteria 20388
551 Ga0268264_10006613 3300028381 Bacteria 9749
552 Ga0268264_10025484 3300028381 Bacteria 4832
553 Ga0268264_10032292 3300028381 Bacteria 4295
554 Ga0268264_10089204 3300028381 Bacteria 2655
555 Ga0307517_10007333 3300028786 Bacteria 16104
556 Ga0307517_10141613 3300028786 Bacteria 1686
557 Ga0307515_10000001 3300028794 Bacteria 4259510
558 Ga0307515_10000074 3300028794 Bacteria 229874
559 Ga0265338_10065504 3300028800 Bacteria 3151
560 Ga0307511_10000673 3300030521 Bacteria 36415
561 Ga0307512_10166470 3300030522 Bacteria 1276
562 Ga0265340_10000049 3300031247 Bacteria 54735
563 Ga0265339_10036450 3300031249 Bacteria 2753
564 Ga0265331_10045401 3300031250 Bacteria 2121
565 Ga0265327_10000152 3300031251 Bacteria 149065
566 Ga0265327_10000440 3300031251 Bacteria 75453
567 Ga0265327_10033388 3300031251 Bacteria 2868
568 Ga0307513_10091590 3300031456 Bacteria 3098
569 Ga0307509_10037992 3300031507 Bacteria 5257
570 Ga0307509_10165614 3300031507 Bacteria 2100
571 Ga0307509_10186612 3300031507 Bacteria 1931
572 Ga0307408_100217521 3300031548 Bacteria 1557
573 Ga0307508_10001210 3300031616 Bacteria 29576
574 Ga0316576_10018872 3300031727 Bacteria 4717
575 Ga0316576_10054425 3300031727 Bacteria 2919
576 Ga0307516_10002603 3300031730 Bacteria 23956
577 Ga0307516_10119609 3300031730 Bacteria 2427
578 Ga0307405_10099571 3300031731 Bacteria 1946
579 Ga0307413_10002944 3300031824 Bacteria 7041
580 Ga0307413_10192730 3300031824 Bacteria 1465
581 Ga0307413_10279812 3300031824 Bacteria 1254
582 Ga0307410_10000067 3300031852 Bacteria 37092
583 Ga0307410_10003887 3300031852 Bacteria 7599
584 Ga0307406_10000035 3300031901 Bacteria 82953
585 Ga0307416_100000639 3300032002 Bacteria 18075
586 Ga0307416_100018966 3300032002 Bacteria 4863
587 Ga0307414_10000063 3300032004 Bacteria 107710
588 Ga0307414_10095338 3300032004 Bacteria 2223
589 Ga0307414_10199913 3300032004 Bacteria 1625
590 Ga0307411_10000001 3300032005 Bacteria 931810
591 Ga0307510_10133750 3300033180 Bacteria 2144
592 Ga0373937_0101686 3300036401 Bacteria 2668
593 Ga0373937_0176297 3300036401 Bacteria 2007
594 Ga0316584_0046497 3300036712 Bacteria 3242
595 Ga0395899_0008094 3300037312 Bacteria 8096
596 Ga0395899_0024335 3300037312 Bacteria 4578
597 Ga0395899_0053919 3300037312 Bacteria 2976
598 Ga0395899_0076878 3300037312 Bacteria 2436
599 Ga0395899_0089406 3300037312 Bacteria 2234
600 Ga0395899_0109418 3300037312 Bacteria 1988
601 Ga0395900_0004748 3300037418 Bacteria 14328
602 Ga0395900_0004811 3300037418 Bacteria 14227
603 Ga0395900_0052346 3300037418 Bacteria 4202
604 Ga0395900_0075560 3300037418 Bacteria 3464
605 Ga0395900_0144408 3300037418 Bacteria 2434
606 Ga0395900_0211801 3300037418 Bacteria 1956
607 Ga0395898_0002029 3300037466 Bacteria 25368
608 Ga0395898_0019287 3300037466 Bacteria 6943
609 Ga0395898_0067190 3300037466 Bacteria 3471
610 Ga0395898_0091877 3300037466 Bacteria 2919
611 Ga0395898_0124969 3300037466 Bacteria 2464
612 Ga0395905_0019861 3300037471 Bacteria 6368
613 Ga0395905_0236900 3300037471 Bacteria 1706
614 Ga0395901_0016383 3300038443 Bacteria 7547
615 Ga0395901_0129613 3300038443 Bacteria 2650
616 Ga0395901_0220309 3300038443 Bacteria 1983
617 Ga0395901_0232373 3300038443 Bacteria 1925
618 Ga0400489_48763 3300039093 Bacteria 9194
619 Ga0436365_1499396 3300039437 Bacteria 2179
620 Ga0436365_1861098 3300039437 Bacteria 2409
621 Ga0436365_1879596 3300039437 Bacteria 24111
622 Ga0439439_0003744 3300041406 Bacteria 3376
623 Ga0439447_004758 3300041407 Bacteria 4624
624 Ga0439466_0002720 3300041411 Bacteria 6928
625 Ga0451798_0554964 3300041458 Bacteria 2314
626 Ga0439441_003884 3300042001 Bacteria 2232
627 Ga0439449_0011541 3300042007 Bacteria 3323
628 Ga0439449_0011855 3300042007 Bacteria 3276
629 Ga0439449_0033163 3300042007 Bacteria 1925
630 Ga0439457_000620 3300042014 Bacteria 10490
631 Ga0450923_007092 3300042125 Bacteria 1882
632 Ga0451577_0000467 3300042876 Bacteria 70229
633 Ga0451577_0013457 3300042876 Bacteria 7655
634 Ga0451577_0022760 3300042876 Bacteria 5721
635 Ga0466969_0000778 3300044656 Bacteria 17395
636 Ga0466969_0020141 3300044656 Bacteria 3458
637 Ga0466972_0000004 3300044658 Bacteria 314413
638 Ga0466972_0000095 3300044658 Bacteria 77981
639 Ga0466972_0000579 3300044658 Bacteria 17790
640 Ga0453683_0000005 3300044673 Bacteria 741657
641 Ga0453683_0000557 3300044673 Bacteria 41344
642 Ga0453683_0094524 3300044673 Bacteria 1875
643 Ga0453683_0109068 3300044673 Bacteria 1740
644 Ga0453683_0142553 3300044673 Bacteria 1513
645 Ga0453684_0000008 3300044712 Bacteria 1200052
646 Ga0453684_0000219 3300044712 Bacteria 250149
647 Ga0453684_0000628 3300044712 Bacteria 128416
648 Ga0453684_0005576 3300044712 Bacteria 24800
649 Ga0453684_0005691 3300044712 Bacteria 24420
650 Ga0453684_0018325 3300044712 Bacteria 10759
651 Ga0453684_0018954 3300044712 Bacteria 10516
652 Ga0453684_0021771 3300044712 Bacteria 9553
653 Ga0453684_0334649 3300044712 Unclassified 1711
654 Ga0453684_0382805 3300044712 Bacteria 1579
655 Ga0466970_0000518 3300044765 Bacteria 18999
656 Ga0466970_0014415 3300044765 Bacteria 4059
657 Ga0466957_0015823 3300044842 Bacteria 4407
658 Ga0466959_0000125 3300045049 Bacteria 49909
659 Ga0466959_0032625 3300045049 Bacteria 3854
660 Ga0451576_0000010 3300045051 Bacteria 679007
661 Ga0451576_0000244 3300045051 Bacteria 133298
662 Ga0451576_0000568 3300045051 Bacteria 78861
663 Ga0451576_0002036 3300045051 Bacteria 31915
664 Ga0451576_0008258 3300045051 Bacteria 12241
665 Ga0451576_0035003 3300045051 Bacteria 5331
666 Ga0451576_0044412 3300045051 Bacteria 4684
667 Ga0495627_000003 3300046453 Bacteria 704557
668 Ga0495627_004497 3300046453 Bacteria 5823
669 Ga0495638_0053431 3300046460 Bacteria 2514
670 Ga0495638_0058491 3300046460 Bacteria 2388
671 Ga0495650_0033358 3300046471 Bacteria 2292
672 Ga0495582_0010257 3300046473 Bacteria 5156
673 Ga0495596_0000277 3300046500 Bacteria 34046
674 Ga0495606_0003492 3300046507 Bacteria 16646
675 Ga0495606_0014393 3300046507 Bacteria 6180
676 Ga0495610_0000001 3300046512 Bacteria 1620061
677 Ga0495632_0005413 3300046519 Bacteria 8444
678 Ga0495648_0002020 3300046524 Bacteria 19235
679 Ga0495663_0003000 3300046525 Bacteria 4960
680 Ga0495654_0000001 3300046530 Bacteria 1513197
681 Ga0495633_0000008 3300046558 Bacteria 301830
682 Ga0495633_0004847 3300046558 Bacteria 8422
683 Ga0495667_0159750 3300046559 Bacteria 1450
684 Ga0495668_0013929 3300046616 Bacteria 4727
685 Ga0495611_0000385 3300046648 Bacteria 28165
686 Ga0495625_0001823 3300046660 Bacteria 24391
687 Ga0495674_0025349 3300047319 Bacteria 5439
688 Ga0495672_0116695 3300047320 Bacteria 1425
689 Ga0495687_000001 3300047443 Bacteria 1215582
690 Ga0495686_0000004 3300047472 Bacteria 869019
691 Ga0495686_0000118 3300047472 Bacteria 165897
692 Ga0495686_0000772 3300047472 Bacteria 42035
693 Ga0495686_0003005 3300047472 Bacteria 14986
694 Ga0495686_0022322 3300047472 Bacteria 4189
695 Ga0496109_0015035 3300048912 Bacteria 6736
696 Ga0496116_0000032 3300048919 Bacteria 419997
697 Ga0496116_0000053 3300048919 Bacteria 291837
698 Ga0496117_0000089 3300048920 Bacteria 210551
699 Ga0496118_0001078 3300048921 Bacteria 42588
700 Ga0496118_0138928 3300048921 Bacteria 1544
701 Ga0496119_0000038 3300048922 Bacteria 209546
702 Ga0496121_0008699 3300048924 Bacteria 11854
703 Ga0496121_0056645 3300048924 Bacteria 3254
704 Ga0496122_0000118 3300048925 Bacteria 182789
705 Ga0496122_0001213 3300048925 Bacteria 43728
706 Ga0496122_0009811 3300048925 Bacteria 9999
707 Ga0496122_0019641 3300048925 Bacteria 6160
708 Ga0496123_0002780 3300048926 Bacteria 20856
709 Ga0496124_0001056 3300048927 Bacteria 43505
710 Ga0496124_0023852 3300048927 Bacteria 5574
711 Ga0496124_0209759 3300048927 Bacteria 1475
712 Ga0496125_0000059 3300048928 Bacteria 264149
713 Ga0496125_0008819 3300048928 Bacteria 10487
714 Ga0496125_0009663 3300048928 Bacteria 9859
715 Ga0496126_0009798 3300048929 Bacteria 10145
716 Ga0496126_0023187 3300048929 Bacteria 6017
717 Ga0501033_0172930 3300049570 Bacteria 1551
718 Ga0501034_0035681 3300049571 Bacteria 5040
719 Ga0501034_0059558 3300049571 Bacteria 3835
720 Ga0501034_0167483 3300049571 Bacteria 2165
721 Ga0501034_0329152 3300049571 Bacteria 1459
722 Ga0501036_0127246 3300049572 Bacteria 2151
723 Ga0501036_0172190 3300049572 Bacteria 1824
724 Ga0501037_0099530 3300049573 Bacteria 2100
725 Ga0501038_0057852 3300049574 Bacteria 3327
726 Ga0501038_0070304 3300049574 Bacteria 2972
727 Ga0501039_0022019 3300049575 Bacteria 4891
728 Ga0501043_0015022 3300049579 Bacteria 6064
729 Ga0501043_0015230 3300049579 Bacteria 6022
730 Ga0501047_0006024 3300049581 Bacteria 11399
731 Ga0501047_0047360 3300049581 Bacteria 4154
732 Ga0501047_0048551 3300049581 Bacteria 4099
733 Ga0501047_0091860 3300049581 Bacteria 2914
734 Ga0501048_0010094 3300049582 Bacteria 7066
735 Ga0501068_0013638 3300049584 Bacteria 4628
736 Ga0501207_000601 3300049654 Bacteria 4141
737 Ga0501223_000421 3300049663 Bacteria 10268
738 Ga0501238_000316 3300049671 Bacteria 6328
739 Ga0501249_000009 3300049679 Bacteria 173938
740 Ga0501259_000442 3300049688 Bacteria 6569
741 Ga0501219_000479 3300049703 Bacteria 6266
742 Ga0501225_0007958 3300049705 Bacteria 3055
743 Ga0501234_001054 3300049707 Bacteria 4353
744 Ga0501080_0280286 3300049742 Bacteria 1516
745 Ga0501266_000039 3300049763 Bacteria 26126
746 Ga0501280_001414 3300049776 Bacteria 4462
747 Ga0501035_0192114 3300049822 Bacteria 1755
748 Ga0501044_0009540 3300049823 Bacteria 10569
749 Ga0501044_0056559 3300049823 Bacteria 4028
750 Ga0501044_0126547 3300049823 Bacteria 2552
751 Ga0501044_0290186 3300049823 Bacteria 1567
752 Ga0501284_00027 3300050005 Bacteria 76239
753 nmdc:mga0k408_63900_c1 3300050493 Bacteria 2141
754 nmdc:mga05p37_160084_c1 3300050507 Bacteria 2750
755 nmdc:mga05p37_54171_c1 3300050507 Bacteria 4935
756 nmdc:mga09592_10171_c1 3300050508 Bacteria 7657
757 nmdc:mga0qj67_146183_c1 3300050509 Bacteria 1917
758 nmdc:mga06r32_8029_c1 3300050510 Bacteria 9493
759 nmdc:mga08y16_153255_c1 3300050511 Bacteria 2395
760 Ga0500635_0005585 3300053080 Bacteria 3309
761 Ga0500646_0008363 3300053090 Bacteria 2646
762 Ga0500583_0000010 3300053092 Bacteria 160546
763 Ga0500583_0006837 3300053092 Bacteria 3961
764 Ga0500641_0000017 3300053096 Bacteria 132678
765 Ga0500641_0001009 3300053096 Bacteria 10014
766 Ga0500562_000062 3300053108 Bacteria 53042
767 Ga0500658_0000003 3300053134 Bacteria 512506
768 Ga0500559_0011905 3300053136 Bacteria 3708
769 Ga0500559_0038292 3300053136 Bacteria 2082
770 Ga0500568_0000236 3300053139 Bacteria 47278
771 Ga0500568_0018122 3300053139 Bacteria 3090
772 Ga0500573_0109930 3300053140 Bacteria 1543
773 Ga0500604_0007716 3300053151 Bacteria 2851
774 Ga0500616_0015900 3300053153 Bacteria 4294
775 Ga0500616_0082282 3300053153 Bacteria 1615
776 Ga0500622_0002122 3300053156 Bacteria 14765
777 Ga0500622_0090723 3300053156 Bacteria 1516
778 Ga0500611_000006 3300053727 Bacteria 226069
779 Ga0500645_025283 3300053730 Bacteria 1812
780 Ga0500587_007103 3300053739 Bacteria 1466
781 Ga0501084_0014972 3300054114 Bacteria 6430
782 Ga0501082_0026906 3300060353 Bacteria 4955
783 Ga0466962_0013673 3300061719 Bacteria 3907

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045051 Ga0451576_0008258 Ga0451576_0008258_10357_11421 343
2 iso_pu_bacteria 2910245624 2910246562 345
3 3300025904 Ga0207647_10125898 Ga0207647_101258981 349
4 3300026121 Ga0207683_10324489 Ga0207683_103244891 349
5 3300028800 Ga0265338_10065504 Ga0265338_100655043 349
6 3300042876 Ga0451577_0013457 Ga0451577_0013457_5774_6829 349
7 3300044712 Ga0453684_0000008 Ga0453684_0000008_226686_227741 349
8 3300001904 JGI24736J21556_1006464 JGI24736J21556_10064642 350
9 3300005366 Ga0070659_100001401 Ga0070659_1000014016 350
10 3300005577 Ga0068857_100058932 Ga0068857_1000589322 350
11 3300010375 Ga0105239_10000015 Ga0105239_10000015245 350
12 3300013100 Ga0157373_10028771 Ga0157373_100287711 350
13 3300013104 Ga0157370_10126898 Ga0157370_101268982 350
14 3300013105 Ga0157369_10119569 Ga0157369_101195691 350
15 3300013307 Ga0157372_10015310 Ga0157372_100153108 350
16 3300025261 Ga0209233_1000685 Ga0209233_100068510 350
17 3300025904 Ga0207647_10000206 Ga0207647_1000020650 350
18 3300025919 Ga0207657_10041644 Ga0207657_100416444 350
19 3300025932 Ga0207690_10004179 Ga0207690_100041795 350
20 3300025949 Ga0207667_10079673 Ga0207667_100796733 350
21 3300032004 Ga0307414_10095338 Ga0307414_100953382 350
22 3300038443 Ga0395901_0232373 Ga0395901_0232373_815_1873 350
23 3300042876 Ga0451577_0000467 Ga0451577_0000467_489_1547 350
24 3300044673 Ga0453683_0000557 Ga0453683_0000557_24396_25454 350
25 3300044712 Ga0453684_0000219 Ga0453684_0000219_226755_227813 350
26 3300044712 Ga0453684_0005691 Ga0453684_0005691_4996_6087 350
27 3300045051 Ga0451576_0000010 Ga0451576_0000010_404299_405357 350
28 3300045051 Ga0451576_0002036 Ga0451576_0002036_8707_9798 350
29 3300047472 Ga0495686_0003005 Ga0495686_0003005_11443_12501 350
30 3300053080 Ga0500635_0005585 Ga0500635_0005585_1322_2380 350
31 3300031247 Ga0265340_10000049 Ga0265340_1000004963 351
32 3300031249 Ga0265339_10036450 Ga0265339_100364503 351
33 3300042876 Ga0451577_0022760 Ga0451577_0022760_779_1843 352
34 3300044673 Ga0453683_0000005 Ga0453683_0000005_693834_694898 352
35 3300044673 Ga0453683_0094524 Ga0453683_0094524_788_1852 352
36 3300044673 Ga0453683_0109068 Ga0453683_0109068_384_1448 352
37 3300044712 Ga0453684_0000628 Ga0453684_0000628_108188_109252 352
38 3300044712 Ga0453684_0005576 Ga0453684_0005576_17425_18489 352
39 3300044712 Ga0453684_0334649 Ga0453684_0334649_176_1240 352
40 3300044712 Ga0453684_0382805 Ga0453684_0382805_93_1157 352
41 3300045051 Ga0451576_0000568 Ga0451576_0000568_71493_72557 352
42 3300045051 Ga0451576_0044412 Ga0451576_0044412_512_1576 352
43 3300039093 Ga0400489_48763 Ga0400489_48763_2818_3879 353
44 3300044712 Ga0453684_0018325 Ga0453684_0018325_2616_3689 353
45 3300044712 Ga0453684_0018954 Ga0453684_0018954_5050_6123 353
46 3300045051 Ga0451576_0000244 Ga0451576_0000244_67011_68078 353
47 3300045051 Ga0451576_0035003 Ga0451576_0035003_2556_3629 353
48 3300025920 Ga0207649_10149210 Ga0207649_101492101 356
49 3300005543 Ga0070672_100346737 Ga0070672_1003467371 357
50 3300031616 Ga0307508_10001210 Ga0307508_100012106 357
51 3300031456 Ga0307513_10091590 Ga0307513_100915901 360
52 3300031507 Ga0307509_10165614 Ga0307509_101656142 360
53 3300031507 Ga0307509_10186612 Ga0307509_101866122 360
54 3300005548 Ga0070665_100000001 Ga0070665_100000001321 363
55 3300028379 Ga0268266_10000102 Ga0268266_1000010245 363
56 iso_pu_bacteria 2818991444 2819590798 365
57 iso_pu_bacteria 2929154850 2929157832 365
58 iso_pu_bacteria 2738541278 2738728996 366
59 iso_pu_bacteria 2833640130 2833642271 366
60 3300049571 Ga0501034_0329152 Ga0501034_0329152_196_1302 367
61 3300049823 Ga0501044_0056559 Ga0501044_0056559_2180_3286 367
62 iso_pu_bacteria 2513020052 2513236367 367
63 iso_pu_bacteria 2519899754 2520879418 367
64 iso_pu_bacteria 2643221600 2644013049 367
65 iso_pu_bacteria 2643221667 2644372364 367
66 iso_pu_bacteria 2643221716 2644642623 367
67 iso_pu_bacteria 2643221725 2644684841 367
68 iso_pu_bacteria 2738541279 2738732476 367
69 iso_pu_bacteria 2738541285 2738765041 367
70 iso_pu_bacteria 2738543007 2739214056 367
71 iso_pu_bacteria 2739367857 2740001339 367
72 iso_pu_bacteria 2739367858 2740006155 367
73 iso_pu_bacteria 2802428842 2802653763 367
74 iso_pu_bacteria 2816332280 2817416286 367
75 iso_pu_bacteria 2857613821 2857614968 367
76 iso_pu_bacteria 2857618242 2857618671 367
77 iso_pu_bacteria 2881359912 2881363178 367
78 iso_pu_bacteria 2903895155 2903896880 367
79 iso_pu_bacteria 2904419702 2904422806 367
80 iso_pu_bacteria 2904555929 2904557084 367
81 iso_pu_bacteria 2919191525 2919195292 367
82 iso_pu_bacteria 2919683626 2919687634 367
83 iso_pu_bacteria 2929150217 2929153575 367
84 iso_pu_bacteria 2958458903 2958461128 367
85 iso_pu_bacteria 2977268062 2977270238 367
86 iso_pu_bacteria 8054307821 8054310071 367
87 iso_pu_bacteria 8055419101 8055421946 367
88 iso_pu_bacteria 8055592153 8055593412 367
89 iso_pu_bacteria 8056440228 8056441893 367
90 iso_pu_bacteria 2738541273 2738700364 368
91 iso_pu_bacteria 2738543014 2739254113 368
92 3300039437 Ga0436365_1861098 Ga0436365_1861098_759_1871 369
93 3300044673 Ga0453683_0142553 Ga0453683_0142553_232_1344 369
94 3300048927 Ga0496124_0209759 Ga0496124_0209759_102_1214 369
95 iso_pu_bacteria 2585428115 2587942901 369
96 iso_pu_bacteria 2585428187 2588233462 369
97 iso_pu_bacteria 2977243572 2977246195 369
98 3300002459 JGI24751J29686_10001178 JGI24751J29686_100011784 370
99 3300003316 rootH1_10062921 rootH1_100629213 370
100 3300003320 rootH2_10024557 rootH2_100245578 370
101 3300003320 rootH2_10053942 rootH2_100539425 370
102 3300003320 rootH2_10104863 rootH2_101048632 370
103 3300003323 rootH1_10011887 rootH1_100118872 370
104 3300003354 JGI25160J50197_1000565 JGI25160J50197_10005656 370
105 3300005289 Ga0065704_10102932 Ga0065704_101029323 370
106 3300005289 Ga0065704_10145601 Ga0065704_101456012 370
107 3300005290 Ga0065712_10077508 Ga0065712_100775083 370
108 3300005290 Ga0065712_10131594 Ga0065712_101315942 370
109 3300005295 Ga0065707_10127397 Ga0065707_101273972 370
110 3300005295 Ga0065707_10190776 Ga0065707_101907761 370
111 3300005328 Ga0070676_10099730 Ga0070676_100997302 370
112 3300005329 Ga0070683_100255695 Ga0070683_1002556952 370
113 3300005329 Ga0070683_100259747 Ga0070683_1002597471 370
114 3300005331 Ga0070670_100031636 Ga0070670_1000316362 370
115 3300005331 Ga0070670_100033064 Ga0070670_1000330641 370
116 3300005331 Ga0070670_100118351 Ga0070670_1001183513 370
117 3300005331 Ga0070670_100180290 Ga0070670_1001802902 370
118 3300005333 Ga0070677_10012402 Ga0070677_100124021 370
119 3300005333 Ga0070677_10079443 Ga0070677_100794431 370
120 3300005334 Ga0068869_100003414 Ga0068869_1000034143 370
121 3300005334 Ga0068869_100171426 Ga0068869_1001714261 370
122 3300005335 Ga0070666_10000042 Ga0070666_1000004249 370
123 3300005336 Ga0070680_100009870 Ga0070680_1000098704 370
124 3300005336 Ga0070680_100019792 Ga0070680_1000197922 370
125 3300005336 Ga0070680_100086945 Ga0070680_1000869453 370
126 3300005337 Ga0070682_100025537 Ga0070682_1000255372 370
127 3300005339 Ga0070660_100029333 Ga0070660_1000293333 370
128 3300005339 Ga0070660_100079904 Ga0070660_1000799042 370
129 3300005339 Ga0070660_100099707 Ga0070660_1000997073 370
130 3300005345 Ga0070692_10061378 Ga0070692_100613781 370
131 3300005347 Ga0070668_100008663 Ga0070668_1000086633 370
132 3300005347 Ga0070668_100028179 Ga0070668_1000281793 370
133 3300005347 Ga0070668_100056191 Ga0070668_1000561913 370
134 3300005347 Ga0070668_100179457 Ga0070668_1001794572 370
135 3300005347 Ga0070668_100184313 Ga0070668_1001843131 370
136 3300005353 Ga0070669_100007952 Ga0070669_1000079522 370
137 3300005353 Ga0070669_100071777 Ga0070669_1000717773 370
138 3300005354 Ga0070675_100007326 Ga0070675_1000073264 370
139 3300005354 Ga0070675_100008572 Ga0070675_1000085725 370
140 3300005354 Ga0070675_100044137 Ga0070675_1000441372 370
141 3300005354 Ga0070675_100133293 Ga0070675_1001332932 370
142 3300005355 Ga0070671_100015437 Ga0070671_1000154372 370
143 3300005355 Ga0070671_100057107 Ga0070671_1000571075 370
144 3300005356 Ga0070674_100091933 Ga0070674_1000919333 370
145 3300005364 Ga0070673_100008121 Ga0070673_1000081214 370
146 3300005364 Ga0070673_100040967 Ga0070673_1000409672 370
147 3300005364 Ga0070673_100072869 Ga0070673_1000728692 370
148 3300005364 Ga0070673_100216998 Ga0070673_1002169982 370
149 3300005364 Ga0070673_100219521 Ga0070673_1002195211 370
150 3300005364 Ga0070673_100255257 Ga0070673_1002552572 370
151 3300005365 Ga0070688_100022867 Ga0070688_1000228671 370
152 3300005366 Ga0070659_100056761 Ga0070659_1000567613 370
153 3300005367 Ga0070667_100016082 Ga0070667_1000160825 370
154 3300005367 Ga0070667_100021145 Ga0070667_1000211455 370
155 3300005367 Ga0070667_100041120 Ga0070667_1000411203 370
156 3300005367 Ga0070667_100061111 Ga0070667_1000611113 370
157 3300005438 Ga0070701_10006124 Ga0070701_100061242 370
158 3300005441 Ga0070700_100101493 Ga0070700_1001014932 370
159 3300005455 Ga0070663_100080139 Ga0070663_1000801391 370
160 3300005456 Ga0070678_100099193 Ga0070678_1000991932 370
161 3300005457 Ga0070662_100110710 Ga0070662_1001107102 370
162 3300005458 Ga0070681_10055011 Ga0070681_100550111 370
163 3300005458 Ga0070681_10110560 Ga0070681_101105601 370
164 3300005458 Ga0070681_10157141 Ga0070681_101571412 370
165 3300005458 Ga0070681_10201409 Ga0070681_102014092 370
166 3300005459 Ga0068867_100029874 Ga0068867_1000298743 370
167 3300005459 Ga0068867_100031374 Ga0068867_1000313742 370
168 3300005459 Ga0068867_100120612 Ga0068867_1001206122 370
169 3300005459 Ga0068867_100246239 Ga0068867_1002462392 370
170 3300005466 Ga0070685_10018548 Ga0070685_100185482 370
171 3300005466 Ga0070685_10130582 Ga0070685_101305822 370
172 3300005471 Ga0070698_100010282 Ga0070698_1000102825 370
173 3300005471 Ga0070698_100068956 Ga0070698_1000689562 370
174 3300005530 Ga0070679_100000454 Ga0070679_10000045432 370
175 3300005530 Ga0070679_100008694 Ga0070679_1000086944 370
176 3300005530 Ga0070679_100027779 Ga0070679_1000277793 370
177 3300005530 Ga0070679_100077176 Ga0070679_1000771764 370
178 3300005535 Ga0070684_100048205 Ga0070684_1000482053 370
179 3300005535 Ga0070684_100213747 Ga0070684_1002137472 370
180 3300005539 Ga0068853_100059071 Ga0068853_1000590713 370
181 3300005539 Ga0068853_100100644 Ga0068853_1001006442 370
182 3300005539 Ga0068853_100231471 Ga0068853_1002314712 370
183 3300005543 Ga0070672_100011386 Ga0070672_1000113865 370
184 3300005543 Ga0070672_100023219 Ga0070672_1000232193 370
185 3300005543 Ga0070672_100149106 Ga0070672_1001491062 370
186 3300005543 Ga0070672_100232438 Ga0070672_1002324382 370
187 3300005543 Ga0070672_100350086 Ga0070672_1003500861 370
188 3300005548 Ga0070665_100045272 Ga0070665_1000452724 370
189 3300005563 Ga0068855_100004391 Ga0068855_1000043917 370
190 3300005563 Ga0068855_100011078 Ga0068855_1000110786 370
191 3300005563 Ga0068855_100011554 Ga0068855_1000115548 370
192 3300005563 Ga0068855_100011962 Ga0068855_1000119624 370
193 3300005563 Ga0068855_100016023 Ga0068855_1000160235 370
194 3300005563 Ga0068855_100044858 Ga0068855_1000448581 370
195 3300005563 Ga0068855_100179165 Ga0068855_1001791652 370
196 3300005564 Ga0070664_100238644 Ga0070664_1002386441 370
197 3300005577 Ga0068857_100000719 Ga0068857_1000007195 370
198 3300005577 Ga0068857_100033696 Ga0068857_1000336963 370
199 3300005577 Ga0068857_100093567 Ga0068857_1000935672 370
200 3300005577 Ga0068857_100146199 Ga0068857_1001461992 370
201 3300005578 Ga0068854_100038337 Ga0068854_1000383373 370
202 3300005578 Ga0068854_100140170 Ga0068854_1001401702 370
203 3300005578 Ga0068854_100148544 Ga0068854_1001485441 370
204 3300005578 Ga0068854_100217071 Ga0068854_1002170712 370
205 3300005614 Ga0068856_100014460 Ga0068856_1000144604 370
206 3300005614 Ga0068856_100027008 Ga0068856_1000270083 370
207 3300005614 Ga0068856_100042972 Ga0068856_1000429722 370
208 3300005614 Ga0068856_100196329 Ga0068856_1001963292 370
209 3300005614 Ga0068856_100209555 Ga0068856_1002095552 370
210 3300005614 Ga0068856_100284871 Ga0068856_1002848712 370
211 3300005616 Ga0068852_100002172 Ga0068852_1000021729 370
212 3300005616 Ga0068852_100004512 Ga0068852_1000045123 370
213 3300005616 Ga0068852_100010145 Ga0068852_1000101455 370
214 3300005616 Ga0068852_100056467 Ga0068852_1000564671 370
215 3300005616 Ga0068852_100181219 Ga0068852_1001812192 370
216 3300005617 Ga0068859_100000130 Ga0068859_10000013012 370
217 3300005617 Ga0068859_100022120 Ga0068859_1000221205 370
218 3300005617 Ga0068859_100035610 Ga0068859_1000356102 370
219 3300005617 Ga0068859_100053438 Ga0068859_1000534384 370
220 3300005617 Ga0068859_100080694 Ga0068859_1000806943 370
221 3300005617 Ga0068859_100377952 Ga0068859_1003779522 370
222 3300005618 Ga0068864_100004066 Ga0068864_1000040668 370
223 3300005618 Ga0068864_100081442 Ga0068864_1000814423 370
224 3300005618 Ga0068864_100163978 Ga0068864_1001639782 370
225 3300005618 Ga0068864_100187896 Ga0068864_1001878962 370
226 3300005618 Ga0068864_100248800 Ga0068864_1002488002 370
227 3300005718 Ga0068866_10035643 Ga0068866_100356434 370
228 3300005719 Ga0068861_100039535 Ga0068861_1000395352 370
229 3300005840 Ga0068870_10001526 Ga0068870_100015264 370
230 3300005840 Ga0068870_10009403 Ga0068870_100094032 370
231 3300005841 Ga0068863_100033987 Ga0068863_1000339872 370
232 3300005842 Ga0068858_100043889 Ga0068858_1000438894 370
233 3300005842 Ga0068858_100084912 Ga0068858_1000849123 370
234 3300005843 Ga0068860_100000241 Ga0068860_1000002418 370
235 3300005843 Ga0068860_100001682 Ga0068860_1000016828 370
236 3300005843 Ga0068860_100006618 Ga0068860_10000661811 370
237 3300005843 Ga0068860_100018807 Ga0068860_1000188076 370
238 3300005843 Ga0068860_100036214 Ga0068860_1000362143 370
239 3300005843 Ga0068860_100120239 Ga0068860_1001202393 370
240 3300005843 Ga0068860_100167036 Ga0068860_1001670362 370
241 3300005844 Ga0068862_100019788 Ga0068862_1000197885 370
242 3300005844 Ga0068862_100089205 Ga0068862_1000892052 370
243 3300005983 Ga0081540_1015256 Ga0081540_10152564 370
244 3300006237 Ga0097621_100000027 Ga0097621_10000002740 370
245 3300006237 Ga0097621_100008505 Ga0097621_1000085051 370
246 3300006237 Ga0097621_100095018 Ga0097621_1000950183 370
247 3300006237 Ga0097621_100144339 Ga0097621_1001443392 370
248 3300006358 Ga0068871_100000338 Ga0068871_10000033816 370
249 3300006358 Ga0068871_100010999 Ga0068871_1000109994 370
250 3300006358 Ga0068871_100077667 Ga0068871_1000776672 370
251 3300006844 Ga0075428_100007732 Ga0075428_10000773211 370
252 3300006844 Ga0075428_100046413 Ga0075428_1000464132 370
253 3300006846 Ga0075430_100000836 Ga0075430_1000008364 370
254 3300006847 Ga0075431_100000860 Ga0075431_1000008604 370
255 3300006847 Ga0075431_100034296 Ga0075431_1000342963 370
256 3300006880 Ga0075429_100001604 Ga0075429_10000160419 370
257 3300006881 Ga0068865_100113023 Ga0068865_1001130231 370
258 3300006931 Ga0097620_100000130 Ga0097620_10000013056 370
259 3300006931 Ga0097620_100022120 Ga0097620_1000221203 370
260 3300006931 Ga0097620_100035610 Ga0097620_1000356102 370
261 3300006931 Ga0097620_100053441 Ga0097620_1000534414 370
262 3300006931 Ga0097620_100080693 Ga0097620_1000806933 370
263 3300006931 Ga0097620_100377983 Ga0097620_1003779832 370
264 3300009093 Ga0105240_10000205 Ga0105240_1000020528 370
265 3300009093 Ga0105240_10001268 Ga0105240_1000126826 370
266 3300009093 Ga0105240_10008514 Ga0105240_100085149 370
267 3300009093 Ga0105240_10010263 Ga0105240_100102637 370
268 3300009093 Ga0105240_10015424 Ga0105240_100154248 370
269 3300009093 Ga0105240_10017211 Ga0105240_100172113 370
270 3300009093 Ga0105240_10019561 Ga0105240_100195616 370
271 3300009093 Ga0105240_10052481 Ga0105240_100524811 370
272 3300009093 Ga0105240_10056043 Ga0105240_100560434 370
273 3300009093 Ga0105240_10102910 Ga0105240_101029101 370
274 3300009093 Ga0105240_10145538 Ga0105240_101455382 370
275 3300009093 Ga0105240_10181706 Ga0105240_101817062 370
276 3300009094 Ga0111539_10014218 Ga0111539_100142184 370
277 3300009094 Ga0111539_10048431 Ga0111539_100484314 370
278 3300009094 Ga0111539_10183079 Ga0111539_101830792 370
279 3300009098 Ga0105245_10120415 Ga0105245_101204153 370
280 3300009101 Ga0105247_10006925 Ga0105247_100069256 370
281 3300009147 Ga0114129_10006547 Ga0114129_100065474 370
282 3300009147 Ga0114129_10017693 Ga0114129_100176937 370
283 3300009147 Ga0114129_10139020 Ga0114129_101390202 370
284 3300009174 Ga0105241_10041934 Ga0105241_100419341 370
285 3300009174 Ga0105241_10092089 Ga0105241_100920892 370
286 3300009174 Ga0105241_10097353 Ga0105241_100973533 370
287 3300009176 Ga0105242_10024370 Ga0105242_100243704 370
288 3300009176 Ga0105242_10061535 Ga0105242_100615353 370
289 3300009176 Ga0105242_10291643 Ga0105242_102916431 370
290 3300009177 Ga0105248_10085742 Ga0105248_100857423 370
291 3300009545 Ga0105237_10005965 Ga0105237_100059654 370
292 3300009545 Ga0105237_10010855 Ga0105237_100108554 370
293 3300009545 Ga0105237_10013031 Ga0105237_100130317 370
294 3300009545 Ga0105237_10016201 Ga0105237_100162014 370
295 3300009545 Ga0105237_10019274 Ga0105237_100192745 370
296 3300009545 Ga0105237_10044194 Ga0105237_100441942 370
297 3300009551 Ga0105238_10005460 Ga0105238_100054607 370
298 3300009551 Ga0105238_10027147 Ga0105238_100271474 370
299 3300009553 Ga0105249_10013227 Ga0105249_100132275 370
300 3300009553 Ga0105249_10032721 Ga0105249_100327214 370
301 3300009553 Ga0105249_10047478 Ga0105249_100474783 370
302 3300009553 Ga0105249_10099402 Ga0105249_100994023 370
303 3300009553 Ga0105249_10250219 Ga0105249_102502192 370
304 3300009553 Ga0105249_10276048 Ga0105249_102760481 370
305 3300009553 Ga0105249_10414786 Ga0105249_104147861 370
306 3300010375 Ga0105239_10000169 Ga0105239_1000016924 370
307 3300010375 Ga0105239_10004544 Ga0105239_100045448 370
308 3300010375 Ga0105239_10005225 Ga0105239_100052253 370
309 3300010375 Ga0105239_10012852 Ga0105239_100128523 370
310 3300010375 Ga0105239_10036577 Ga0105239_100365772 370
311 3300010375 Ga0105239_10057993 Ga0105239_100579932 370
312 3300010375 Ga0105239_10443450 Ga0105239_104434501 370
313 3300013100 Ga0157373_10008001 Ga0157373_100080017 370
314 3300013100 Ga0157373_10017187 Ga0157373_100171875 370
315 3300013100 Ga0157373_10027272 Ga0157373_100272723 370
316 3300013102 Ga0157371_10001203 Ga0157371_1000120324 370
317 3300013102 Ga0157371_10001756 Ga0157371_100017564 370
318 3300013102 Ga0157371_10011977 Ga0157371_100119775 370
319 3300013102 Ga0157371_10013531 Ga0157371_100135313 370
320 3300013102 Ga0157371_10013976 Ga0157371_100139764 370
321 3300013102 Ga0157371_10041880 Ga0157371_100418802 370
322 3300013102 Ga0157371_10053664 Ga0157371_100536642 370
323 3300013102 Ga0157371_10072114 Ga0157371_100721142 370
324 3300013102 Ga0157371_10108147 Ga0157371_101081473 370
325 3300013104 Ga0157370_10000712 Ga0157370_1000071233 370
326 3300013104 Ga0157370_10001268 Ga0157370_100012681 370
327 3300013104 Ga0157370_10001336 Ga0157370_100013364 370
328 3300013104 Ga0157370_10006253 Ga0157370_100062535 370
329 3300013104 Ga0157370_10038169 Ga0157370_100381693 370
330 3300013104 Ga0157370_10296340 Ga0157370_102963402 370
331 3300013105 Ga0157369_10031531 Ga0157369_100315314 370
332 3300013105 Ga0157369_10034972 Ga0157369_100349722 370
333 3300013105 Ga0157369_10044874 Ga0157369_100448742 370
334 3300013105 Ga0157369_10051082 Ga0157369_100510822 370
335 3300013105 Ga0157369_10051098 Ga0157369_100510984 370
336 3300013105 Ga0157369_10053731 Ga0157369_100537312 370
337 3300013296 Ga0157374_10000001 Ga0157374_10000001491 370
338 3300013296 Ga0157374_10010176 Ga0157374_100101765 370
339 3300013296 Ga0157374_10073566 Ga0157374_100735663 370
340 3300013296 Ga0157374_10079610 Ga0157374_100796103 370
341 3300013297 Ga0157378_10009809 Ga0157378_100098093 370
342 3300013297 Ga0157378_10020236 Ga0157378_100202361 370
343 3300013297 Ga0157378_10021231 Ga0157378_100212314 370
344 3300013297 Ga0157378_10042364 Ga0157378_100423643 370
345 3300013306 Ga0163162_10000437 Ga0163162_100004375 370
346 3300013306 Ga0163162_10000445 Ga0163162_1000044526 370
347 3300013306 Ga0163162_10000699 Ga0163162_1000069915 370
348 3300013306 Ga0163162_10016883 Ga0163162_100168833 370
349 3300013306 Ga0163162_10090642 Ga0163162_100906423 370
350 3300013306 Ga0163162_10152854 Ga0163162_101528542 370
351 3300013306 Ga0163162_10273427 Ga0163162_102734273 370
352 3300013307 Ga0157372_10001013 Ga0157372_1000101311 370
353 3300013307 Ga0157372_10016165 Ga0157372_100161655 370
354 3300013307 Ga0157372_10047470 Ga0157372_100474703 370
355 3300013307 Ga0157372_10162152 Ga0157372_101621523 370
356 3300013307 Ga0157372_10192326 Ga0157372_101923262 370
357 3300013307 Ga0157372_10220682 Ga0157372_102206822 370
358 3300013307 Ga0157372_10225364 Ga0157372_102253642 370
359 3300013307 Ga0157372_10345657 Ga0157372_103456572 370
360 3300013307 Ga0157372_10402538 Ga0157372_104025382 370
361 3300013307 Ga0157372_10526126 Ga0157372_105261261 370
362 3300014325 Ga0163163_10000193 Ga0163163_100001939 370
363 3300014325 Ga0163163_10133191 Ga0163163_101331911 370
364 3300014326 Ga0157380_10008991 Ga0157380_100089914 370
365 3300014326 Ga0157380_10017582 Ga0157380_100175823 370
366 3300014326 Ga0157380_10020669 Ga0157380_100206692 370
367 3300014326 Ga0157380_10034213 Ga0157380_100342133 370
368 3300014326 Ga0157380_10137890 Ga0157380_101378901 370
369 3300014326 Ga0157380_10274458 Ga0157380_102744581 370
370 3300014745 Ga0157377_10063586 Ga0157377_100635862 370
371 3300014745 Ga0157377_10111515 Ga0157377_101115152 370
372 3300014968 Ga0157379_10021712 Ga0157379_100217123 370
373 3300014968 Ga0157379_10105014 Ga0157379_101050143 370
374 3300014968 Ga0157379_10351996 Ga0157379_103519961 370
375 3300014969 Ga0157376_10000808 Ga0157376_100008086 370
376 3300014969 Ga0157376_10013444 Ga0157376_100134444 370
377 3300014969 Ga0157376_10034855 Ga0157376_100348553 370
378 3300014969 Ga0157376_10091171 Ga0157376_100911712 370
379 3300014969 Ga0157376_10151472 Ga0157376_101514722 370
380 3300015265 Ga0182005_1033393 Ga0182005_10333932 370
381 3300017792 Ga0163161_10027148 Ga0163161_100271482 370
382 3300025271 Ga0207666_1002853 Ga0207666_10028531 370
383 3300025302 Ga0207426_1000132 Ga0207426_100013255 370
384 3300025893 Ga0207682_10004723 Ga0207682_100047232 370
385 3300025899 Ga0207642_10021042 Ga0207642_100210423 370
386 3300025899 Ga0207642_10046154 Ga0207642_100461541 370
387 3300025901 Ga0207688_10073525 Ga0207688_100735252 370
388 3300025903 Ga0207680_10000135 Ga0207680_1000013525 370
389 3300025903 Ga0207680_10049520 Ga0207680_100495202 370
390 3300025903 Ga0207680_10186009 Ga0207680_101860091 370
391 3300025904 Ga0207647_10014917 Ga0207647_100149174 370
392 3300025904 Ga0207647_10040181 Ga0207647_100401813 370
393 3300025907 Ga0207645_10000306 Ga0207645_1000030622 370
394 3300025907 Ga0207645_10025857 Ga0207645_100258572 370
395 3300025907 Ga0207645_10126601 Ga0207645_101266012 370
396 3300025908 Ga0207643_10038760 Ga0207643_100387603 370
397 3300025909 Ga0207705_10006335 Ga0207705_100063358 370
398 3300025909 Ga0207705_10041667 Ga0207705_100416673 370
399 3300025909 Ga0207705_10165136 Ga0207705_101651362 370
400 3300025911 Ga0207654_10103154 Ga0207654_101031542 370
401 3300025912 Ga0207707_10026673 Ga0207707_100266734 370
402 3300025912 Ga0207707_10100014 Ga0207707_101000142 370
403 3300025912 Ga0207707_10122218 Ga0207707_101222183 370
404 3300025913 Ga0207695_10000232 Ga0207695_1000023250 370
405 3300025913 Ga0207695_10000962 Ga0207695_100009627 370
406 3300025913 Ga0207695_10001367 Ga0207695_100013672 370
407 3300025913 Ga0207695_10002931 Ga0207695_1000293111 370
408 3300025913 Ga0207695_10018994 Ga0207695_100189944 370
409 3300025913 Ga0207695_10022165 Ga0207695_100221651 370
410 3300025913 Ga0207695_10065272 Ga0207695_100652723 370
411 3300025913 Ga0207695_10101320 Ga0207695_101013202 370
412 3300025913 Ga0207695_10324150 Ga0207695_103241502 370
413 3300025914 Ga0207671_10003343 Ga0207671_100033438 370
414 3300025914 Ga0207671_10005449 Ga0207671_100054494 370
415 3300025914 Ga0207671_10007213 Ga0207671_100072134 370
416 3300025914 Ga0207671_10012002 Ga0207671_100120024 370
417 3300025914 Ga0207671_10015938 Ga0207671_100159385 370
418 3300025917 Ga0207660_10009183 Ga0207660_100091834 370
419 3300025917 Ga0207660_10169115 Ga0207660_101691152 370
420 3300025918 Ga0207662_10051559 Ga0207662_100515592 370
421 3300025919 Ga0207657_10001302 Ga0207657_100013022 370
422 3300025919 Ga0207657_10038219 Ga0207657_100382192 370
423 3300025919 Ga0207657_10059567 Ga0207657_100595672 370
424 3300025919 Ga0207657_10114358 Ga0207657_101143582 370
425 3300025919 Ga0207657_10135652 Ga0207657_101356522 370
426 3300025921 Ga0207652_10000064 Ga0207652_1000006433 370
427 3300025921 Ga0207652_10000967 Ga0207652_1000096712 370
428 3300025921 Ga0207652_10005809 Ga0207652_100058096 370
429 3300025921 Ga0207652_10019337 Ga0207652_100193373 370
430 3300025921 Ga0207652_10095599 Ga0207652_100955992 370
431 3300025923 Ga0207681_10038689 Ga0207681_100386893 370
432 3300025923 Ga0207681_10079998 Ga0207681_100799983 370
433 3300025924 Ga0207694_10013495 Ga0207694_100134954 370
434 3300025924 Ga0207694_10265998 Ga0207694_102659982 370
435 3300025925 Ga0207650_10027725 Ga0207650_100277255 370
436 3300025925 Ga0207650_10089938 Ga0207650_100899381 370
437 3300025925 Ga0207650_10100631 Ga0207650_101006312 370
438 3300025925 Ga0207650_10105170 Ga0207650_101051701 370
439 3300025925 Ga0207650_10106315 Ga0207650_101063153 370
440 3300025926 Ga0207659_10050044 Ga0207659_100500443 370
441 3300025926 Ga0207659_10128071 Ga0207659_101280712 370
442 3300025926 Ga0207659_10243401 Ga0207659_102434011 370
443 3300025931 Ga0207644_10004809 Ga0207644_100048096 370
444 3300025931 Ga0207644_10023199 Ga0207644_100231994 370
445 3300025931 Ga0207644_10072359 Ga0207644_100723593 370
446 3300025932 Ga0207690_10075384 Ga0207690_100753843 370
447 3300025933 Ga0207706_10005978 Ga0207706_100059783 370
448 3300025933 Ga0207706_10090397 Ga0207706_100903972 370
449 3300025933 Ga0207706_10111115 Ga0207706_101111151 370
450 3300025934 Ga0207686_10004001 Ga0207686_100040014 370
451 3300025936 Ga0207670_10188820 Ga0207670_101888202 370
452 3300025937 Ga0207669_10129805 Ga0207669_101298051 370
453 3300025937 Ga0207669_10143778 Ga0207669_101437782 370
454 3300025938 Ga0207704_10086365 Ga0207704_100863652 370
455 3300025940 Ga0207691_10007147 Ga0207691_100071476 370
456 3300025940 Ga0207691_10009060 Ga0207691_100090604 370
457 3300025940 Ga0207691_10174223 Ga0207691_101742231 370
458 3300025940 Ga0207691_10180542 Ga0207691_101805422 370
459 3300025942 Ga0207689_10001865 Ga0207689_100018654 370
460 3300025942 Ga0207689_10002862 Ga0207689_100028623 370
461 3300025942 Ga0207689_10006619 Ga0207689_100066195 370
462 3300025942 Ga0207689_10050628 Ga0207689_100506282 370
463 3300025944 Ga0207661_10032567 Ga0207661_100325673 370
464 3300025944 Ga0207661_10062710 Ga0207661_100627102 370
465 3300025944 Ga0207661_10214131 Ga0207661_102141311 370
466 3300025949 Ga0207667_10000111 Ga0207667_1000011151 370
467 3300025949 Ga0207667_10000549 Ga0207667_1000054920 370
468 3300025949 Ga0207667_10001284 Ga0207667_1000128411 370
469 3300025949 Ga0207667_10004600 Ga0207667_1000460010 370
470 3300025949 Ga0207667_10021040 Ga0207667_100210403 370
471 3300025949 Ga0207667_10021551 Ga0207667_100215517 370
472 3300025949 Ga0207667_10026519 Ga0207667_100265193 370
473 3300025960 Ga0207651_10015067 Ga0207651_100150673 370
474 3300025960 Ga0207651_10022198 Ga0207651_100221983 370
475 3300025960 Ga0207651_10057536 Ga0207651_100575362 370
476 3300025960 Ga0207651_10195781 Ga0207651_101957812 370
477 3300025961 Ga0207712_10015650 Ga0207712_100156503 370
478 3300025961 Ga0207712_10024861 Ga0207712_100248613 370
479 3300025961 Ga0207712_10025025 Ga0207712_100250253 370
480 3300025961 Ga0207712_10046020 Ga0207712_100460203 370
481 3300025961 Ga0207712_10165644 Ga0207712_101656442 370
482 3300025972 Ga0207668_10037291 Ga0207668_100372914 370
483 3300025981 Ga0207640_10050642 Ga0207640_100506423 370
484 3300025981 Ga0207640_10207129 Ga0207640_102071292 370
485 3300025986 Ga0207658_10003314 Ga0207658_100033142 370
486 3300025986 Ga0207658_10009745 Ga0207658_100097455 370
487 3300025986 Ga0207658_10010955 Ga0207658_100109552 370
488 3300025986 Ga0207658_10040515 Ga0207658_100405153 370
489 3300025986 Ga0207658_10124603 Ga0207658_101246032 370
490 3300026023 Ga0207677_10188252 Ga0207677_101882521 370
491 3300026035 Ga0207703_10005679 Ga0207703_100056799 370
492 3300026035 Ga0207703_10087464 Ga0207703_100874642 370
493 3300026041 Ga0207639_10023583 Ga0207639_100235834 370
494 3300026041 Ga0207639_10038237 Ga0207639_100382373 370
495 3300026041 Ga0207639_10059996 Ga0207639_100599963 370
496 3300026041 Ga0207639_10080302 Ga0207639_100803022 370
497 3300026041 Ga0207639_10180841 Ga0207639_101808412 370
498 3300026075 Ga0207708_10081894 Ga0207708_100818943 370
499 3300026075 Ga0207708_10137759 Ga0207708_101377591 370
500 3300026078 Ga0207702_10019126 Ga0207702_100191262 370
501 3300026078 Ga0207702_10061481 Ga0207702_100614812 370
502 3300026078 Ga0207702_10066409 Ga0207702_100664092 370
503 3300026078 Ga0207702_10084699 Ga0207702_100846992 370
504 3300026078 Ga0207702_10158519 Ga0207702_101585192 370
505 3300026078 Ga0207702_10220671 Ga0207702_102206712 370
506 3300026078 Ga0207702_10419214 Ga0207702_104192141 370
507 3300026088 Ga0207641_10000158 Ga0207641_1000015857 370
508 3300026088 Ga0207641_10001128 Ga0207641_100011284 370
509 3300026088 Ga0207641_10092034 Ga0207641_100920341 370
510 3300026088 Ga0207641_10347976 Ga0207641_103479761 370
511 3300026089 Ga0207648_10000653 Ga0207648_100006532 370
512 3300026089 Ga0207648_10003171 Ga0207648_100031717 370
513 3300026089 Ga0207648_10011997 Ga0207648_100119975 370
514 3300026089 Ga0207648_10081603 Ga0207648_100816033 370
515 3300026089 Ga0207648_10133982 Ga0207648_101339822 370
516 3300026095 Ga0207676_10072025 Ga0207676_100720254 370
517 3300026095 Ga0207676_10109171 Ga0207676_101091712 370
518 3300026116 Ga0207674_10001723 Ga0207674_1000172318 370
519 3300026116 Ga0207674_10019660 Ga0207674_100196607 370
520 3300026116 Ga0207674_10028397 Ga0207674_100283976 370
521 3300026116 Ga0207674_10122746 Ga0207674_101227462 370
522 3300026118 Ga0207675_100004088 Ga0207675_1000040884 370
523 3300026118 Ga0207675_100074599 Ga0207675_1000745992 370
524 3300026118 Ga0207675_100090583 Ga0207675_1000905832 370
525 3300026118 Ga0207675_100191537 Ga0207675_1001915372 370
526 3300026121 Ga0207683_10004426 Ga0207683_100044264 370
527 3300026121 Ga0207683_10132651 Ga0207683_101326512 370
528 3300026142 Ga0207698_10002758 Ga0207698_100027588 370
529 3300026142 Ga0207698_10026494 Ga0207698_100264943 370
530 3300026142 Ga0207698_10168610 Ga0207698_101686102 370
531 3300028380 Ga0268265_10053903 Ga0268265_100539034 370
532 3300028381 Ga0268264_10000011 Ga0268264_10000011424 370
533 3300028381 Ga0268264_10001129 Ga0268264_1000112916 370
534 3300028381 Ga0268264_10001678 Ga0268264_100016787 370
535 3300028381 Ga0268264_10025484 Ga0268264_100254844 370
536 3300028381 Ga0268264_10089204 Ga0268264_100892042 370
537 3300028786 Ga0307517_10007333 Ga0307517_100073333 370
538 3300028786 Ga0307517_10141613 Ga0307517_101416132 370
539 3300028794 Ga0307515_10000001 Ga0307515_100000011334 370
540 3300028794 Ga0307515_10000074 Ga0307515_10000074155 370
541 3300030521 Ga0307511_10000673 Ga0307511_100006735 370
542 3300030522 Ga0307512_10166470 Ga0307512_101664701 370
543 3300031250 Ga0265331_10045401 Ga0265331_100454012 370
544 3300031251 Ga0265327_10000152 Ga0265327_1000015258 370
545 3300031251 Ga0265327_10000440 Ga0265327_1000044047 370
546 3300031251 Ga0265327_10033388 Ga0265327_100333882 370
547 3300031507 Ga0307509_10037992 Ga0307509_100379922 370
548 3300031548 Ga0307408_100217521 Ga0307408_1002175212 370
549 3300031730 Ga0307516_10002603 Ga0307516_100026033 370
550 3300031730 Ga0307516_10119609 Ga0307516_101196092 370
551 3300031731 Ga0307405_10099571 Ga0307405_100995712 370
552 3300031824 Ga0307413_10279812 Ga0307413_102798121 370
553 3300031852 Ga0307410_10003887 Ga0307410_100038873 370
554 3300032002 Ga0307416_100018966 Ga0307416_1000189663 370
555 3300032004 Ga0307414_10199913 Ga0307414_101999132 370
556 3300036401 Ga0373937_0176297 Ga0373937_0176297_667_1782 370
557 3300037312 Ga0395899_0008094 Ga0395899_0008094_2601_3716 370
558 3300037312 Ga0395899_0024335 Ga0395899_0024335_3085_4200 370
559 3300037312 Ga0395899_0053919 Ga0395899_0053919_1597_2712 370
560 3300037312 Ga0395899_0076878 Ga0395899_0076878_65_1180 370
561 3300037312 Ga0395899_0089406 Ga0395899_0089406_851_1966 370
562 3300037312 Ga0395899_0109418 Ga0395899_0109418_163_1278 370
563 3300037418 Ga0395900_0004748 Ga0395900_0004748_11907_13022 370
564 3300037418 Ga0395900_0004811 Ga0395900_0004811_4992_6107 370
565 3300037418 Ga0395900_0052346 Ga0395900_0052346_1590_2705 370
566 3300037418 Ga0395900_0075560 Ga0395900_0075560_452_1567 370
567 3300037418 Ga0395900_0144408 Ga0395900_0144408_91_1206 370
568 3300037418 Ga0395900_0211801 Ga0395900_0211801_101_1216 370
569 3300037466 Ga0395898_0002029 Ga0395898_0002029_14734_15849 370
570 3300037466 Ga0395898_0019287 Ga0395898_0019287_2447_3562 370
571 3300037466 Ga0395898_0067190 Ga0395898_0067190_1256_2371 370
572 3300037466 Ga0395898_0091877 Ga0395898_0091877_1574_2689 370
573 3300037466 Ga0395898_0124969 Ga0395898_0124969_93_1208 370
574 3300037471 Ga0395905_0019861 Ga0395905_0019861_3138_4253 370
575 3300037471 Ga0395905_0236900 Ga0395905_0236900_319_1434 370
576 3300038443 Ga0395901_0016383 Ga0395901_0016383_2255_3370 370
577 3300038443 Ga0395901_0129613 Ga0395901_0129613_61_1176 370
578 3300038443 Ga0395901_0220309 Ga0395901_0220309_93_1208 370
579 3300039437 Ga0436365_1499396 Ga0436365_1499396_666_1781 370
580 3300039437 Ga0436365_1879596 Ga0436365_1879596_4105_5220 370
581 3300041406 Ga0439439_0003744 Ga0439439_0003744_1226_2386 370
582 3300041458 Ga0451798_0554964 Ga0451798_0554964_979_2094 370
583 3300042001 Ga0439441_003884 Ga0439441_003884_75_1190 370
584 3300042007 Ga0439449_0011541 Ga0439449_0011541_1671_2798 370
585 3300042007 Ga0439449_0011855 Ga0439449_0011855_1086_2246 370
586 3300042007 Ga0439449_0033163 Ga0439449_0033163_429_1544 370
587 3300042014 Ga0439457_000620 Ga0439457_000620_9072_10232 370
588 3300042125 Ga0450923_007092 Ga0450923_007092_259_1374 370
589 3300044656 Ga0466969_0000778 Ga0466969_0000778_9391_10506 370
590 3300044656 Ga0466969_0020141 Ga0466969_0020141_113_1228 370
591 3300044658 Ga0466972_0000004 Ga0466972_0000004_298071_299186 370
592 3300044658 Ga0466972_0000095 Ga0466972_0000095_75453_76568 370
593 3300044658 Ga0466972_0000579 Ga0466972_0000579_12696_13811 370
594 3300044712 Ga0453684_0021771 Ga0453684_0021771_1856_2971 370
595 3300044765 Ga0466970_0000518 Ga0466970_0000518_12984_14099 370
596 3300044765 Ga0466970_0014415 Ga0466970_0014415_1544_2659 370
597 3300044842 Ga0466957_0015823 Ga0466957_0015823_485_1600 370
598 3300045049 Ga0466959_0000125 Ga0466959_0000125_32570_33685 370
599 3300045049 Ga0466959_0032625 Ga0466959_0032625_1136_2251 370
600 3300046460 Ga0495638_0053431 Ga0495638_0053431_1013_2128 370
601 3300046460 Ga0495638_0058491 Ga0495638_0058491_1235_2350 370
602 3300046471 Ga0495650_0033358 Ga0495650_0033358_384_1499 370
603 3300046507 Ga0495606_0003492 Ga0495606_0003492_60_1175 370
604 3300046524 Ga0495648_0002020 Ga0495648_0002020_15803_16918 370
605 3300046616 Ga0495668_0013929 Ga0495668_0013929_3569_4684 370
606 3300046648 Ga0495611_0000385 Ga0495611_0000385_15637_16752 370
607 3300047320 Ga0495672_0116695 Ga0495672_0116695_188_1303 370
608 3300047443 Ga0495687_000001 Ga0495687_000001_850912_852027 370
609 3300047472 Ga0495686_0000004 Ga0495686_0000004_139783_140898 370
610 3300047472 Ga0495686_0000772 Ga0495686_0000772_21562_22677 370
611 3300049570 Ga0501033_0172930 Ga0501033_0172930_278_1393 370
612 3300049571 Ga0501034_0035681 Ga0501034_0035681_280_1395 370
613 3300049571 Ga0501034_0059558 Ga0501034_0059558_2119_3234 370
614 3300049571 Ga0501034_0167483 Ga0501034_0167483_48_1163 370
615 3300049572 Ga0501036_0127246 Ga0501036_0127246_701_1816 370
616 3300049572 Ga0501036_0172190 Ga0501036_0172190_61_1176 370
617 3300049573 Ga0501037_0099530 Ga0501037_0099530_719_1834 370
618 3300049574 Ga0501038_0057852 Ga0501038_0057852_2004_3119 370
619 3300049574 Ga0501038_0070304 Ga0501038_0070304_81_1196 370
620 3300049575 Ga0501039_0022019 Ga0501039_0022019_3534_4649 370
621 3300049579 Ga0501043_0015022 Ga0501043_0015022_2813_3928 370
622 3300049579 Ga0501043_0015230 Ga0501043_0015230_4557_5672 370
623 3300049581 Ga0501047_0006024 Ga0501047_0006024_939_2054 370
624 3300049581 Ga0501047_0047360 Ga0501047_0047360_1502_2617 370
625 3300049581 Ga0501047_0048551 Ga0501047_0048551_2119_3234 370
626 3300049581 Ga0501047_0091860 Ga0501047_0091860_1416_2531 370
627 3300049654 Ga0501207_000601 Ga0501207_000601_2396_3511 370
628 3300049663 Ga0501223_000421 Ga0501223_000421_3655_4770 370
629 3300049688 Ga0501259_000442 Ga0501259_000442_1269_2384 370
630 3300049703 Ga0501219_000479 Ga0501219_000479_865_1980 370
631 3300049705 Ga0501225_0007958 Ga0501225_0007958_1497_2612 370
632 3300049707 Ga0501234_001054 Ga0501234_001054_2513_3628 370
633 3300049742 Ga0501080_0280286 Ga0501080_0280286_179_1294 370
634 3300049822 Ga0501035_0192114 Ga0501035_0192114_47_1162 370
635 3300049823 Ga0501044_0009540 Ga0501044_0009540_3392_4507 370
636 3300049823 Ga0501044_0126547 Ga0501044_0126547_492_1607 370
637 3300049823 Ga0501044_0290186 Ga0501044_0290186_324_1439 370
638 3300050005 Ga0501284_00027 Ga0501284_00027_54583_55698 370
639 3300050493 nmdc:mga0k408_63900_c1 nmdc:mga0k408_63900_c1_633_1748 370
640 3300050507 nmdc:mga05p37_160084_c1 nmdc:mga05p37_160084_c1_56_1171 370
641 3300050507 nmdc:mga05p37_54171_c1 nmdc:mga05p37_54171_c1_846_1961 370
642 3300050508 nmdc:mga09592_10171_c1 nmdc:mga09592_10171_c1_3655_4770 370
643 3300050509 nmdc:mga0qj67_146183_c1 nmdc:mga0qj67_146183_c1_197_1312 370
644 3300050510 nmdc:mga06r32_8029_c1 nmdc:mga06r32_8029_c1_4688_5803 370
645 3300050511 nmdc:mga08y16_153255_c1 nmdc:mga08y16_153255_c1_494_1609 370
646 3300053090 Ga0500646_0008363 Ga0500646_0008363_492_1607 370
647 3300053092 Ga0500583_0000010 Ga0500583_0000010_94819_95934 370
648 3300053092 Ga0500583_0006837 Ga0500583_0006837_514_1629 370
649 3300053108 Ga0500562_000062 Ga0500562_000062_14436_15551 370
650 3300053136 Ga0500559_0038292 Ga0500559_0038292_245_1360 370
651 3300053139 Ga0500568_0000236 Ga0500568_0000236_42617_43732 370
652 3300053139 Ga0500568_0018122 Ga0500568_0018122_1278_2393 370
653 3300053151 Ga0500604_0007716 Ga0500604_0007716_1621_2736 370
654 3300053153 Ga0500616_0015900 Ga0500616_0015900_885_2000 370
655 3300053153 Ga0500616_0082282 Ga0500616_0082282_384_1499 370
656 3300053156 Ga0500622_0002122 Ga0500622_0002122_269_1384 370
657 3300053156 Ga0500622_0090723 Ga0500622_0090723_167_1282 370
658 3300053727 Ga0500611_000006 Ga0500611_000006_75550_76665 370
659 3300053730 Ga0500645_025283 Ga0500645_025283_250_1365 370
660 3300053739 Ga0500587_007103 Ga0500587_007103_239_1354 370
661 3300061719 Ga0466962_0013673 Ga0466962_0013673_221_1336 370
662 iso_pu_bacteria 2511231000 2511231344 370
663 iso_pu_bacteria 2582581278 2585143499 370
664 iso_pu_bacteria 2582581281 2585156806 370
665 iso_pu_bacteria 2582581282 2585160891 370
666 iso_pu_bacteria 2585428045 2587680560 370
667 iso_pu_bacteria 2585428060 2587749568 370
668 iso_pu_bacteria 2585428182 2588208218 370
669 iso_pu_bacteria 2585428183 2588213218 370
670 iso_pu_bacteria 2585428184 2588219831 370
671 iso_pu_bacteria 2585428185 2588223896 370
672 iso_pu_bacteria 2588253712 2588446466 370
673 iso_pu_bacteria 2588254255 2590600812 370
674 iso_pu_bacteria 2588254257 2590611923 370
675 iso_pu_bacteria 2751185877 2753672652 370
676 iso_pu_bacteria 2765235839 2765572600 370
677 iso_pu_bacteria 2772190705 2772607101 370
678 iso_pu_bacteria 2816332188 2816872949 370
679 iso_pu_bacteria 2842083920 2842084204 370
680 iso_pu_bacteria 2871720351 2871723752 370
681 iso_pu_bacteria 2889290771 2889291675 370
682 iso_pu_bacteria 2905999023 2906000788 370
683 iso_pu_bacteria 2919399522 2919402915 370
684 iso_pu_bacteria 2984572630 2984575992 370
685 iso_pu_bacteria 2984606641 2984609447 370
686 3300005328 Ga0070676_10011986 Ga0070676_100119864 371
687 3300005334 Ga0068869_100010028 Ga0068869_1000100283 371
688 3300005335 Ga0070666_10019114 Ga0070666_100191142 371
689 3300005336 Ga0070680_100000323 Ga0070680_1000003236 371
690 3300005337 Ga0070682_100001720 Ga0070682_1000017206 371
691 3300005341 Ga0070691_10008842 Ga0070691_100088423 371
692 3300005347 Ga0070668_100054934 Ga0070668_1000549342 371
693 3300005366 Ga0070659_100124333 Ga0070659_1001243332 371
694 3300005367 Ga0070667_100000584 Ga0070667_1000005842 371
695 3300005457 Ga0070662_100325629 Ga0070662_1003256291 371
696 3300005458 Ga0070681_10007717 Ga0070681_100077172 371
697 3300005459 Ga0068867_100000678 Ga0068867_1000006783 371
698 3300005530 Ga0070679_100000397 Ga0070679_10000039710 371
699 3300005539 Ga0068853_100002716 Ga0068853_1000027168 371
700 3300005539 Ga0068853_100149590 Ga0068853_1001495902 371
701 3300005543 Ga0070672_100000067 Ga0070672_10000006712 371
702 3300005547 Ga0070693_100034731 Ga0070693_1000347313 371
703 3300005548 Ga0070665_100002117 Ga0070665_1000021177 371
704 3300005563 Ga0068855_100071361 Ga0068855_1000713613 371
705 3300005618 Ga0068864_100012055 Ga0068864_1000120552 371
706 3300005719 Ga0068861_100230903 Ga0068861_1002309032 371
707 3300005834 Ga0068851_10001272 Ga0068851_100012721 371
708 3300005841 Ga0068863_100002443 Ga0068863_1000024433 371
709 3300005843 Ga0068860_100039626 Ga0068860_1000396263 371
710 3300006948 Ga0099826_10007777 Ga0099826_100077774 371
711 3300009036 Ga0105244_10000063 Ga0105244_1000006333 371
712 3300009093 Ga0105240_10019796 Ga0105240_100197965 371
713 3300009093 Ga0105240_10305433 Ga0105240_103054332 371
714 3300009101 Ga0105247_10090314 Ga0105247_100903142 371
715 3300009174 Ga0105241_10000105 Ga0105241_1000010529 371
716 3300009176 Ga0105242_10144251 Ga0105242_101442512 371
717 3300009177 Ga0105248_10054545 Ga0105248_100545454 371
718 3300009545 Ga0105237_10048637 Ga0105237_100486373 371
719 3300009553 Ga0105249_10033891 Ga0105249_100338913 371
720 3300011119 Ga0105246_10051112 Ga0105246_100511122 371
721 3300013102 Ga0157371_10005877 Ga0157371_100058774 371
722 3300013104 Ga0157370_10000703 Ga0157370_100007033 371
723 3300013104 Ga0157370_10059792 Ga0157370_100597922 371
724 3300013104 Ga0157370_10068257 Ga0157370_100682572 371
725 3300013105 Ga0157369_10001138 Ga0157369_100011386 371
726 3300013105 Ga0157369_10105452 Ga0157369_101054523 371
727 3300013297 Ga0157378_10069761 Ga0157378_100697613 371
728 3300013306 Ga0163162_10011686 Ga0163162_100116867 371
729 3300013306 Ga0163162_10073353 Ga0163162_100733534 371
730 3300013307 Ga0157372_10110049 Ga0157372_101100493 371
731 3300013308 Ga0157375_10020011 Ga0157375_100200113 371
732 3300014968 Ga0157379_10022058 Ga0157379_100220586 371
733 3300014968 Ga0157379_10061632 Ga0157379_100616321 371
734 3300014969 Ga0157376_10450428 Ga0157376_104504281 371
735 3300014969 Ga0157376_10450430 Ga0157376_104504301 371
736 3300015261 Ga0182006_1001549 Ga0182006_10015496 371
737 3300017792 Ga0163161_10000012 Ga0163161_1000001234 371
738 3300017792 Ga0163161_10034726 Ga0163161_100347262 371
739 3300025728 Ga0207655_1000008 Ga0207655_1000008620 371
740 3300025903 Ga0207680_10031567 Ga0207680_100315673 371
741 3300025907 Ga0207645_10000776 Ga0207645_100007762 371
742 3300025911 Ga0207654_10001533 Ga0207654_100015333 371
743 3300025912 Ga0207707_10000205 Ga0207707_1000020520 371
744 3300025913 Ga0207695_10003840 Ga0207695_1000384010 371
745 3300025921 Ga0207652_10000186 Ga0207652_1000018643 371
746 3300025933 Ga0207706_10086259 Ga0207706_100862592 371
747 3300025940 Ga0207691_10002208 Ga0207691_100022084 371
748 3300025941 Ga0207711_10084963 Ga0207711_100849632 371
749 3300025942 Ga0207689_10030127 Ga0207689_100301274 371
750 3300025960 Ga0207651_10000296 Ga0207651_100002967 371
751 3300025972 Ga0207668_10000272 Ga0207668_1000027215 371
752 3300026035 Ga0207703_10058478 Ga0207703_100584783 371
753 3300026041 Ga0207639_10005538 Ga0207639_100055386 371
754 3300026041 Ga0207639_10194961 Ga0207639_101949612 371
755 3300026067 Ga0207678_10131516 Ga0207678_101315162 371
756 3300026088 Ga0207641_10003749 Ga0207641_100037497 371
757 3300026089 Ga0207648_10000786 Ga0207648_100007867 371
758 3300026095 Ga0207676_10001574 Ga0207676_1000157410 371
759 3300026118 Ga0207675_100236489 Ga0207675_1002364892 371
760 3300026142 Ga0207698_10215309 Ga0207698_102153092 371
761 3300027111 Ga0209281_1000244 Ga0209281_1000244107 371
762 3300027361 Ga0209489_115968 Ga0209489_1159683 371
763 3300028379 Ga0268266_10002971 Ga0268266_100029713 371
764 3300028381 Ga0268264_10032292 Ga0268264_100322922 371
765 3300031727 Ga0316576_10054425 Ga0316576_100544253 371
766 3300031824 Ga0307413_10002944 Ga0307413_100029442 371
767 3300031824 Ga0307413_10192730 Ga0307413_101927301 371
768 3300031852 Ga0307410_10000067 Ga0307410_1000006719 371
769 3300031901 Ga0307406_10000035 Ga0307406_1000003559 371
770 3300032002 Ga0307416_100000639 Ga0307416_10000063914 371
771 3300032004 Ga0307414_10000063 Ga0307414_1000006346 371
772 3300032005 Ga0307411_10000001 Ga0307411_10000001434 371
773 3300033180 Ga0307510_10133750 Ga0307510_101337502 371
774 3300036401 Ga0373937_0101686 Ga0373937_0101686_1260_2378 371
775 3300036712 Ga0316584_0046497 Ga0316584_0046497_1451_2569 371
776 3300041407 Ga0439447_004758 Ga0439447_004758_1357_2475 371
777 3300041411 Ga0439466_0002720 Ga0439466_0002720_4485_5603 371
778 3300046473 Ga0495582_0010257 Ga0495582_0010257_1205_2323 371
779 3300046559 Ga0495667_0159750 Ga0495667_0159750_167_1285 371
780 3300047319 Ga0495674_0025349 Ga0495674_0025349_2355_3473 371
781 3300048912 Ga0496109_0015035 Ga0496109_0015035_2771_3889 371
782 3300048919 Ga0496116_0000032 Ga0496116_0000032_130561_131679 371
783 3300048924 Ga0496121_0008699 Ga0496121_0008699_4333_5451 371
784 3300048927 Ga0496124_0023852 Ga0496124_0023852_2859_3977 371
785 3300048928 Ga0496125_0000059 Ga0496125_0000059_128139_129257 371
786 3300048929 Ga0496126_0023187 Ga0496126_0023187_3388_4506 371
787 3300049582 Ga0501048_0010094 Ga0501048_0010094_1110_2228 371
788 3300049584 Ga0501068_0013638 Ga0501068_0013638_426_1544 371
789 3300049671 Ga0501238_000316 Ga0501238_000316_173_1291 371
790 3300049679 Ga0501249_000009 Ga0501249_000009_23007_24125 371
791 3300049763 Ga0501266_000039 Ga0501266_000039_21495_22613 371
792 3300049776 Ga0501280_001414 Ga0501280_001414_190_1308 371
793 3300053096 Ga0500641_0000017 Ga0500641_0000017_126137_127255 371
794 3300053096 Ga0500641_0001009 Ga0500641_0001009_7045_8163 371
795 3300053134 Ga0500658_0000003 Ga0500658_0000003_179643_180761 371
796 3300053136 Ga0500559_0011905 Ga0500559_0011905_596_1714 371
797 3300053140 Ga0500573_0109930 Ga0500573_0109930_301_1419 371
798 3300054114 Ga0501084_0014972 Ga0501084_0014972_3065_4183 371
799 3300060353 Ga0501082_0026906 Ga0501082_0026906_133_1251 371
800 3300005843 Ga0068860_100003389 Ga0068860_10000338915 372
801 3300005844 Ga0068862_100052004 Ga0068862_1000520043 372
802 3300025925 Ga0207650_10190430 Ga0207650_101904301 372
803 3300028381 Ga0268264_10006613 Ga0268264_100066138 372
804 3300031727 Ga0316576_10018872 Ga0316576_100188722 372
805 2162886007 SwRhRL2b_contig_95641 SwRhRL2b_0542.00005230 373
806 3300003323 rootH1_10155400 rootH1_101554002 373
807 3300005289 Ga0065704_10092508 Ga0065704_100925083 373
808 3300005329 Ga0070683_100011995 Ga0070683_1000119951 373
809 3300005337 Ga0070682_100000153 Ga0070682_10000015321 373
810 3300009036 Ga0105244_10000261 Ga0105244_1000026110 373
811 3300009148 Ga0105243_10000564 Ga0105243_1000056427 373
812 3300013104 Ga0157370_10004625 Ga0157370_1000462519 373
813 3300013105 Ga0157369_10000224 Ga0157369_100002243 373
814 3300025291 Ga0209675_1000033 Ga0209675_100003339 373
815 3300025728 Ga0207655_1002095 Ga0207655_10020959 373
816 3300025935 Ga0207709_10000462 Ga0207709_1000046227 373
817 3300025944 Ga0207661_10081685 Ga0207661_100816851 373
818 3300046453 Ga0495627_000003 Ga0495627_000003_363191_364312 373
819 3300046453 Ga0495627_004497 Ga0495627_004497_250_1371 373
820 3300046500 Ga0495596_0000277 Ga0495596_0000277_16666_17790 373
821 3300046507 Ga0495606_0014393 Ga0495606_0014393_434_1558 373
822 3300046512 Ga0495610_0000001 Ga0495610_0000001_1473637_1474761 373
823 3300046519 Ga0495632_0005413 Ga0495632_0005413_2836_3957 373
824 3300046525 Ga0495663_0003000 Ga0495663_0003000_3536_4660 373
825 3300046530 Ga0495654_0000001 Ga0495654_0000001_756518_757639 373
826 3300046558 Ga0495633_0000008 Ga0495633_0000008_188860_189981 373
827 3300046558 Ga0495633_0004847 Ga0495633_0004847_5684_6805 373
828 3300046660 Ga0495625_0001823 Ga0495625_0001823_7466_8587 373
829 3300047472 Ga0495686_0000118 Ga0495686_0000118_147990_149111 373
830 3300047472 Ga0495686_0022322 Ga0495686_0022322_637_1758 373
831 3300048919 Ga0496116_0000053 Ga0496116_0000053_133818_134942 373
832 3300048920 Ga0496117_0000089 Ga0496117_0000089_21726_22850 373
833 3300048921 Ga0496118_0001078 Ga0496118_0001078_23566_24690 373
834 3300048921 Ga0496118_0138928 Ga0496118_0138928_109_1230 373
835 3300048922 Ga0496119_0000038 Ga0496119_0000038_21719_22843 373
836 3300048924 Ga0496121_0056645 Ga0496121_0056645_1098_2222 373
837 3300048925 Ga0496122_0000118 Ga0496122_0000118_24780_25904 373
838 3300048925 Ga0496122_0001213 Ga0496122_0001213_17617_18741 373
839 3300048925 Ga0496122_0009811 Ga0496122_0009811_2045_3169 373
840 3300048925 Ga0496122_0019641 Ga0496122_0019641_3003_4127 373
841 3300048926 Ga0496123_0002780 Ga0496123_0002780_8899_10023 373
842 3300048927 Ga0496124_0001056 Ga0496124_0001056_37461_38585 373
843 3300048928 Ga0496125_0008819 Ga0496125_0008819_1890_3014 373
844 3300048928 Ga0496125_0009663 Ga0496125_0009663_2053_3177 373
845 3300048929 Ga0496126_0009798 Ga0496126_0009798_5626_6750 373

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00180

Iso_dh

Isocitrate/isopropylmalate dehydrogenase

4

339

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1a05-assembly1.cif.gz_B crystal structure of the complex of 3-isopropylmalate dehydrogenase from thiobacillus ferrooxidans with 3-isopropylmalate 0.9638 5 354
5j33-assembly3.cif.gz_F isopropylmalate dehydrogenase in complex with nad+ 0.9609 3 352
4wuo-assembly1.cif.gz_B structure of the e270a mutant isopropylmalate dehydrogenase from thermus thermophilus in complex with ipm, mn and nadh 0.9581 6 352
6xxy-assembly1.cif.gz_B crystal structure of haemophilus influenzae 3-isopropylmalate dehydrogenase in complex with o-isobutenyl oxalylhydroxamate. 0.9577 3 350
3wzy-assembly1.cif.gz_A-2 s266a mutant 3-isopropylmalate dehydrogenase from shewanella oneidensis mr-1 at 580mpa - complex with ipm and mg 0.9559 3 353
ID Description Score Start End Superfamily
5hn5A00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.953 5 353 3.40.718.10
5hn5A00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.928 5 353 3.40.718.10
3u1hA00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.9273 6 372 3.40.718.10
af_A0A1D6Q461_5_211_3.40.718.10 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.9226 162 352 3.40.718.10
3u1hA00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.9222 6 372 3.40.718.10
ID Description Score Start End GO Terms
AF-A0A5N9E846-F1-model_v4 Isopropylmalate dehydrogenase-like domain-containing protein 0.9948 4 81 GO:0003862
GO:0005829
GO:0009098
GO:0046872
AF-X1TLG0-F1-model_v4 Isopropylmalate dehydrogenase-like domain-containing protein 0.9943 3 77 GO:0003862
GO:0005829
GO:0009098
GO:0046872
AF-A0A1B6DTA9-F1-model_v4 3-isopropylmalate dehydrogenase (EC 1.1.1.85) 0.9924 3 313 GO:0000287
GO:0003862
GO:0005829
GO:0006099
GO:0009098
GO:0051287
AF-A0A3D5S8N2-F1-model_v4 3-isopropylmalate dehydrogenase 0.9895 4 230 GO:0003862
GO:0005829
GO:0009098
GO:0046872
AF-A0A399YM76-F1-model_v4 3-isopropylmalate dehydrogenase 0.9893 3 76 GO:0003862
GO:0005829
GO:0009098
GO:0046872

Feature Viewer

pLDDT pTM Quality
92.13 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map