F483254

General Info

Members Datasets Scaffolds Average Seq Length
845 542 637 569

Family's Representative Sequence

Representative Sequence 3300025728|Ga0207655_1000027|Ga0207655_1000027249
Length 653
Sequence MRRAGGARSVPPRKSQADTKELEISALRPIVGNRVGNQEFSAHREIFPDTTIKPKVAVMTRSPRRPLFAVSLVLSAMLLAGAAHAAVSNEEILQDPKNPQQIVTNGLGVQGQRYSPLDLLNANNVKELRPVWAFSFGGEKQRGQQAQPLIKDGVMYLTGSYSRVFAVDARTGKKLWQYDARLPDDIRPCCDVINRGVALYGDLVFFGTLDAKLVALNKDTGKVVWSKKVADHKEGYSISAAPMIVNGKLITGVAGGEFGVVGKIQAYNPENGELLWMRPTVEGHMGYVYKDGKAIENGISGGEAGKTWPGDLWKTGGAAPWLGGYYDPETNLILFGTGNPAPWNSHLRPGDNLYSSSRLALNPDDGTIKWHFQSTPHDGWDFDGVNELISFNYKDGGKEVKAAATADRNGFFYVLDRTNGKFIRGFPFVDKITWATGLDKDGRPIYNDASRPGAPGSEAKGSSVFVAPAFLGAKNWMPMAYNKDTGLFYVPSNEWGMDIWNEGIAYKKGAAFLGAGFTIKPLNEDYIGVLRAIDPISGKEVWRHKNYAPLWGGVLTTKGNLVFTGTPEGFLQAFNAKTGDKVWEFQTGSGVLGSPVTWEMDGEQYVSVVSGWGGAVPLWGGEVAKRVKDFNQGGMLWTFKLPKQLQQTASAQP

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2511231004 Pseudomonas sp. GM102 Isolate Nodule
4 2511231007 Pseudomonas sp. GM18 Isolate Nodule
5 2511231008 Pseudomonas sp. GM21 Isolate Nodule
6 2511231012 Pseudomonas sp. GM33 Isolate Nodule
7 2511231015 Pseudomonas sp. GM49 Isolate Nodule
8 2511231016 Pseudomonas sp. GM50 Isolate Nodule
9 2511231017 Pseudomonas sp. GM55 Isolate Nodule
10 2511231018 Pseudomonas sp. GM60 Isolate Nodule
11 2511231019 Pseudomonas sp. GM67 Isolate Nodule
12 2511231021 Pseudomonas sp. GM78 Isolate Nodule
13 2511231022 Pseudomonas sp. GM79 Isolate Nodule
14 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
15 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
16 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
17 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
18 2516143018 Ensifer sp. BR816 Isolate Nodule
19 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
20 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
21 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
22 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
23 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
24 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
25 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
26 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
27 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
28 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
29 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
30 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
31 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
32 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
33 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
34 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
35 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
36 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
37 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
38 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
39 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
40 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
41 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
42 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
43 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
44 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
45 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
46 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
47 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
48 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
49 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
50 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
51 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
52 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
53 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
54 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
55 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
56 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
57 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
58 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
59 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
60 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
61 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
62 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
63 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
64 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
65 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
66 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
67 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
68 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
69 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
70 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
71 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
72 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
73 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
74 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
75 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
76 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
77 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
78 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
79 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
80 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
81 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
82 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
83 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
84 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
85 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
86 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
87 2643221660 Methylibium sp. Root1272 Isolate Unclassified
88 2643221664 Massilia sp. Root418 Isolate Unclassified
89 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
90 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
91 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
92 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
93 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
94 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
95 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
96 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
97 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
98 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
99 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
100 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
101 2738541300 Massilia sp. GV016 Isolate Unclassified
102 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
103 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
104 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
105 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
106 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
107 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
108 2738543018 Massilia sp. GV045 Isolate Unclassified
109 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
110 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
111 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
112 2738543030 Massilia sp. GV097 Isolate Unclassified
113 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
114 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
115 2773857670 Pseudomonas sp. 478 Isolate Unclassified
116 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
117 2784132072 Pseudomonas sp. 460 Isolate Unclassified
118 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
119 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
120 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
121 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
122 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
123 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
124 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
125 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
126 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
127 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
128 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
129 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
130 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
131 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
132 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
133 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
134 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
135 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
136 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
137 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
138 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
139 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
140 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
141 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
142 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
143 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
144 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
145 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
146 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
147 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
148 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
149 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
150 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
151 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
152 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
153 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
154 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
155 2885266251 Ralstonia sp. SET104 Isolate Nodule
156 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
157 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
158 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
159 2904456579 Variovorax sp. 2002 Isolate Unclassified
160 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
161 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
162 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
163 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
164 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
165 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
166 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
167 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
168 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
169 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
170 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
171 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
172 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
173 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
174 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
175 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
176 2928058823 Ralstonia sp. 1138 Isolate Unclassified
177 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
178 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
179 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
180 2929520902 Variovorax beijingensis 502 Isolate Unclassified
181 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
182 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
183 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
184 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
185 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
186 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
187 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
188 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
189 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
190 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
191 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
192 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
193 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
194 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
195 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
196 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
197 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
198 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
199 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
200 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
201 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
202 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
203 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
204 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
205 3300003157 Avena fatua rhizosphere microbial communities - H3_Bulk_Litter_17 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
206 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
207 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
208 3300003479 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
209 3300003558 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_10_fullP_mix1_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
210 3300003565 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_16_lowP_mix3_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
211 3300003567 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
212 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
213 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
214 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
215 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
216 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
217 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
218 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
219 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
220 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
221 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
222 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
223 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
224 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
225 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
226 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
227 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
228 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
229 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
230 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
231 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
232 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
233 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
234 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
235 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
236 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
237 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
238 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
239 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
240 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
241 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
242 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
243 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
244 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
245 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
246 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
247 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
248 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
249 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
250 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
251 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
252 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
253 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
254 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
255 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
256 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
257 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
258 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
259 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
260 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
261 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
262 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
263 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
264 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
265 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
266 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
267 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
268 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
269 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
270 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
271 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
272 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
273 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
274 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
275 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
276 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
277 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
278 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
279 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
280 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
281 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
282 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
283 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
284 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
285 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
286 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
287 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
288 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
289 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
290 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
291 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
292 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
293 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
294 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
296 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
297 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
298 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
299 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
300 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
301 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
302 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
303 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
304 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
305 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
306 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
307 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
308 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
309 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
310 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
311 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
312 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
313 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
314 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
315 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
316 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
317 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
318 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
319 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
320 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
321 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
322 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
323 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
324 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
325 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
326 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
327 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
328 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
354 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
355 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
357 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
358 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
359 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
360 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
362 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
363 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
364 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
365 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
366 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
367 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
368 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
369 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
370 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
371 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
373 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
374 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
375 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
376 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
377 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
378 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
379 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
380 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
381 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
382 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
383 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
384 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
385 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
386 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
387 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
388 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
389 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
390 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
391 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
392 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
393 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
394 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
395 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
396 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
397 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
398 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
399 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
400 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
401 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
402 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
403 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
404 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
405 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
406 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
407 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
408 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
409 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
410 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
411 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
412 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
413 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
414 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
415 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
416 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
417 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
418 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
419 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
420 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
421 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
422 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
423 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
424 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
425 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
426 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
427 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
428 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
429 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
430 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
431 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
432 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
433 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
434 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
435 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
436 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
437 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
438 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
439 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
440 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
441 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
442 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
443 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
444 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
445 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
446 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
447 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
448 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
449 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
450 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
451 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
452 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
453 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
454 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
455 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
456 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
457 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
458 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
459 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
460 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
461 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
462 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
463 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
464 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
465 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
466 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
467 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
468 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
469 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
470 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
471 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
472 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
473 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
474 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
475 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
476 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
477 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
478 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
479 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
480 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
481 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
482 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
483 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
484 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
485 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
486 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
487 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
488 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
489 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
490 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
491 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
492 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
493 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
494 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
495 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
496 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
497 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
498 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
499 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
500 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
501 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
502 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
503 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
504 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
505 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
506 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
507 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
508 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
509 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
510 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
511 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
512 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
513 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
514 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
515 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
516 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
517 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
518 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
519 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
520 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
521 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
522 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
523 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
524 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
525 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
526 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
527 646564506 Arcobacter nitrofigilis DSM 7299 Isolate Unclassified
528 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
529 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
530 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
531 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
532 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
533 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
534 8052494512 Pseudomonas putida LD6 Isolate Unclassified
535 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
536 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
537 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
538 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
539 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
540 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
541 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
542 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 73.73
Metatranscriptomes 1.66
Isolates 24.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.9
Nodule 4.14
Rhizoplane 8.05
Rhizosphere 58.11
Stem 0
Stem Tuber 0
Unclassified 16.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_5158 2124908027 Bacteria 19190
2 SwRhRL2b_contig_2160423 2162886007 Bacteria 2025
3 JGI24736J21556_1000711 3300001904 Bacteria 6068
4 JGI24741J21665_1000182 3300001915 Bacteria 18224
5 JGI24741J21665_1000642 3300001915 Bacteria 10568
6 JGI24740J21852_10000084 3300001979 Bacteria 32275
7 JGI24740J21852_10000388 3300001979 Bacteria 18881
8 JGI24740J21852_10000924 3300001979 Bacteria 13055
9 JGI24740J21852_10001008 3300001979 Bacteria 12592
10 JGI24737J22298_10000869 3300001990 Bacteria 10788
11 JGI24737J22298_10001102 3300001990 Bacteria 9496
12 JGI24735J21928_10002829 3300002067 Bacteria 5988
13 JGI24738J21930_10006730 3300002075 Bacteria 2675
14 JGI25156J39149_1000247 3300002705 Bacteria 37338
15 JGI25156J39149_1000284 3300002705 Bacteria 34180
16 JGI25162J39368_1000013 3300002737 Bacteria 343384
17 JGI25162J39368_1000050 3300002737 Bacteria 157157
18 JGI25154J39366_1000792 3300002738 Bacteria 14000
19 JGI25154J39366_1003144 3300002738 Bacteria 3671
20 JGI25157J39369_1000280 3300002741 Bacteria 37332
21 JGI25164J39214_1000005 3300002772 Bacteria 343384
22 JGI25164J39214_1000025 3300002772 Bacteria 157157
23 JGI25152J39213_1000747 3300002773 Bacteria 16582
24 JGI25150J39212_1000509 3300002774 Bacteria 16087
25 JGI25150J39212_1001065 3300002774 Bacteria 8347
26 Ga0006774J45829_10489 3300003157 Bacteria 1945
27 JGI25165J46597_1000099 3300003214 Bacteria 158550
28 JGI25165J46597_1000114 3300003214 Bacteria 144350
29 JGI25165J46597_1000176 3300003214 Bacteria 99160
30 JGI25153J46596_10000179 3300003215 Bacteria 62415
31 JGI25153J46596_10007048 3300003215 Bacteria 5593
32 Ga0006556J51387_1002520 3300003479 Bacteria 8573
33 Ga0006558J51389_1003962 3300003558 Bacteria 8580
34 Ga0006560J51390_1001645 3300003565 Bacteria 8700
35 Ga0006554J51385_1007769 3300003567 Bacteria 4660
36 Ga0006562J51391_1005668 3300003578 Bacteria 8205
37 Ga0006562J51391_1145654 3300003578 Bacteria 2207
38 Ga0055538_1001384 3300003751 Bacteria 4751
39 Ga0055539_1000068 3300003752 Bacteria 134912
40 Ga0055539_1000287 3300003752 Bacteria 28380
41 Ga0055533_1000045 3300003756 Bacteria 223637
42 Ga0055533_1000386 3300003756 Bacteria 17595
43 Ga0055532_1000028 3300003758 Bacteria 234512
44 Ga0055525_1000012 3300003759 Bacteria 486564
45 Ga0055525_1000723 3300003759 Bacteria 11605
46 Ga0055527_1001261 3300003760 Bacteria 5564
47 Ga0055535_1000022 3300003761 Bacteria 234512
48 Ga0055535_1000275 3300003761 Bacteria 53952
49 Ga0055535_1005127 3300003761 Bacteria 2962
50 Ga0055542_1000025 3300003762 Bacteria 263538
51 Ga0055529_1000014 3300003763 Bacteria 367283
52 Ga0055529_1000145 3300003763 Bacteria 101255
53 Ga0055529_1000323 3300003763 Bacteria 53943
54 Ga0055537_1000484 3300003773 Bacteria 24629
55 Ga0055524_1004765 3300003775 Bacteria 6194
56 Ga0055534_1000406 3300003784 Bacteria 26436
57 Ga0055530_10000075 3300003791 Bacteria 84932
58 Ga0055540_1000115 3300003792 Bacteria 84932
59 Ga0055540_1001656 3300003792 Bacteria 12919
60 Ga0055540_1009310 3300003792 Bacteria 3407
61 Ga0055541_1001507 3300003841 Bacteria 5016
62 Ga0065714_10002340 3300005288 Bacteria 25797
63 Ga0065714_10074368 3300005288 Bacteria 3047
64 Ga0065704_10000778 3300005289 Bacteria 18558
65 Ga0065704_10007641 3300005289 Bacteria 2861
66 Ga0065704_10019304 3300005289 Bacteria 3314
67 Ga0065704_10099251 3300005289 Bacteria 2319
68 Ga0065704_10103485 3300005289 Bacteria 2170
69 Ga0065712_10013359 3300005290 Bacteria 2944
70 Ga0070658_10047548 3300005327 Bacteria 3472
71 Ga0070676_10007335 3300005328 Bacteria 5916
72 Ga0070683_100071398 3300005329 Bacteria 3240
73 Ga0070670_100000303 3300005331 Bacteria 42489
74 Ga0068868_100020175 3300005338 Bacteria 5003
75 Ga0068868_100030410 3300005338 Bacteria 4141
76 Ga0070661_100000002 3300005344 Bacteria 265686
77 Ga0070661_100002107 3300005344 Bacteria 13699
78 Ga0070661_100014968 3300005344 Bacteria 5472
79 Ga0070669_100023152 3300005353 Bacteria 4446
80 Ga0070674_100000078 3300005356 Bacteria 44919
81 Ga0070673_100008566 3300005364 Bacteria 6807
82 Ga0070667_100000036 3300005367 Bacteria 172536
83 Ga0070663_100000005 3300005455 Bacteria 251758
84 Ga0070663_100001970 3300005455 Bacteria 11459
85 Ga0070678_100000005 3300005456 Bacteria 70019
86 Ga0068867_100000059 3300005459 Bacteria 68279
87 Ga0068867_100003198 3300005459 Bacteria 11546
88 Ga0068867_100066953 3300005459 Bacteria 2676
89 Ga0070706_100017358 3300005467 Bacteria 6640
90 Ga0068853_100054173 3300005539 Bacteria 3456
91 Ga0070672_100089138 3300005543 Bacteria 2485
92 Ga0070664_100000001 3300005564 Bacteria 551832
93 Ga0070664_100002981 3300005564 Bacteria 13699
94 Ga0068857_100027609 3300005577 Bacteria 5007
95 Ga0068854_100000030 3300005578 Bacteria 111321
96 Ga0068854_100000932 3300005578 Bacteria 17578
97 Ga0068854_100009039 3300005578 Bacteria 6420
98 Ga0068856_100000008 3300005614 Bacteria 190886
99 Ga0068856_100002287 3300005614 Bacteria 19767
100 Ga0068859_100001847 3300005617 Bacteria 21526
101 Ga0068863_100004775 3300005841 Bacteria 13353
102 Ga0068863_100025167 3300005841 Bacteria 5675
103 Ga0068860_100000063 3300005843 Bacteria 189519
104 Ga0075365_10022563 3300006038 Bacteria 3946
105 Ga0075432_10001039 3300006058 Bacteria 8837
106 Ga0070712_100007112 3300006175 Bacteria 6984
107 Ga0075362_10006557 3300006177 Bacteria 4347
108 Ga0075362_10016832 3300006177 Bacteria 3001
109 Ga0075369_10001143 3300006186 Bacteria 8949
110 Ga0075366_10000092 3300006195 Bacteria 36018
111 Ga0075366_10000924 3300006195 Bacteria 14249
112 Ga0075366_10001343 3300006195 Bacteria 12291
113 Ga0075366_10028656 3300006195 Bacteria 3269
114 Ga0075370_10000335 3300006353 Bacteria 16965
115 Ga0075430_100008435 3300006846 Bacteria 8707
116 Ga0075429_100000203 3300006880 Bacteria 39542
117 Ga0075436_100050914 3300006914 Bacteria 2858
118 Ga0097620_100001847 3300006931 Bacteria 21526
119 Ga0099823_1000001 3300006944 Bacteria 216833
120 Ga0079104_1000303 3300006946 Bacteria 62394
121 Ga0079104_1000554 3300006946 Bacteria 38699
122 Ga0099826_10026578 3300006948 Bacteria 4267
123 Ga0105251_10012550 3300009011 Bacteria 4789
124 Ga0105244_10000016 3300009036 Bacteria 255363
125 Ga0105244_10001524 3300009036 Bacteria 18507
126 Ga0105244_10004851 3300009036 Bacteria 9120
127 Ga0105244_10008586 3300009036 Bacteria 6370
128 Ga0105244_10016545 3300009036 Bacteria 4199
129 Ga0105250_10000353 3300009092 Bacteria 35144
130 Ga0105240_10000220 3300009093 Bacteria 115299
131 Ga0105240_10252249 3300009093 Bacteria 2040
132 Ga0114129_10240297 3300009147 Bacteria 2435
133 Ga0105243_10000030 3300009148 Bacteria 190342
134 Ga0105243_10055083 3300009148 Bacteria 3159
135 Ga0105241_10005180 3300009174 Bacteria 9619
136 Ga0105242_10022928 3300009176 Bacteria 4917
137 Ga0105248_10001130 3300009177 Bacteria 29698
138 Ga0105237_10000099 3300009545 Bacteria 120098
139 Ga0105237_10003006 3300009545 Bacteria 20353
140 Ga0105237_10006234 3300009545 Bacteria 13284
141 Ga0105237_10024834 3300009545 Bacteria 6132
142 Ga0105237_10069063 3300009545 Bacteria 3528
143 Ga0105239_10000111 3300010375 Bacteria 115283
144 Ga0105239_10019943 3300010375 Bacteria 7399
145 Ga0105239_10033874 3300010375 Bacteria 5607
146 Ga0105246_10040883 3300011119 Bacteria 3132
147 Ga0157373_10001148 3300013100 Bacteria 20279
148 Ga0157373_10008114 3300013100 Bacteria 7806
149 Ga0157373_10010732 3300013100 Bacteria 6739
150 Ga0157373_10064853 3300013100 Bacteria 2585
151 Ga0157371_10000035 3300013102 Bacteria 223396
152 Ga0157371_10000183 3300013102 Bacteria 92426
153 Ga0157371_10001502 3300013102 Bacteria 24121
154 Ga0157371_10001866 3300013102 Bacteria 21095
155 Ga0157370_10000021 3300013104 Bacteria 166168
156 Ga0157370_10001953 3300013104 Bacteria 25403
157 Ga0157370_10009438 3300013104 Bacteria 10423
158 Ga0157369_10012461 3300013105 Bacteria 9646
159 Ga0157369_10037886 3300013105 Bacteria 5276
160 Ga0157372_10000225 3300013307 Bacteria 62752
161 Ga0157372_10001218 3300013307 Bacteria 27843
162 Ga0157375_10095431 3300013308 Bacteria 3045
163 Ga0182008_10001536 3300014497 Bacteria 15362
164 Ga0182008_10007960 3300014497 Bacteria 5813
165 Ga0182008_10009829 3300014497 Bacteria 5143
166 Ga0182008_10018151 3300014497 Bacteria 3644
167 Ga0157377_10000029 3300014745 Bacteria 134270
168 Ga0182006_1001034 3300015261 Bacteria 18093
169 Ga0182006_1001143 3300015261 Bacteria 16891
170 Ga0182006_1001202 3300015261 Bacteria 16166
171 Ga0182006_1001942 3300015261 Bacteria 11744
172 Ga0182007_10000071 3300015262 Bacteria 81966
173 Ga0182007_10000877 3300015262 Bacteria 16671
174 Ga0182007_10001255 3300015262 Bacteria 13789
175 Ga0182005_1000524 3300015265 Bacteria 19519
176 Ga0182005_1000619 3300015265 Bacteria 17139
177 Ga0183362_10002 3300015683 Bacteria 1432711
178 Ga0183363_1005 3300015690 Bacteria 403020
179 Ga0163161_10004705 3300017792 Bacteria 9493
180 Ga0163161_10004884 3300017792 Bacteria 9339
181 Ga0163161_10024693 3300017792 Bacteria 4249
182 Ga0154015_1469424 3300020610 Bacteria 24934
183 Ga0214544_1001054 3300021320 Bacteria 55518
184 Ga0214542_1000019 3300021321 Bacteria 199445
185 Ga0214543_1000010 3300021327 Bacteria 364844
186 Ga0228711_1001487 3300022739 Bacteria 34563
187 Ga0228710_1001373 3300022740 Bacteria 36316
188 Ga0209760_100033 3300025207 Bacteria 136583
189 Ga0209760_100035 3300025207 Bacteria 132204
190 Ga0209784_100014 3300025224 Bacteria 496182
191 Ga0209784_100246 3300025224 Bacteria 34625
192 Ga0209566_100011 3300025225 Bacteria 496182
193 Ga0209566_100403 3300025225 Bacteria 34323
194 Ga0209566_101345 3300025225 Bacteria 7787
195 Ga0209674_100032 3300025226 Bacteria 426888
196 Ga0209674_100073 3300025226 Bacteria 223689
197 Ga0209674_100131 3300025226 Bacteria 118079
198 Ga0209672_100137 3300025228 Bacteria 71589
199 Ga0209147_100002 3300025229 Bacteria 2158988
200 Ga0209563_100029 3300025230 Bacteria 496182
201 Ga0209563_100030 3300025230 Bacteria 489259
202 Ga0209563_100061 3300025230 Bacteria 274295
203 Ga0207427_100003 3300025231 Bacteria 1035004
204 Ga0207427_100018 3300025231 Bacteria 530735
205 Ga0207427_100551 3300025231 Bacteria 19055
206 Ga0209437_100002 3300025233 Bacteria 1574801
207 Ga0209437_100031 3300025233 Bacteria 530871
208 Ga0209258_100002 3300025242 Bacteria 2158988
209 Ga0209258_100071 3300025242 Bacteria 278319
210 Ga0209258_101275 3300025242 Bacteria 9474
211 Ga0209646_1000058 3300025246 Bacteria 259999
212 Ga0209646_1000249 3300025246 Bacteria 54511
213 Ga0209026_1000011 3300025250 Bacteria 507291
214 Ga0209026_1002043 3300025250 Bacteria 7978
215 Ga0209677_100042 3300025253 Bacteria 225037
216 Ga0209677_100070 3300025253 Bacteria 143311
217 Ga0209677_100160 3300025253 Bacteria 60301
218 Ga0209148_1000011 3300025254 Bacteria 1196503
219 Ga0209148_1000043 3300025254 Bacteria 461531
220 Ga0209759_1000034 3300025256 Bacteria 271209
221 Ga0209759_1000878 3300025256 Bacteria 22980
222 Ga0209759_1002422 3300025256 Bacteria 8203
223 Ga0209759_1007957 3300025256 Bacteria 3352
224 Ga0209129_1000722 3300025258 Bacteria 21252
225 Ga0209233_1000004 3300025261 Bacteria 1574798
226 Ga0209233_1000012 3300025261 Bacteria 1019519
227 Ga0209565_1000085 3300025263 Bacteria 153075
228 Ga0209565_1011740 3300025263 Bacteria 2118
229 Ga0209455_1000006 3300025272 Bacteria 1196503
230 Ga0209455_1000009 3300025272 Bacteria 1042273
231 Ga0209455_1000030 3300025272 Bacteria 533479
232 Ga0209673_1001052 3300025273 Bacteria 31821
233 Ga0209675_1000083 3300025291 Bacteria 153075
234 Ga0209676_1000617 3300025292 Bacteria 51959
235 Ga0209676_1004064 3300025292 Bacteria 8411
236 Ga0209025_1003640 3300025294 Bacteria 14310
237 Ga0209758_1000007 3300025297 Bacteria 1270410
238 Ga0209758_1002100 3300025297 Bacteria 21160
239 Ga0209758_1002961 3300025297 Bacteria 16289
240 Ga0209050_1000013 3300025298 Bacteria 811408
241 Ga0209050_1000914 3300025298 Bacteria 38994
242 Ga0209256_1001697 3300025299 Bacteria 21250
243 Ga0209051_1000007 3300025303 Bacteria 811408
244 Ga0209051_1002295 3300025303 Bacteria 13956
245 Ga0209051_1002532 3300025303 Bacteria 12929
246 Ga0209257_1011899 3300025304 Bacteria 4108
247 Ga0207656_10009882 3300025321 Bacteria 3553
248 Ga0207696_1000016 3300025711 Bacteria 502467
249 Ga0207696_1000108 3300025711 Bacteria 157445
250 Ga0207696_1012629 3300025711 Bacteria 2979
251 Ga0207655_1000027 3300025728 Bacteria 444552
252 Ga0207655_1000114 3300025728 Bacteria 164098
253 Ga0207655_1000384 3300025728 Bacteria 61818
254 Ga0207655_1002020 3300025728 Bacteria 17156
255 Ga0207655_1003059 3300025728 Bacteria 12750
256 Ga0207655_1022254 3300025728 Bacteria 3186
257 Ga0207655_1028880 3300025728 Bacteria 2607
258 Ga0207713_1000185 3300025735 Bacteria 88697
259 Ga0207713_1001969 3300025735 Bacteria 15463
260 Ga0207713_1002029 3300025735 Bacteria 15167
261 Ga0207713_1015292 3300025735 Bacteria 3946
262 Ga0207713_1022044 3300025735 Bacteria 3035
263 Ga0207713_1034813 3300025735 Bacteria 2183
264 Ga0207645_10008891 3300025907 Bacteria 6976
265 Ga0207705_10000752 3300025909 Bacteria 26709
266 Ga0207684_10018394 3300025910 Bacteria 5982
267 Ga0207654_10001142 3300025911 Bacteria 14298
268 Ga0207695_10000213 3300025913 Bacteria 155843
269 Ga0207695_10001452 3300025913 Bacteria 39680
270 Ga0207695_10004535 3300025913 Bacteria 18900
271 Ga0207695_10009243 3300025913 Bacteria 12215
272 Ga0207695_10014624 3300025913 Bacteria 9282
273 Ga0207695_10046919 3300025913 Bacteria 4576
274 Ga0207671_10000918 3300025914 Bacteria 37118
275 Ga0207671_10001354 3300025914 Bacteria 28611
276 Ga0207671_10013772 3300025914 Bacteria 6421
277 Ga0207671_10034150 3300025914 Bacteria 3781
278 Ga0207657_10027377 3300025919 Bacteria 5222
279 Ga0207657_10040355 3300025919 Bacteria 4135
280 Ga0207649_10000577 3300025920 Bacteria 25047
281 Ga0207649_10002446 3300025920 Bacteria 10395
282 Ga0207649_10002538 3300025920 Bacteria 10167
283 Ga0207694_10030644 3300025924 Bacteria 4107
284 Ga0207694_10039858 3300025924 Bacteria 3615
285 Ga0207694_10052525 3300025924 Bacteria 3159
286 Ga0207650_10000068 3300025925 Bacteria 139947
287 Ga0207690_10001322 3300025932 Bacteria 15581
288 Ga0207706_10030797 3300025933 Bacteria 4785
289 Ga0207706_10044090 3300025933 Bacteria 3953
290 Ga0207709_10000137 3300025935 Bacteria 106203
291 Ga0207709_10000911 3300025935 Bacteria 22279
292 Ga0207709_10033091 3300025935 Bacteria 3033
293 Ga0207669_10000093 3300025937 Bacteria 45459
294 Ga0207691_10072392 3300025940 Bacteria 3109
295 Ga0207691_10075591 3300025940 Bacteria 3037
296 Ga0207711_10001219 3300025941 Bacteria 24358
297 Ga0207689_10074851 3300025942 Bacteria 2782
298 Ga0207679_10000003 3300025945 Bacteria 597553
299 Ga0207679_10001702 3300025945 Bacteria 13713
300 Ga0207667_10000107 3300025949 Bacteria 133066
301 Ga0207667_10032962 3300025949 Bacteria 5575
302 Ga0207640_10000070 3300025981 Bacteria 80803
303 Ga0207640_10001944 3300025981 Bacteria 11122
304 Ga0207640_10002305 3300025981 Bacteria 10255
305 Ga0207658_10000482 3300025986 Bacteria 36904
306 Ga0207677_10009710 3300026023 Bacteria 5420
307 Ga0207639_10000561 3300026041 Bacteria 25544
308 Ga0207639_10000895 3300026041 Bacteria 20198
309 Ga0207678_10000002 3300026067 Bacteria 371723
310 Ga0207678_10000943 3300026067 Bacteria 26547
311 Ga0207678_10001250 3300026067 Bacteria 23447
312 Ga0207702_10000031 3300026078 Bacteria 175405
313 Ga0207702_10005445 3300026078 Bacteria 11137
314 Ga0207702_10005713 3300026078 Bacteria 10845
315 Ga0207702_10013157 3300026078 Bacteria 6880
316 Ga0207641_10086712 3300026088 Bacteria 2730
317 Ga0207648_10000080 3300026089 Bacteria 92020
318 Ga0207648_10072853 3300026089 Bacteria 2994
319 Ga0207674_10005181 3300026116 Bacteria 15526
320 Ga0207674_10021967 3300026116 Bacteria 6862
321 Ga0207674_10056318 3300026116 Bacteria 3994
322 Ga0207683_10000115 3300026121 Bacteria 65630
323 Ga0207683_10034445 3300026121 Bacteria 4401
324 Ga0207698_10016691 3300026142 Bacteria 4959
325 Ga0209281_1000009 3300027111 Bacteria 771717
326 Ga0209281_1000063 3300027111 Bacteria 288465
327 Ga0209389_1000007 3300027296 Bacteria 227459
328 Ga0209996_1002261 3300027395 Bacteria 2378
329 Ga0209995_1000908 3300027471 Bacteria 4596
330 Ga0209968_1000129 3300027526 Bacteria 13402
331 Ga0209983_1001879 3300027665 Bacteria 4667
332 Ga0209971_1001017 3300027682 Bacteria 7172
333 Ga0209966_1000035 3300027695 Bacteria 56067
334 Ga0209974_10007897 3300027876 Bacteria 3651
335 Ga0268266_10140585 3300028379 Bacteria 2166
336 Ga0268264_10000083 3300028381 Bacteria 245366
337 Ga0265336_10000042 3300028666 Bacteria 136760
338 Ga0307517_10000005 3300028786 Bacteria 260207
339 Ga0307515_10009815 3300028794 Bacteria 18443
340 Ga0307515_10068680 3300028794 Bacteria 4862
341 Ga0265324_10000213 3300029957 Bacteria 44530
342 Ga0265330_10000267 3300031235 Bacteria 38266
343 Ga0265332_10000031 3300031238 Bacteria 162330
344 Ga0265320_10001568 3300031240 Bacteria 16431
345 Ga0307513_10008449 3300031456 Bacteria 13174
346 Ga0307509_10000072 3300031507 Bacteria 140566
347 Ga0307509_10003311 3300031507 Bacteria 24713
348 Ga0307408_100000006 3300031548 Bacteria 472824
349 Ga0307408_100000018 3300031548 Bacteria 346872
350 Ga0307408_100000644 3300031548 Bacteria 29299
351 Ga0307408_100000898 3300031548 Bacteria 23396
352 Ga0307408_100002935 3300031548 Bacteria 11812
353 Ga0307508_10089304 3300031616 Bacteria 2666
354 Ga0307514_10000339 3300031649 Bacteria 111130
355 Ga0265314_10000095 3300031711 Bacteria 134372
356 Ga0265314_10064117 3300031711 Bacteria 2489
357 Ga0307516_10000067 3300031730 Bacteria 111575
358 Ga0307516_10000669 3300031730 Bacteria 46347
359 Ga0307405_10000137 3300031731 Bacteria 28468
360 Ga0307405_10000180 3300031731 Bacteria 23310
361 Ga0307410_10090387 3300031852 Bacteria 2171
362 Ga0307406_10005409 3300031901 Bacteria 6987
363 Ga0307416_100153277 3300032002 Bacteria 2117
364 Ga0307414_10002079 3300032004 Bacteria 10406
365 Ga0307414_10002924 3300032004 Bacteria 9032
366 Ga0307411_10001033 3300032005 Bacteria 10749
367 Ga0307510_10023302 3300033180 Bacteria 7178
368 Ga0373931_0026309 3300035691 Bacteria 2960
369 Ga0373931_0052573 3300035691 Bacteria 2172
370 Ga0395899_0001213 3300037312 Bacteria 22591
371 Ga0395899_0062480 3300037312 Bacteria 2743
372 Ga0395900_0006153 3300037418 Bacteria 12529
373 Ga0395900_0022224 3300037418 Bacteria 6489
374 Ga0395900_0032950 3300037418 Bacteria 5331
375 Ga0395905_0000720 3300037471 Bacteria 43690
376 Ga0395905_0001365 3300037471 Bacteria 29683
377 Ga0395905_0004587 3300037471 Bacteria 14293
378 Ga0395905_0007075 3300037471 Bacteria 11217
379 Ga0395905_0008321 3300037471 Bacteria 10233
380 Ga0395905_0101454 3300037471 Bacteria 2701
381 Ga0395905_0158094 3300037471 Bacteria 2131
382 Ga0395905_0183120 3300037471 Bacteria 1967
383 Ga0400483_029521 3300039062 Bacteria 8340
384 Ga0400483_084836 3300039062 Bacteria 4427
385 Ga0436361_0118095 3300039447 Bacteria 3442
386 Ga0436361_0291965 3300039447 Bacteria 3283
387 Ga0436361_0650737 3300039447 Bacteria 41996
388 Ga0439436_0004667 3300041404 Bacteria 4202
389 Ga0439466_0002538 3300041411 Bacteria 7147
390 Ga0439432_000171 3300042006 Bacteria 22714
391 Ga0439451_004360 3300042009 Bacteria 2874
392 Ga0439463_004592 3300042016 Bacteria 3458
393 Ga0439463_010682 3300042016 Bacteria 2257
394 Ga0450911_002259 3300042115 Bacteria 3866
395 Ga0450888_000479 3300042126 Bacteria 3781
396 Ga0450890_001666 3300042127 Bacteria 3172
397 Ga0450892_000109 3300042130 Bacteria 9264
398 Ga0450906_001662 3300042145 Bacteria 4885
399 Ga0450907_000140 3300042146 Bacteria 27596
400 Ga0439464_0000443 3300042439 Bacteria 8221
401 Ga0439460_0007780 3300042461 Bacteria 2690
402 Ga0450893_0001586 3300042532 Bacteria 3487
403 Ga0466972_0001141 3300044658 Bacteria 12724
404 Ga0466972_0025957 3300044658 Bacteria 2902
405 Ga0466965_0000988 3300044683 Bacteria 10999
406 Ga0466961_0000248 3300044693 Bacteria 36217
407 Ga0466961_0002100 3300044693 Bacteria 12401
408 Ga0466964_0005504 3300044706 Bacteria 4702
409 Ga0453684_0004221 3300044712 Bacteria 30842
410 Ga0453684_0065737 3300044712 Bacteria 4623
411 Ga0466970_0000407 3300044765 Bacteria 20971
412 Ga0466959_0002049 3300045049 Bacteria 12742
413 Ga0466959_0011535 3300045049 Bacteria 6352
414 Ga0451576_0002747 3300045051 Bacteria 25528
415 Ga0495627_000183 3300046453 Bacteria 69743
416 Ga0495592_0000159 3300046454 Bacteria 59481
417 Ga0495590_0002605 3300046457 Bacteria 7455
418 Ga0495591_000174 3300046458 Bacteria 66422
419 Ga0495591_000697 3300046458 Bacteria 24507
420 Ga0495591_010060 3300046458 Bacteria 3702
421 Ga0495638_0003448 3300046460 Bacteria 12455
422 Ga0495638_0011837 3300046460 Bacteria 6001
423 Ga0495653_0041055 3300046463 Bacteria 3613
424 Ga0495650_0001051 3300046471 Bacteria 30683
425 Ga0495650_0001555 3300046471 Bacteria 21655
426 Ga0495650_0002026 3300046471 Bacteria 17727
427 Ga0495605_0000076 3300046474 Bacteria 128699
428 Ga0495605_0001638 3300046474 Bacteria 14431
429 Ga0495605_0002121 3300046474 Bacteria 12413
430 Ga0495605_0023402 3300046474 Bacteria 3249
431 Ga0495584_0002919 3300046491 Bacteria 9540
432 Ga0495584_0003118 3300046491 Bacteria 9206
433 Ga0495585_0000545 3300046492 Bacteria 35585
434 Ga0495585_0008542 3300046492 Bacteria 6201
435 Ga0495585_0026285 3300046492 Bacteria 3324
436 Ga0495596_0006327 3300046500 Bacteria 5466
437 Ga0495607_0000799 3300046501 Bacteria 29847
438 Ga0495607_0002369 3300046501 Bacteria 15384
439 Ga0495607_0002716 3300046501 Bacteria 14116
440 Ga0495583_0000129 3300046506 Bacteria 126766
441 Ga0495583_0000172 3300046506 Bacteria 109791
442 Ga0495583_0000497 3300046506 Bacteria 57112
443 Ga0495583_0001454 3300046506 Bacteria 23965
444 Ga0495583_0003405 3300046506 Bacteria 12156
445 Ga0495583_0005099 3300046506 Bacteria 9057
446 Ga0495583_0006345 3300046506 Bacteria 7752
447 Ga0495583_0030157 3300046506 Bacteria 2645
448 Ga0495606_0000028 3300046507 Bacteria 251032
449 Ga0495606_0000684 3300046507 Bacteria 52863
450 Ga0495606_0001984 3300046507 Bacteria 25232
451 Ga0495606_0002075 3300046507 Bacteria 24486
452 Ga0495606_0003306 3300046507 Bacteria 17217
453 Ga0495606_0012296 3300046507 Bacteria 6884
454 Ga0495606_0059884 3300046507 Bacteria 2441
455 Ga0495610_0000031 3300046512 Bacteria 254606
456 Ga0495610_0000136 3300046512 Bacteria 82060
457 Ga0495610_0004091 3300046512 Bacteria 10927
458 Ga0495620_0000314 3300046515 Bacteria 34524
459 Ga0495620_0004729 3300046515 Bacteria 7653
460 Ga0495631_0000275 3300046518 Bacteria 35971
461 Ga0495632_0000942 3300046519 Bacteria 25452
462 Ga0495632_0001284 3300046519 Bacteria 21252
463 Ga0495637_0000027 3300046520 Bacteria 146241
464 Ga0495637_0001476 3300046520 Bacteria 13811
465 Ga0495637_0004465 3300046520 Bacteria 7244
466 Ga0495637_0014441 3300046520 Bacteria 3727
467 Ga0495643_0000107 3300046522 Bacteria 138292
468 Ga0495643_0001730 3300046522 Bacteria 18877
469 Ga0495643_0005423 3300046522 Bacteria 8632
470 Ga0495644_0000127 3300046523 Bacteria 36626
471 Ga0495644_0007674 3300046523 Bacteria 4160
472 Ga0495644_0030543 3300046523 Bacteria 2034
473 Ga0495648_0027650 3300046524 Bacteria 3792
474 Ga0495642_0000067 3300046528 Bacteria 61823
475 Ga0495642_0000334 3300046528 Bacteria 25618
476 Ga0495642_0003572 3300046528 Bacteria 6123
477 Ga0495642_0007961 3300046528 Bacteria 4055
478 Ga0495654_0003393 3300046530 Bacteria 9794
479 Ga0495654_0004194 3300046530 Bacteria 8623
480 Ga0495654_0005001 3300046530 Bacteria 7787
481 Ga0495654_0044825 3300046530 Bacteria 2185
482 Ga0495587_0039571 3300046536 Bacteria 2820
483 Ga0495587_0040769 3300046536 Bacteria 2772
484 Ga0495609_0000206 3300046538 Bacteria 58720
485 Ga0495609_0000373 3300046538 Bacteria 38466
486 Ga0495609_0004161 3300046538 Bacteria 8035
487 Ga0495609_0006540 3300046538 Bacteria 5937
488 Ga0495621_0017167 3300046539 Bacteria 2335
489 Ga0495645_0085210 3300046543 Bacteria 2262
490 Ga0495622_0000638 3300046557 Bacteria 20320
491 Ga0495622_0004006 3300046557 Bacteria 6876
492 Ga0495633_0003417 3300046558 Bacteria 10575
493 Ga0495656_0007101 3300046615 Bacteria 3949
494 Ga0495656_0021443 3300046615 Bacteria 2515
495 Ga0495668_0003932 3300046616 Bacteria 10849
496 Ga0495611_0003215 3300046648 Bacteria 7231
497 Ga0495611_0004712 3300046648 Bacteria 5858
498 Ga0495625_0000296 3300046660 Bacteria 77050
499 Ga0495625_0000436 3300046660 Bacteria 62756
500 Ga0495625_0005432 3300046660 Bacteria 11619
501 Ga0495635_0043568 3300046663 Bacteria 3096
502 Ga0495659_0000766 3300046664 Bacteria 11527
503 Ga0495661_0000119 3300046665 Bacteria 94133
504 Ga0495661_0001902 3300046665 Bacteria 16649
505 Ga0495661_0008680 3300046665 Bacteria 7022
506 Ga0495661_0008899 3300046665 Bacteria 6914
507 Ga0495661_0011128 3300046665 Bacteria 6109
508 Ga0495646_0049093 3300046680 Bacteria 2561
509 Ga0495669_0003573 3300046684 Bacteria 6412
510 Ga0495670_0004075 3300046691 Bacteria 7167
511 Ga0495670_0004671 3300046691 Bacteria 6718
512 Ga0495671_0000663 3300046692 Bacteria 24982
513 Ga0495671_0001916 3300046692 Bacteria 13352
514 Ga0495671_0002682 3300046692 Bacteria 11153
515 Ga0495671_0004284 3300046692 Bacteria 8574
516 Ga0495649_0001926 3300046694 Bacteria 15132
517 Ga0495649_0008024 3300046694 Bacteria 6377
518 Ga0495589_0000220 3300046794 Bacteria 48490
519 Ga0495600_0004150 3300046809 Bacteria 8628
520 Ga0495660_0000688 3300046810 Bacteria 25918
521 Ga0495660_0002659 3300046810 Bacteria 11320
522 Ga0495636_0001853 3300047318 Bacteria 8095
523 Ga0495672_0000553 3300047320 Bacteria 42512
524 Ga0495672_0001299 3300047320 Bacteria 24902
525 Ga0495672_0008074 3300047320 Bacteria 7819
526 Ga0495676_0000003 3300047321 Bacteria 318463
527 Ga0495683_0000382 3300047323 Bacteria 36179
528 Ga0495683_0000852 3300047323 Bacteria 21615
529 Ga0495677_0000341 3300047445 Bacteria 20129
530 Ga0495677_0000810 3300047445 Bacteria 12626
531 Ga0495677_0003801 3300047445 Bacteria 5840
532 Ga0495679_001158 3300047446 Bacteria 15748
533 Ga0495679_003272 3300047446 Bacteria 7848
534 Ga0495673_0000602 3300047469 Bacteria 35831
535 Ga0495673_0000782 3300047469 Bacteria 30047
536 Ga0495673_0002393 3300047469 Bacteria 13258
537 Ga0495673_0003440 3300047469 Bacteria 10422
538 Ga0495673_0027861 3300047469 Bacteria 2682
539 Ga0495681_0000115 3300047470 Bacteria 69813
540 Ga0495681_0007269 3300047470 Bacteria 7114
541 Ga0495681_0010033 3300047470 Bacteria 5766
542 Ga0495686_0002113 3300047472 Bacteria 19478
543 Ga0495686_0013786 3300047472 Bacteria 5600
544 Ga0495593_0010684 3300047673 Bacteria 5293
545 Ga0495615_0001676 3300048090 Bacteria 3358
546 Ga0495626_0000086 3300048091 Bacteria 123059
547 Ga0495626_0001191 3300048091 Bacteria 21581
548 Ga0495626_0002350 3300048091 Bacteria 13316
549 Ga0495626_0005927 3300048091 Bacteria 7037
550 Ga0495626_0015958 3300048091 Bacteria 3829
551 Ga0496101_0000818 3300048904 Bacteria 18336
552 Ga0496102_0000067 3300048905 Bacteria 156790
553 Ga0496102_0000073 3300048905 Bacteria 149887
554 Ga0496102_0005919 3300048905 Bacteria 10413
555 Ga0496103_0000242 3300048906 Bacteria 53258
556 Ga0496104_0004671 3300048907 Bacteria 11920
557 Ga0496104_0010698 3300048907 Bacteria 8204
558 Ga0496105_0000452 3300048908 Bacteria 27069
559 Ga0496110_0056337 3300048913 Bacteria 3459
560 Ga0496110_0075255 3300048913 Bacteria 3000
561 Ga0496111_0011343 3300048914 Bacteria 6000
562 Ga0496113_0183084 3300048916 Bacteria 1661
563 Ga0496115_0000056 3300048918 Bacteria 104434
564 Ga0496116_0000995 3300048919 Bacteria 34718
565 Ga0496116_0009849 3300048919 Bacteria 8090
566 Ga0496116_0014858 3300048919 Bacteria 6187
567 Ga0496117_0000090 3300048920 Bacteria 206388
568 Ga0496117_0000114 3300048920 Bacteria 180658
569 Ga0496117_0003807 3300048920 Bacteria 17188
570 Ga0496117_0004650 3300048920 Bacteria 14934
571 Ga0496118_0000032 3300048921 Bacteria 330072
572 Ga0496118_0000082 3300048921 Bacteria 185820
573 Ga0496118_0004224 3300048921 Bacteria 17244
574 Ga0496119_0002172 3300048922 Bacteria 22016
575 Ga0496119_0026396 3300048922 Bacteria 4028
576 Ga0496119_0031893 3300048922 Bacteria 3521
577 Ga0496120_0002014 3300048923 Bacteria 22111
578 Ga0496121_0000079 3300048924 Bacteria 232653
579 Ga0496121_0000344 3300048924 Bacteria 96865
580 Ga0496121_0001663 3300048924 Bacteria 36677
581 Ga0496121_0003604 3300048924 Bacteria 21861
582 Ga0496121_0005421 3300048924 Bacteria 16376
583 Ga0496121_0010128 3300048924 Bacteria 10682
584 Ga0496121_0043779 3300048924 Bacteria 3871
585 Ga0496122_0000244 3300048925 Bacteria 122107
586 Ga0496122_0004942 3300048925 Bacteria 16167
587 Ga0496122_0005970 3300048925 Bacteria 14253
588 Ga0496122_0012273 3300048925 Bacteria 8561
589 Ga0496122_0061191 3300048925 Bacteria 2765
590 Ga0496123_0000201 3300048926 Bacteria 121915
591 Ga0496123_0007071 3300048926 Bacteria 10670
592 Ga0496123_0013135 3300048926 Bacteria 6983
593 Ga0496123_0028961 3300048926 Bacteria 4088
594 Ga0496124_0000068 3300048927 Bacteria 221819
595 Ga0496124_0018543 3300048927 Bacteria 6514
596 Ga0496124_0019143 3300048927 Bacteria 6387
597 Ga0496125_0000219 3300048928 Bacteria 116721
598 Ga0496125_0000862 3300048928 Bacteria 48602
599 Ga0496125_0013075 3300048928 Bacteria 8185
600 Ga0496125_0035776 3300048928 Bacteria 4348
601 Ga0496125_0059744 3300048928 Bacteria 3068
602 Ga0496126_0000157 3300048929 Bacteria 156203
603 Ga0496126_0004738 3300048929 Bacteria 16040
604 Ga0501308_000952 3300049128 Bacteria 2143
605 Ga0501307_000075 3300049162 Bacteria 4218
606 Ga0495678_001067 3300049459 Bacteria 23249
607 Ga0495678_008505 3300049459 Bacteria 5169
608 Ga0495678_018802 3300049459 Bacteria 3097
609 Ga0495682_0000138 3300049460 Bacteria 63246
610 Ga0495682_0000287 3300049460 Bacteria 39287
611 Ga0495682_0009479 3300049460 Bacteria 3798
612 Ga0501300_003656 3300049523 Bacteria 2290
613 Ga0501321_001062 3300049537 Bacteria 2073
614 Ga0501034_0000003 3300049571 Bacteria 471748
615 Ga0501034_0000210 3300049571 Bacteria 110909
616 Ga0501043_0010019 3300049579 Bacteria 7433
617 Ga0501047_0002410 3300049581 Bacteria 17866
618 Ga0501229_001322 3300049706 Bacteria 2885
619 Ga0501226_000017 3300049853 Bacteria 150879
620 nmdc:mga03683_7338_c1 3300050489 Bacteria 3823
621 nmdc:mga0k408_11372_c1 3300050493 Bacteria 4846
622 nmdc:mga0k408_18079_c1 3300050493 Bacteria 3931
623 nmdc:mga0k408_3739_c1 3300050493 Bacteria 8072
624 nmdc:mga07m45_4868_c1 3300050496 Bacteria 6610
625 nmdc:mga07m45_9985_c1 3300050496 Bacteria 3454
626 nmdc:mga09592_2271_c1 3300050508 Bacteria 15486
627 Ga0495595_0061598 3300053084 Bacteria 1758
628 Ga0500595_000211 3300053119 Bacteria 39658
629 Ga0500655_000002 3300053133 Bacteria 116051
630 Ga0500559_0013465 3300053136 Bacteria 3464
631 Ga0500559_0020350 3300053136 Bacteria 2806
632 Ga0500577_0012176 3300053142 Bacteria 2591
633 Ga0500622_0004519 3300053156 Bacteria 8698
634 Ga0500570_000153 3300053724 Bacteria 21288
635 Ga0587098_000519 3300059604 Bacteria 2397
636 Ga0587076_000201 3300059645 Bacteria 4157
637 Ga0587111_0000403 3300060346 Bacteria 4012

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049523 Ga0501300_003656 Ga0501300_003656_172_1686 479
2 3300053084 Ga0495595_0061598 Ga0495595_0061598_84_1724 488
3 3300039447 Ga0436361_0118095 Ga0436361_0118095_74_1861 504
4 3300048916 Ga0496113_0183084 Ga0496113_0183084_34_1632 505
5 3300046512 Ga0495610_0000031 Ga0495610_0000031_66322_68112 513
6 3300005353 Ga0070669_100023152 Ga0070669_1000231521 516
7 3300005543 Ga0070672_100089138 Ga0070672_1000891381 516
8 3300025940 Ga0207691_10075591 Ga0207691_100755912 516
9 3300046528 Ga0495642_0003572 Ga0495642_0003572_1226_2977 516
10 3300046539 Ga0495621_0017167 Ga0495621_0017167_395_2191 516
11 3300046665 Ga0495661_0011128 Ga0495661_0011128_437_2188 516
12 3300037471 Ga0395905_0004587 Ga0395905_0004587_802_2541 517
13 3300039062 Ga0400483_029521 Ga0400483_029521_1453_3198 518
14 3300049162 Ga0501307_000075 Ga0501307_000075_904_2631 518
15 3300046507 Ga0495606_0059884 Ga0495606_0059884_344_2098 520
16 3300046528 Ga0495642_0007961 Ga0495642_0007961_679_2433 520
17 3300047445 Ga0495677_0000810 Ga0495677_0000810_5201_6955 520
18 3300049579 Ga0501043_0010019 Ga0501043_0010019_433_2172 520
19 3300049581 Ga0501047_0002410 Ga0501047_0002410_10293_12032 520
20 3300005467 Ga0070706_100017358 Ga0070706_1000173583 521
21 3300025910 Ga0207684_10018394 Ga0207684_100183943 521
22 3300044658 Ga0466972_0001141 Ga0466972_0001141_5966_7630 521
23 3300044706 Ga0466964_0005504 Ga0466964_0005504_325_1989 521
24 3300044765 Ga0466970_0000407 Ga0466970_0000407_5452_7116 521
25 3300045049 Ga0466959_0002049 Ga0466959_0002049_5569_7233 521
26 3300050496 nmdc:mga07m45_9985_c1 nmdc:mga07m45_9985_c1_410_2149 521
27 3300045049 Ga0466959_0011535 Ga0466959_0011535_2382_4154 522
28 3300048924 Ga0496121_0000079 Ga0496121_0000079_131784_133550 522
29 3300025256 Ga0209759_1007957 Ga0209759_10079572 523
30 3300037471 Ga0395905_0007075 Ga0395905_0007075_9347_11170 523
31 3300001915 JGI24741J21665_1000182 JGI24741J21665_100018211 524
32 3300001979 JGI24740J21852_10000388 JGI24740J21852_1000038810 524
33 3300005344 Ga0070661_100014968 Ga0070661_1000149683 524
34 3300005455 Ga0070663_100001970 Ga0070663_1000019709 524
35 3300005614 Ga0068856_100002287 Ga0068856_10000228710 524
36 3300009093 Ga0105240_10252249 Ga0105240_102522491 524
37 3300009545 Ga0105237_10024834 Ga0105237_100248344 524
38 3300025913 Ga0207695_10014624 Ga0207695_100146242 524
39 3300026041 Ga0207639_10000895 Ga0207639_1000089511 524
40 3300026067 Ga0207678_10001250 Ga0207678_1000125011 524
41 3300026078 Ga0207702_10005445 Ga0207702_100054459 524
42 3300026116 Ga0207674_10056318 Ga0207674_100563184 524
43 3300022739 Ga0228711_1001487 Ga0228711_100148717 525
44 3300022740 Ga0228710_1001373 Ga0228710_100137321 525
45 3300037471 Ga0395905_0008321 Ga0395905_0008321_119_1864 526
46 3300042126 Ga0450888_000479 Ga0450888_000479_1169_2917 526
47 3300042127 Ga0450890_001666 Ga0450890_001666_536_2284 526
48 3300042130 Ga0450892_000109 Ga0450892_000109_925_2673 526
49 3300042532 Ga0450893_0001586 Ga0450893_0001586_392_2140 526
50 3300046512 Ga0495610_0000136 Ga0495610_0000136_73687_75426 527
51 3300046519 Ga0495632_0000942 Ga0495632_0000942_17606_19396 527
52 3300046522 Ga0495643_0000107 Ga0495643_0000107_66503_68242 527
53 3300053136 Ga0500559_0013465 Ga0500559_0013465_425_2239 527
54 3300049706 Ga0501229_001322 Ga0501229_001322_924_2657 528
55 3300059645 Ga0587076_000201 Ga0587076_000201_110_1861 528
56 3300006177 Ga0075362_10006557 Ga0075362_100065573 529
57 3300039447 Ga0436361_0650737 Ga0436361_0650737_17795_19609 529
58 3300046694 Ga0495649_0001926 Ga0495649_0001926_7102_8856 529
59 3300046809 Ga0495600_0004150 Ga0495600_0004150_1364_3199 529
60 3300053119 Ga0500595_000211 Ga0500595_000211_31022_32857 529
61 iso_pu_bacteria 2900577576 2900578249 529
62 3300046453 Ga0495627_000183 Ga0495627_000183_46277_48055 530
63 3300046471 Ga0495650_0001555 Ga0495650_0001555_6977_8755 530
64 3300047470 Ga0495681_0000115 Ga0495681_0000115_21747_23525 530
65 3300048090 Ga0495615_0001676 Ga0495615_0001676_1356_3101 530
66 3300048926 Ga0496123_0007071 Ga0496123_0007071_5950_7695 530
67 3300003761 Ga0055535_1005127 Ga0055535_10051273 531
68 3300017792 Ga0163161_10024693 Ga0163161_100246934 531
69 3300025242 Ga0209258_101275 Ga0209258_1012753 531
70 3300028794 Ga0307515_10068680 Ga0307515_100686804 531
71 3300035691 Ga0373931_0026309 Ga0373931_0026309_1001_2842 531
72 3300044683 Ga0466965_0000988 Ga0466965_0000988_141_1955 531
73 3300046615 Ga0495656_0021443 Ga0495656_0021443_177_1946 531
74 3300048904 Ga0496101_0000818 Ga0496101_0000818_9218_11014 531
75 3300048907 Ga0496104_0004671 Ga0496104_0004671_5306_7102 531
76 3300048908 Ga0496105_0000452 Ga0496105_0000452_5112_6908 531
77 3300003792 Ga0055540_1009310 Ga0055540_10093103 532
78 3300025303 Ga0209051_1002295 Ga0209051_10022959 532
79 3300025942 Ga0207689_10074851 Ga0207689_100748513 532
80 3300037312 Ga0395899_0001213 Ga0395899_0001213_16491_18242 532
81 3300037418 Ga0395900_0006153 Ga0395900_0006153_9741_11492 532
82 3300037471 Ga0395905_0158094 Ga0395905_0158094_149_1900 532
83 3300013102 Ga0157371_10000035 Ga0157371_1000003583 533
84 3300013104 Ga0157370_10000021 Ga0157370_1000002132 533
85 3300013307 Ga0157372_10000225 Ga0157372_1000022536 533
86 3300015261 Ga0182006_1001942 Ga0182006_100194213 533
87 3300037312 Ga0395899_0062480 Ga0395899_0062480_56_1774 533
88 3300037418 Ga0395900_0032950 Ga0395900_0032950_2182_3900 533
89 3300046810 Ga0495660_0000688 Ga0495660_0000688_16912_18642 533
90 3300048928 Ga0496125_0013075 Ga0496125_0013075_4434_6152 533
91 3300002067 JGI24735J21928_10002829 JGI24735J21928_100028292 534
92 3300021320 Ga0214544_1001054 Ga0214544_100105434 534
93 3300021321 Ga0214542_1000019 Ga0214542_1000019143 534
94 3300021327 Ga0214543_1000010 Ga0214543_1000010299 534
95 3300046530 Ga0495654_0003393 Ga0495654_0003393_2213_3991 534
96 3300003751 Ga0055538_1001384 Ga0055538_10013843 535
97 3300009148 Ga0105243_10000030 Ga0105243_1000003019 535
98 3300009174 Ga0105241_10005180 Ga0105241_100051806 535
99 3300013102 Ga0157371_10000183 Ga0157371_1000018362 535
100 3300044693 Ga0466961_0000248 Ga0466961_0000248_5770_7509 535
101 3300005327 Ga0070658_10047548 Ga0070658_100475483 536
102 3300005367 Ga0070667_100000036 Ga0070667_10000003634 536
103 3300005841 Ga0068863_100004775 Ga0068863_1000047757 536
104 3300005843 Ga0068860_100000063 Ga0068860_100000063134 536
105 3300025986 Ga0207658_10000482 Ga0207658_1000048225 536
106 3300028381 Ga0268264_10000083 Ga0268264_10000083186 536
107 3300046519 Ga0495632_0001284 Ga0495632_0001284_7154_8866 536
108 3300047673 Ga0495593_0010684 Ga0495593_0010684_929_2737 536
109 3300002705 JGI25156J39149_1000247 JGI25156J39149_100024724 537
110 3300002705 JGI25156J39149_1000284 JGI25156J39149_10002849 537
111 3300002738 JGI25154J39366_1003144 JGI25154J39366_10031443 537
112 3300002741 JGI25157J39369_1000280 JGI25157J39369_100028010 537
113 3300003761 Ga0055535_1000275 Ga0055535_100027551 537
114 3300003763 Ga0055529_1000323 Ga0055529_100032351 537
115 3300005328 Ga0070676_10007335 Ga0070676_100073354 537
116 3300005329 Ga0070683_100071398 Ga0070683_1000713983 537
117 3300005338 Ga0068868_100030410 Ga0068868_1000304102 537
118 3300005364 Ga0070673_100008566 Ga0070673_1000085663 537
119 3300005459 Ga0068867_100003198 Ga0068867_1000031986 537
120 3300005578 Ga0068854_100000932 Ga0068854_1000009326 537
121 3300006195 Ga0075366_10000924 Ga0075366_100009248 537
122 3300009545 Ga0105237_10069063 Ga0105237_100690633 537
123 3300010375 Ga0105239_10033874 Ga0105239_100338742 537
124 3300013105 Ga0157369_10037886 Ga0157369_100378863 537
125 3300025242 Ga0209258_100071 Ga0209258_100071220 537
126 3300025246 Ga0209646_1000249 Ga0209646_100024924 537
127 3300025250 Ga0209026_1000011 Ga0209026_1000011406 537
128 3300025253 Ga0209677_100160 Ga0209677_10016038 537
129 3300025256 Ga0209759_1000034 Ga0209759_100003470 537
130 3300025256 Ga0209759_1000878 Ga0209759_10008789 537
131 3300025272 Ga0209455_1000030 Ga0209455_100003051 537
132 3300025907 Ga0207645_10008891 Ga0207645_100088914 537
133 3300025913 Ga0207695_10004535 Ga0207695_1000453512 537
134 3300025914 Ga0207671_10034150 Ga0207671_100341503 537
135 3300025924 Ga0207694_10052525 Ga0207694_100525252 537
136 3300025940 Ga0207691_10072392 Ga0207691_100723922 537
137 3300025949 Ga0207667_10032962 Ga0207667_100329623 537
138 3300025981 Ga0207640_10001944 Ga0207640_100019441 537
139 3300026023 Ga0207677_10009710 Ga0207677_100097104 537
140 3300026078 Ga0207702_10013157 Ga0207702_100131573 537
141 3300031507 Ga0307509_10000072 Ga0307509_1000007268 537
142 3300031730 Ga0307516_10000669 Ga0307516_100006694 537
143 3300037471 Ga0395905_0183120 Ga0395905_0183120_98_1915 537
144 3300046507 Ga0495606_0001984 Ga0495606_0001984_13583_15403 537
145 iso_pu_bacteria 2857547612 2857553200 537
146 3300001904 JGI24736J21556_1000711 JGI24736J21556_10007115 538
147 3300001990 JGI24737J22298_10001102 JGI24737J22298_100011021 538
148 3300002075 JGI24738J21930_10006730 JGI24738J21930_100067302 538
149 3300003479 Ga0006556J51387_1002520 Ga0006556J51387_10025205 538
150 3300003558 Ga0006558J51389_1003962 Ga0006558J51389_10039625 538
151 3300003565 Ga0006560J51390_1001645 Ga0006560J51390_10016455 538
152 3300003567 Ga0006554J51385_1007769 Ga0006554J51385_10077694 538
153 3300013100 Ga0157373_10010732 Ga0157373_100107323 538
154 3300013104 Ga0157370_10009438 Ga0157370_100094386 538
155 3300025231 Ga0207427_100551 Ga0207427_10055112 538
156 3300025919 Ga0207657_10040355 Ga0207657_100403554 538
157 3300025924 Ga0207694_10030644 Ga0207694_100306444 538
158 3300025933 Ga0207706_10030797 Ga0207706_100307973 538
159 3300026142 Ga0207698_10016691 Ga0207698_100166914 538
160 3300028666 Ga0265336_10000042 Ga0265336_1000004279 538
161 3300029957 Ga0265324_10000213 Ga0265324_1000021311 538
162 3300031548 Ga0307408_100000644 Ga0307408_10000064412 538
163 3300031852 Ga0307410_10090387 Ga0307410_100903872 538
164 3300048913 Ga0496110_0056337 Ga0496110_0056337_298_2046 538
165 3300050489 nmdc:mga03683_7338_c1 nmdc:mga03683_7338_c1_1849_3567 538
166 3300002773 JGI25152J39213_1000747 JGI25152J39213_10007473 539
167 3300002774 JGI25150J39212_1000509 JGI25150J39212_10005093 539
168 3300003215 JGI25153J46596_10007048 JGI25153J46596_100070485 539
169 3300003775 Ga0055524_1004765 Ga0055524_10047654 539
170 3300005578 Ga0068854_100009039 Ga0068854_1000090395 539
171 3300009093 Ga0105240_10000220 Ga0105240_1000022056 539
172 3300009545 Ga0105237_10000099 Ga0105237_1000009955 539
173 3300010375 Ga0105239_10000111 Ga0105239_1000011156 539
174 3300025263 Ga0209565_1011740 Ga0209565_10117402 539
175 3300025913 Ga0207695_10000213 Ga0207695_1000021397 539
176 3300025914 Ga0207671_10000918 Ga0207671_1000091825 539
177 3300026121 Ga0207683_10034445 Ga0207683_100344452 539
178 3300031456 Ga0307513_10008449 Ga0307513_100084497 539
179 3300032004 Ga0307414_10002079 Ga0307414_100020792 539
180 3300045051 Ga0451576_0002747 Ga0451576_0002747_12438_14204 539
181 3300046664 Ga0495659_0000766 Ga0495659_0000766_736_2520 539
182 3300046692 Ga0495671_0000663 Ga0495671_0000663_14129_15913 539
183 3300047320 Ga0495672_0001299 Ga0495672_0001299_8998_10782 539
184 3300048924 Ga0496121_0005421 Ga0496121_0005421_7318_9018 539
185 2162886007 SwRhRL2b_contig_2160423 SwRhRL2b_0453.00003010 540
186 3300001915 JGI24741J21665_1000642 JGI24741J21665_10006426 540
187 3300001979 JGI24740J21852_10000924 JGI24740J21852_100009248 540
188 3300003752 Ga0055539_1000068 Ga0055539_100006839 540
189 3300003758 Ga0055532_1000028 Ga0055532_100002813 540
190 3300003759 Ga0055525_1000723 Ga0055525_10007232 540
191 3300003760 Ga0055527_1001261 Ga0055527_10012613 540
192 3300003761 Ga0055535_1000022 Ga0055535_100002213 540
193 3300003763 Ga0055529_1000145 Ga0055529_100014574 540
194 3300003792 Ga0055540_1001656 Ga0055540_10016565 540
195 3300005289 Ga0065704_10103485 Ga0065704_101034851 540
196 3300005344 Ga0070661_100000002 Ga0070661_10000000210 540
197 3300005455 Ga0070663_100000005 Ga0070663_100000005194 540
198 3300005564 Ga0070664_100000001 Ga0070664_100000001152 540
199 3300005577 Ga0068857_100027609 Ga0068857_1000276096 540
200 3300005578 Ga0068854_100000030 Ga0068854_10000003067 540
201 3300005614 Ga0068856_100000008 Ga0068856_10000000877 540
202 3300020610 Ga0154015_1469424 Ga0154015_146942418 540
203 3300025224 Ga0209784_100014 Ga0209784_100014285 540
204 3300025225 Ga0209566_100011 Ga0209566_100011285 540
205 3300025225 Ga0209566_101345 Ga0209566_1013456 540
206 3300025226 Ga0209674_100032 Ga0209674_100032200 540
207 3300025228 Ga0209672_100137 Ga0209672_1001376 540
208 3300025229 Ga0209147_100002 Ga0209147_100002566 540
209 3300025230 Ga0209563_100029 Ga0209563_100029200 540
210 3300025242 Ga0209258_100002 Ga0209258_100002566 540
211 3300025253 Ga0209677_100042 Ga0209677_10004211 540
212 3300025256 Ga0209759_1002422 Ga0209759_10024225 540
213 3300025272 Ga0209455_1000009 Ga0209455_1000009447 540
214 3300025303 Ga0209051_1002532 Ga0209051_10025329 540
215 3300025913 Ga0207695_10001452 Ga0207695_1000145224 540
216 3300025920 Ga0207649_10002446 Ga0207649_1000244610 540
217 3300025945 Ga0207679_10000003 Ga0207679_10000003371 540
218 3300025981 Ga0207640_10000070 Ga0207640_1000007057 540
219 3300026067 Ga0207678_10000002 Ga0207678_10000002239 540
220 3300026078 Ga0207702_10000031 Ga0207702_1000003191 540
221 3300026116 Ga0207674_10021967 Ga0207674_100219673 540
222 3300031548 Ga0307408_100000006 Ga0307408_100000006221 540
223 3300046492 Ga0495585_0008542 Ga0495585_0008542_4292_6025 540
224 3300046501 Ga0495607_0002716 Ga0495607_0002716_8256_9989 540
225 3300046506 Ga0495583_0000497 Ga0495583_0000497_24962_26695 540
226 3300046523 Ga0495644_0000127 Ga0495644_0000127_21129_22862 540
227 3300046538 Ga0495609_0000373 Ga0495609_0000373_24539_26272 540
228 3300046558 Ga0495633_0003417 Ga0495633_0003417_103_1848 540
229 3300046648 Ga0495611_0003215 Ga0495611_0003215_1323_3056 540
230 3300046665 Ga0495661_0001902 Ga0495661_0001902_12228_13961 540
231 3300046691 Ga0495670_0004671 Ga0495670_0004671_968_2701 540
232 3300047445 Ga0495677_0000341 Ga0495677_0000341_12081_13814 540
233 3300049460 Ga0495682_0000287 Ga0495682_0000287_23984_25717 540
234 3300002738 JGI25154J39366_1000792 JGI25154J39366_100079216 541
235 3300003157 Ga0006774J45829_10489 Ga0006774J45829_104891 541
236 3300003752 Ga0055539_1000287 Ga0055539_10002879 541
237 3300003756 Ga0055533_1000045 Ga0055533_1000045131 541
238 3300003756 Ga0055533_1000386 Ga0055533_100038620 541
239 3300003841 Ga0055541_1001507 Ga0055541_10015073 541
240 3300025224 Ga0209784_100246 Ga0209784_10024610 541
241 3300025225 Ga0209566_100403 Ga0209566_10040310 541
242 3300025226 Ga0209674_100073 Ga0209674_100073131 541
243 3300025226 Ga0209674_100131 Ga0209674_10013172 541
244 3300025230 Ga0209563_100061 Ga0209563_10006199 541
245 3300025246 Ga0209646_1000058 Ga0209646_100005887 541
246 3300025250 Ga0209026_1002043 Ga0209026_10020432 541
247 3300025253 Ga0209677_100070 Ga0209677_10007014 541
248 3300025254 Ga0209148_1000043 Ga0209148_1000043283 541
249 3300059604 Ga0587098_000519 Ga0587098_000519_499_2262 541
250 3300060346 Ga0587111_0000403 Ga0587111_0000403_886_2649 541
251 iso_pu_bacteria 2513237165 2514045177 541
252 iso_pu_bacteria 2582581305 2585260845 541
253 iso_pu_bacteria 2596583598 2597031831 541
254 iso_pu_bacteria 2599185178 2599443669 541
255 iso_pu_bacteria 2643221664 2644356104 541
256 iso_pu_bacteria 2834641062 2834642198 541
257 iso_pu_bacteria 2885266251 2885267448 541
258 iso_pu_bacteria 2928058823 2928061922 541
259 3300001979 JGI24740J21852_10000084 JGI24740J21852_1000008416 542
260 3300015690 Ga0183363_1005 Ga0183363_100551 542
261 3300037471 Ga0395905_0000720 Ga0395905_0000720_39891_41621 542
262 3300037471 Ga0395905_0001365 Ga0395905_0001365_7914_9647 542
263 3300044712 Ga0453684_0004221 Ga0453684_0004221_7117_8871 542
264 3300046506 Ga0495583_0001454 Ga0495583_0001454_7095_8825 542
265 3300046506 Ga0495583_0030157 Ga0495583_0030157_367_2097 542
266 3300046522 Ga0495643_0001730 Ga0495643_0001730_12324_14054 542
267 3300046665 Ga0495661_0008899 Ga0495661_0008899_3894_5624 542
268 3300047318 Ga0495636_0001853 Ga0495636_0001853_2053_3783 542
269 3300047445 Ga0495677_0003801 Ga0495677_0003801_3733_5463 542
270 3300047472 Ga0495686_0002113 Ga0495686_0002113_10565_12298 542
271 3300048091 Ga0495626_0015958 Ga0495626_0015958_331_2061 542
272 3300049571 Ga0501034_0000210 Ga0501034_0000210_95374_97140 542
273 iso_pu_bacteria 2516143018 2516207332 542
274 iso_pu_bacteria 2643221544 2643741742 542
275 iso_pu_bacteria 2643221639 2644220386 542
276 iso_pu_bacteria 2643221646 2644259312 542
277 iso_pu_bacteria 2643221660 2644340834 542
278 iso_pu_bacteria 2690316117 2692318089 542
279 iso_pu_bacteria 2791355082 2792584562 542
280 iso_pu_bacteria 2791355094 2792642191 542
281 iso_pu_bacteria 2847417321 2847423404 542
282 iso_pu_bacteria 2848992105 2848997116 542
283 iso_pu_bacteria 2854916844 2854922497 542
284 iso_pu_bacteria 2855872281 2855875149 542
285 iso_pu_bacteria 2885080285 2885080326 542
286 iso_pu_bacteria 2896384573 2896389546 542
287 iso_pu_bacteria 2913295892 2913300599 542
288 iso_pu_bacteria 2919679072 2919683088 542
289 iso_pu_bacteria 2920760137 2920764777 542
290 iso_pu_bacteria 2920822456 2920827423 542
291 iso_pu_bacteria 2989349275 2989350491 542
292 iso_pu_bacteria 643692032 643822194 542
293 iso_pu_bacteria 8049293176 8049297697 542
294 iso_pu_bacteria 8054558443 8054559409 542
295 3300006846 Ga0075430_100008435 Ga0075430_1000084352 543
296 iso_pu_bacteria 2513237150 2513952669 543
297 iso_pu_bacteria 2738541275 2738711002 543
298 iso_pu_bacteria 2738541301 2738849427 543
299 iso_pu_bacteria 2738541304 2738865156 543
300 iso_pu_bacteria 2738543022 2739297674 543
301 iso_pu_bacteria 2738543033 2739359352 543
302 iso_pu_bacteria 2808606419 2809150781 543
303 iso_pu_bacteria 2852618963 2852622299 543
304 3300025258 Ga0209129_1000722 Ga0209129_10007224 544
305 3300025297 Ga0209758_1002100 Ga0209758_10021004 544
306 3300025299 Ga0209256_1001697 Ga0209256_100169716 544
307 3300031240 Ga0265320_10001568 Ga0265320_100015686 544
308 3300031711 Ga0265314_10064117 Ga0265314_100641171 544
309 3300044712 Ga0453684_0065737 Ga0453684_0065737_187_1926 544
310 3300049537 Ga0501321_001062 Ga0501321_001062_275_2020 544
311 iso_pu_bacteria 2511231221 2512037138 544
312 iso_pu_bacteria 2600255292 2601667168 544
313 iso_pu_bacteria 2928100450 2928103615 544
314 iso_pu_bacteria 2928959182 2928961376 544
315 iso_pu_bacteria 2932410948 2932416668 544
316 iso_pu_bacteria 2932416698 2932422417 544
317 iso_pu_bacteria 8054002106 8054003160 544
318 3300005617 Ga0068859_100001847 Ga0068859_10000184717 545
319 3300006931 Ga0097620_100001847 Ga0097620_10000184717 545
320 3300009147 Ga0114129_10240297 Ga0114129_102402972 545
321 3300009177 Ga0105248_10001130 Ga0105248_1000113019 545
322 3300025941 Ga0207711_10001219 Ga0207711_1000121911 545
323 3300031548 Ga0307408_100000898 Ga0307408_1000008987 545
324 3300032002 Ga0307416_100153277 Ga0307416_1001532772 545
325 3300044658 Ga0466972_0025957 Ga0466972_0025957_1004_2764 545
326 3300044693 Ga0466961_0002100 Ga0466961_0002100_71_1843 545
327 3300046471 Ga0495650_0002026 Ga0495650_0002026_9119_10858 545
328 3300046660 Ga0495625_0005432 Ga0495625_0005432_9042_10802 545
329 3300047472 Ga0495686_0013786 Ga0495686_0013786_3842_5584 545
330 3300053133 Ga0500655_000002 Ga0500655_000002_99205_100947 545
331 3300053136 Ga0500559_0020350 Ga0500559_0020350_193_1935 545
332 3300053142 Ga0500577_0012176 Ga0500577_0012176_781_2523 545
333 3300053156 Ga0500622_0004519 Ga0500622_0004519_6400_8142 545
334 3300053724 Ga0500570_000153 Ga0500570_000153_6792_8534 545
335 iso_pu_bacteria 2643221605 2644036573 545
336 iso_pu_bacteria 2738541300 2738847116 545
337 iso_pu_bacteria 2738543018 2739277885 545
338 iso_pu_bacteria 2738543030 2739346928 545
339 iso_pu_bacteria 8054302542 8054305316 545
340 3300002774 JGI25150J39212_1001065 JGI25150J39212_10010654 546
341 3300006175 Ga0070712_100007112 Ga0070712_1000071122 546
342 3300006195 Ga0075366_10001343 Ga0075366_1000134313 546
343 3300014497 Ga0182008_10001536 Ga0182008_100015361 546
344 3300015261 Ga0182006_1001143 Ga0182006_10011439 546
345 3300015262 Ga0182007_10000877 Ga0182007_100008776 546
346 3300015265 Ga0182005_1000619 Ga0182005_10006196 546
347 3300025294 Ga0209025_1003640 Ga0209025_10036405 546
348 3300025297 Ga0209758_1002961 Ga0209758_10029615 546
349 3300027395 Ga0209996_1002261 Ga0209996_10022612 546
350 3300039062 Ga0400483_084836 Ga0400483_084836_2296_4131 546
351 3300039447 Ga0436361_0291965 Ga0436361_0291965_992_2746 546
352 3300042016 Ga0439463_010682 Ga0439463_010682_519_2240 546
353 3300046543 Ga0495645_0085210 Ga0495645_0085210_498_2219 546
354 3300048919 Ga0496116_0014858 Ga0496116_0014858_929_2686 546
355 3300048920 Ga0496117_0003807 Ga0496117_0003807_8305_10062 546
356 3300048921 Ga0496118_0004224 Ga0496118_0004224_8361_10118 546
357 3300048924 Ga0496121_0003604 Ga0496121_0003604_6665_8422 546
358 3300048924 Ga0496121_0010128 Ga0496121_0010128_1682_3439 546
359 3300048925 Ga0496122_0004942 Ga0496122_0004942_1064_2821 546
360 3300049460 Ga0495682_0009479 Ga0495682_0009479_1382_3139 546
361 3300050493 nmdc:mga0k408_11372_c1 nmdc:mga0k408_11372_c1_2035_3933 546
362 iso_pu_bacteria 2597490356 2599103414 546
363 iso_pu_bacteria 2775507255 2778127034 546
364 iso_pu_bacteria 2846952575 2846953299 546
365 iso_pu_bacteria 2848858292 2848858772 546
366 iso_pu_bacteria 2919138771 2919139312 546
367 3300006177 Ga0075362_10016832 Ga0075362_100168322 547
368 3300006186 Ga0075369_10001143 Ga0075369_100011433 547
369 3300006195 Ga0075366_10000092 Ga0075366_1000009211 547
370 3300006353 Ga0075370_10000335 Ga0075370_100003359 547
371 3300027876 Ga0209974_10007897 Ga0209974_100078971 547
372 3300031649 Ga0307514_10000339 Ga0307514_1000033921 547
373 3300046684 Ga0495669_0003573 Ga0495669_0003573_3589_5409 547
374 3300048925 Ga0496122_0012273 Ga0496122_0012273_5040_6836 547
375 3300048928 Ga0496125_0000219 Ga0496125_0000219_40088_41884 547
376 3300050493 nmdc:mga0k408_3739_c1 nmdc:mga0k408_3739_c1_4843_6591 547
377 3300050496 nmdc:mga07m45_4868_c1 nmdc:mga07m45_4868_c1_3261_5099 547
378 iso_pu_bacteria 2643221628 2644160731 547
379 iso_pu_bacteria 2643221654 2644301754 547
380 iso_pu_bacteria 2904449895 2904455961 547
381 iso_pu_bacteria 2904456579 2904461722 547
382 iso_pu_bacteria 2919462493 2919467439 547
383 iso_pu_bacteria 2929520902 2929525072 547
384 3300005459 Ga0068867_100066953 Ga0068867_1000669531 548
385 3300006195 Ga0075366_10028656 Ga0075366_100286562 548
386 3300027471 Ga0209995_1000908 Ga0209995_10009084 548
387 3300027526 Ga0209968_1000129 Ga0209968_10001292 548
388 3300027695 Ga0209966_1000035 Ga0209966_10000352 548
389 3300037418 Ga0395900_0022224 Ga0395900_0022224_3364_5133 548
390 3300049128 Ga0501308_000952 Ga0501308_000952_326_2086 548
391 iso_pu_bacteria 2842333319 2842337585 548
392 3300042016 Ga0439463_004592 Ga0439463_004592_1518_3254 549
393 3300042461 Ga0439460_0007780 Ga0439460_0007780_750_2486 549
394 3300046520 Ga0495637_0001476 Ga0495637_0001476_1177_2913 549
395 3300005289 Ga0065704_10007641 Ga0065704_100076412 550
396 3300005338 Ga0068868_100020175 Ga0068868_1000201754 550
397 3300005841 Ga0068863_100025167 Ga0068863_1000251673 550
398 3300006038 Ga0075365_10022563 Ga0075365_100225633 550
399 3300026088 Ga0207641_10086712 Ga0207641_100867121 550
400 3300028379 Ga0268266_10140585 Ga0268266_101405851 550
401 3300042115 Ga0450911_002259 Ga0450911_002259_28_1764 550
402 3300001979 JGI24740J21852_10001008 JGI24740J21852_100010086 551
403 3300001990 JGI24737J22298_10000869 JGI24737J22298_100008697 551
404 3300003215 JGI25153J46596_10000179 JGI25153J46596_1000017924 551
405 3300003578 Ga0006562J51391_1145654 Ga0006562J51391_11456541 551
406 3300003759 Ga0055525_1000012 Ga0055525_100001272 551
407 3300003762 Ga0055542_1000025 Ga0055542_100002530 551
408 3300003763 Ga0055529_1000014 Ga0055529_1000014223 551
409 3300003773 Ga0055537_1000484 Ga0055537_100048421 551
410 3300003784 Ga0055534_1000406 Ga0055534_10004066 551
411 3300005356 Ga0070674_100000078 Ga0070674_1000000786 551
412 3300005456 Ga0070678_100000005 Ga0070678_10000000551 551
413 3300005539 Ga0068853_100054173 Ga0068853_1000541732 551
414 3300013100 Ga0157373_10064853 Ga0157373_100648531 551
415 3300017792 Ga0163161_10004884 Ga0163161_1000488410 551
416 3300025230 Ga0209563_100030 Ga0209563_100030376 551
417 3300025254 Ga0209148_1000011 Ga0209148_1000011227 551
418 3300025263 Ga0209565_1000085 Ga0209565_1000085142 551
419 3300025272 Ga0209455_1000006 Ga0209455_1000006967 551
420 3300025273 Ga0209673_1001052 Ga0209673_100105227 551
421 3300025291 Ga0209675_1000083 Ga0209675_1000083142 551
422 3300025297 Ga0209758_1000007 Ga0209758_1000007831 551
423 3300025321 Ga0207656_10009882 Ga0207656_100098821 551
424 3300025909 Ga0207705_10000752 Ga0207705_1000075211 551
425 3300025911 Ga0207654_10001142 Ga0207654_100011422 551
426 3300025913 Ga0207695_10009243 Ga0207695_100092436 551
427 3300025919 Ga0207657_10027377 Ga0207657_100273773 551
428 3300025920 Ga0207649_10002538 Ga0207649_100025384 551
429 3300025924 Ga0207694_10039858 Ga0207694_100398582 551
430 3300025932 Ga0207690_10001322 Ga0207690_100013223 551
431 3300025935 Ga0207709_10000137 Ga0207709_1000013719 551
432 3300025937 Ga0207669_10000093 Ga0207669_1000009329 551
433 3300025949 Ga0207667_10000107 Ga0207667_1000010738 551
434 3300025981 Ga0207640_10002305 Ga0207640_100023054 551
435 3300026041 Ga0207639_10000561 Ga0207639_1000056115 551
436 3300026067 Ga0207678_10000943 Ga0207678_1000094314 551
437 3300026078 Ga0207702_10005713 Ga0207702_100057136 551
438 3300026089 Ga0207648_10072853 Ga0207648_100728532 551
439 3300026116 Ga0207674_10005181 Ga0207674_100051817 551
440 3300026121 Ga0207683_10000115 Ga0207683_1000011553 551
441 3300028794 Ga0307515_10009815 Ga0307515_1000981514 551
442 3300031507 Ga0307509_10003311 Ga0307509_1000331110 551
443 3300031731 Ga0307405_10000180 Ga0307405_100001804 551
444 3300031901 Ga0307406_10005409 Ga0307406_100054091 551
445 3300032004 Ga0307414_10002924 Ga0307414_100029248 551
446 3300032005 Ga0307411_10001033 Ga0307411_100010339 551
447 3300033180 Ga0307510_10023302 Ga0307510_100233024 551
448 3300035691 Ga0373931_0052573 Ga0373931_0052573_192_2000 551
449 3300037471 Ga0395905_0101454 Ga0395905_0101454_595_2391 551
450 3300042145 Ga0450906_001662 Ga0450906_001662_1136_2917 551
451 3300046454 Ga0495592_0000159 Ga0495592_0000159_31091_32899 551
452 3300046660 Ga0495625_0000436 Ga0495625_0000436_55205_56998 551
453 3300048905 Ga0496102_0000067 Ga0496102_0000067_83324_85120 551
454 3300048906 Ga0496103_0000242 Ga0496103_0000242_50113_51909 551
455 3300048907 Ga0496104_0010698 Ga0496104_0010698_946_2742 551
456 3300048914 Ga0496111_0011343 Ga0496111_0011343_742_2538 551
457 3300048918 Ga0496115_0000056 Ga0496115_0000056_30662_32458 551
458 3300048919 Ga0496116_0009849 Ga0496116_0009849_5668_7464 551
459 3300048920 Ga0496117_0000114 Ga0496117_0000114_71603_73399 551
460 3300048921 Ga0496118_0000082 Ga0496118_0000082_111786_113582 551
461 3300048922 Ga0496119_0026396 Ga0496119_0026396_1189_2985 551
462 3300048924 Ga0496121_0000344 Ga0496121_0000344_71720_73516 551
463 3300048927 Ga0496124_0000068 Ga0496124_0000068_71740_73536 551
464 3300048929 Ga0496126_0000157 Ga0496126_0000157_71752_73548 551
465 iso_pu_bacteria 2574179768 2574430843 551
466 3300005459 Ga0068867_100000059 Ga0068867_10000005941 552
467 3300006880 Ga0075429_100000203 Ga0075429_10000020320 552
468 3300009545 Ga0105237_10003006 Ga0105237_100030066 552
469 3300010375 Ga0105239_10019943 Ga0105239_1001994310 552
470 3300014745 Ga0157377_10000029 Ga0157377_1000002984 552
471 3300015683 Ga0183362_10002 Ga0183362_100021296 552
472 3300025913 Ga0207695_10046919 Ga0207695_100469193 552
473 3300025914 Ga0207671_10013772 Ga0207671_100137725 552
474 3300025933 Ga0207706_10044090 Ga0207706_100440903 552
475 3300025935 Ga0207709_10000911 Ga0207709_1000091117 552
476 3300026089 Ga0207648_10000080 Ga0207648_1000008042 552
477 3300028786 Ga0307517_10000005 Ga0307517_1000000537 552
478 3300031616 Ga0307508_10089304 Ga0307508_100893043 552
479 3300046506 Ga0495583_0000129 Ga0495583_0000129_41382_43202 552
480 3300048924 Ga0496121_0043779 Ga0496121_0043779_1994_3802 552
481 3300050493 nmdc:mga0k408_18079_c1 nmdc:mga0k408_18079_c1_1677_3482 552
482 3300050508 nmdc:mga09592_2271_c1 nmdc:mga09592_2271_c1_10156_11913 552
483 3300031235 Ga0265330_10000267 Ga0265330_1000026713 553
484 3300031238 Ga0265332_10000031 Ga0265332_1000003113 553
485 3300031711 Ga0265314_10000095 Ga0265314_10000095116 553
486 iso_pu_bacteria 646564506 646815010 553
487 3300031730 Ga0307516_10000067 Ga0307516_1000006775 555
488 iso_pu_bacteria 2844665904 2844669660 555
489 iso_pu_bacteria 8019769354 8019775664 555
490 3300009036 Ga0105244_10000016 Ga0105244_1000001619 556
491 3300009036 Ga0105244_10001524 Ga0105244_100015246 556
492 3300009036 Ga0105244_10016545 Ga0105244_100165453 556
493 3300013307 Ga0157372_10001218 Ga0157372_100012184 556
494 3300015265 Ga0182005_1000524 Ga0182005_100052417 556
495 3300048922 Ga0496119_0002172 Ga0496119_0002172_15325_17091 556
496 3300048923 Ga0496120_0002014 Ga0496120_0002014_15728_17494 556
497 3300048925 Ga0496122_0005970 Ga0496122_0005970_2739_4502 556
498 3300049571 Ga0501034_0000003 Ga0501034_0000003_465141_466904 556
499 3300048905 Ga0496102_0005919 Ga0496102_0005919_3641_5476 557
500 3300048920 Ga0496117_0000090 Ga0496117_0000090_52152_53987 557
501 3300048921 Ga0496118_0000032 Ga0496118_0000032_151050_152885 557
502 3300048922 Ga0496119_0031893 Ga0496119_0031893_1718_3502 557
503 3300048928 Ga0496125_0035776 Ga0496125_0035776_1479_3263 557
504 iso_pu_bacteria 8011350971 8011354594 557
505 iso_pu_bacteria 651053060 651176163 559
506 3300046522 Ga0495643_0005423 Ga0495643_0005423_763_2529 560
507 iso_pu_bacteria 2511231004 2511258059 560
508 iso_pu_bacteria 2511231007 2511271544 560
509 iso_pu_bacteria 2511231008 2511280845 560
510 iso_pu_bacteria 2511231012 2511300269 560
511 iso_pu_bacteria 2511231015 2511322863 560
512 iso_pu_bacteria 2511231016 2511329321 560
513 iso_pu_bacteria 2511231017 2511331382 560
514 iso_pu_bacteria 2511231018 2511336177 560
515 iso_pu_bacteria 2511231019 2511342238 560
516 iso_pu_bacteria 2511231021 2511354952 560
517 iso_pu_bacteria 2511231022 2511362725 560
518 iso_pu_bacteria 2511231156 2511824963 560
519 iso_pu_bacteria 2554235341 2555669225 560
520 iso_pu_bacteria 2599185160 2599357877 560
521 iso_pu_bacteria 2599185161 2599361630 560
522 iso_pu_bacteria 2599185162 2599367952 560
523 iso_pu_bacteria 2599185163 2599374741 560
524 iso_pu_bacteria 2599185164 2599383042 560
525 iso_pu_bacteria 2599185165 2599389575 560
526 iso_pu_bacteria 2599185166 2599393599 560
527 iso_pu_bacteria 2599185168 2599405366 560
528 iso_pu_bacteria 2599185181 2599464693 560
529 iso_pu_bacteria 2599185182 2599468243 560
530 iso_pu_bacteria 2599185186 2599493716 560
531 iso_pu_bacteria 2599185188 2599502316 560
532 iso_pu_bacteria 2599185212 2599612843 560
533 iso_pu_bacteria 2599185248 2599769046 560
534 iso_pu_bacteria 2599185288 2599877984 560
535 iso_pu_bacteria 2599185289 2599884845 560
536 iso_pu_bacteria 2599185291 2599895977 560
537 iso_pu_bacteria 2599185300 2599932622 560
538 iso_pu_bacteria 2599185302 2599943374 560
539 iso_pu_bacteria 2599185303 2599952208 560
540 iso_pu_bacteria 2599185304 2599954485 560
541 iso_pu_bacteria 2599185305 2599957862 560
542 iso_pu_bacteria 2599185306 2599966788 560
543 iso_pu_bacteria 2599185307 2599970389 560
544 iso_pu_bacteria 2599185308 2599978067 560
545 iso_pu_bacteria 2599185309 2599983798 560
546 iso_pu_bacteria 2599185310 2599988696 560
547 iso_pu_bacteria 2599185311 2599993355 560
548 iso_pu_bacteria 2599185312 2600001400 560
549 iso_pu_bacteria 2599185313 2600004041 560
550 iso_pu_bacteria 2599185314 2600012206 560
551 iso_pu_bacteria 2599185315 2600015585 560
552 iso_pu_bacteria 2599185316 2600021942 560
553 iso_pu_bacteria 2599185317 2600028544 560
554 iso_pu_bacteria 2599185318 2600037539 560
555 iso_pu_bacteria 2599185319 2600042866 560
556 iso_pu_bacteria 2599185320 2600048603 560
557 iso_pu_bacteria 2599185321 2600050793 560
558 iso_pu_bacteria 2599185322 2600060076 560
559 iso_pu_bacteria 2599185323 2600063297 560
560 iso_pu_bacteria 2599185324 2600072675 560
561 iso_pu_bacteria 2599185325 2600075216 560
562 iso_pu_bacteria 2599185356 2600217415 560
563 iso_pu_bacteria 2600254930 2600357711 560
564 iso_pu_bacteria 2600254931 2600365631 560
565 iso_pu_bacteria 2600254954 2600446628 560
566 iso_pu_bacteria 2600255313 2601777585 560
567 iso_pu_bacteria 2600255389 2602010831 560
568 iso_pu_bacteria 2619619299 2621298796 560
569 iso_pu_bacteria 2623620446 2624492659 560
570 iso_pu_bacteria 2643221565 2643841652 560
571 iso_pu_bacteria 2643221589 2643956967 560
572 iso_pu_bacteria 2643221602 2644024890 560
573 iso_pu_bacteria 2643221633 2644186761 560
574 iso_pu_bacteria 2643221650 2644283939 560
575 iso_pu_bacteria 2651869719 2652544948 560
576 iso_pu_bacteria 2667528170 2671088669 560
577 iso_pu_bacteria 2667528171 2671098272 560
578 iso_pu_bacteria 2667528176 2671126290 560
579 iso_pu_bacteria 2675903420 2677900728 560
580 iso_pu_bacteria 2675903515 2678263602 560
581 iso_pu_bacteria 2728369097 2729145861 560
582 iso_pu_bacteria 2738541265 2738672045 560
583 iso_pu_bacteria 2738541282 2738750438 560
584 iso_pu_bacteria 2738541294 2738810033 560
585 iso_pu_bacteria 2738541303 2738859479 560
586 iso_pu_bacteria 2738541309 2738897393 560
587 iso_pu_bacteria 2738543004 2739197682 560
588 iso_pu_bacteria 2738543015 2739258598 560
589 iso_pu_bacteria 2738543020 2739286374 560
590 iso_pu_bacteria 2738543021 2739291687 560
591 iso_pu_bacteria 2744054620 2745009933 560
592 iso_pu_bacteria 2773857670 2774123242 560
593 iso_pu_bacteria 2784132072 2784315766 560
594 iso_pu_bacteria 2791355520 2794594852 560
595 iso_pu_bacteria 2808606361 2808856269 560
596 iso_pu_bacteria 2808606376 2808924711 560
597 iso_pu_bacteria 2808606377 2808932979 560
598 iso_pu_bacteria 2808606378 2808938990 560
599 iso_pu_bacteria 2808606379 2808943239 560
600 iso_pu_bacteria 2808606380 2808946707 560
601 iso_pu_bacteria 2808606381 2808955122 560
602 iso_pu_bacteria 2808606382 2808958310 560
603 iso_pu_bacteria 2808606383 2808964763 560
604 iso_pu_bacteria 2808606385 2808976999 560
605 iso_pu_bacteria 2808606388 2808992154 560
606 iso_pu_bacteria 2808606389 2809002099 560
607 iso_pu_bacteria 2816332298 2817492043 560
608 iso_pu_bacteria 2818991464 2819703343 560
609 iso_pu_bacteria 2823421272 2823423413 560
610 iso_pu_bacteria 2825651385 2825651974 560
611 iso_pu_bacteria 2834028612 2834032857 560
612 iso_pu_bacteria 2842854478 2842858151 560
613 iso_pu_bacteria 2852612431 2852613667 560
614 iso_pu_bacteria 2852667396 2852668597 560
615 iso_pu_bacteria 2860339153 2860342339 560
616 iso_pu_bacteria 2904550169 2904550567 560
617 iso_pu_bacteria 2913036834 2913039679 560
618 iso_pu_bacteria 2917070673 2917073028 560
619 iso_pu_bacteria 2919155634 2919156764 560
620 iso_pu_bacteria 2919456309 2919459019 560
621 iso_pu_bacteria 2919481497 2919484768 560
622 iso_pu_bacteria 2919501602 2919505218 560
623 iso_pu_bacteria 2919697872 2919702647 560
624 iso_pu_bacteria 2923586266 2923588448 560
625 iso_pu_bacteria 2926063275 2926066895 560
626 iso_pu_bacteria 2929144301 2929147580 560
627 iso_pu_bacteria 2931369376 2931375148 560
628 iso_pu_bacteria 2931396565 2931402422 560
629 iso_pu_bacteria 2935353572 2935359444 560
630 iso_pu_bacteria 2939636861 2939638500 560
631 iso_pu_bacteria 2988728565 2988728861 560
632 iso_pu_bacteria 3007511990 3007514618 560
633 iso_pu_bacteria 3007803356 3007808262 560
634 iso_pu_bacteria 3007866637 3007869136 560
635 iso_pu_bacteria 637000220 637319560 560
636 iso_pu_bacteria 8019775933 8019781051 560
637 iso_pu_bacteria 8034962539 8034963695 560
638 iso_pu_bacteria 8052494512 8052497778 560
639 iso_pu_bacteria 8054503363 8054507049 560
640 iso_pu_bacteria 8056125926 8056129297 560
641 iso_pu_bacteria 8056131705 8056135480 560
642 iso_pu_bacteria 8056143049 8056146202 560
643 iso_pu_bacteria 8056155041 8056157624 560
644 3300002737 JGI25162J39368_1000013 JGI25162J39368_1000013289 562
645 3300002772 JGI25164J39214_1000005 JGI25164J39214_1000005289 562
646 3300003214 JGI25165J46597_1000099 JGI25165J46597_100009971 562
647 3300003578 Ga0006562J51391_1005668 Ga0006562J51391_10056686 562
648 3300003791 Ga0055530_10000075 Ga0055530_1000007537 562
649 3300003792 Ga0055540_1000115 Ga0055540_100011537 562
650 3300005288 Ga0065714_10002340 Ga0065714_100023403 562
651 3300005289 Ga0065704_10000778 Ga0065704_1000077811 562
652 3300006946 Ga0079104_1000554 Ga0079104_10005542 562
653 3300006948 Ga0099826_10026578 Ga0099826_100265781 562
654 3300009036 Ga0105244_10008586 Ga0105244_100085865 562
655 3300011119 Ga0105246_10040883 Ga0105246_100408832 562
656 3300013100 Ga0157373_10001148 Ga0157373_1000114813 562
657 3300013102 Ga0157371_10001866 Ga0157371_100018662 562
658 3300015261 Ga0182006_1001034 Ga0182006_100103416 562
659 3300015262 Ga0182007_10000071 Ga0182007_1000007118 562
660 3300025207 Ga0209760_100035 Ga0209760_10003542 562
661 3300025231 Ga0207427_100018 Ga0207427_100018446 562
662 3300025233 Ga0209437_100031 Ga0209437_100031446 562
663 3300025261 Ga0209233_1000012 Ga0209233_1000012443 562
664 3300025292 Ga0209676_1004064 Ga0209676_10040644 562
665 3300025298 Ga0209050_1000013 Ga0209050_1000013429 562
666 3300025298 Ga0209050_1000914 Ga0209050_100091422 562
667 3300025303 Ga0209051_1000007 Ga0209051_1000007429 562
668 3300025304 Ga0209257_1011899 Ga0209257_10118992 562
669 3300025728 Ga0207655_1003059 Ga0207655_10030598 562
670 3300025735 Ga0207713_1015292 Ga0207713_10152923 562
671 3300027111 Ga0209281_1000009 Ga0209281_1000009446 562
672 3300031548 Ga0307408_100002935 Ga0307408_1000029358 562
673 3300042009 Ga0439451_004360 Ga0439451_004360_439_2220 562
674 3300046457 Ga0495590_0002605 Ga0495590_0002605_1155_2930 562
675 3300046474 Ga0495605_0002121 Ga0495605_0002121_890_2668 562
676 3300046474 Ga0495605_0023402 Ga0495605_0023402_1394_3169 562
677 3300046491 Ga0495584_0002919 Ga0495584_0002919_826_2601 562
678 3300046501 Ga0495607_0002369 Ga0495607_0002369_1043_2818 562
679 3300046507 Ga0495606_0003306 Ga0495606_0003306_5525_7300 562
680 3300046528 Ga0495642_0000067 Ga0495642_0000067_34709_36484 562
681 3300046538 Ga0495609_0004161 Ga0495609_0004161_622_2397 562
682 3300046557 Ga0495622_0000638 Ga0495622_0000638_16860_18635 562
683 3300046692 Ga0495671_0004284 Ga0495671_0004284_1375_3150 562
684 3300046694 Ga0495649_0008024 Ga0495649_0008024_29_1804 562
685 3300046794 Ga0495589_0000220 Ga0495589_0000220_39563_41338 562
686 3300047320 Ga0495672_0000553 Ga0495672_0000553_22712_24487 562
687 3300047320 Ga0495672_0008074 Ga0495672_0008074_5142_6917 562
688 3300047469 Ga0495673_0003440 Ga0495673_0003440_6931_8709 562
689 3300048091 Ga0495626_0001191 Ga0495626_0001191_18738_20513 562
690 3300048091 Ga0495626_0002350 Ga0495626_0002350_6090_7865 562
691 3300048091 Ga0495626_0005927 Ga0495626_0005927_4479_6254 562
692 3300048905 Ga0496102_0000073 Ga0496102_0000073_129440_131218 562
693 3300048919 Ga0496116_0000995 Ga0496116_0000995_17593_19368 562
694 3300049459 Ga0495678_008505 Ga0495678_008505_2155_3930 562
695 3300025292 Ga0209676_1000617 Ga0209676_10006177 563
696 3300047323 Ga0495683_0000852 Ga0495683_0000852_18945_20720 563
697 iso_pu_bacteria 640427133 640488209 563
698 2124908027 MRS2a_Contig_5158 MRS2a_00057600 564
699 3300002737 JGI25162J39368_1000050 JGI25162J39368_100005059 564
700 3300002772 JGI25164J39214_1000025 JGI25164J39214_1000025102 564
701 3300003214 JGI25165J46597_1000114 JGI25165J46597_1000114102 564
702 3300003214 JGI25165J46597_1000176 JGI25165J46597_100017643 564
703 3300005288 Ga0065714_10074368 Ga0065714_100743681 564
704 3300005289 Ga0065704_10019304 Ga0065704_100193042 564
705 3300005289 Ga0065704_10099251 Ga0065704_100992511 564
706 3300005290 Ga0065712_10013359 Ga0065712_100133591 564
707 3300005331 Ga0070670_100000303 Ga0070670_10000030324 564
708 3300005344 Ga0070661_100002107 Ga0070661_1000021076 564
709 3300005564 Ga0070664_100002981 Ga0070664_1000029815 564
710 3300006058 Ga0075432_10001039 Ga0075432_100010392 564
711 3300006914 Ga0075436_100050914 Ga0075436_1000509142 564
712 3300006944 Ga0099823_1000001 Ga0099823_1000001146 564
713 3300006946 Ga0079104_1000303 Ga0079104_100030350 564
714 3300009011 Ga0105251_10012550 Ga0105251_100125502 564
715 3300009036 Ga0105244_10004851 Ga0105244_100048517 564
716 3300009092 Ga0105250_10000353 Ga0105250_1000035315 564
717 3300009148 Ga0105243_10055083 Ga0105243_100550831 564
718 3300009176 Ga0105242_10022928 Ga0105242_100229282 564
719 3300009545 Ga0105237_10006234 Ga0105237_100062346 564
720 3300013100 Ga0157373_10008114 Ga0157373_100081142 564
721 3300013102 Ga0157371_10001502 Ga0157371_1000150217 564
722 3300013104 Ga0157370_10001953 Ga0157370_100019536 564
723 3300013105 Ga0157369_10012461 Ga0157369_100124618 564
724 3300013308 Ga0157375_10095431 Ga0157375_100954311 564
725 3300014497 Ga0182008_10007960 Ga0182008_100079604 564
726 3300014497 Ga0182008_10009829 Ga0182008_100098295 564
727 3300014497 Ga0182008_10018151 Ga0182008_100181512 564
728 3300015261 Ga0182006_1001202 Ga0182006_100120213 564
729 3300015262 Ga0182007_10001255 Ga0182007_100012556 564
730 3300017792 Ga0163161_10004705 Ga0163161_100047056 564
731 3300025207 Ga0209760_100033 Ga0209760_10003332 564
732 3300025231 Ga0207427_100003 Ga0207427_100003895 564
733 3300025233 Ga0209437_100002 Ga0209437_100002119 564
734 3300025261 Ga0209233_1000004 Ga0209233_10000041307 564
735 3300025711 Ga0207696_1000016 Ga0207696_1000016148 564
736 3300025711 Ga0207696_1000108 Ga0207696_100010898 564
737 3300025711 Ga0207696_1012629 Ga0207696_10126292 564
738 3300025728 Ga0207655_1000027 Ga0207655_1000027249 564
739 3300025728 Ga0207655_1000114 Ga0207655_10001146 564
740 3300025728 Ga0207655_1000384 Ga0207655_100038445 564
741 3300025728 Ga0207655_1002020 Ga0207655_10020201 564
742 3300025728 Ga0207655_1022254 Ga0207655_10222541 564
743 3300025728 Ga0207655_1028880 Ga0207655_10288802 564
744 3300025735 Ga0207713_1000185 Ga0207713_100018571 564
745 3300025735 Ga0207713_1001969 Ga0207713_10019692 564
746 3300025735 Ga0207713_1002029 Ga0207713_10020292 564
747 3300025735 Ga0207713_1022044 Ga0207713_10220441 564
748 3300025735 Ga0207713_1034813 Ga0207713_10348131 564
749 3300025914 Ga0207671_10001354 Ga0207671_100013546 564
750 3300025920 Ga0207649_10000577 Ga0207649_100005775 564
751 3300025925 Ga0207650_10000068 Ga0207650_10000068113 564
752 3300025935 Ga0207709_10033091 Ga0207709_100330912 564
753 3300025945 Ga0207679_10001702 Ga0207679_100017026 564
754 3300027111 Ga0209281_1000063 Ga0209281_100006347 564
755 3300027296 Ga0209389_1000007 Ga0209389_1000007156 564
756 3300027665 Ga0209983_1001879 Ga0209983_10018793 564
757 3300027682 Ga0209971_1001017 Ga0209971_10010171 564
758 3300031548 Ga0307408_100000018 Ga0307408_100000018250 564
759 3300031731 Ga0307405_10000137 Ga0307405_1000013715 564
760 3300041404 Ga0439436_0004667 Ga0439436_0004667_2118_3902 564
761 3300041411 Ga0439466_0002538 Ga0439466_0002538_625_2400 564
762 3300042006 Ga0439432_000171 Ga0439432_000171_7473_9248 564
763 3300042146 Ga0450907_000140 Ga0450907_000140_10168_11943 564
764 3300042439 Ga0439464_0000443 Ga0439464_0000443_5012_6787 564
765 3300046458 Ga0495591_000174 Ga0495591_000174_31767_33542 564
766 3300046458 Ga0495591_000697 Ga0495591_000697_13365_15140 564
767 3300046458 Ga0495591_010060 Ga0495591_010060_251_2026 564
768 3300046460 Ga0495638_0003448 Ga0495638_0003448_8599_10374 564
769 3300046460 Ga0495638_0011837 Ga0495638_0011837_4047_5822 564
770 3300046463 Ga0495653_0041055 Ga0495653_0041055_1571_3346 564
771 3300046471 Ga0495650_0001051 Ga0495650_0001051_8654_10429 564
772 3300046474 Ga0495605_0000076 Ga0495605_0000076_93325_95100 564
773 3300046474 Ga0495605_0001638 Ga0495605_0001638_10099_11874 564
774 3300046491 Ga0495584_0003118 Ga0495584_0003118_5362_7137 564
775 3300046492 Ga0495585_0000545 Ga0495585_0000545_29138_30913 564
776 3300046492 Ga0495585_0026285 Ga0495585_0026285_1076_2851 564
777 3300046500 Ga0495596_0006327 Ga0495596_0006327_1006_2781 564
778 3300046501 Ga0495607_0000799 Ga0495607_0000799_3554_5329 564
779 3300046506 Ga0495583_0000172 Ga0495583_0000172_103919_105694 564
780 3300046506 Ga0495583_0003405 Ga0495583_0003405_7957_9732 564
781 3300046506 Ga0495583_0005099 Ga0495583_0005099_3508_5283 564
782 3300046506 Ga0495583_0006345 Ga0495583_0006345_4980_6755 564
783 3300046507 Ga0495606_0000028 Ga0495606_0000028_9655_11430 564
784 3300046507 Ga0495606_0000684 Ga0495606_0000684_34_1812 564
785 3300046507 Ga0495606_0002075 Ga0495606_0002075_22471_24246 564
786 3300046507 Ga0495606_0012296 Ga0495606_0012296_4131_5906 564
787 3300046512 Ga0495610_0004091 Ga0495610_0004091_1134_2909 564
788 3300046515 Ga0495620_0000314 Ga0495620_0000314_3715_5490 564
789 3300046515 Ga0495620_0004729 Ga0495620_0004729_5448_7223 564
790 3300046518 Ga0495631_0000275 Ga0495631_0000275_16014_17789 564
791 3300046520 Ga0495637_0000027 Ga0495637_0000027_94848_96623 564
792 3300046520 Ga0495637_0004465 Ga0495637_0004465_4999_6774 564
793 3300046520 Ga0495637_0014441 Ga0495637_0014441_1099_2874 564
794 3300046523 Ga0495644_0007674 Ga0495644_0007674_1812_3587 564
795 3300046523 Ga0495644_0030543 Ga0495644_0030543_39_1814 564
796 3300046524 Ga0495648_0027650 Ga0495648_0027650_602_2377 564
797 3300046528 Ga0495642_0000334 Ga0495642_0000334_15915_17690 564
798 3300046530 Ga0495654_0004194 Ga0495654_0004194_5076_6851 564
799 3300046530 Ga0495654_0005001 Ga0495654_0005001_1792_3567 564
800 3300046530 Ga0495654_0044825 Ga0495654_0044825_180_1955 564
801 3300046536 Ga0495587_0039571 Ga0495587_0039571_788_2566 564
802 3300046536 Ga0495587_0040769 Ga0495587_0040769_270_2045 564
803 3300046538 Ga0495609_0000206 Ga0495609_0000206_29358_31133 564
804 3300046538 Ga0495609_0006540 Ga0495609_0006540_3470_5245 564
805 3300046557 Ga0495622_0004006 Ga0495622_0004006_1279_3054 564
806 3300046615 Ga0495656_0007101 Ga0495656_0007101_2136_3911 564
807 3300046616 Ga0495668_0003932 Ga0495668_0003932_2623_4398 564
808 3300046648 Ga0495611_0004712 Ga0495611_0004712_2531_4306 564
809 3300046660 Ga0495625_0000296 Ga0495625_0000296_70639_72414 564
810 3300046663 Ga0495635_0043568 Ga0495635_0043568_579_2354 564
811 3300046665 Ga0495661_0000119 Ga0495661_0000119_31505_33280 564
812 3300046665 Ga0495661_0008680 Ga0495661_0008680_5012_6787 564
813 3300046680 Ga0495646_0049093 Ga0495646_0049093_17_1795 564
814 3300046691 Ga0495670_0004075 Ga0495670_0004075_5007_6782 564
815 3300046692 Ga0495671_0001916 Ga0495671_0001916_10880_12658 564
816 3300046692 Ga0495671_0002682 Ga0495671_0002682_497_2272 564
817 3300046810 Ga0495660_0002659 Ga0495660_0002659_4187_5962 564
818 3300047321 Ga0495676_0000003 Ga0495676_0000003_53676_55451 564
819 3300047323 Ga0495683_0000382 Ga0495683_0000382_18180_19955 564
820 3300047446 Ga0495679_001158 Ga0495679_001158_13922_15697 564
821 3300047446 Ga0495679_003272 Ga0495679_003272_1957_3732 564
822 3300047469 Ga0495673_0000602 Ga0495673_0000602_16024_17799 564
823 3300047469 Ga0495673_0000782 Ga0495673_0000782_8566_10341 564
824 3300047469 Ga0495673_0002393 Ga0495673_0002393_2169_3944 564
825 3300047469 Ga0495673_0027861 Ga0495673_0027861_256_2031 564
826 3300047470 Ga0495681_0007269 Ga0495681_0007269_4308_6083 564
827 3300047470 Ga0495681_0010033 Ga0495681_0010033_1125_2900 564
828 3300048091 Ga0495626_0000086 Ga0495626_0000086_27389_29164 564
829 3300048913 Ga0496110_0075255 Ga0496110_0075255_236_2011 564
830 3300048920 Ga0496117_0004650 Ga0496117_0004650_40_1815 564
831 3300048924 Ga0496121_0001663 Ga0496121_0001663_27518_29293 564
832 3300048925 Ga0496122_0000244 Ga0496122_0000244_75612_77387 564
833 3300048925 Ga0496122_0061191 Ga0496122_0061191_277_2052 564
834 3300048926 Ga0496123_0000201 Ga0496123_0000201_75665_77440 564
835 3300048926 Ga0496123_0013135 Ga0496123_0013135_3940_5715 564
836 3300048926 Ga0496123_0028961 Ga0496123_0028961_1600_3375 564
837 3300048927 Ga0496124_0018543 Ga0496124_0018543_3744_5519 564
838 3300048927 Ga0496124_0019143 Ga0496124_0019143_674_2449 564
839 3300048928 Ga0496125_0000862 Ga0496125_0000862_21766_23541 564
840 3300048928 Ga0496125_0059744 Ga0496125_0059744_201_1976 564
841 3300048929 Ga0496126_0004738 Ga0496126_0004738_4831_6606 564
842 3300049459 Ga0495678_001067 Ga0495678_001067_12059_13834 564
843 3300049459 Ga0495678_018802 Ga0495678_018802_279_2054 564
844 3300049460 Ga0495682_0000138 Ga0495682_0000138_36985_38760 564
845 3300049853 Ga0501226_000017 Ga0501226_000017_10206_11987 564

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13570

PQQ_3

PQQ-like domain

538

578

0.98

PF01011

PQQ

PQQ enzyme repeat

560

597

0.95

PF01011

PQQ

PQQ enzyme repeat

202

239

0.93

PF13360

PQQ_2

PQQ-like domain

527

641

0.89

PF01011

PQQ

PQQ enzyme repeat

153

188

0.88

PF13570

PQQ_3

PQQ-like domain

172

220

0.8

PF13360

PQQ_2

PQQ-like domain

122

298

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
6zcv-assembly1.cif.gz_A crystal structure of lanthanide-dependent alcohol dehydrogenase pedh from pseudomonas putida kt2440 0.9676 29 560
6zcw-assembly1.cif.gz_A crystal structure of lanthanide-dependent alcohol dehydrogenase pedh from pseudomonas putida kt2440 0.967 29 560
1flg-assembly1.cif.gz_B crystal structure of the quinoprotein ethanol dehydrogenase from pseudomonas aeruginosa 0.9427 28 557
6zcv-assembly1.cif.gz_A crystal structure of lanthanide-dependent alcohol dehydrogenase pedh from pseudomonas putida kt2440 0.9153 29 560
6zcw-assembly1.cif.gz_A crystal structure of lanthanide-dependent alcohol dehydrogenase pedh from pseudomonas putida kt2440 0.9148 29 560
ID Description Score Start End Superfamily
1flgA00 Mainly Beta;8 Propeller;Methanol Dehydrogenase; Chain A;Quinoprotein alcohol dehydrogenase-like superfamily 0.9446 28 557 2.140.10.10
1flgA00 Mainly Beta;8 Propeller;Methanol Dehydrogenase; Chain A;Quinoprotein alcohol dehydrogenase-like superfamily 0.8893 28 557 2.140.10.10
4tqoD00 Mainly Beta;8 Propeller;Methanol Dehydrogenase; Chain A;Quinoprotein alcohol dehydrogenase-like superfamily 0.8775 32 555 2.140.10.10
6damA00 Mainly Beta;8 Propeller;Methanol Dehydrogenase; Chain A;Quinoprotein alcohol dehydrogenase-like superfamily 0.8702 32 557 2.140.10.10
af_D3Z757_2_150_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.8524 92 168 2.40.128.630
ID Description Score Start End GO Terms
AF-A0A0I9SGI2-F1-model_v4 Dehydrogenase 0.9638 64 563 GO:0005509
GO:0016020
GO:0016614
AF-A0A7H2DPB2-F1-model_v4 deleted 0.9608 19 562
AF-A0A6I1NS56-F1-model_v4 PQQ-dependent dehydrogenase, methanol/ethanol family 0.9552 344 492
AF-A0A2V8BVC9-F1-model_v4 PQQ-binding-like beta-propeller repeat protein 0.9541 92 173
AF-A0A661FFX2-F1-model_v4 PQQ-dependent dehydrogenase, methanol/ethanol family 0.9513 118 557 GO:0005509
GO:0016020
GO:0016614
GO:0030288

Feature Viewer

pLDDT pTM Quality
84.73 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map