F483254
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 845 | 542 | 637 | 569 |
Family's Representative Sequence
| Representative Sequence | 3300025728|Ga0207655_1000027|Ga0207655_1000027249 |
| Length | 653 |
| Sequence | MRRAGGARSVPPRKSQADTKELEISALRPIVGNRVGNQEFSAHREIFPDTTIKPKVAVMTRSPRRPLFAVSLVLSAMLLAGAAHAAVSNEEILQDPKNPQQIVTNGLGVQGQRYSPLDLLNANNVKELRPVWAFSFGGEKQRGQQAQPLIKDGVMYLTGSYSRVFAVDARTGKKLWQYDARLPDDIRPCCDVINRGVALYGDLVFFGTLDAKLVALNKDTGKVVWSKKVADHKEGYSISAAPMIVNGKLITGVAGGEFGVVGKIQAYNPENGELLWMRPTVEGHMGYVYKDGKAIENGISGGEAGKTWPGDLWKTGGAAPWLGGYYDPETNLILFGTGNPAPWNSHLRPGDNLYSSSRLALNPDDGTIKWHFQSTPHDGWDFDGVNELISFNYKDGGKEVKAAATADRNGFFYVLDRTNGKFIRGFPFVDKITWATGLDKDGRPIYNDASRPGAPGSEAKGSSVFVAPAFLGAKNWMPMAYNKDTGLFYVPSNEWGMDIWNEGIAYKKGAAFLGAGFTIKPLNEDYIGVLRAIDPISGKEVWRHKNYAPLWGGVLTTKGNLVFTGTPEGFLQAFNAKTGDKVWEFQTGSGVLGSPVTWEMDGEQYVSVVSGWGGAVPLWGGEVAKRVKDFNQGGMLWTFKLPKQLQQTASAQP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 4 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 5 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 6 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 7 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 8 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 9 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 10 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 11 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 12 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 13 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 14 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 15 | 2511231221 | Azospirillum lipoferum 4B | Isolate | Rhizosphere |
| 16 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 17 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 18 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 19 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 20 | 2574179768 | Azoarcus communis DSM 12120 | Isolate | Unclassified |
| 21 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 22 | 2596583598 | Ralstonia sp. UNCCL144 | Isolate | Unclassified |
| 23 | 2597490356 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 24 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 25 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 26 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 27 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 28 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 29 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 30 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 31 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 32 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 33 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 34 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 35 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 36 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 37 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 38 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 39 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 40 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 41 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 42 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 43 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 44 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 45 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 46 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 47 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 48 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 49 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 50 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 51 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 52 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 53 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 54 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 55 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 56 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 57 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 58 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 59 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 60 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 61 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 62 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 63 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 64 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 65 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 66 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 67 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 68 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 69 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 70 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 71 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 72 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 73 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 74 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 75 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 76 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 77 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 78 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 79 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 80 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 81 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 82 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 83 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 84 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 85 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 86 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 87 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 88 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 89 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 90 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 91 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 92 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 93 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 94 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 95 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 96 | 2728369097 | Stutzerimonas balearica st101 | Isolate | Unclassified |
| 97 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 98 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 99 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 100 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 101 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 102 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 103 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 104 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 105 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 106 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 107 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 108 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 109 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 110 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 111 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 112 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 113 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 114 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 115 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 116 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 117 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 118 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 119 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 120 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 121 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 122 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 123 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 124 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 125 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 126 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 127 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 128 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 129 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 130 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 131 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 132 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 133 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 134 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 135 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 136 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 137 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 138 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 139 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 140 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 141 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 142 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 143 | 2846952575 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 144 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 145 | 2848858292 | Azospirillum brasilense Az39 | Isolate | Unclassified |
| 146 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 147 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 148 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 149 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 150 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 151 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 152 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 153 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 154 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 155 | 2885266251 | Ralstonia sp. SET104 | Isolate | Nodule |
| 156 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 157 | 2900577576 | Ralstonia sp. TCR112 | Isolate | Rhizosphere |
| 158 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 159 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 160 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 161 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 162 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 163 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 164 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 165 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 166 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 167 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 168 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 169 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 170 | 2919679072 | Pseudotabrizicola sp. 4114 | Isolate | Unclassified |
| 171 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 172 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 173 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 174 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 175 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 176 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 177 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 178 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 179 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 180 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 181 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 182 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 183 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 184 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 185 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 186 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 187 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 188 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 189 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 190 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 191 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 192 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 193 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 194 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 195 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 196 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 197 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 198 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 199 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 200 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 201 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 202 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 203 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 204 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 205 | 3300003157 | Avena fatua rhizosphere microbial communities - H3_Bulk_Litter_17 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 206 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 207 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 208 | 3300003479 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 209 | 3300003558 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_10_fullP_mix1_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 210 | 3300003565 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_16_lowP_mix3_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 211 | 3300003567 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 212 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 213 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 214 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 215 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 216 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 217 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 218 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 219 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 220 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 221 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 222 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 223 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 224 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 225 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 226 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 227 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 228 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 229 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 230 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 231 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 232 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 233 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 234 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 235 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 236 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 237 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 238 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 239 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 240 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 241 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 242 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 243 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 244 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 245 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 246 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 247 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 248 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 249 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 250 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 251 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 252 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 253 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 254 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 255 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 256 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 257 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 258 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 259 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 260 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 261 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 262 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 263 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 264 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 266 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 267 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 268 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 269 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 270 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 271 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 272 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 274 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 275 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 276 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 277 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 278 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 279 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 280 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 281 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 282 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 283 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 284 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 285 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 286 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 287 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 288 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 289 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 290 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 291 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 292 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 293 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 294 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 295 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 296 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 297 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 298 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 299 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 300 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 301 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 302 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 303 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 304 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 305 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 306 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 307 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 308 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 309 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 310 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 311 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 312 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 313 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 314 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 315 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 316 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 317 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 318 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 319 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 320 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 321 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 322 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 323 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 324 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 325 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 326 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 327 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 328 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 354 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 356 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 359 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 360 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 361 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 363 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 364 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 365 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 366 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 367 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 368 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 369 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 370 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 371 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 372 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 373 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 374 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 375 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 376 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 377 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 378 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 379 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 380 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 381 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 382 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 383 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 384 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 385 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 386 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 387 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 388 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 389 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 390 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 391 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 392 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 393 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 394 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 395 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 396 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 397 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 398 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 399 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 400 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 401 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 402 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 403 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 404 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 405 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 406 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 407 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 408 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 409 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 410 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 411 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 412 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 413 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 414 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 415 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 416 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 417 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 418 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 419 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 420 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 421 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 422 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 480 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 481 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 482 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 483 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 484 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 485 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 486 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 487 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 488 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 489 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 490 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 491 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 492 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 493 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 494 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 495 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 496 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 497 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 498 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 499 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 500 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 501 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 504 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 505 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 506 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 507 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 508 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 509 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 510 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 511 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 512 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 513 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 514 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 516 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 517 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 518 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 519 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 520 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 521 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 522 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 523 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 524 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 525 | 640427133 | Stutzerimonas stutzeri A1501 | Isolate | Rhizosphere |
| 526 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 527 | 646564506 | Arcobacter nitrofigilis DSM 7299 | Isolate | Unclassified |
| 528 | 651053060 | Stutzerimonas stutzeri CMT.A.9 | Isolate | Rhizosphere |
| 529 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 530 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 531 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 532 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 533 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 534 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 535 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
| 536 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
| 537 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 538 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 539 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 540 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 541 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 542 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 73.73 |
| Metatranscriptomes | 1.66 |
| Isolates | 24.62 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.9 |
| Nodule | 4.14 |
| Rhizoplane | 8.05 |
| Rhizosphere | 58.11 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 16.8 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_5158 | 2124908027 | Bacteria | 19190 |
| 2 | SwRhRL2b_contig_2160423 | 2162886007 | Bacteria | 2025 |
| 3 | JGI24736J21556_1000711 | 3300001904 | Bacteria | 6068 |
| 4 | JGI24741J21665_1000182 | 3300001915 | Bacteria | 18224 |
| 5 | JGI24741J21665_1000642 | 3300001915 | Bacteria | 10568 |
| 6 | JGI24740J21852_10000084 | 3300001979 | Bacteria | 32275 |
| 7 | JGI24740J21852_10000388 | 3300001979 | Bacteria | 18881 |
| 8 | JGI24740J21852_10000924 | 3300001979 | Bacteria | 13055 |
| 9 | JGI24740J21852_10001008 | 3300001979 | Bacteria | 12592 |
| 10 | JGI24737J22298_10000869 | 3300001990 | Bacteria | 10788 |
| 11 | JGI24737J22298_10001102 | 3300001990 | Bacteria | 9496 |
| 12 | JGI24735J21928_10002829 | 3300002067 | Bacteria | 5988 |
| 13 | JGI24738J21930_10006730 | 3300002075 | Bacteria | 2675 |
| 14 | JGI25156J39149_1000247 | 3300002705 | Bacteria | 37338 |
| 15 | JGI25156J39149_1000284 | 3300002705 | Bacteria | 34180 |
| 16 | JGI25162J39368_1000013 | 3300002737 | Bacteria | 343384 |
| 17 | JGI25162J39368_1000050 | 3300002737 | Bacteria | 157157 |
| 18 | JGI25154J39366_1000792 | 3300002738 | Bacteria | 14000 |
| 19 | JGI25154J39366_1003144 | 3300002738 | Bacteria | 3671 |
| 20 | JGI25157J39369_1000280 | 3300002741 | Bacteria | 37332 |
| 21 | JGI25164J39214_1000005 | 3300002772 | Bacteria | 343384 |
| 22 | JGI25164J39214_1000025 | 3300002772 | Bacteria | 157157 |
| 23 | JGI25152J39213_1000747 | 3300002773 | Bacteria | 16582 |
| 24 | JGI25150J39212_1000509 | 3300002774 | Bacteria | 16087 |
| 25 | JGI25150J39212_1001065 | 3300002774 | Bacteria | 8347 |
| 26 | Ga0006774J45829_10489 | 3300003157 | Bacteria | 1945 |
| 27 | JGI25165J46597_1000099 | 3300003214 | Bacteria | 158550 |
| 28 | JGI25165J46597_1000114 | 3300003214 | Bacteria | 144350 |
| 29 | JGI25165J46597_1000176 | 3300003214 | Bacteria | 99160 |
| 30 | JGI25153J46596_10000179 | 3300003215 | Bacteria | 62415 |
| 31 | JGI25153J46596_10007048 | 3300003215 | Bacteria | 5593 |
| 32 | Ga0006556J51387_1002520 | 3300003479 | Bacteria | 8573 |
| 33 | Ga0006558J51389_1003962 | 3300003558 | Bacteria | 8580 |
| 34 | Ga0006560J51390_1001645 | 3300003565 | Bacteria | 8700 |
| 35 | Ga0006554J51385_1007769 | 3300003567 | Bacteria | 4660 |
| 36 | Ga0006562J51391_1005668 | 3300003578 | Bacteria | 8205 |
| 37 | Ga0006562J51391_1145654 | 3300003578 | Bacteria | 2207 |
| 38 | Ga0055538_1001384 | 3300003751 | Bacteria | 4751 |
| 39 | Ga0055539_1000068 | 3300003752 | Bacteria | 134912 |
| 40 | Ga0055539_1000287 | 3300003752 | Bacteria | 28380 |
| 41 | Ga0055533_1000045 | 3300003756 | Bacteria | 223637 |
| 42 | Ga0055533_1000386 | 3300003756 | Bacteria | 17595 |
| 43 | Ga0055532_1000028 | 3300003758 | Bacteria | 234512 |
| 44 | Ga0055525_1000012 | 3300003759 | Bacteria | 486564 |
| 45 | Ga0055525_1000723 | 3300003759 | Bacteria | 11605 |
| 46 | Ga0055527_1001261 | 3300003760 | Bacteria | 5564 |
| 47 | Ga0055535_1000022 | 3300003761 | Bacteria | 234512 |
| 48 | Ga0055535_1000275 | 3300003761 | Bacteria | 53952 |
| 49 | Ga0055535_1005127 | 3300003761 | Bacteria | 2962 |
| 50 | Ga0055542_1000025 | 3300003762 | Bacteria | 263538 |
| 51 | Ga0055529_1000014 | 3300003763 | Bacteria | 367283 |
| 52 | Ga0055529_1000145 | 3300003763 | Bacteria | 101255 |
| 53 | Ga0055529_1000323 | 3300003763 | Bacteria | 53943 |
| 54 | Ga0055537_1000484 | 3300003773 | Bacteria | 24629 |
| 55 | Ga0055524_1004765 | 3300003775 | Bacteria | 6194 |
| 56 | Ga0055534_1000406 | 3300003784 | Bacteria | 26436 |
| 57 | Ga0055530_10000075 | 3300003791 | Bacteria | 84932 |
| 58 | Ga0055540_1000115 | 3300003792 | Bacteria | 84932 |
| 59 | Ga0055540_1001656 | 3300003792 | Bacteria | 12919 |
| 60 | Ga0055540_1009310 | 3300003792 | Bacteria | 3407 |
| 61 | Ga0055541_1001507 | 3300003841 | Bacteria | 5016 |
| 62 | Ga0065714_10002340 | 3300005288 | Bacteria | 25797 |
| 63 | Ga0065714_10074368 | 3300005288 | Bacteria | 3047 |
| 64 | Ga0065704_10000778 | 3300005289 | Bacteria | 18558 |
| 65 | Ga0065704_10007641 | 3300005289 | Bacteria | 2861 |
| 66 | Ga0065704_10019304 | 3300005289 | Bacteria | 3314 |
| 67 | Ga0065704_10099251 | 3300005289 | Bacteria | 2319 |
| 68 | Ga0065704_10103485 | 3300005289 | Bacteria | 2170 |
| 69 | Ga0065712_10013359 | 3300005290 | Bacteria | 2944 |
| 70 | Ga0070658_10047548 | 3300005327 | Bacteria | 3472 |
| 71 | Ga0070676_10007335 | 3300005328 | Bacteria | 5916 |
| 72 | Ga0070683_100071398 | 3300005329 | Bacteria | 3240 |
| 73 | Ga0070670_100000303 | 3300005331 | Bacteria | 42489 |
| 74 | Ga0068868_100020175 | 3300005338 | Bacteria | 5003 |
| 75 | Ga0068868_100030410 | 3300005338 | Bacteria | 4141 |
| 76 | Ga0070661_100000002 | 3300005344 | Bacteria | 265686 |
| 77 | Ga0070661_100002107 | 3300005344 | Bacteria | 13699 |
| 78 | Ga0070661_100014968 | 3300005344 | Bacteria | 5472 |
| 79 | Ga0070669_100023152 | 3300005353 | Bacteria | 4446 |
| 80 | Ga0070674_100000078 | 3300005356 | Bacteria | 44919 |
| 81 | Ga0070673_100008566 | 3300005364 | Bacteria | 6807 |
| 82 | Ga0070667_100000036 | 3300005367 | Bacteria | 172536 |
| 83 | Ga0070663_100000005 | 3300005455 | Bacteria | 251758 |
| 84 | Ga0070663_100001970 | 3300005455 | Bacteria | 11459 |
| 85 | Ga0070678_100000005 | 3300005456 | Bacteria | 70019 |
| 86 | Ga0068867_100000059 | 3300005459 | Bacteria | 68279 |
| 87 | Ga0068867_100003198 | 3300005459 | Bacteria | 11546 |
| 88 | Ga0068867_100066953 | 3300005459 | Bacteria | 2676 |
| 89 | Ga0070706_100017358 | 3300005467 | Bacteria | 6640 |
| 90 | Ga0068853_100054173 | 3300005539 | Bacteria | 3456 |
| 91 | Ga0070672_100089138 | 3300005543 | Bacteria | 2485 |
| 92 | Ga0070664_100000001 | 3300005564 | Bacteria | 551832 |
| 93 | Ga0070664_100002981 | 3300005564 | Bacteria | 13699 |
| 94 | Ga0068857_100027609 | 3300005577 | Bacteria | 5007 |
| 95 | Ga0068854_100000030 | 3300005578 | Bacteria | 111321 |
| 96 | Ga0068854_100000932 | 3300005578 | Bacteria | 17578 |
| 97 | Ga0068854_100009039 | 3300005578 | Bacteria | 6420 |
| 98 | Ga0068856_100000008 | 3300005614 | Bacteria | 190886 |
| 99 | Ga0068856_100002287 | 3300005614 | Bacteria | 19767 |
| 100 | Ga0068859_100001847 | 3300005617 | Bacteria | 21526 |
| 101 | Ga0068863_100004775 | 3300005841 | Bacteria | 13353 |
| 102 | Ga0068863_100025167 | 3300005841 | Bacteria | 5675 |
| 103 | Ga0068860_100000063 | 3300005843 | Bacteria | 189519 |
| 104 | Ga0075365_10022563 | 3300006038 | Bacteria | 3946 |
| 105 | Ga0075432_10001039 | 3300006058 | Bacteria | 8837 |
| 106 | Ga0070712_100007112 | 3300006175 | Bacteria | 6984 |
| 107 | Ga0075362_10006557 | 3300006177 | Bacteria | 4347 |
| 108 | Ga0075362_10016832 | 3300006177 | Bacteria | 3001 |
| 109 | Ga0075369_10001143 | 3300006186 | Bacteria | 8949 |
| 110 | Ga0075366_10000092 | 3300006195 | Bacteria | 36018 |
| 111 | Ga0075366_10000924 | 3300006195 | Bacteria | 14249 |
| 112 | Ga0075366_10001343 | 3300006195 | Bacteria | 12291 |
| 113 | Ga0075366_10028656 | 3300006195 | Bacteria | 3269 |
| 114 | Ga0075370_10000335 | 3300006353 | Bacteria | 16965 |
| 115 | Ga0075430_100008435 | 3300006846 | Bacteria | 8707 |
| 116 | Ga0075429_100000203 | 3300006880 | Bacteria | 39542 |
| 117 | Ga0075436_100050914 | 3300006914 | Bacteria | 2858 |
| 118 | Ga0097620_100001847 | 3300006931 | Bacteria | 21526 |
| 119 | Ga0099823_1000001 | 3300006944 | Bacteria | 216833 |
| 120 | Ga0079104_1000303 | 3300006946 | Bacteria | 62394 |
| 121 | Ga0079104_1000554 | 3300006946 | Bacteria | 38699 |
| 122 | Ga0099826_10026578 | 3300006948 | Bacteria | 4267 |
| 123 | Ga0105251_10012550 | 3300009011 | Bacteria | 4789 |
| 124 | Ga0105244_10000016 | 3300009036 | Bacteria | 255363 |
| 125 | Ga0105244_10001524 | 3300009036 | Bacteria | 18507 |
| 126 | Ga0105244_10004851 | 3300009036 | Bacteria | 9120 |
| 127 | Ga0105244_10008586 | 3300009036 | Bacteria | 6370 |
| 128 | Ga0105244_10016545 | 3300009036 | Bacteria | 4199 |
| 129 | Ga0105250_10000353 | 3300009092 | Bacteria | 35144 |
| 130 | Ga0105240_10000220 | 3300009093 | Bacteria | 115299 |
| 131 | Ga0105240_10252249 | 3300009093 | Bacteria | 2040 |
| 132 | Ga0114129_10240297 | 3300009147 | Bacteria | 2435 |
| 133 | Ga0105243_10000030 | 3300009148 | Bacteria | 190342 |
| 134 | Ga0105243_10055083 | 3300009148 | Bacteria | 3159 |
| 135 | Ga0105241_10005180 | 3300009174 | Bacteria | 9619 |
| 136 | Ga0105242_10022928 | 3300009176 | Bacteria | 4917 |
| 137 | Ga0105248_10001130 | 3300009177 | Bacteria | 29698 |
| 138 | Ga0105237_10000099 | 3300009545 | Bacteria | 120098 |
| 139 | Ga0105237_10003006 | 3300009545 | Bacteria | 20353 |
| 140 | Ga0105237_10006234 | 3300009545 | Bacteria | 13284 |
| 141 | Ga0105237_10024834 | 3300009545 | Bacteria | 6132 |
| 142 | Ga0105237_10069063 | 3300009545 | Bacteria | 3528 |
| 143 | Ga0105239_10000111 | 3300010375 | Bacteria | 115283 |
| 144 | Ga0105239_10019943 | 3300010375 | Bacteria | 7399 |
| 145 | Ga0105239_10033874 | 3300010375 | Bacteria | 5607 |
| 146 | Ga0105246_10040883 | 3300011119 | Bacteria | 3132 |
| 147 | Ga0157373_10001148 | 3300013100 | Bacteria | 20279 |
| 148 | Ga0157373_10008114 | 3300013100 | Bacteria | 7806 |
| 149 | Ga0157373_10010732 | 3300013100 | Bacteria | 6739 |
| 150 | Ga0157373_10064853 | 3300013100 | Bacteria | 2585 |
| 151 | Ga0157371_10000035 | 3300013102 | Bacteria | 223396 |
| 152 | Ga0157371_10000183 | 3300013102 | Bacteria | 92426 |
| 153 | Ga0157371_10001502 | 3300013102 | Bacteria | 24121 |
| 154 | Ga0157371_10001866 | 3300013102 | Bacteria | 21095 |
| 155 | Ga0157370_10000021 | 3300013104 | Bacteria | 166168 |
| 156 | Ga0157370_10001953 | 3300013104 | Bacteria | 25403 |
| 157 | Ga0157370_10009438 | 3300013104 | Bacteria | 10423 |
| 158 | Ga0157369_10012461 | 3300013105 | Bacteria | 9646 |
| 159 | Ga0157369_10037886 | 3300013105 | Bacteria | 5276 |
| 160 | Ga0157372_10000225 | 3300013307 | Bacteria | 62752 |
| 161 | Ga0157372_10001218 | 3300013307 | Bacteria | 27843 |
| 162 | Ga0157375_10095431 | 3300013308 | Bacteria | 3045 |
| 163 | Ga0182008_10001536 | 3300014497 | Bacteria | 15362 |
| 164 | Ga0182008_10007960 | 3300014497 | Bacteria | 5813 |
| 165 | Ga0182008_10009829 | 3300014497 | Bacteria | 5143 |
| 166 | Ga0182008_10018151 | 3300014497 | Bacteria | 3644 |
| 167 | Ga0157377_10000029 | 3300014745 | Bacteria | 134270 |
| 168 | Ga0182006_1001034 | 3300015261 | Bacteria | 18093 |
| 169 | Ga0182006_1001143 | 3300015261 | Bacteria | 16891 |
| 170 | Ga0182006_1001202 | 3300015261 | Bacteria | 16166 |
| 171 | Ga0182006_1001942 | 3300015261 | Bacteria | 11744 |
| 172 | Ga0182007_10000071 | 3300015262 | Bacteria | 81966 |
| 173 | Ga0182007_10000877 | 3300015262 | Bacteria | 16671 |
| 174 | Ga0182007_10001255 | 3300015262 | Bacteria | 13789 |
| 175 | Ga0182005_1000524 | 3300015265 | Bacteria | 19519 |
| 176 | Ga0182005_1000619 | 3300015265 | Bacteria | 17139 |
| 177 | Ga0183362_10002 | 3300015683 | Bacteria | 1432711 |
| 178 | Ga0183363_1005 | 3300015690 | Bacteria | 403020 |
| 179 | Ga0163161_10004705 | 3300017792 | Bacteria | 9493 |
| 180 | Ga0163161_10004884 | 3300017792 | Bacteria | 9339 |
| 181 | Ga0163161_10024693 | 3300017792 | Bacteria | 4249 |
| 182 | Ga0154015_1469424 | 3300020610 | Bacteria | 24934 |
| 183 | Ga0214544_1001054 | 3300021320 | Bacteria | 55518 |
| 184 | Ga0214542_1000019 | 3300021321 | Bacteria | 199445 |
| 185 | Ga0214543_1000010 | 3300021327 | Bacteria | 364844 |
| 186 | Ga0228711_1001487 | 3300022739 | Bacteria | 34563 |
| 187 | Ga0228710_1001373 | 3300022740 | Bacteria | 36316 |
| 188 | Ga0209760_100033 | 3300025207 | Bacteria | 136583 |
| 189 | Ga0209760_100035 | 3300025207 | Bacteria | 132204 |
| 190 | Ga0209784_100014 | 3300025224 | Bacteria | 496182 |
| 191 | Ga0209784_100246 | 3300025224 | Bacteria | 34625 |
| 192 | Ga0209566_100011 | 3300025225 | Bacteria | 496182 |
| 193 | Ga0209566_100403 | 3300025225 | Bacteria | 34323 |
| 194 | Ga0209566_101345 | 3300025225 | Bacteria | 7787 |
| 195 | Ga0209674_100032 | 3300025226 | Bacteria | 426888 |
| 196 | Ga0209674_100073 | 3300025226 | Bacteria | 223689 |
| 197 | Ga0209674_100131 | 3300025226 | Bacteria | 118079 |
| 198 | Ga0209672_100137 | 3300025228 | Bacteria | 71589 |
| 199 | Ga0209147_100002 | 3300025229 | Bacteria | 2158988 |
| 200 | Ga0209563_100029 | 3300025230 | Bacteria | 496182 |
| 201 | Ga0209563_100030 | 3300025230 | Bacteria | 489259 |
| 202 | Ga0209563_100061 | 3300025230 | Bacteria | 274295 |
| 203 | Ga0207427_100003 | 3300025231 | Bacteria | 1035004 |
| 204 | Ga0207427_100018 | 3300025231 | Bacteria | 530735 |
| 205 | Ga0207427_100551 | 3300025231 | Bacteria | 19055 |
| 206 | Ga0209437_100002 | 3300025233 | Bacteria | 1574801 |
| 207 | Ga0209437_100031 | 3300025233 | Bacteria | 530871 |
| 208 | Ga0209258_100002 | 3300025242 | Bacteria | 2158988 |
| 209 | Ga0209258_100071 | 3300025242 | Bacteria | 278319 |
| 210 | Ga0209258_101275 | 3300025242 | Bacteria | 9474 |
| 211 | Ga0209646_1000058 | 3300025246 | Bacteria | 259999 |
| 212 | Ga0209646_1000249 | 3300025246 | Bacteria | 54511 |
| 213 | Ga0209026_1000011 | 3300025250 | Bacteria | 507291 |
| 214 | Ga0209026_1002043 | 3300025250 | Bacteria | 7978 |
| 215 | Ga0209677_100042 | 3300025253 | Bacteria | 225037 |
| 216 | Ga0209677_100070 | 3300025253 | Bacteria | 143311 |
| 217 | Ga0209677_100160 | 3300025253 | Bacteria | 60301 |
| 218 | Ga0209148_1000011 | 3300025254 | Bacteria | 1196503 |
| 219 | Ga0209148_1000043 | 3300025254 | Bacteria | 461531 |
| 220 | Ga0209759_1000034 | 3300025256 | Bacteria | 271209 |
| 221 | Ga0209759_1000878 | 3300025256 | Bacteria | 22980 |
| 222 | Ga0209759_1002422 | 3300025256 | Bacteria | 8203 |
| 223 | Ga0209759_1007957 | 3300025256 | Bacteria | 3352 |
| 224 | Ga0209129_1000722 | 3300025258 | Bacteria | 21252 |
| 225 | Ga0209233_1000004 | 3300025261 | Bacteria | 1574798 |
| 226 | Ga0209233_1000012 | 3300025261 | Bacteria | 1019519 |
| 227 | Ga0209565_1000085 | 3300025263 | Bacteria | 153075 |
| 228 | Ga0209565_1011740 | 3300025263 | Bacteria | 2118 |
| 229 | Ga0209455_1000006 | 3300025272 | Bacteria | 1196503 |
| 230 | Ga0209455_1000009 | 3300025272 | Bacteria | 1042273 |
| 231 | Ga0209455_1000030 | 3300025272 | Bacteria | 533479 |
| 232 | Ga0209673_1001052 | 3300025273 | Bacteria | 31821 |
| 233 | Ga0209675_1000083 | 3300025291 | Bacteria | 153075 |
| 234 | Ga0209676_1000617 | 3300025292 | Bacteria | 51959 |
| 235 | Ga0209676_1004064 | 3300025292 | Bacteria | 8411 |
| 236 | Ga0209025_1003640 | 3300025294 | Bacteria | 14310 |
| 237 | Ga0209758_1000007 | 3300025297 | Bacteria | 1270410 |
| 238 | Ga0209758_1002100 | 3300025297 | Bacteria | 21160 |
| 239 | Ga0209758_1002961 | 3300025297 | Bacteria | 16289 |
| 240 | Ga0209050_1000013 | 3300025298 | Bacteria | 811408 |
| 241 | Ga0209050_1000914 | 3300025298 | Bacteria | 38994 |
| 242 | Ga0209256_1001697 | 3300025299 | Bacteria | 21250 |
| 243 | Ga0209051_1000007 | 3300025303 | Bacteria | 811408 |
| 244 | Ga0209051_1002295 | 3300025303 | Bacteria | 13956 |
| 245 | Ga0209051_1002532 | 3300025303 | Bacteria | 12929 |
| 246 | Ga0209257_1011899 | 3300025304 | Bacteria | 4108 |
| 247 | Ga0207656_10009882 | 3300025321 | Bacteria | 3553 |
| 248 | Ga0207696_1000016 | 3300025711 | Bacteria | 502467 |
| 249 | Ga0207696_1000108 | 3300025711 | Bacteria | 157445 |
| 250 | Ga0207696_1012629 | 3300025711 | Bacteria | 2979 |
| 251 | Ga0207655_1000027 | 3300025728 | Bacteria | 444552 |
| 252 | Ga0207655_1000114 | 3300025728 | Bacteria | 164098 |
| 253 | Ga0207655_1000384 | 3300025728 | Bacteria | 61818 |
| 254 | Ga0207655_1002020 | 3300025728 | Bacteria | 17156 |
| 255 | Ga0207655_1003059 | 3300025728 | Bacteria | 12750 |
| 256 | Ga0207655_1022254 | 3300025728 | Bacteria | 3186 |
| 257 | Ga0207655_1028880 | 3300025728 | Bacteria | 2607 |
| 258 | Ga0207713_1000185 | 3300025735 | Bacteria | 88697 |
| 259 | Ga0207713_1001969 | 3300025735 | Bacteria | 15463 |
| 260 | Ga0207713_1002029 | 3300025735 | Bacteria | 15167 |
| 261 | Ga0207713_1015292 | 3300025735 | Bacteria | 3946 |
| 262 | Ga0207713_1022044 | 3300025735 | Bacteria | 3035 |
| 263 | Ga0207713_1034813 | 3300025735 | Bacteria | 2183 |
| 264 | Ga0207645_10008891 | 3300025907 | Bacteria | 6976 |
| 265 | Ga0207705_10000752 | 3300025909 | Bacteria | 26709 |
| 266 | Ga0207684_10018394 | 3300025910 | Bacteria | 5982 |
| 267 | Ga0207654_10001142 | 3300025911 | Bacteria | 14298 |
| 268 | Ga0207695_10000213 | 3300025913 | Bacteria | 155843 |
| 269 | Ga0207695_10001452 | 3300025913 | Bacteria | 39680 |
| 270 | Ga0207695_10004535 | 3300025913 | Bacteria | 18900 |
| 271 | Ga0207695_10009243 | 3300025913 | Bacteria | 12215 |
| 272 | Ga0207695_10014624 | 3300025913 | Bacteria | 9282 |
| 273 | Ga0207695_10046919 | 3300025913 | Bacteria | 4576 |
| 274 | Ga0207671_10000918 | 3300025914 | Bacteria | 37118 |
| 275 | Ga0207671_10001354 | 3300025914 | Bacteria | 28611 |
| 276 | Ga0207671_10013772 | 3300025914 | Bacteria | 6421 |
| 277 | Ga0207671_10034150 | 3300025914 | Bacteria | 3781 |
| 278 | Ga0207657_10027377 | 3300025919 | Bacteria | 5222 |
| 279 | Ga0207657_10040355 | 3300025919 | Bacteria | 4135 |
| 280 | Ga0207649_10000577 | 3300025920 | Bacteria | 25047 |
| 281 | Ga0207649_10002446 | 3300025920 | Bacteria | 10395 |
| 282 | Ga0207649_10002538 | 3300025920 | Bacteria | 10167 |
| 283 | Ga0207694_10030644 | 3300025924 | Bacteria | 4107 |
| 284 | Ga0207694_10039858 | 3300025924 | Bacteria | 3615 |
| 285 | Ga0207694_10052525 | 3300025924 | Bacteria | 3159 |
| 286 | Ga0207650_10000068 | 3300025925 | Bacteria | 139947 |
| 287 | Ga0207690_10001322 | 3300025932 | Bacteria | 15581 |
| 288 | Ga0207706_10030797 | 3300025933 | Bacteria | 4785 |
| 289 | Ga0207706_10044090 | 3300025933 | Bacteria | 3953 |
| 290 | Ga0207709_10000137 | 3300025935 | Bacteria | 106203 |
| 291 | Ga0207709_10000911 | 3300025935 | Bacteria | 22279 |
| 292 | Ga0207709_10033091 | 3300025935 | Bacteria | 3033 |
| 293 | Ga0207669_10000093 | 3300025937 | Bacteria | 45459 |
| 294 | Ga0207691_10072392 | 3300025940 | Bacteria | 3109 |
| 295 | Ga0207691_10075591 | 3300025940 | Bacteria | 3037 |
| 296 | Ga0207711_10001219 | 3300025941 | Bacteria | 24358 |
| 297 | Ga0207689_10074851 | 3300025942 | Bacteria | 2782 |
| 298 | Ga0207679_10000003 | 3300025945 | Bacteria | 597553 |
| 299 | Ga0207679_10001702 | 3300025945 | Bacteria | 13713 |
| 300 | Ga0207667_10000107 | 3300025949 | Bacteria | 133066 |
| 301 | Ga0207667_10032962 | 3300025949 | Bacteria | 5575 |
| 302 | Ga0207640_10000070 | 3300025981 | Bacteria | 80803 |
| 303 | Ga0207640_10001944 | 3300025981 | Bacteria | 11122 |
| 304 | Ga0207640_10002305 | 3300025981 | Bacteria | 10255 |
| 305 | Ga0207658_10000482 | 3300025986 | Bacteria | 36904 |
| 306 | Ga0207677_10009710 | 3300026023 | Bacteria | 5420 |
| 307 | Ga0207639_10000561 | 3300026041 | Bacteria | 25544 |
| 308 | Ga0207639_10000895 | 3300026041 | Bacteria | 20198 |
| 309 | Ga0207678_10000002 | 3300026067 | Bacteria | 371723 |
| 310 | Ga0207678_10000943 | 3300026067 | Bacteria | 26547 |
| 311 | Ga0207678_10001250 | 3300026067 | Bacteria | 23447 |
| 312 | Ga0207702_10000031 | 3300026078 | Bacteria | 175405 |
| 313 | Ga0207702_10005445 | 3300026078 | Bacteria | 11137 |
| 314 | Ga0207702_10005713 | 3300026078 | Bacteria | 10845 |
| 315 | Ga0207702_10013157 | 3300026078 | Bacteria | 6880 |
| 316 | Ga0207641_10086712 | 3300026088 | Bacteria | 2730 |
| 317 | Ga0207648_10000080 | 3300026089 | Bacteria | 92020 |
| 318 | Ga0207648_10072853 | 3300026089 | Bacteria | 2994 |
| 319 | Ga0207674_10005181 | 3300026116 | Bacteria | 15526 |
| 320 | Ga0207674_10021967 | 3300026116 | Bacteria | 6862 |
| 321 | Ga0207674_10056318 | 3300026116 | Bacteria | 3994 |
| 322 | Ga0207683_10000115 | 3300026121 | Bacteria | 65630 |
| 323 | Ga0207683_10034445 | 3300026121 | Bacteria | 4401 |
| 324 | Ga0207698_10016691 | 3300026142 | Bacteria | 4959 |
| 325 | Ga0209281_1000009 | 3300027111 | Bacteria | 771717 |
| 326 | Ga0209281_1000063 | 3300027111 | Bacteria | 288465 |
| 327 | Ga0209389_1000007 | 3300027296 | Bacteria | 227459 |
| 328 | Ga0209996_1002261 | 3300027395 | Bacteria | 2378 |
| 329 | Ga0209995_1000908 | 3300027471 | Bacteria | 4596 |
| 330 | Ga0209968_1000129 | 3300027526 | Bacteria | 13402 |
| 331 | Ga0209983_1001879 | 3300027665 | Bacteria | 4667 |
| 332 | Ga0209971_1001017 | 3300027682 | Bacteria | 7172 |
| 333 | Ga0209966_1000035 | 3300027695 | Bacteria | 56067 |
| 334 | Ga0209974_10007897 | 3300027876 | Bacteria | 3651 |
| 335 | Ga0268266_10140585 | 3300028379 | Bacteria | 2166 |
| 336 | Ga0268264_10000083 | 3300028381 | Bacteria | 245366 |
| 337 | Ga0265336_10000042 | 3300028666 | Bacteria | 136760 |
| 338 | Ga0307517_10000005 | 3300028786 | Bacteria | 260207 |
| 339 | Ga0307515_10009815 | 3300028794 | Bacteria | 18443 |
| 340 | Ga0307515_10068680 | 3300028794 | Bacteria | 4862 |
| 341 | Ga0265324_10000213 | 3300029957 | Bacteria | 44530 |
| 342 | Ga0265330_10000267 | 3300031235 | Bacteria | 38266 |
| 343 | Ga0265332_10000031 | 3300031238 | Bacteria | 162330 |
| 344 | Ga0265320_10001568 | 3300031240 | Bacteria | 16431 |
| 345 | Ga0307513_10008449 | 3300031456 | Bacteria | 13174 |
| 346 | Ga0307509_10000072 | 3300031507 | Bacteria | 140566 |
| 347 | Ga0307509_10003311 | 3300031507 | Bacteria | 24713 |
| 348 | Ga0307408_100000006 | 3300031548 | Bacteria | 472824 |
| 349 | Ga0307408_100000018 | 3300031548 | Bacteria | 346872 |
| 350 | Ga0307408_100000644 | 3300031548 | Bacteria | 29299 |
| 351 | Ga0307408_100000898 | 3300031548 | Bacteria | 23396 |
| 352 | Ga0307408_100002935 | 3300031548 | Bacteria | 11812 |
| 353 | Ga0307508_10089304 | 3300031616 | Bacteria | 2666 |
| 354 | Ga0307514_10000339 | 3300031649 | Bacteria | 111130 |
| 355 | Ga0265314_10000095 | 3300031711 | Bacteria | 134372 |
| 356 | Ga0265314_10064117 | 3300031711 | Bacteria | 2489 |
| 357 | Ga0307516_10000067 | 3300031730 | Bacteria | 111575 |
| 358 | Ga0307516_10000669 | 3300031730 | Bacteria | 46347 |
| 359 | Ga0307405_10000137 | 3300031731 | Bacteria | 28468 |
| 360 | Ga0307405_10000180 | 3300031731 | Bacteria | 23310 |
| 361 | Ga0307410_10090387 | 3300031852 | Bacteria | 2171 |
| 362 | Ga0307406_10005409 | 3300031901 | Bacteria | 6987 |
| 363 | Ga0307416_100153277 | 3300032002 | Bacteria | 2117 |
| 364 | Ga0307414_10002079 | 3300032004 | Bacteria | 10406 |
| 365 | Ga0307414_10002924 | 3300032004 | Bacteria | 9032 |
| 366 | Ga0307411_10001033 | 3300032005 | Bacteria | 10749 |
| 367 | Ga0307510_10023302 | 3300033180 | Bacteria | 7178 |
| 368 | Ga0373931_0026309 | 3300035691 | Bacteria | 2960 |
| 369 | Ga0373931_0052573 | 3300035691 | Bacteria | 2172 |
| 370 | Ga0395899_0001213 | 3300037312 | Bacteria | 22591 |
| 371 | Ga0395899_0062480 | 3300037312 | Bacteria | 2743 |
| 372 | Ga0395900_0006153 | 3300037418 | Bacteria | 12529 |
| 373 | Ga0395900_0022224 | 3300037418 | Bacteria | 6489 |
| 374 | Ga0395900_0032950 | 3300037418 | Bacteria | 5331 |
| 375 | Ga0395905_0000720 | 3300037471 | Bacteria | 43690 |
| 376 | Ga0395905_0001365 | 3300037471 | Bacteria | 29683 |
| 377 | Ga0395905_0004587 | 3300037471 | Bacteria | 14293 |
| 378 | Ga0395905_0007075 | 3300037471 | Bacteria | 11217 |
| 379 | Ga0395905_0008321 | 3300037471 | Bacteria | 10233 |
| 380 | Ga0395905_0101454 | 3300037471 | Bacteria | 2701 |
| 381 | Ga0395905_0158094 | 3300037471 | Bacteria | 2131 |
| 382 | Ga0395905_0183120 | 3300037471 | Bacteria | 1967 |
| 383 | Ga0400483_029521 | 3300039062 | Bacteria | 8340 |
| 384 | Ga0400483_084836 | 3300039062 | Bacteria | 4427 |
| 385 | Ga0436361_0118095 | 3300039447 | Bacteria | 3442 |
| 386 | Ga0436361_0291965 | 3300039447 | Bacteria | 3283 |
| 387 | Ga0436361_0650737 | 3300039447 | Bacteria | 41996 |
| 388 | Ga0439436_0004667 | 3300041404 | Bacteria | 4202 |
| 389 | Ga0439466_0002538 | 3300041411 | Bacteria | 7147 |
| 390 | Ga0439432_000171 | 3300042006 | Bacteria | 22714 |
| 391 | Ga0439451_004360 | 3300042009 | Bacteria | 2874 |
| 392 | Ga0439463_004592 | 3300042016 | Bacteria | 3458 |
| 393 | Ga0439463_010682 | 3300042016 | Bacteria | 2257 |
| 394 | Ga0450911_002259 | 3300042115 | Bacteria | 3866 |
| 395 | Ga0450888_000479 | 3300042126 | Bacteria | 3781 |
| 396 | Ga0450890_001666 | 3300042127 | Bacteria | 3172 |
| 397 | Ga0450892_000109 | 3300042130 | Bacteria | 9264 |
| 398 | Ga0450906_001662 | 3300042145 | Bacteria | 4885 |
| 399 | Ga0450907_000140 | 3300042146 | Bacteria | 27596 |
| 400 | Ga0439464_0000443 | 3300042439 | Bacteria | 8221 |
| 401 | Ga0439460_0007780 | 3300042461 | Bacteria | 2690 |
| 402 | Ga0450893_0001586 | 3300042532 | Bacteria | 3487 |
| 403 | Ga0466972_0001141 | 3300044658 | Bacteria | 12724 |
| 404 | Ga0466972_0025957 | 3300044658 | Bacteria | 2902 |
| 405 | Ga0466965_0000988 | 3300044683 | Bacteria | 10999 |
| 406 | Ga0466961_0000248 | 3300044693 | Bacteria | 36217 |
| 407 | Ga0466961_0002100 | 3300044693 | Bacteria | 12401 |
| 408 | Ga0466964_0005504 | 3300044706 | Bacteria | 4702 |
| 409 | Ga0453684_0004221 | 3300044712 | Bacteria | 30842 |
| 410 | Ga0453684_0065737 | 3300044712 | Bacteria | 4623 |
| 411 | Ga0466970_0000407 | 3300044765 | Bacteria | 20971 |
| 412 | Ga0466959_0002049 | 3300045049 | Bacteria | 12742 |
| 413 | Ga0466959_0011535 | 3300045049 | Bacteria | 6352 |
| 414 | Ga0451576_0002747 | 3300045051 | Bacteria | 25528 |
| 415 | Ga0495627_000183 | 3300046453 | Bacteria | 69743 |
| 416 | Ga0495592_0000159 | 3300046454 | Bacteria | 59481 |
| 417 | Ga0495590_0002605 | 3300046457 | Bacteria | 7455 |
| 418 | Ga0495591_000174 | 3300046458 | Bacteria | 66422 |
| 419 | Ga0495591_000697 | 3300046458 | Bacteria | 24507 |
| 420 | Ga0495591_010060 | 3300046458 | Bacteria | 3702 |
| 421 | Ga0495638_0003448 | 3300046460 | Bacteria | 12455 |
| 422 | Ga0495638_0011837 | 3300046460 | Bacteria | 6001 |
| 423 | Ga0495653_0041055 | 3300046463 | Bacteria | 3613 |
| 424 | Ga0495650_0001051 | 3300046471 | Bacteria | 30683 |
| 425 | Ga0495650_0001555 | 3300046471 | Bacteria | 21655 |
| 426 | Ga0495650_0002026 | 3300046471 | Bacteria | 17727 |
| 427 | Ga0495605_0000076 | 3300046474 | Bacteria | 128699 |
| 428 | Ga0495605_0001638 | 3300046474 | Bacteria | 14431 |
| 429 | Ga0495605_0002121 | 3300046474 | Bacteria | 12413 |
| 430 | Ga0495605_0023402 | 3300046474 | Bacteria | 3249 |
| 431 | Ga0495584_0002919 | 3300046491 | Bacteria | 9540 |
| 432 | Ga0495584_0003118 | 3300046491 | Bacteria | 9206 |
| 433 | Ga0495585_0000545 | 3300046492 | Bacteria | 35585 |
| 434 | Ga0495585_0008542 | 3300046492 | Bacteria | 6201 |
| 435 | Ga0495585_0026285 | 3300046492 | Bacteria | 3324 |
| 436 | Ga0495596_0006327 | 3300046500 | Bacteria | 5466 |
| 437 | Ga0495607_0000799 | 3300046501 | Bacteria | 29847 |
| 438 | Ga0495607_0002369 | 3300046501 | Bacteria | 15384 |
| 439 | Ga0495607_0002716 | 3300046501 | Bacteria | 14116 |
| 440 | Ga0495583_0000129 | 3300046506 | Bacteria | 126766 |
| 441 | Ga0495583_0000172 | 3300046506 | Bacteria | 109791 |
| 442 | Ga0495583_0000497 | 3300046506 | Bacteria | 57112 |
| 443 | Ga0495583_0001454 | 3300046506 | Bacteria | 23965 |
| 444 | Ga0495583_0003405 | 3300046506 | Bacteria | 12156 |
| 445 | Ga0495583_0005099 | 3300046506 | Bacteria | 9057 |
| 446 | Ga0495583_0006345 | 3300046506 | Bacteria | 7752 |
| 447 | Ga0495583_0030157 | 3300046506 | Bacteria | 2645 |
| 448 | Ga0495606_0000028 | 3300046507 | Bacteria | 251032 |
| 449 | Ga0495606_0000684 | 3300046507 | Bacteria | 52863 |
| 450 | Ga0495606_0001984 | 3300046507 | Bacteria | 25232 |
| 451 | Ga0495606_0002075 | 3300046507 | Bacteria | 24486 |
| 452 | Ga0495606_0003306 | 3300046507 | Bacteria | 17217 |
| 453 | Ga0495606_0012296 | 3300046507 | Bacteria | 6884 |
| 454 | Ga0495606_0059884 | 3300046507 | Bacteria | 2441 |
| 455 | Ga0495610_0000031 | 3300046512 | Bacteria | 254606 |
| 456 | Ga0495610_0000136 | 3300046512 | Bacteria | 82060 |
| 457 | Ga0495610_0004091 | 3300046512 | Bacteria | 10927 |
| 458 | Ga0495620_0000314 | 3300046515 | Bacteria | 34524 |
| 459 | Ga0495620_0004729 | 3300046515 | Bacteria | 7653 |
| 460 | Ga0495631_0000275 | 3300046518 | Bacteria | 35971 |
| 461 | Ga0495632_0000942 | 3300046519 | Bacteria | 25452 |
| 462 | Ga0495632_0001284 | 3300046519 | Bacteria | 21252 |
| 463 | Ga0495637_0000027 | 3300046520 | Bacteria | 146241 |
| 464 | Ga0495637_0001476 | 3300046520 | Bacteria | 13811 |
| 465 | Ga0495637_0004465 | 3300046520 | Bacteria | 7244 |
| 466 | Ga0495637_0014441 | 3300046520 | Bacteria | 3727 |
| 467 | Ga0495643_0000107 | 3300046522 | Bacteria | 138292 |
| 468 | Ga0495643_0001730 | 3300046522 | Bacteria | 18877 |
| 469 | Ga0495643_0005423 | 3300046522 | Bacteria | 8632 |
| 470 | Ga0495644_0000127 | 3300046523 | Bacteria | 36626 |
| 471 | Ga0495644_0007674 | 3300046523 | Bacteria | 4160 |
| 472 | Ga0495644_0030543 | 3300046523 | Bacteria | 2034 |
| 473 | Ga0495648_0027650 | 3300046524 | Bacteria | 3792 |
| 474 | Ga0495642_0000067 | 3300046528 | Bacteria | 61823 |
| 475 | Ga0495642_0000334 | 3300046528 | Bacteria | 25618 |
| 476 | Ga0495642_0003572 | 3300046528 | Bacteria | 6123 |
| 477 | Ga0495642_0007961 | 3300046528 | Bacteria | 4055 |
| 478 | Ga0495654_0003393 | 3300046530 | Bacteria | 9794 |
| 479 | Ga0495654_0004194 | 3300046530 | Bacteria | 8623 |
| 480 | Ga0495654_0005001 | 3300046530 | Bacteria | 7787 |
| 481 | Ga0495654_0044825 | 3300046530 | Bacteria | 2185 |
| 482 | Ga0495587_0039571 | 3300046536 | Bacteria | 2820 |
| 483 | Ga0495587_0040769 | 3300046536 | Bacteria | 2772 |
| 484 | Ga0495609_0000206 | 3300046538 | Bacteria | 58720 |
| 485 | Ga0495609_0000373 | 3300046538 | Bacteria | 38466 |
| 486 | Ga0495609_0004161 | 3300046538 | Bacteria | 8035 |
| 487 | Ga0495609_0006540 | 3300046538 | Bacteria | 5937 |
| 488 | Ga0495621_0017167 | 3300046539 | Bacteria | 2335 |
| 489 | Ga0495645_0085210 | 3300046543 | Bacteria | 2262 |
| 490 | Ga0495622_0000638 | 3300046557 | Bacteria | 20320 |
| 491 | Ga0495622_0004006 | 3300046557 | Bacteria | 6876 |
| 492 | Ga0495633_0003417 | 3300046558 | Bacteria | 10575 |
| 493 | Ga0495656_0007101 | 3300046615 | Bacteria | 3949 |
| 494 | Ga0495656_0021443 | 3300046615 | Bacteria | 2515 |
| 495 | Ga0495668_0003932 | 3300046616 | Bacteria | 10849 |
| 496 | Ga0495611_0003215 | 3300046648 | Bacteria | 7231 |
| 497 | Ga0495611_0004712 | 3300046648 | Bacteria | 5858 |
| 498 | Ga0495625_0000296 | 3300046660 | Bacteria | 77050 |
| 499 | Ga0495625_0000436 | 3300046660 | Bacteria | 62756 |
| 500 | Ga0495625_0005432 | 3300046660 | Bacteria | 11619 |
| 501 | Ga0495635_0043568 | 3300046663 | Bacteria | 3096 |
| 502 | Ga0495659_0000766 | 3300046664 | Bacteria | 11527 |
| 503 | Ga0495661_0000119 | 3300046665 | Bacteria | 94133 |
| 504 | Ga0495661_0001902 | 3300046665 | Bacteria | 16649 |
| 505 | Ga0495661_0008680 | 3300046665 | Bacteria | 7022 |
| 506 | Ga0495661_0008899 | 3300046665 | Bacteria | 6914 |
| 507 | Ga0495661_0011128 | 3300046665 | Bacteria | 6109 |
| 508 | Ga0495646_0049093 | 3300046680 | Bacteria | 2561 |
| 509 | Ga0495669_0003573 | 3300046684 | Bacteria | 6412 |
| 510 | Ga0495670_0004075 | 3300046691 | Bacteria | 7167 |
| 511 | Ga0495670_0004671 | 3300046691 | Bacteria | 6718 |
| 512 | Ga0495671_0000663 | 3300046692 | Bacteria | 24982 |
| 513 | Ga0495671_0001916 | 3300046692 | Bacteria | 13352 |
| 514 | Ga0495671_0002682 | 3300046692 | Bacteria | 11153 |
| 515 | Ga0495671_0004284 | 3300046692 | Bacteria | 8574 |
| 516 | Ga0495649_0001926 | 3300046694 | Bacteria | 15132 |
| 517 | Ga0495649_0008024 | 3300046694 | Bacteria | 6377 |
| 518 | Ga0495589_0000220 | 3300046794 | Bacteria | 48490 |
| 519 | Ga0495600_0004150 | 3300046809 | Bacteria | 8628 |
| 520 | Ga0495660_0000688 | 3300046810 | Bacteria | 25918 |
| 521 | Ga0495660_0002659 | 3300046810 | Bacteria | 11320 |
| 522 | Ga0495636_0001853 | 3300047318 | Bacteria | 8095 |
| 523 | Ga0495672_0000553 | 3300047320 | Bacteria | 42512 |
| 524 | Ga0495672_0001299 | 3300047320 | Bacteria | 24902 |
| 525 | Ga0495672_0008074 | 3300047320 | Bacteria | 7819 |
| 526 | Ga0495676_0000003 | 3300047321 | Bacteria | 318463 |
| 527 | Ga0495683_0000382 | 3300047323 | Bacteria | 36179 |
| 528 | Ga0495683_0000852 | 3300047323 | Bacteria | 21615 |
| 529 | Ga0495677_0000341 | 3300047445 | Bacteria | 20129 |
| 530 | Ga0495677_0000810 | 3300047445 | Bacteria | 12626 |
| 531 | Ga0495677_0003801 | 3300047445 | Bacteria | 5840 |
| 532 | Ga0495679_001158 | 3300047446 | Bacteria | 15748 |
| 533 | Ga0495679_003272 | 3300047446 | Bacteria | 7848 |
| 534 | Ga0495673_0000602 | 3300047469 | Bacteria | 35831 |
| 535 | Ga0495673_0000782 | 3300047469 | Bacteria | 30047 |
| 536 | Ga0495673_0002393 | 3300047469 | Bacteria | 13258 |
| 537 | Ga0495673_0003440 | 3300047469 | Bacteria | 10422 |
| 538 | Ga0495673_0027861 | 3300047469 | Bacteria | 2682 |
| 539 | Ga0495681_0000115 | 3300047470 | Bacteria | 69813 |
| 540 | Ga0495681_0007269 | 3300047470 | Bacteria | 7114 |
| 541 | Ga0495681_0010033 | 3300047470 | Bacteria | 5766 |
| 542 | Ga0495686_0002113 | 3300047472 | Bacteria | 19478 |
| 543 | Ga0495686_0013786 | 3300047472 | Bacteria | 5600 |
| 544 | Ga0495593_0010684 | 3300047673 | Bacteria | 5293 |
| 545 | Ga0495615_0001676 | 3300048090 | Bacteria | 3358 |
| 546 | Ga0495626_0000086 | 3300048091 | Bacteria | 123059 |
| 547 | Ga0495626_0001191 | 3300048091 | Bacteria | 21581 |
| 548 | Ga0495626_0002350 | 3300048091 | Bacteria | 13316 |
| 549 | Ga0495626_0005927 | 3300048091 | Bacteria | 7037 |
| 550 | Ga0495626_0015958 | 3300048091 | Bacteria | 3829 |
| 551 | Ga0496101_0000818 | 3300048904 | Bacteria | 18336 |
| 552 | Ga0496102_0000067 | 3300048905 | Bacteria | 156790 |
| 553 | Ga0496102_0000073 | 3300048905 | Bacteria | 149887 |
| 554 | Ga0496102_0005919 | 3300048905 | Bacteria | 10413 |
| 555 | Ga0496103_0000242 | 3300048906 | Bacteria | 53258 |
| 556 | Ga0496104_0004671 | 3300048907 | Bacteria | 11920 |
| 557 | Ga0496104_0010698 | 3300048907 | Bacteria | 8204 |
| 558 | Ga0496105_0000452 | 3300048908 | Bacteria | 27069 |
| 559 | Ga0496110_0056337 | 3300048913 | Bacteria | 3459 |
| 560 | Ga0496110_0075255 | 3300048913 | Bacteria | 3000 |
| 561 | Ga0496111_0011343 | 3300048914 | Bacteria | 6000 |
| 562 | Ga0496113_0183084 | 3300048916 | Bacteria | 1661 |
| 563 | Ga0496115_0000056 | 3300048918 | Bacteria | 104434 |
| 564 | Ga0496116_0000995 | 3300048919 | Bacteria | 34718 |
| 565 | Ga0496116_0009849 | 3300048919 | Bacteria | 8090 |
| 566 | Ga0496116_0014858 | 3300048919 | Bacteria | 6187 |
| 567 | Ga0496117_0000090 | 3300048920 | Bacteria | 206388 |
| 568 | Ga0496117_0000114 | 3300048920 | Bacteria | 180658 |
| 569 | Ga0496117_0003807 | 3300048920 | Bacteria | 17188 |
| 570 | Ga0496117_0004650 | 3300048920 | Bacteria | 14934 |
| 571 | Ga0496118_0000032 | 3300048921 | Bacteria | 330072 |
| 572 | Ga0496118_0000082 | 3300048921 | Bacteria | 185820 |
| 573 | Ga0496118_0004224 | 3300048921 | Bacteria | 17244 |
| 574 | Ga0496119_0002172 | 3300048922 | Bacteria | 22016 |
| 575 | Ga0496119_0026396 | 3300048922 | Bacteria | 4028 |
| 576 | Ga0496119_0031893 | 3300048922 | Bacteria | 3521 |
| 577 | Ga0496120_0002014 | 3300048923 | Bacteria | 22111 |
| 578 | Ga0496121_0000079 | 3300048924 | Bacteria | 232653 |
| 579 | Ga0496121_0000344 | 3300048924 | Bacteria | 96865 |
| 580 | Ga0496121_0001663 | 3300048924 | Bacteria | 36677 |
| 581 | Ga0496121_0003604 | 3300048924 | Bacteria | 21861 |
| 582 | Ga0496121_0005421 | 3300048924 | Bacteria | 16376 |
| 583 | Ga0496121_0010128 | 3300048924 | Bacteria | 10682 |
| 584 | Ga0496121_0043779 | 3300048924 | Bacteria | 3871 |
| 585 | Ga0496122_0000244 | 3300048925 | Bacteria | 122107 |
| 586 | Ga0496122_0004942 | 3300048925 | Bacteria | 16167 |
| 587 | Ga0496122_0005970 | 3300048925 | Bacteria | 14253 |
| 588 | Ga0496122_0012273 | 3300048925 | Bacteria | 8561 |
| 589 | Ga0496122_0061191 | 3300048925 | Bacteria | 2765 |
| 590 | Ga0496123_0000201 | 3300048926 | Bacteria | 121915 |
| 591 | Ga0496123_0007071 | 3300048926 | Bacteria | 10670 |
| 592 | Ga0496123_0013135 | 3300048926 | Bacteria | 6983 |
| 593 | Ga0496123_0028961 | 3300048926 | Bacteria | 4088 |
| 594 | Ga0496124_0000068 | 3300048927 | Bacteria | 221819 |
| 595 | Ga0496124_0018543 | 3300048927 | Bacteria | 6514 |
| 596 | Ga0496124_0019143 | 3300048927 | Bacteria | 6387 |
| 597 | Ga0496125_0000219 | 3300048928 | Bacteria | 116721 |
| 598 | Ga0496125_0000862 | 3300048928 | Bacteria | 48602 |
| 599 | Ga0496125_0013075 | 3300048928 | Bacteria | 8185 |
| 600 | Ga0496125_0035776 | 3300048928 | Bacteria | 4348 |
| 601 | Ga0496125_0059744 | 3300048928 | Bacteria | 3068 |
| 602 | Ga0496126_0000157 | 3300048929 | Bacteria | 156203 |
| 603 | Ga0496126_0004738 | 3300048929 | Bacteria | 16040 |
| 604 | Ga0501308_000952 | 3300049128 | Bacteria | 2143 |
| 605 | Ga0501307_000075 | 3300049162 | Bacteria | 4218 |
| 606 | Ga0495678_001067 | 3300049459 | Bacteria | 23249 |
| 607 | Ga0495678_008505 | 3300049459 | Bacteria | 5169 |
| 608 | Ga0495678_018802 | 3300049459 | Bacteria | 3097 |
| 609 | Ga0495682_0000138 | 3300049460 | Bacteria | 63246 |
| 610 | Ga0495682_0000287 | 3300049460 | Bacteria | 39287 |
| 611 | Ga0495682_0009479 | 3300049460 | Bacteria | 3798 |
| 612 | Ga0501300_003656 | 3300049523 | Bacteria | 2290 |
| 613 | Ga0501321_001062 | 3300049537 | Bacteria | 2073 |
| 614 | Ga0501034_0000003 | 3300049571 | Bacteria | 471748 |
| 615 | Ga0501034_0000210 | 3300049571 | Bacteria | 110909 |
| 616 | Ga0501043_0010019 | 3300049579 | Bacteria | 7433 |
| 617 | Ga0501047_0002410 | 3300049581 | Bacteria | 17866 |
| 618 | Ga0501229_001322 | 3300049706 | Bacteria | 2885 |
| 619 | Ga0501226_000017 | 3300049853 | Bacteria | 150879 |
| 620 | nmdc:mga03683_7338_c1 | 3300050489 | Bacteria | 3823 |
| 621 | nmdc:mga0k408_11372_c1 | 3300050493 | Bacteria | 4846 |
| 622 | nmdc:mga0k408_18079_c1 | 3300050493 | Bacteria | 3931 |
| 623 | nmdc:mga0k408_3739_c1 | 3300050493 | Bacteria | 8072 |
| 624 | nmdc:mga07m45_4868_c1 | 3300050496 | Bacteria | 6610 |
| 625 | nmdc:mga07m45_9985_c1 | 3300050496 | Bacteria | 3454 |
| 626 | nmdc:mga09592_2271_c1 | 3300050508 | Bacteria | 15486 |
| 627 | Ga0495595_0061598 | 3300053084 | Bacteria | 1758 |
| 628 | Ga0500595_000211 | 3300053119 | Bacteria | 39658 |
| 629 | Ga0500655_000002 | 3300053133 | Bacteria | 116051 |
| 630 | Ga0500559_0013465 | 3300053136 | Bacteria | 3464 |
| 631 | Ga0500559_0020350 | 3300053136 | Bacteria | 2806 |
| 632 | Ga0500577_0012176 | 3300053142 | Bacteria | 2591 |
| 633 | Ga0500622_0004519 | 3300053156 | Bacteria | 8698 |
| 634 | Ga0500570_000153 | 3300053724 | Bacteria | 21288 |
| 635 | Ga0587098_000519 | 3300059604 | Bacteria | 2397 |
| 636 | Ga0587076_000201 | 3300059645 | Bacteria | 4157 |
| 637 | Ga0587111_0000403 | 3300060346 | Bacteria | 4012 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049523 | Ga0501300_003656 | Ga0501300_003656_172_1686 | 479 |
| 2 | 3300053084 | Ga0495595_0061598 | Ga0495595_0061598_84_1724 | 488 |
| 3 | 3300039447 | Ga0436361_0118095 | Ga0436361_0118095_74_1861 | 504 |
| 4 | 3300048916 | Ga0496113_0183084 | Ga0496113_0183084_34_1632 | 505 |
| 5 | 3300046512 | Ga0495610_0000031 | Ga0495610_0000031_66322_68112 | 513 |
| 6 | 3300005353 | Ga0070669_100023152 | Ga0070669_1000231521 | 516 |
| 7 | 3300005543 | Ga0070672_100089138 | Ga0070672_1000891381 | 516 |
| 8 | 3300025940 | Ga0207691_10075591 | Ga0207691_100755912 | 516 |
| 9 | 3300046528 | Ga0495642_0003572 | Ga0495642_0003572_1226_2977 | 516 |
| 10 | 3300046539 | Ga0495621_0017167 | Ga0495621_0017167_395_2191 | 516 |
| 11 | 3300046665 | Ga0495661_0011128 | Ga0495661_0011128_437_2188 | 516 |
| 12 | 3300037471 | Ga0395905_0004587 | Ga0395905_0004587_802_2541 | 517 |
| 13 | 3300039062 | Ga0400483_029521 | Ga0400483_029521_1453_3198 | 518 |
| 14 | 3300049162 | Ga0501307_000075 | Ga0501307_000075_904_2631 | 518 |
| 15 | 3300046507 | Ga0495606_0059884 | Ga0495606_0059884_344_2098 | 520 |
| 16 | 3300046528 | Ga0495642_0007961 | Ga0495642_0007961_679_2433 | 520 |
| 17 | 3300047445 | Ga0495677_0000810 | Ga0495677_0000810_5201_6955 | 520 |
| 18 | 3300049579 | Ga0501043_0010019 | Ga0501043_0010019_433_2172 | 520 |
| 19 | 3300049581 | Ga0501047_0002410 | Ga0501047_0002410_10293_12032 | 520 |
| 20 | 3300005467 | Ga0070706_100017358 | Ga0070706_1000173583 | 521 |
| 21 | 3300025910 | Ga0207684_10018394 | Ga0207684_100183943 | 521 |
| 22 | 3300044658 | Ga0466972_0001141 | Ga0466972_0001141_5966_7630 | 521 |
| 23 | 3300044706 | Ga0466964_0005504 | Ga0466964_0005504_325_1989 | 521 |
| 24 | 3300044765 | Ga0466970_0000407 | Ga0466970_0000407_5452_7116 | 521 |
| 25 | 3300045049 | Ga0466959_0002049 | Ga0466959_0002049_5569_7233 | 521 |
| 26 | 3300050496 | nmdc:mga07m45_9985_c1 | nmdc:mga07m45_9985_c1_410_2149 | 521 |
| 27 | 3300045049 | Ga0466959_0011535 | Ga0466959_0011535_2382_4154 | 522 |
| 28 | 3300048924 | Ga0496121_0000079 | Ga0496121_0000079_131784_133550 | 522 |
| 29 | 3300025256 | Ga0209759_1007957 | Ga0209759_10079572 | 523 |
| 30 | 3300037471 | Ga0395905_0007075 | Ga0395905_0007075_9347_11170 | 523 |
| 31 | 3300001915 | JGI24741J21665_1000182 | JGI24741J21665_100018211 | 524 |
| 32 | 3300001979 | JGI24740J21852_10000388 | JGI24740J21852_1000038810 | 524 |
| 33 | 3300005344 | Ga0070661_100014968 | Ga0070661_1000149683 | 524 |
| 34 | 3300005455 | Ga0070663_100001970 | Ga0070663_1000019709 | 524 |
| 35 | 3300005614 | Ga0068856_100002287 | Ga0068856_10000228710 | 524 |
| 36 | 3300009093 | Ga0105240_10252249 | Ga0105240_102522491 | 524 |
| 37 | 3300009545 | Ga0105237_10024834 | Ga0105237_100248344 | 524 |
| 38 | 3300025913 | Ga0207695_10014624 | Ga0207695_100146242 | 524 |
| 39 | 3300026041 | Ga0207639_10000895 | Ga0207639_1000089511 | 524 |
| 40 | 3300026067 | Ga0207678_10001250 | Ga0207678_1000125011 | 524 |
| 41 | 3300026078 | Ga0207702_10005445 | Ga0207702_100054459 | 524 |
| 42 | 3300026116 | Ga0207674_10056318 | Ga0207674_100563184 | 524 |
| 43 | 3300022739 | Ga0228711_1001487 | Ga0228711_100148717 | 525 |
| 44 | 3300022740 | Ga0228710_1001373 | Ga0228710_100137321 | 525 |
| 45 | 3300037471 | Ga0395905_0008321 | Ga0395905_0008321_119_1864 | 526 |
| 46 | 3300042126 | Ga0450888_000479 | Ga0450888_000479_1169_2917 | 526 |
| 47 | 3300042127 | Ga0450890_001666 | Ga0450890_001666_536_2284 | 526 |
| 48 | 3300042130 | Ga0450892_000109 | Ga0450892_000109_925_2673 | 526 |
| 49 | 3300042532 | Ga0450893_0001586 | Ga0450893_0001586_392_2140 | 526 |
| 50 | 3300046512 | Ga0495610_0000136 | Ga0495610_0000136_73687_75426 | 527 |
| 51 | 3300046519 | Ga0495632_0000942 | Ga0495632_0000942_17606_19396 | 527 |
| 52 | 3300046522 | Ga0495643_0000107 | Ga0495643_0000107_66503_68242 | 527 |
| 53 | 3300053136 | Ga0500559_0013465 | Ga0500559_0013465_425_2239 | 527 |
| 54 | 3300049706 | Ga0501229_001322 | Ga0501229_001322_924_2657 | 528 |
| 55 | 3300059645 | Ga0587076_000201 | Ga0587076_000201_110_1861 | 528 |
| 56 | 3300006177 | Ga0075362_10006557 | Ga0075362_100065573 | 529 |
| 57 | 3300039447 | Ga0436361_0650737 | Ga0436361_0650737_17795_19609 | 529 |
| 58 | 3300046694 | Ga0495649_0001926 | Ga0495649_0001926_7102_8856 | 529 |
| 59 | 3300046809 | Ga0495600_0004150 | Ga0495600_0004150_1364_3199 | 529 |
| 60 | 3300053119 | Ga0500595_000211 | Ga0500595_000211_31022_32857 | 529 |
| 61 | iso_pu_bacteria | 2900577576 | 2900578249 | 529 |
| 62 | 3300046453 | Ga0495627_000183 | Ga0495627_000183_46277_48055 | 530 |
| 63 | 3300046471 | Ga0495650_0001555 | Ga0495650_0001555_6977_8755 | 530 |
| 64 | 3300047470 | Ga0495681_0000115 | Ga0495681_0000115_21747_23525 | 530 |
| 65 | 3300048090 | Ga0495615_0001676 | Ga0495615_0001676_1356_3101 | 530 |
| 66 | 3300048926 | Ga0496123_0007071 | Ga0496123_0007071_5950_7695 | 530 |
| 67 | 3300003761 | Ga0055535_1005127 | Ga0055535_10051273 | 531 |
| 68 | 3300017792 | Ga0163161_10024693 | Ga0163161_100246934 | 531 |
| 69 | 3300025242 | Ga0209258_101275 | Ga0209258_1012753 | 531 |
| 70 | 3300028794 | Ga0307515_10068680 | Ga0307515_100686804 | 531 |
| 71 | 3300035691 | Ga0373931_0026309 | Ga0373931_0026309_1001_2842 | 531 |
| 72 | 3300044683 | Ga0466965_0000988 | Ga0466965_0000988_141_1955 | 531 |
| 73 | 3300046615 | Ga0495656_0021443 | Ga0495656_0021443_177_1946 | 531 |
| 74 | 3300048904 | Ga0496101_0000818 | Ga0496101_0000818_9218_11014 | 531 |
| 75 | 3300048907 | Ga0496104_0004671 | Ga0496104_0004671_5306_7102 | 531 |
| 76 | 3300048908 | Ga0496105_0000452 | Ga0496105_0000452_5112_6908 | 531 |
| 77 | 3300003792 | Ga0055540_1009310 | Ga0055540_10093103 | 532 |
| 78 | 3300025303 | Ga0209051_1002295 | Ga0209051_10022959 | 532 |
| 79 | 3300025942 | Ga0207689_10074851 | Ga0207689_100748513 | 532 |
| 80 | 3300037312 | Ga0395899_0001213 | Ga0395899_0001213_16491_18242 | 532 |
| 81 | 3300037418 | Ga0395900_0006153 | Ga0395900_0006153_9741_11492 | 532 |
| 82 | 3300037471 | Ga0395905_0158094 | Ga0395905_0158094_149_1900 | 532 |
| 83 | 3300013102 | Ga0157371_10000035 | Ga0157371_1000003583 | 533 |
| 84 | 3300013104 | Ga0157370_10000021 | Ga0157370_1000002132 | 533 |
| 85 | 3300013307 | Ga0157372_10000225 | Ga0157372_1000022536 | 533 |
| 86 | 3300015261 | Ga0182006_1001942 | Ga0182006_100194213 | 533 |
| 87 | 3300037312 | Ga0395899_0062480 | Ga0395899_0062480_56_1774 | 533 |
| 88 | 3300037418 | Ga0395900_0032950 | Ga0395900_0032950_2182_3900 | 533 |
| 89 | 3300046810 | Ga0495660_0000688 | Ga0495660_0000688_16912_18642 | 533 |
| 90 | 3300048928 | Ga0496125_0013075 | Ga0496125_0013075_4434_6152 | 533 |
| 91 | 3300002067 | JGI24735J21928_10002829 | JGI24735J21928_100028292 | 534 |
| 92 | 3300021320 | Ga0214544_1001054 | Ga0214544_100105434 | 534 |
| 93 | 3300021321 | Ga0214542_1000019 | Ga0214542_1000019143 | 534 |
| 94 | 3300021327 | Ga0214543_1000010 | Ga0214543_1000010299 | 534 |
| 95 | 3300046530 | Ga0495654_0003393 | Ga0495654_0003393_2213_3991 | 534 |
| 96 | 3300003751 | Ga0055538_1001384 | Ga0055538_10013843 | 535 |
| 97 | 3300009148 | Ga0105243_10000030 | Ga0105243_1000003019 | 535 |
| 98 | 3300009174 | Ga0105241_10005180 | Ga0105241_100051806 | 535 |
| 99 | 3300013102 | Ga0157371_10000183 | Ga0157371_1000018362 | 535 |
| 100 | 3300044693 | Ga0466961_0000248 | Ga0466961_0000248_5770_7509 | 535 |
| 101 | 3300005327 | Ga0070658_10047548 | Ga0070658_100475483 | 536 |
| 102 | 3300005367 | Ga0070667_100000036 | Ga0070667_10000003634 | 536 |
| 103 | 3300005841 | Ga0068863_100004775 | Ga0068863_1000047757 | 536 |
| 104 | 3300005843 | Ga0068860_100000063 | Ga0068860_100000063134 | 536 |
| 105 | 3300025986 | Ga0207658_10000482 | Ga0207658_1000048225 | 536 |
| 106 | 3300028381 | Ga0268264_10000083 | Ga0268264_10000083186 | 536 |
| 107 | 3300046519 | Ga0495632_0001284 | Ga0495632_0001284_7154_8866 | 536 |
| 108 | 3300047673 | Ga0495593_0010684 | Ga0495593_0010684_929_2737 | 536 |
| 109 | 3300002705 | JGI25156J39149_1000247 | JGI25156J39149_100024724 | 537 |
| 110 | 3300002705 | JGI25156J39149_1000284 | JGI25156J39149_10002849 | 537 |
| 111 | 3300002738 | JGI25154J39366_1003144 | JGI25154J39366_10031443 | 537 |
| 112 | 3300002741 | JGI25157J39369_1000280 | JGI25157J39369_100028010 | 537 |
| 113 | 3300003761 | Ga0055535_1000275 | Ga0055535_100027551 | 537 |
| 114 | 3300003763 | Ga0055529_1000323 | Ga0055529_100032351 | 537 |
| 115 | 3300005328 | Ga0070676_10007335 | Ga0070676_100073354 | 537 |
| 116 | 3300005329 | Ga0070683_100071398 | Ga0070683_1000713983 | 537 |
| 117 | 3300005338 | Ga0068868_100030410 | Ga0068868_1000304102 | 537 |
| 118 | 3300005364 | Ga0070673_100008566 | Ga0070673_1000085663 | 537 |
| 119 | 3300005459 | Ga0068867_100003198 | Ga0068867_1000031986 | 537 |
| 120 | 3300005578 | Ga0068854_100000932 | Ga0068854_1000009326 | 537 |
| 121 | 3300006195 | Ga0075366_10000924 | Ga0075366_100009248 | 537 |
| 122 | 3300009545 | Ga0105237_10069063 | Ga0105237_100690633 | 537 |
| 123 | 3300010375 | Ga0105239_10033874 | Ga0105239_100338742 | 537 |
| 124 | 3300013105 | Ga0157369_10037886 | Ga0157369_100378863 | 537 |
| 125 | 3300025242 | Ga0209258_100071 | Ga0209258_100071220 | 537 |
| 126 | 3300025246 | Ga0209646_1000249 | Ga0209646_100024924 | 537 |
| 127 | 3300025250 | Ga0209026_1000011 | Ga0209026_1000011406 | 537 |
| 128 | 3300025253 | Ga0209677_100160 | Ga0209677_10016038 | 537 |
| 129 | 3300025256 | Ga0209759_1000034 | Ga0209759_100003470 | 537 |
| 130 | 3300025256 | Ga0209759_1000878 | Ga0209759_10008789 | 537 |
| 131 | 3300025272 | Ga0209455_1000030 | Ga0209455_100003051 | 537 |
| 132 | 3300025907 | Ga0207645_10008891 | Ga0207645_100088914 | 537 |
| 133 | 3300025913 | Ga0207695_10004535 | Ga0207695_1000453512 | 537 |
| 134 | 3300025914 | Ga0207671_10034150 | Ga0207671_100341503 | 537 |
| 135 | 3300025924 | Ga0207694_10052525 | Ga0207694_100525252 | 537 |
| 136 | 3300025940 | Ga0207691_10072392 | Ga0207691_100723922 | 537 |
| 137 | 3300025949 | Ga0207667_10032962 | Ga0207667_100329623 | 537 |
| 138 | 3300025981 | Ga0207640_10001944 | Ga0207640_100019441 | 537 |
| 139 | 3300026023 | Ga0207677_10009710 | Ga0207677_100097104 | 537 |
| 140 | 3300026078 | Ga0207702_10013157 | Ga0207702_100131573 | 537 |
| 141 | 3300031507 | Ga0307509_10000072 | Ga0307509_1000007268 | 537 |
| 142 | 3300031730 | Ga0307516_10000669 | Ga0307516_100006694 | 537 |
| 143 | 3300037471 | Ga0395905_0183120 | Ga0395905_0183120_98_1915 | 537 |
| 144 | 3300046507 | Ga0495606_0001984 | Ga0495606_0001984_13583_15403 | 537 |
| 145 | iso_pu_bacteria | 2857547612 | 2857553200 | 537 |
| 146 | 3300001904 | JGI24736J21556_1000711 | JGI24736J21556_10007115 | 538 |
| 147 | 3300001990 | JGI24737J22298_10001102 | JGI24737J22298_100011021 | 538 |
| 148 | 3300002075 | JGI24738J21930_10006730 | JGI24738J21930_100067302 | 538 |
| 149 | 3300003479 | Ga0006556J51387_1002520 | Ga0006556J51387_10025205 | 538 |
| 150 | 3300003558 | Ga0006558J51389_1003962 | Ga0006558J51389_10039625 | 538 |
| 151 | 3300003565 | Ga0006560J51390_1001645 | Ga0006560J51390_10016455 | 538 |
| 152 | 3300003567 | Ga0006554J51385_1007769 | Ga0006554J51385_10077694 | 538 |
| 153 | 3300013100 | Ga0157373_10010732 | Ga0157373_100107323 | 538 |
| 154 | 3300013104 | Ga0157370_10009438 | Ga0157370_100094386 | 538 |
| 155 | 3300025231 | Ga0207427_100551 | Ga0207427_10055112 | 538 |
| 156 | 3300025919 | Ga0207657_10040355 | Ga0207657_100403554 | 538 |
| 157 | 3300025924 | Ga0207694_10030644 | Ga0207694_100306444 | 538 |
| 158 | 3300025933 | Ga0207706_10030797 | Ga0207706_100307973 | 538 |
| 159 | 3300026142 | Ga0207698_10016691 | Ga0207698_100166914 | 538 |
| 160 | 3300028666 | Ga0265336_10000042 | Ga0265336_1000004279 | 538 |
| 161 | 3300029957 | Ga0265324_10000213 | Ga0265324_1000021311 | 538 |
| 162 | 3300031548 | Ga0307408_100000644 | Ga0307408_10000064412 | 538 |
| 163 | 3300031852 | Ga0307410_10090387 | Ga0307410_100903872 | 538 |
| 164 | 3300048913 | Ga0496110_0056337 | Ga0496110_0056337_298_2046 | 538 |
| 165 | 3300050489 | nmdc:mga03683_7338_c1 | nmdc:mga03683_7338_c1_1849_3567 | 538 |
| 166 | 3300002773 | JGI25152J39213_1000747 | JGI25152J39213_10007473 | 539 |
| 167 | 3300002774 | JGI25150J39212_1000509 | JGI25150J39212_10005093 | 539 |
| 168 | 3300003215 | JGI25153J46596_10007048 | JGI25153J46596_100070485 | 539 |
| 169 | 3300003775 | Ga0055524_1004765 | Ga0055524_10047654 | 539 |
| 170 | 3300005578 | Ga0068854_100009039 | Ga0068854_1000090395 | 539 |
| 171 | 3300009093 | Ga0105240_10000220 | Ga0105240_1000022056 | 539 |
| 172 | 3300009545 | Ga0105237_10000099 | Ga0105237_1000009955 | 539 |
| 173 | 3300010375 | Ga0105239_10000111 | Ga0105239_1000011156 | 539 |
| 174 | 3300025263 | Ga0209565_1011740 | Ga0209565_10117402 | 539 |
| 175 | 3300025913 | Ga0207695_10000213 | Ga0207695_1000021397 | 539 |
| 176 | 3300025914 | Ga0207671_10000918 | Ga0207671_1000091825 | 539 |
| 177 | 3300026121 | Ga0207683_10034445 | Ga0207683_100344452 | 539 |
| 178 | 3300031456 | Ga0307513_10008449 | Ga0307513_100084497 | 539 |
| 179 | 3300032004 | Ga0307414_10002079 | Ga0307414_100020792 | 539 |
| 180 | 3300045051 | Ga0451576_0002747 | Ga0451576_0002747_12438_14204 | 539 |
| 181 | 3300046664 | Ga0495659_0000766 | Ga0495659_0000766_736_2520 | 539 |
| 182 | 3300046692 | Ga0495671_0000663 | Ga0495671_0000663_14129_15913 | 539 |
| 183 | 3300047320 | Ga0495672_0001299 | Ga0495672_0001299_8998_10782 | 539 |
| 184 | 3300048924 | Ga0496121_0005421 | Ga0496121_0005421_7318_9018 | 539 |
| 185 | 2162886007 | SwRhRL2b_contig_2160423 | SwRhRL2b_0453.00003010 | 540 |
| 186 | 3300001915 | JGI24741J21665_1000642 | JGI24741J21665_10006426 | 540 |
| 187 | 3300001979 | JGI24740J21852_10000924 | JGI24740J21852_100009248 | 540 |
| 188 | 3300003752 | Ga0055539_1000068 | Ga0055539_100006839 | 540 |
| 189 | 3300003758 | Ga0055532_1000028 | Ga0055532_100002813 | 540 |
| 190 | 3300003759 | Ga0055525_1000723 | Ga0055525_10007232 | 540 |
| 191 | 3300003760 | Ga0055527_1001261 | Ga0055527_10012613 | 540 |
| 192 | 3300003761 | Ga0055535_1000022 | Ga0055535_100002213 | 540 |
| 193 | 3300003763 | Ga0055529_1000145 | Ga0055529_100014574 | 540 |
| 194 | 3300003792 | Ga0055540_1001656 | Ga0055540_10016565 | 540 |
| 195 | 3300005289 | Ga0065704_10103485 | Ga0065704_101034851 | 540 |
| 196 | 3300005344 | Ga0070661_100000002 | Ga0070661_10000000210 | 540 |
| 197 | 3300005455 | Ga0070663_100000005 | Ga0070663_100000005194 | 540 |
| 198 | 3300005564 | Ga0070664_100000001 | Ga0070664_100000001152 | 540 |
| 199 | 3300005577 | Ga0068857_100027609 | Ga0068857_1000276096 | 540 |
| 200 | 3300005578 | Ga0068854_100000030 | Ga0068854_10000003067 | 540 |
| 201 | 3300005614 | Ga0068856_100000008 | Ga0068856_10000000877 | 540 |
| 202 | 3300020610 | Ga0154015_1469424 | Ga0154015_146942418 | 540 |
| 203 | 3300025224 | Ga0209784_100014 | Ga0209784_100014285 | 540 |
| 204 | 3300025225 | Ga0209566_100011 | Ga0209566_100011285 | 540 |
| 205 | 3300025225 | Ga0209566_101345 | Ga0209566_1013456 | 540 |
| 206 | 3300025226 | Ga0209674_100032 | Ga0209674_100032200 | 540 |
| 207 | 3300025228 | Ga0209672_100137 | Ga0209672_1001376 | 540 |
| 208 | 3300025229 | Ga0209147_100002 | Ga0209147_100002566 | 540 |
| 209 | 3300025230 | Ga0209563_100029 | Ga0209563_100029200 | 540 |
| 210 | 3300025242 | Ga0209258_100002 | Ga0209258_100002566 | 540 |
| 211 | 3300025253 | Ga0209677_100042 | Ga0209677_10004211 | 540 |
| 212 | 3300025256 | Ga0209759_1002422 | Ga0209759_10024225 | 540 |
| 213 | 3300025272 | Ga0209455_1000009 | Ga0209455_1000009447 | 540 |
| 214 | 3300025303 | Ga0209051_1002532 | Ga0209051_10025329 | 540 |
| 215 | 3300025913 | Ga0207695_10001452 | Ga0207695_1000145224 | 540 |
| 216 | 3300025920 | Ga0207649_10002446 | Ga0207649_1000244610 | 540 |
| 217 | 3300025945 | Ga0207679_10000003 | Ga0207679_10000003371 | 540 |
| 218 | 3300025981 | Ga0207640_10000070 | Ga0207640_1000007057 | 540 |
| 219 | 3300026067 | Ga0207678_10000002 | Ga0207678_10000002239 | 540 |
| 220 | 3300026078 | Ga0207702_10000031 | Ga0207702_1000003191 | 540 |
| 221 | 3300026116 | Ga0207674_10021967 | Ga0207674_100219673 | 540 |
| 222 | 3300031548 | Ga0307408_100000006 | Ga0307408_100000006221 | 540 |
| 223 | 3300046492 | Ga0495585_0008542 | Ga0495585_0008542_4292_6025 | 540 |
| 224 | 3300046501 | Ga0495607_0002716 | Ga0495607_0002716_8256_9989 | 540 |
| 225 | 3300046506 | Ga0495583_0000497 | Ga0495583_0000497_24962_26695 | 540 |
| 226 | 3300046523 | Ga0495644_0000127 | Ga0495644_0000127_21129_22862 | 540 |
| 227 | 3300046538 | Ga0495609_0000373 | Ga0495609_0000373_24539_26272 | 540 |
| 228 | 3300046558 | Ga0495633_0003417 | Ga0495633_0003417_103_1848 | 540 |
| 229 | 3300046648 | Ga0495611_0003215 | Ga0495611_0003215_1323_3056 | 540 |
| 230 | 3300046665 | Ga0495661_0001902 | Ga0495661_0001902_12228_13961 | 540 |
| 231 | 3300046691 | Ga0495670_0004671 | Ga0495670_0004671_968_2701 | 540 |
| 232 | 3300047445 | Ga0495677_0000341 | Ga0495677_0000341_12081_13814 | 540 |
| 233 | 3300049460 | Ga0495682_0000287 | Ga0495682_0000287_23984_25717 | 540 |
| 234 | 3300002738 | JGI25154J39366_1000792 | JGI25154J39366_100079216 | 541 |
| 235 | 3300003157 | Ga0006774J45829_10489 | Ga0006774J45829_104891 | 541 |
| 236 | 3300003752 | Ga0055539_1000287 | Ga0055539_10002879 | 541 |
| 237 | 3300003756 | Ga0055533_1000045 | Ga0055533_1000045131 | 541 |
| 238 | 3300003756 | Ga0055533_1000386 | Ga0055533_100038620 | 541 |
| 239 | 3300003841 | Ga0055541_1001507 | Ga0055541_10015073 | 541 |
| 240 | 3300025224 | Ga0209784_100246 | Ga0209784_10024610 | 541 |
| 241 | 3300025225 | Ga0209566_100403 | Ga0209566_10040310 | 541 |
| 242 | 3300025226 | Ga0209674_100073 | Ga0209674_100073131 | 541 |
| 243 | 3300025226 | Ga0209674_100131 | Ga0209674_10013172 | 541 |
| 244 | 3300025230 | Ga0209563_100061 | Ga0209563_10006199 | 541 |
| 245 | 3300025246 | Ga0209646_1000058 | Ga0209646_100005887 | 541 |
| 246 | 3300025250 | Ga0209026_1002043 | Ga0209026_10020432 | 541 |
| 247 | 3300025253 | Ga0209677_100070 | Ga0209677_10007014 | 541 |
| 248 | 3300025254 | Ga0209148_1000043 | Ga0209148_1000043283 | 541 |
| 249 | 3300059604 | Ga0587098_000519 | Ga0587098_000519_499_2262 | 541 |
| 250 | 3300060346 | Ga0587111_0000403 | Ga0587111_0000403_886_2649 | 541 |
| 251 | iso_pu_bacteria | 2513237165 | 2514045177 | 541 |
| 252 | iso_pu_bacteria | 2582581305 | 2585260845 | 541 |
| 253 | iso_pu_bacteria | 2596583598 | 2597031831 | 541 |
| 254 | iso_pu_bacteria | 2599185178 | 2599443669 | 541 |
| 255 | iso_pu_bacteria | 2643221664 | 2644356104 | 541 |
| 256 | iso_pu_bacteria | 2834641062 | 2834642198 | 541 |
| 257 | iso_pu_bacteria | 2885266251 | 2885267448 | 541 |
| 258 | iso_pu_bacteria | 2928058823 | 2928061922 | 541 |
| 259 | 3300001979 | JGI24740J21852_10000084 | JGI24740J21852_1000008416 | 542 |
| 260 | 3300015690 | Ga0183363_1005 | Ga0183363_100551 | 542 |
| 261 | 3300037471 | Ga0395905_0000720 | Ga0395905_0000720_39891_41621 | 542 |
| 262 | 3300037471 | Ga0395905_0001365 | Ga0395905_0001365_7914_9647 | 542 |
| 263 | 3300044712 | Ga0453684_0004221 | Ga0453684_0004221_7117_8871 | 542 |
| 264 | 3300046506 | Ga0495583_0001454 | Ga0495583_0001454_7095_8825 | 542 |
| 265 | 3300046506 | Ga0495583_0030157 | Ga0495583_0030157_367_2097 | 542 |
| 266 | 3300046522 | Ga0495643_0001730 | Ga0495643_0001730_12324_14054 | 542 |
| 267 | 3300046665 | Ga0495661_0008899 | Ga0495661_0008899_3894_5624 | 542 |
| 268 | 3300047318 | Ga0495636_0001853 | Ga0495636_0001853_2053_3783 | 542 |
| 269 | 3300047445 | Ga0495677_0003801 | Ga0495677_0003801_3733_5463 | 542 |
| 270 | 3300047472 | Ga0495686_0002113 | Ga0495686_0002113_10565_12298 | 542 |
| 271 | 3300048091 | Ga0495626_0015958 | Ga0495626_0015958_331_2061 | 542 |
| 272 | 3300049571 | Ga0501034_0000210 | Ga0501034_0000210_95374_97140 | 542 |
| 273 | iso_pu_bacteria | 2516143018 | 2516207332 | 542 |
| 274 | iso_pu_bacteria | 2643221544 | 2643741742 | 542 |
| 275 | iso_pu_bacteria | 2643221639 | 2644220386 | 542 |
| 276 | iso_pu_bacteria | 2643221646 | 2644259312 | 542 |
| 277 | iso_pu_bacteria | 2643221660 | 2644340834 | 542 |
| 278 | iso_pu_bacteria | 2690316117 | 2692318089 | 542 |
| 279 | iso_pu_bacteria | 2791355082 | 2792584562 | 542 |
| 280 | iso_pu_bacteria | 2791355094 | 2792642191 | 542 |
| 281 | iso_pu_bacteria | 2847417321 | 2847423404 | 542 |
| 282 | iso_pu_bacteria | 2848992105 | 2848997116 | 542 |
| 283 | iso_pu_bacteria | 2854916844 | 2854922497 | 542 |
| 284 | iso_pu_bacteria | 2855872281 | 2855875149 | 542 |
| 285 | iso_pu_bacteria | 2885080285 | 2885080326 | 542 |
| 286 | iso_pu_bacteria | 2896384573 | 2896389546 | 542 |
| 287 | iso_pu_bacteria | 2913295892 | 2913300599 | 542 |
| 288 | iso_pu_bacteria | 2919679072 | 2919683088 | 542 |
| 289 | iso_pu_bacteria | 2920760137 | 2920764777 | 542 |
| 290 | iso_pu_bacteria | 2920822456 | 2920827423 | 542 |
| 291 | iso_pu_bacteria | 2989349275 | 2989350491 | 542 |
| 292 | iso_pu_bacteria | 643692032 | 643822194 | 542 |
| 293 | iso_pu_bacteria | 8049293176 | 8049297697 | 542 |
| 294 | iso_pu_bacteria | 8054558443 | 8054559409 | 542 |
| 295 | 3300006846 | Ga0075430_100008435 | Ga0075430_1000084352 | 543 |
| 296 | iso_pu_bacteria | 2513237150 | 2513952669 | 543 |
| 297 | iso_pu_bacteria | 2738541275 | 2738711002 | 543 |
| 298 | iso_pu_bacteria | 2738541301 | 2738849427 | 543 |
| 299 | iso_pu_bacteria | 2738541304 | 2738865156 | 543 |
| 300 | iso_pu_bacteria | 2738543022 | 2739297674 | 543 |
| 301 | iso_pu_bacteria | 2738543033 | 2739359352 | 543 |
| 302 | iso_pu_bacteria | 2808606419 | 2809150781 | 543 |
| 303 | iso_pu_bacteria | 2852618963 | 2852622299 | 543 |
| 304 | 3300025258 | Ga0209129_1000722 | Ga0209129_10007224 | 544 |
| 305 | 3300025297 | Ga0209758_1002100 | Ga0209758_10021004 | 544 |
| 306 | 3300025299 | Ga0209256_1001697 | Ga0209256_100169716 | 544 |
| 307 | 3300031240 | Ga0265320_10001568 | Ga0265320_100015686 | 544 |
| 308 | 3300031711 | Ga0265314_10064117 | Ga0265314_100641171 | 544 |
| 309 | 3300044712 | Ga0453684_0065737 | Ga0453684_0065737_187_1926 | 544 |
| 310 | 3300049537 | Ga0501321_001062 | Ga0501321_001062_275_2020 | 544 |
| 311 | iso_pu_bacteria | 2511231221 | 2512037138 | 544 |
| 312 | iso_pu_bacteria | 2600255292 | 2601667168 | 544 |
| 313 | iso_pu_bacteria | 2928100450 | 2928103615 | 544 |
| 314 | iso_pu_bacteria | 2928959182 | 2928961376 | 544 |
| 315 | iso_pu_bacteria | 2932410948 | 2932416668 | 544 |
| 316 | iso_pu_bacteria | 2932416698 | 2932422417 | 544 |
| 317 | iso_pu_bacteria | 8054002106 | 8054003160 | 544 |
| 318 | 3300005617 | Ga0068859_100001847 | Ga0068859_10000184717 | 545 |
| 319 | 3300006931 | Ga0097620_100001847 | Ga0097620_10000184717 | 545 |
| 320 | 3300009147 | Ga0114129_10240297 | Ga0114129_102402972 | 545 |
| 321 | 3300009177 | Ga0105248_10001130 | Ga0105248_1000113019 | 545 |
| 322 | 3300025941 | Ga0207711_10001219 | Ga0207711_1000121911 | 545 |
| 323 | 3300031548 | Ga0307408_100000898 | Ga0307408_1000008987 | 545 |
| 324 | 3300032002 | Ga0307416_100153277 | Ga0307416_1001532772 | 545 |
| 325 | 3300044658 | Ga0466972_0025957 | Ga0466972_0025957_1004_2764 | 545 |
| 326 | 3300044693 | Ga0466961_0002100 | Ga0466961_0002100_71_1843 | 545 |
| 327 | 3300046471 | Ga0495650_0002026 | Ga0495650_0002026_9119_10858 | 545 |
| 328 | 3300046660 | Ga0495625_0005432 | Ga0495625_0005432_9042_10802 | 545 |
| 329 | 3300047472 | Ga0495686_0013786 | Ga0495686_0013786_3842_5584 | 545 |
| 330 | 3300053133 | Ga0500655_000002 | Ga0500655_000002_99205_100947 | 545 |
| 331 | 3300053136 | Ga0500559_0020350 | Ga0500559_0020350_193_1935 | 545 |
| 332 | 3300053142 | Ga0500577_0012176 | Ga0500577_0012176_781_2523 | 545 |
| 333 | 3300053156 | Ga0500622_0004519 | Ga0500622_0004519_6400_8142 | 545 |
| 334 | 3300053724 | Ga0500570_000153 | Ga0500570_000153_6792_8534 | 545 |
| 335 | iso_pu_bacteria | 2643221605 | 2644036573 | 545 |
| 336 | iso_pu_bacteria | 2738541300 | 2738847116 | 545 |
| 337 | iso_pu_bacteria | 2738543018 | 2739277885 | 545 |
| 338 | iso_pu_bacteria | 2738543030 | 2739346928 | 545 |
| 339 | iso_pu_bacteria | 8054302542 | 8054305316 | 545 |
| 340 | 3300002774 | JGI25150J39212_1001065 | JGI25150J39212_10010654 | 546 |
| 341 | 3300006175 | Ga0070712_100007112 | Ga0070712_1000071122 | 546 |
| 342 | 3300006195 | Ga0075366_10001343 | Ga0075366_1000134313 | 546 |
| 343 | 3300014497 | Ga0182008_10001536 | Ga0182008_100015361 | 546 |
| 344 | 3300015261 | Ga0182006_1001143 | Ga0182006_10011439 | 546 |
| 345 | 3300015262 | Ga0182007_10000877 | Ga0182007_100008776 | 546 |
| 346 | 3300015265 | Ga0182005_1000619 | Ga0182005_10006196 | 546 |
| 347 | 3300025294 | Ga0209025_1003640 | Ga0209025_10036405 | 546 |
| 348 | 3300025297 | Ga0209758_1002961 | Ga0209758_10029615 | 546 |
| 349 | 3300027395 | Ga0209996_1002261 | Ga0209996_10022612 | 546 |
| 350 | 3300039062 | Ga0400483_084836 | Ga0400483_084836_2296_4131 | 546 |
| 351 | 3300039447 | Ga0436361_0291965 | Ga0436361_0291965_992_2746 | 546 |
| 352 | 3300042016 | Ga0439463_010682 | Ga0439463_010682_519_2240 | 546 |
| 353 | 3300046543 | Ga0495645_0085210 | Ga0495645_0085210_498_2219 | 546 |
| 354 | 3300048919 | Ga0496116_0014858 | Ga0496116_0014858_929_2686 | 546 |
| 355 | 3300048920 | Ga0496117_0003807 | Ga0496117_0003807_8305_10062 | 546 |
| 356 | 3300048921 | Ga0496118_0004224 | Ga0496118_0004224_8361_10118 | 546 |
| 357 | 3300048924 | Ga0496121_0003604 | Ga0496121_0003604_6665_8422 | 546 |
| 358 | 3300048924 | Ga0496121_0010128 | Ga0496121_0010128_1682_3439 | 546 |
| 359 | 3300048925 | Ga0496122_0004942 | Ga0496122_0004942_1064_2821 | 546 |
| 360 | 3300049460 | Ga0495682_0009479 | Ga0495682_0009479_1382_3139 | 546 |
| 361 | 3300050493 | nmdc:mga0k408_11372_c1 | nmdc:mga0k408_11372_c1_2035_3933 | 546 |
| 362 | iso_pu_bacteria | 2597490356 | 2599103414 | 546 |
| 363 | iso_pu_bacteria | 2775507255 | 2778127034 | 546 |
| 364 | iso_pu_bacteria | 2846952575 | 2846953299 | 546 |
| 365 | iso_pu_bacteria | 2848858292 | 2848858772 | 546 |
| 366 | iso_pu_bacteria | 2919138771 | 2919139312 | 546 |
| 367 | 3300006177 | Ga0075362_10016832 | Ga0075362_100168322 | 547 |
| 368 | 3300006186 | Ga0075369_10001143 | Ga0075369_100011433 | 547 |
| 369 | 3300006195 | Ga0075366_10000092 | Ga0075366_1000009211 | 547 |
| 370 | 3300006353 | Ga0075370_10000335 | Ga0075370_100003359 | 547 |
| 371 | 3300027876 | Ga0209974_10007897 | Ga0209974_100078971 | 547 |
| 372 | 3300031649 | Ga0307514_10000339 | Ga0307514_1000033921 | 547 |
| 373 | 3300046684 | Ga0495669_0003573 | Ga0495669_0003573_3589_5409 | 547 |
| 374 | 3300048925 | Ga0496122_0012273 | Ga0496122_0012273_5040_6836 | 547 |
| 375 | 3300048928 | Ga0496125_0000219 | Ga0496125_0000219_40088_41884 | 547 |
| 376 | 3300050493 | nmdc:mga0k408_3739_c1 | nmdc:mga0k408_3739_c1_4843_6591 | 547 |
| 377 | 3300050496 | nmdc:mga07m45_4868_c1 | nmdc:mga07m45_4868_c1_3261_5099 | 547 |
| 378 | iso_pu_bacteria | 2643221628 | 2644160731 | 547 |
| 379 | iso_pu_bacteria | 2643221654 | 2644301754 | 547 |
| 380 | iso_pu_bacteria | 2904449895 | 2904455961 | 547 |
| 381 | iso_pu_bacteria | 2904456579 | 2904461722 | 547 |
| 382 | iso_pu_bacteria | 2919462493 | 2919467439 | 547 |
| 383 | iso_pu_bacteria | 2929520902 | 2929525072 | 547 |
| 384 | 3300005459 | Ga0068867_100066953 | Ga0068867_1000669531 | 548 |
| 385 | 3300006195 | Ga0075366_10028656 | Ga0075366_100286562 | 548 |
| 386 | 3300027471 | Ga0209995_1000908 | Ga0209995_10009084 | 548 |
| 387 | 3300027526 | Ga0209968_1000129 | Ga0209968_10001292 | 548 |
| 388 | 3300027695 | Ga0209966_1000035 | Ga0209966_10000352 | 548 |
| 389 | 3300037418 | Ga0395900_0022224 | Ga0395900_0022224_3364_5133 | 548 |
| 390 | 3300049128 | Ga0501308_000952 | Ga0501308_000952_326_2086 | 548 |
| 391 | iso_pu_bacteria | 2842333319 | 2842337585 | 548 |
| 392 | 3300042016 | Ga0439463_004592 | Ga0439463_004592_1518_3254 | 549 |
| 393 | 3300042461 | Ga0439460_0007780 | Ga0439460_0007780_750_2486 | 549 |
| 394 | 3300046520 | Ga0495637_0001476 | Ga0495637_0001476_1177_2913 | 549 |
| 395 | 3300005289 | Ga0065704_10007641 | Ga0065704_100076412 | 550 |
| 396 | 3300005338 | Ga0068868_100020175 | Ga0068868_1000201754 | 550 |
| 397 | 3300005841 | Ga0068863_100025167 | Ga0068863_1000251673 | 550 |
| 398 | 3300006038 | Ga0075365_10022563 | Ga0075365_100225633 | 550 |
| 399 | 3300026088 | Ga0207641_10086712 | Ga0207641_100867121 | 550 |
| 400 | 3300028379 | Ga0268266_10140585 | Ga0268266_101405851 | 550 |
| 401 | 3300042115 | Ga0450911_002259 | Ga0450911_002259_28_1764 | 550 |
| 402 | 3300001979 | JGI24740J21852_10001008 | JGI24740J21852_100010086 | 551 |
| 403 | 3300001990 | JGI24737J22298_10000869 | JGI24737J22298_100008697 | 551 |
| 404 | 3300003215 | JGI25153J46596_10000179 | JGI25153J46596_1000017924 | 551 |
| 405 | 3300003578 | Ga0006562J51391_1145654 | Ga0006562J51391_11456541 | 551 |
| 406 | 3300003759 | Ga0055525_1000012 | Ga0055525_100001272 | 551 |
| 407 | 3300003762 | Ga0055542_1000025 | Ga0055542_100002530 | 551 |
| 408 | 3300003763 | Ga0055529_1000014 | Ga0055529_1000014223 | 551 |
| 409 | 3300003773 | Ga0055537_1000484 | Ga0055537_100048421 | 551 |
| 410 | 3300003784 | Ga0055534_1000406 | Ga0055534_10004066 | 551 |
| 411 | 3300005356 | Ga0070674_100000078 | Ga0070674_1000000786 | 551 |
| 412 | 3300005456 | Ga0070678_100000005 | Ga0070678_10000000551 | 551 |
| 413 | 3300005539 | Ga0068853_100054173 | Ga0068853_1000541732 | 551 |
| 414 | 3300013100 | Ga0157373_10064853 | Ga0157373_100648531 | 551 |
| 415 | 3300017792 | Ga0163161_10004884 | Ga0163161_1000488410 | 551 |
| 416 | 3300025230 | Ga0209563_100030 | Ga0209563_100030376 | 551 |
| 417 | 3300025254 | Ga0209148_1000011 | Ga0209148_1000011227 | 551 |
| 418 | 3300025263 | Ga0209565_1000085 | Ga0209565_1000085142 | 551 |
| 419 | 3300025272 | Ga0209455_1000006 | Ga0209455_1000006967 | 551 |
| 420 | 3300025273 | Ga0209673_1001052 | Ga0209673_100105227 | 551 |
| 421 | 3300025291 | Ga0209675_1000083 | Ga0209675_1000083142 | 551 |
| 422 | 3300025297 | Ga0209758_1000007 | Ga0209758_1000007831 | 551 |
| 423 | 3300025321 | Ga0207656_10009882 | Ga0207656_100098821 | 551 |
| 424 | 3300025909 | Ga0207705_10000752 | Ga0207705_1000075211 | 551 |
| 425 | 3300025911 | Ga0207654_10001142 | Ga0207654_100011422 | 551 |
| 426 | 3300025913 | Ga0207695_10009243 | Ga0207695_100092436 | 551 |
| 427 | 3300025919 | Ga0207657_10027377 | Ga0207657_100273773 | 551 |
| 428 | 3300025920 | Ga0207649_10002538 | Ga0207649_100025384 | 551 |
| 429 | 3300025924 | Ga0207694_10039858 | Ga0207694_100398582 | 551 |
| 430 | 3300025932 | Ga0207690_10001322 | Ga0207690_100013223 | 551 |
| 431 | 3300025935 | Ga0207709_10000137 | Ga0207709_1000013719 | 551 |
| 432 | 3300025937 | Ga0207669_10000093 | Ga0207669_1000009329 | 551 |
| 433 | 3300025949 | Ga0207667_10000107 | Ga0207667_1000010738 | 551 |
| 434 | 3300025981 | Ga0207640_10002305 | Ga0207640_100023054 | 551 |
| 435 | 3300026041 | Ga0207639_10000561 | Ga0207639_1000056115 | 551 |
| 436 | 3300026067 | Ga0207678_10000943 | Ga0207678_1000094314 | 551 |
| 437 | 3300026078 | Ga0207702_10005713 | Ga0207702_100057136 | 551 |
| 438 | 3300026089 | Ga0207648_10072853 | Ga0207648_100728532 | 551 |
| 439 | 3300026116 | Ga0207674_10005181 | Ga0207674_100051817 | 551 |
| 440 | 3300026121 | Ga0207683_10000115 | Ga0207683_1000011553 | 551 |
| 441 | 3300028794 | Ga0307515_10009815 | Ga0307515_1000981514 | 551 |
| 442 | 3300031507 | Ga0307509_10003311 | Ga0307509_1000331110 | 551 |
| 443 | 3300031731 | Ga0307405_10000180 | Ga0307405_100001804 | 551 |
| 444 | 3300031901 | Ga0307406_10005409 | Ga0307406_100054091 | 551 |
| 445 | 3300032004 | Ga0307414_10002924 | Ga0307414_100029248 | 551 |
| 446 | 3300032005 | Ga0307411_10001033 | Ga0307411_100010339 | 551 |
| 447 | 3300033180 | Ga0307510_10023302 | Ga0307510_100233024 | 551 |
| 448 | 3300035691 | Ga0373931_0052573 | Ga0373931_0052573_192_2000 | 551 |
| 449 | 3300037471 | Ga0395905_0101454 | Ga0395905_0101454_595_2391 | 551 |
| 450 | 3300042145 | Ga0450906_001662 | Ga0450906_001662_1136_2917 | 551 |
| 451 | 3300046454 | Ga0495592_0000159 | Ga0495592_0000159_31091_32899 | 551 |
| 452 | 3300046660 | Ga0495625_0000436 | Ga0495625_0000436_55205_56998 | 551 |
| 453 | 3300048905 | Ga0496102_0000067 | Ga0496102_0000067_83324_85120 | 551 |
| 454 | 3300048906 | Ga0496103_0000242 | Ga0496103_0000242_50113_51909 | 551 |
| 455 | 3300048907 | Ga0496104_0010698 | Ga0496104_0010698_946_2742 | 551 |
| 456 | 3300048914 | Ga0496111_0011343 | Ga0496111_0011343_742_2538 | 551 |
| 457 | 3300048918 | Ga0496115_0000056 | Ga0496115_0000056_30662_32458 | 551 |
| 458 | 3300048919 | Ga0496116_0009849 | Ga0496116_0009849_5668_7464 | 551 |
| 459 | 3300048920 | Ga0496117_0000114 | Ga0496117_0000114_71603_73399 | 551 |
| 460 | 3300048921 | Ga0496118_0000082 | Ga0496118_0000082_111786_113582 | 551 |
| 461 | 3300048922 | Ga0496119_0026396 | Ga0496119_0026396_1189_2985 | 551 |
| 462 | 3300048924 | Ga0496121_0000344 | Ga0496121_0000344_71720_73516 | 551 |
| 463 | 3300048927 | Ga0496124_0000068 | Ga0496124_0000068_71740_73536 | 551 |
| 464 | 3300048929 | Ga0496126_0000157 | Ga0496126_0000157_71752_73548 | 551 |
| 465 | iso_pu_bacteria | 2574179768 | 2574430843 | 551 |
| 466 | 3300005459 | Ga0068867_100000059 | Ga0068867_10000005941 | 552 |
| 467 | 3300006880 | Ga0075429_100000203 | Ga0075429_10000020320 | 552 |
| 468 | 3300009545 | Ga0105237_10003006 | Ga0105237_100030066 | 552 |
| 469 | 3300010375 | Ga0105239_10019943 | Ga0105239_1001994310 | 552 |
| 470 | 3300014745 | Ga0157377_10000029 | Ga0157377_1000002984 | 552 |
| 471 | 3300015683 | Ga0183362_10002 | Ga0183362_100021296 | 552 |
| 472 | 3300025913 | Ga0207695_10046919 | Ga0207695_100469193 | 552 |
| 473 | 3300025914 | Ga0207671_10013772 | Ga0207671_100137725 | 552 |
| 474 | 3300025933 | Ga0207706_10044090 | Ga0207706_100440903 | 552 |
| 475 | 3300025935 | Ga0207709_10000911 | Ga0207709_1000091117 | 552 |
| 476 | 3300026089 | Ga0207648_10000080 | Ga0207648_1000008042 | 552 |
| 477 | 3300028786 | Ga0307517_10000005 | Ga0307517_1000000537 | 552 |
| 478 | 3300031616 | Ga0307508_10089304 | Ga0307508_100893043 | 552 |
| 479 | 3300046506 | Ga0495583_0000129 | Ga0495583_0000129_41382_43202 | 552 |
| 480 | 3300048924 | Ga0496121_0043779 | Ga0496121_0043779_1994_3802 | 552 |
| 481 | 3300050493 | nmdc:mga0k408_18079_c1 | nmdc:mga0k408_18079_c1_1677_3482 | 552 |
| 482 | 3300050508 | nmdc:mga09592_2271_c1 | nmdc:mga09592_2271_c1_10156_11913 | 552 |
| 483 | 3300031235 | Ga0265330_10000267 | Ga0265330_1000026713 | 553 |
| 484 | 3300031238 | Ga0265332_10000031 | Ga0265332_1000003113 | 553 |
| 485 | 3300031711 | Ga0265314_10000095 | Ga0265314_10000095116 | 553 |
| 486 | iso_pu_bacteria | 646564506 | 646815010 | 553 |
| 487 | 3300031730 | Ga0307516_10000067 | Ga0307516_1000006775 | 555 |
| 488 | iso_pu_bacteria | 2844665904 | 2844669660 | 555 |
| 489 | iso_pu_bacteria | 8019769354 | 8019775664 | 555 |
| 490 | 3300009036 | Ga0105244_10000016 | Ga0105244_1000001619 | 556 |
| 491 | 3300009036 | Ga0105244_10001524 | Ga0105244_100015246 | 556 |
| 492 | 3300009036 | Ga0105244_10016545 | Ga0105244_100165453 | 556 |
| 493 | 3300013307 | Ga0157372_10001218 | Ga0157372_100012184 | 556 |
| 494 | 3300015265 | Ga0182005_1000524 | Ga0182005_100052417 | 556 |
| 495 | 3300048922 | Ga0496119_0002172 | Ga0496119_0002172_15325_17091 | 556 |
| 496 | 3300048923 | Ga0496120_0002014 | Ga0496120_0002014_15728_17494 | 556 |
| 497 | 3300048925 | Ga0496122_0005970 | Ga0496122_0005970_2739_4502 | 556 |
| 498 | 3300049571 | Ga0501034_0000003 | Ga0501034_0000003_465141_466904 | 556 |
| 499 | 3300048905 | Ga0496102_0005919 | Ga0496102_0005919_3641_5476 | 557 |
| 500 | 3300048920 | Ga0496117_0000090 | Ga0496117_0000090_52152_53987 | 557 |
| 501 | 3300048921 | Ga0496118_0000032 | Ga0496118_0000032_151050_152885 | 557 |
| 502 | 3300048922 | Ga0496119_0031893 | Ga0496119_0031893_1718_3502 | 557 |
| 503 | 3300048928 | Ga0496125_0035776 | Ga0496125_0035776_1479_3263 | 557 |
| 504 | iso_pu_bacteria | 8011350971 | 8011354594 | 557 |
| 505 | iso_pu_bacteria | 651053060 | 651176163 | 559 |
| 506 | 3300046522 | Ga0495643_0005423 | Ga0495643_0005423_763_2529 | 560 |
| 507 | iso_pu_bacteria | 2511231004 | 2511258059 | 560 |
| 508 | iso_pu_bacteria | 2511231007 | 2511271544 | 560 |
| 509 | iso_pu_bacteria | 2511231008 | 2511280845 | 560 |
| 510 | iso_pu_bacteria | 2511231012 | 2511300269 | 560 |
| 511 | iso_pu_bacteria | 2511231015 | 2511322863 | 560 |
| 512 | iso_pu_bacteria | 2511231016 | 2511329321 | 560 |
| 513 | iso_pu_bacteria | 2511231017 | 2511331382 | 560 |
| 514 | iso_pu_bacteria | 2511231018 | 2511336177 | 560 |
| 515 | iso_pu_bacteria | 2511231019 | 2511342238 | 560 |
| 516 | iso_pu_bacteria | 2511231021 | 2511354952 | 560 |
| 517 | iso_pu_bacteria | 2511231022 | 2511362725 | 560 |
| 518 | iso_pu_bacteria | 2511231156 | 2511824963 | 560 |
| 519 | iso_pu_bacteria | 2554235341 | 2555669225 | 560 |
| 520 | iso_pu_bacteria | 2599185160 | 2599357877 | 560 |
| 521 | iso_pu_bacteria | 2599185161 | 2599361630 | 560 |
| 522 | iso_pu_bacteria | 2599185162 | 2599367952 | 560 |
| 523 | iso_pu_bacteria | 2599185163 | 2599374741 | 560 |
| 524 | iso_pu_bacteria | 2599185164 | 2599383042 | 560 |
| 525 | iso_pu_bacteria | 2599185165 | 2599389575 | 560 |
| 526 | iso_pu_bacteria | 2599185166 | 2599393599 | 560 |
| 527 | iso_pu_bacteria | 2599185168 | 2599405366 | 560 |
| 528 | iso_pu_bacteria | 2599185181 | 2599464693 | 560 |
| 529 | iso_pu_bacteria | 2599185182 | 2599468243 | 560 |
| 530 | iso_pu_bacteria | 2599185186 | 2599493716 | 560 |
| 531 | iso_pu_bacteria | 2599185188 | 2599502316 | 560 |
| 532 | iso_pu_bacteria | 2599185212 | 2599612843 | 560 |
| 533 | iso_pu_bacteria | 2599185248 | 2599769046 | 560 |
| 534 | iso_pu_bacteria | 2599185288 | 2599877984 | 560 |
| 535 | iso_pu_bacteria | 2599185289 | 2599884845 | 560 |
| 536 | iso_pu_bacteria | 2599185291 | 2599895977 | 560 |
| 537 | iso_pu_bacteria | 2599185300 | 2599932622 | 560 |
| 538 | iso_pu_bacteria | 2599185302 | 2599943374 | 560 |
| 539 | iso_pu_bacteria | 2599185303 | 2599952208 | 560 |
| 540 | iso_pu_bacteria | 2599185304 | 2599954485 | 560 |
| 541 | iso_pu_bacteria | 2599185305 | 2599957862 | 560 |
| 542 | iso_pu_bacteria | 2599185306 | 2599966788 | 560 |
| 543 | iso_pu_bacteria | 2599185307 | 2599970389 | 560 |
| 544 | iso_pu_bacteria | 2599185308 | 2599978067 | 560 |
| 545 | iso_pu_bacteria | 2599185309 | 2599983798 | 560 |
| 546 | iso_pu_bacteria | 2599185310 | 2599988696 | 560 |
| 547 | iso_pu_bacteria | 2599185311 | 2599993355 | 560 |
| 548 | iso_pu_bacteria | 2599185312 | 2600001400 | 560 |
| 549 | iso_pu_bacteria | 2599185313 | 2600004041 | 560 |
| 550 | iso_pu_bacteria | 2599185314 | 2600012206 | 560 |
| 551 | iso_pu_bacteria | 2599185315 | 2600015585 | 560 |
| 552 | iso_pu_bacteria | 2599185316 | 2600021942 | 560 |
| 553 | iso_pu_bacteria | 2599185317 | 2600028544 | 560 |
| 554 | iso_pu_bacteria | 2599185318 | 2600037539 | 560 |
| 555 | iso_pu_bacteria | 2599185319 | 2600042866 | 560 |
| 556 | iso_pu_bacteria | 2599185320 | 2600048603 | 560 |
| 557 | iso_pu_bacteria | 2599185321 | 2600050793 | 560 |
| 558 | iso_pu_bacteria | 2599185322 | 2600060076 | 560 |
| 559 | iso_pu_bacteria | 2599185323 | 2600063297 | 560 |
| 560 | iso_pu_bacteria | 2599185324 | 2600072675 | 560 |
| 561 | iso_pu_bacteria | 2599185325 | 2600075216 | 560 |
| 562 | iso_pu_bacteria | 2599185356 | 2600217415 | 560 |
| 563 | iso_pu_bacteria | 2600254930 | 2600357711 | 560 |
| 564 | iso_pu_bacteria | 2600254931 | 2600365631 | 560 |
| 565 | iso_pu_bacteria | 2600254954 | 2600446628 | 560 |
| 566 | iso_pu_bacteria | 2600255313 | 2601777585 | 560 |
| 567 | iso_pu_bacteria | 2600255389 | 2602010831 | 560 |
| 568 | iso_pu_bacteria | 2619619299 | 2621298796 | 560 |
| 569 | iso_pu_bacteria | 2623620446 | 2624492659 | 560 |
| 570 | iso_pu_bacteria | 2643221565 | 2643841652 | 560 |
| 571 | iso_pu_bacteria | 2643221589 | 2643956967 | 560 |
| 572 | iso_pu_bacteria | 2643221602 | 2644024890 | 560 |
| 573 | iso_pu_bacteria | 2643221633 | 2644186761 | 560 |
| 574 | iso_pu_bacteria | 2643221650 | 2644283939 | 560 |
| 575 | iso_pu_bacteria | 2651869719 | 2652544948 | 560 |
| 576 | iso_pu_bacteria | 2667528170 | 2671088669 | 560 |
| 577 | iso_pu_bacteria | 2667528171 | 2671098272 | 560 |
| 578 | iso_pu_bacteria | 2667528176 | 2671126290 | 560 |
| 579 | iso_pu_bacteria | 2675903420 | 2677900728 | 560 |
| 580 | iso_pu_bacteria | 2675903515 | 2678263602 | 560 |
| 581 | iso_pu_bacteria | 2728369097 | 2729145861 | 560 |
| 582 | iso_pu_bacteria | 2738541265 | 2738672045 | 560 |
| 583 | iso_pu_bacteria | 2738541282 | 2738750438 | 560 |
| 584 | iso_pu_bacteria | 2738541294 | 2738810033 | 560 |
| 585 | iso_pu_bacteria | 2738541303 | 2738859479 | 560 |
| 586 | iso_pu_bacteria | 2738541309 | 2738897393 | 560 |
| 587 | iso_pu_bacteria | 2738543004 | 2739197682 | 560 |
| 588 | iso_pu_bacteria | 2738543015 | 2739258598 | 560 |
| 589 | iso_pu_bacteria | 2738543020 | 2739286374 | 560 |
| 590 | iso_pu_bacteria | 2738543021 | 2739291687 | 560 |
| 591 | iso_pu_bacteria | 2744054620 | 2745009933 | 560 |
| 592 | iso_pu_bacteria | 2773857670 | 2774123242 | 560 |
| 593 | iso_pu_bacteria | 2784132072 | 2784315766 | 560 |
| 594 | iso_pu_bacteria | 2791355520 | 2794594852 | 560 |
| 595 | iso_pu_bacteria | 2808606361 | 2808856269 | 560 |
| 596 | iso_pu_bacteria | 2808606376 | 2808924711 | 560 |
| 597 | iso_pu_bacteria | 2808606377 | 2808932979 | 560 |
| 598 | iso_pu_bacteria | 2808606378 | 2808938990 | 560 |
| 599 | iso_pu_bacteria | 2808606379 | 2808943239 | 560 |
| 600 | iso_pu_bacteria | 2808606380 | 2808946707 | 560 |
| 601 | iso_pu_bacteria | 2808606381 | 2808955122 | 560 |
| 602 | iso_pu_bacteria | 2808606382 | 2808958310 | 560 |
| 603 | iso_pu_bacteria | 2808606383 | 2808964763 | 560 |
| 604 | iso_pu_bacteria | 2808606385 | 2808976999 | 560 |
| 605 | iso_pu_bacteria | 2808606388 | 2808992154 | 560 |
| 606 | iso_pu_bacteria | 2808606389 | 2809002099 | 560 |
| 607 | iso_pu_bacteria | 2816332298 | 2817492043 | 560 |
| 608 | iso_pu_bacteria | 2818991464 | 2819703343 | 560 |
| 609 | iso_pu_bacteria | 2823421272 | 2823423413 | 560 |
| 610 | iso_pu_bacteria | 2825651385 | 2825651974 | 560 |
| 611 | iso_pu_bacteria | 2834028612 | 2834032857 | 560 |
| 612 | iso_pu_bacteria | 2842854478 | 2842858151 | 560 |
| 613 | iso_pu_bacteria | 2852612431 | 2852613667 | 560 |
| 614 | iso_pu_bacteria | 2852667396 | 2852668597 | 560 |
| 615 | iso_pu_bacteria | 2860339153 | 2860342339 | 560 |
| 616 | iso_pu_bacteria | 2904550169 | 2904550567 | 560 |
| 617 | iso_pu_bacteria | 2913036834 | 2913039679 | 560 |
| 618 | iso_pu_bacteria | 2917070673 | 2917073028 | 560 |
| 619 | iso_pu_bacteria | 2919155634 | 2919156764 | 560 |
| 620 | iso_pu_bacteria | 2919456309 | 2919459019 | 560 |
| 621 | iso_pu_bacteria | 2919481497 | 2919484768 | 560 |
| 622 | iso_pu_bacteria | 2919501602 | 2919505218 | 560 |
| 623 | iso_pu_bacteria | 2919697872 | 2919702647 | 560 |
| 624 | iso_pu_bacteria | 2923586266 | 2923588448 | 560 |
| 625 | iso_pu_bacteria | 2926063275 | 2926066895 | 560 |
| 626 | iso_pu_bacteria | 2929144301 | 2929147580 | 560 |
| 627 | iso_pu_bacteria | 2931369376 | 2931375148 | 560 |
| 628 | iso_pu_bacteria | 2931396565 | 2931402422 | 560 |
| 629 | iso_pu_bacteria | 2935353572 | 2935359444 | 560 |
| 630 | iso_pu_bacteria | 2939636861 | 2939638500 | 560 |
| 631 | iso_pu_bacteria | 2988728565 | 2988728861 | 560 |
| 632 | iso_pu_bacteria | 3007511990 | 3007514618 | 560 |
| 633 | iso_pu_bacteria | 3007803356 | 3007808262 | 560 |
| 634 | iso_pu_bacteria | 3007866637 | 3007869136 | 560 |
| 635 | iso_pu_bacteria | 637000220 | 637319560 | 560 |
| 636 | iso_pu_bacteria | 8019775933 | 8019781051 | 560 |
| 637 | iso_pu_bacteria | 8034962539 | 8034963695 | 560 |
| 638 | iso_pu_bacteria | 8052494512 | 8052497778 | 560 |
| 639 | iso_pu_bacteria | 8054503363 | 8054507049 | 560 |
| 640 | iso_pu_bacteria | 8056125926 | 8056129297 | 560 |
| 641 | iso_pu_bacteria | 8056131705 | 8056135480 | 560 |
| 642 | iso_pu_bacteria | 8056143049 | 8056146202 | 560 |
| 643 | iso_pu_bacteria | 8056155041 | 8056157624 | 560 |
| 644 | 3300002737 | JGI25162J39368_1000013 | JGI25162J39368_1000013289 | 562 |
| 645 | 3300002772 | JGI25164J39214_1000005 | JGI25164J39214_1000005289 | 562 |
| 646 | 3300003214 | JGI25165J46597_1000099 | JGI25165J46597_100009971 | 562 |
| 647 | 3300003578 | Ga0006562J51391_1005668 | Ga0006562J51391_10056686 | 562 |
| 648 | 3300003791 | Ga0055530_10000075 | Ga0055530_1000007537 | 562 |
| 649 | 3300003792 | Ga0055540_1000115 | Ga0055540_100011537 | 562 |
| 650 | 3300005288 | Ga0065714_10002340 | Ga0065714_100023403 | 562 |
| 651 | 3300005289 | Ga0065704_10000778 | Ga0065704_1000077811 | 562 |
| 652 | 3300006946 | Ga0079104_1000554 | Ga0079104_10005542 | 562 |
| 653 | 3300006948 | Ga0099826_10026578 | Ga0099826_100265781 | 562 |
| 654 | 3300009036 | Ga0105244_10008586 | Ga0105244_100085865 | 562 |
| 655 | 3300011119 | Ga0105246_10040883 | Ga0105246_100408832 | 562 |
| 656 | 3300013100 | Ga0157373_10001148 | Ga0157373_1000114813 | 562 |
| 657 | 3300013102 | Ga0157371_10001866 | Ga0157371_100018662 | 562 |
| 658 | 3300015261 | Ga0182006_1001034 | Ga0182006_100103416 | 562 |
| 659 | 3300015262 | Ga0182007_10000071 | Ga0182007_1000007118 | 562 |
| 660 | 3300025207 | Ga0209760_100035 | Ga0209760_10003542 | 562 |
| 661 | 3300025231 | Ga0207427_100018 | Ga0207427_100018446 | 562 |
| 662 | 3300025233 | Ga0209437_100031 | Ga0209437_100031446 | 562 |
| 663 | 3300025261 | Ga0209233_1000012 | Ga0209233_1000012443 | 562 |
| 664 | 3300025292 | Ga0209676_1004064 | Ga0209676_10040644 | 562 |
| 665 | 3300025298 | Ga0209050_1000013 | Ga0209050_1000013429 | 562 |
| 666 | 3300025298 | Ga0209050_1000914 | Ga0209050_100091422 | 562 |
| 667 | 3300025303 | Ga0209051_1000007 | Ga0209051_1000007429 | 562 |
| 668 | 3300025304 | Ga0209257_1011899 | Ga0209257_10118992 | 562 |
| 669 | 3300025728 | Ga0207655_1003059 | Ga0207655_10030598 | 562 |
| 670 | 3300025735 | Ga0207713_1015292 | Ga0207713_10152923 | 562 |
| 671 | 3300027111 | Ga0209281_1000009 | Ga0209281_1000009446 | 562 |
| 672 | 3300031548 | Ga0307408_100002935 | Ga0307408_1000029358 | 562 |
| 673 | 3300042009 | Ga0439451_004360 | Ga0439451_004360_439_2220 | 562 |
| 674 | 3300046457 | Ga0495590_0002605 | Ga0495590_0002605_1155_2930 | 562 |
| 675 | 3300046474 | Ga0495605_0002121 | Ga0495605_0002121_890_2668 | 562 |
| 676 | 3300046474 | Ga0495605_0023402 | Ga0495605_0023402_1394_3169 | 562 |
| 677 | 3300046491 | Ga0495584_0002919 | Ga0495584_0002919_826_2601 | 562 |
| 678 | 3300046501 | Ga0495607_0002369 | Ga0495607_0002369_1043_2818 | 562 |
| 679 | 3300046507 | Ga0495606_0003306 | Ga0495606_0003306_5525_7300 | 562 |
| 680 | 3300046528 | Ga0495642_0000067 | Ga0495642_0000067_34709_36484 | 562 |
| 681 | 3300046538 | Ga0495609_0004161 | Ga0495609_0004161_622_2397 | 562 |
| 682 | 3300046557 | Ga0495622_0000638 | Ga0495622_0000638_16860_18635 | 562 |
| 683 | 3300046692 | Ga0495671_0004284 | Ga0495671_0004284_1375_3150 | 562 |
| 684 | 3300046694 | Ga0495649_0008024 | Ga0495649_0008024_29_1804 | 562 |
| 685 | 3300046794 | Ga0495589_0000220 | Ga0495589_0000220_39563_41338 | 562 |
| 686 | 3300047320 | Ga0495672_0000553 | Ga0495672_0000553_22712_24487 | 562 |
| 687 | 3300047320 | Ga0495672_0008074 | Ga0495672_0008074_5142_6917 | 562 |
| 688 | 3300047469 | Ga0495673_0003440 | Ga0495673_0003440_6931_8709 | 562 |
| 689 | 3300048091 | Ga0495626_0001191 | Ga0495626_0001191_18738_20513 | 562 |
| 690 | 3300048091 | Ga0495626_0002350 | Ga0495626_0002350_6090_7865 | 562 |
| 691 | 3300048091 | Ga0495626_0005927 | Ga0495626_0005927_4479_6254 | 562 |
| 692 | 3300048905 | Ga0496102_0000073 | Ga0496102_0000073_129440_131218 | 562 |
| 693 | 3300048919 | Ga0496116_0000995 | Ga0496116_0000995_17593_19368 | 562 |
| 694 | 3300049459 | Ga0495678_008505 | Ga0495678_008505_2155_3930 | 562 |
| 695 | 3300025292 | Ga0209676_1000617 | Ga0209676_10006177 | 563 |
| 696 | 3300047323 | Ga0495683_0000852 | Ga0495683_0000852_18945_20720 | 563 |
| 697 | iso_pu_bacteria | 640427133 | 640488209 | 563 |
| 698 | 2124908027 | MRS2a_Contig_5158 | MRS2a_00057600 | 564 |
| 699 | 3300002737 | JGI25162J39368_1000050 | JGI25162J39368_100005059 | 564 |
| 700 | 3300002772 | JGI25164J39214_1000025 | JGI25164J39214_1000025102 | 564 |
| 701 | 3300003214 | JGI25165J46597_1000114 | JGI25165J46597_1000114102 | 564 |
| 702 | 3300003214 | JGI25165J46597_1000176 | JGI25165J46597_100017643 | 564 |
| 703 | 3300005288 | Ga0065714_10074368 | Ga0065714_100743681 | 564 |
| 704 | 3300005289 | Ga0065704_10019304 | Ga0065704_100193042 | 564 |
| 705 | 3300005289 | Ga0065704_10099251 | Ga0065704_100992511 | 564 |
| 706 | 3300005290 | Ga0065712_10013359 | Ga0065712_100133591 | 564 |
| 707 | 3300005331 | Ga0070670_100000303 | Ga0070670_10000030324 | 564 |
| 708 | 3300005344 | Ga0070661_100002107 | Ga0070661_1000021076 | 564 |
| 709 | 3300005564 | Ga0070664_100002981 | Ga0070664_1000029815 | 564 |
| 710 | 3300006058 | Ga0075432_10001039 | Ga0075432_100010392 | 564 |
| 711 | 3300006914 | Ga0075436_100050914 | Ga0075436_1000509142 | 564 |
| 712 | 3300006944 | Ga0099823_1000001 | Ga0099823_1000001146 | 564 |
| 713 | 3300006946 | Ga0079104_1000303 | Ga0079104_100030350 | 564 |
| 714 | 3300009011 | Ga0105251_10012550 | Ga0105251_100125502 | 564 |
| 715 | 3300009036 | Ga0105244_10004851 | Ga0105244_100048517 | 564 |
| 716 | 3300009092 | Ga0105250_10000353 | Ga0105250_1000035315 | 564 |
| 717 | 3300009148 | Ga0105243_10055083 | Ga0105243_100550831 | 564 |
| 718 | 3300009176 | Ga0105242_10022928 | Ga0105242_100229282 | 564 |
| 719 | 3300009545 | Ga0105237_10006234 | Ga0105237_100062346 | 564 |
| 720 | 3300013100 | Ga0157373_10008114 | Ga0157373_100081142 | 564 |
| 721 | 3300013102 | Ga0157371_10001502 | Ga0157371_1000150217 | 564 |
| 722 | 3300013104 | Ga0157370_10001953 | Ga0157370_100019536 | 564 |
| 723 | 3300013105 | Ga0157369_10012461 | Ga0157369_100124618 | 564 |
| 724 | 3300013308 | Ga0157375_10095431 | Ga0157375_100954311 | 564 |
| 725 | 3300014497 | Ga0182008_10007960 | Ga0182008_100079604 | 564 |
| 726 | 3300014497 | Ga0182008_10009829 | Ga0182008_100098295 | 564 |
| 727 | 3300014497 | Ga0182008_10018151 | Ga0182008_100181512 | 564 |
| 728 | 3300015261 | Ga0182006_1001202 | Ga0182006_100120213 | 564 |
| 729 | 3300015262 | Ga0182007_10001255 | Ga0182007_100012556 | 564 |
| 730 | 3300017792 | Ga0163161_10004705 | Ga0163161_100047056 | 564 |
| 731 | 3300025207 | Ga0209760_100033 | Ga0209760_10003332 | 564 |
| 732 | 3300025231 | Ga0207427_100003 | Ga0207427_100003895 | 564 |
| 733 | 3300025233 | Ga0209437_100002 | Ga0209437_100002119 | 564 |
| 734 | 3300025261 | Ga0209233_1000004 | Ga0209233_10000041307 | 564 |
| 735 | 3300025711 | Ga0207696_1000016 | Ga0207696_1000016148 | 564 |
| 736 | 3300025711 | Ga0207696_1000108 | Ga0207696_100010898 | 564 |
| 737 | 3300025711 | Ga0207696_1012629 | Ga0207696_10126292 | 564 |
| 738 | 3300025728 | Ga0207655_1000027 | Ga0207655_1000027249 | 564 |
| 739 | 3300025728 | Ga0207655_1000114 | Ga0207655_10001146 | 564 |
| 740 | 3300025728 | Ga0207655_1000384 | Ga0207655_100038445 | 564 |
| 741 | 3300025728 | Ga0207655_1002020 | Ga0207655_10020201 | 564 |
| 742 | 3300025728 | Ga0207655_1022254 | Ga0207655_10222541 | 564 |
| 743 | 3300025728 | Ga0207655_1028880 | Ga0207655_10288802 | 564 |
| 744 | 3300025735 | Ga0207713_1000185 | Ga0207713_100018571 | 564 |
| 745 | 3300025735 | Ga0207713_1001969 | Ga0207713_10019692 | 564 |
| 746 | 3300025735 | Ga0207713_1002029 | Ga0207713_10020292 | 564 |
| 747 | 3300025735 | Ga0207713_1022044 | Ga0207713_10220441 | 564 |
| 748 | 3300025735 | Ga0207713_1034813 | Ga0207713_10348131 | 564 |
| 749 | 3300025914 | Ga0207671_10001354 | Ga0207671_100013546 | 564 |
| 750 | 3300025920 | Ga0207649_10000577 | Ga0207649_100005775 | 564 |
| 751 | 3300025925 | Ga0207650_10000068 | Ga0207650_10000068113 | 564 |
| 752 | 3300025935 | Ga0207709_10033091 | Ga0207709_100330912 | 564 |
| 753 | 3300025945 | Ga0207679_10001702 | Ga0207679_100017026 | 564 |
| 754 | 3300027111 | Ga0209281_1000063 | Ga0209281_100006347 | 564 |
| 755 | 3300027296 | Ga0209389_1000007 | Ga0209389_1000007156 | 564 |
| 756 | 3300027665 | Ga0209983_1001879 | Ga0209983_10018793 | 564 |
| 757 | 3300027682 | Ga0209971_1001017 | Ga0209971_10010171 | 564 |
| 758 | 3300031548 | Ga0307408_100000018 | Ga0307408_100000018250 | 564 |
| 759 | 3300031731 | Ga0307405_10000137 | Ga0307405_1000013715 | 564 |
| 760 | 3300041404 | Ga0439436_0004667 | Ga0439436_0004667_2118_3902 | 564 |
| 761 | 3300041411 | Ga0439466_0002538 | Ga0439466_0002538_625_2400 | 564 |
| 762 | 3300042006 | Ga0439432_000171 | Ga0439432_000171_7473_9248 | 564 |
| 763 | 3300042146 | Ga0450907_000140 | Ga0450907_000140_10168_11943 | 564 |
| 764 | 3300042439 | Ga0439464_0000443 | Ga0439464_0000443_5012_6787 | 564 |
| 765 | 3300046458 | Ga0495591_000174 | Ga0495591_000174_31767_33542 | 564 |
| 766 | 3300046458 | Ga0495591_000697 | Ga0495591_000697_13365_15140 | 564 |
| 767 | 3300046458 | Ga0495591_010060 | Ga0495591_010060_251_2026 | 564 |
| 768 | 3300046460 | Ga0495638_0003448 | Ga0495638_0003448_8599_10374 | 564 |
| 769 | 3300046460 | Ga0495638_0011837 | Ga0495638_0011837_4047_5822 | 564 |
| 770 | 3300046463 | Ga0495653_0041055 | Ga0495653_0041055_1571_3346 | 564 |
| 771 | 3300046471 | Ga0495650_0001051 | Ga0495650_0001051_8654_10429 | 564 |
| 772 | 3300046474 | Ga0495605_0000076 | Ga0495605_0000076_93325_95100 | 564 |
| 773 | 3300046474 | Ga0495605_0001638 | Ga0495605_0001638_10099_11874 | 564 |
| 774 | 3300046491 | Ga0495584_0003118 | Ga0495584_0003118_5362_7137 | 564 |
| 775 | 3300046492 | Ga0495585_0000545 | Ga0495585_0000545_29138_30913 | 564 |
| 776 | 3300046492 | Ga0495585_0026285 | Ga0495585_0026285_1076_2851 | 564 |
| 777 | 3300046500 | Ga0495596_0006327 | Ga0495596_0006327_1006_2781 | 564 |
| 778 | 3300046501 | Ga0495607_0000799 | Ga0495607_0000799_3554_5329 | 564 |
| 779 | 3300046506 | Ga0495583_0000172 | Ga0495583_0000172_103919_105694 | 564 |
| 780 | 3300046506 | Ga0495583_0003405 | Ga0495583_0003405_7957_9732 | 564 |
| 781 | 3300046506 | Ga0495583_0005099 | Ga0495583_0005099_3508_5283 | 564 |
| 782 | 3300046506 | Ga0495583_0006345 | Ga0495583_0006345_4980_6755 | 564 |
| 783 | 3300046507 | Ga0495606_0000028 | Ga0495606_0000028_9655_11430 | 564 |
| 784 | 3300046507 | Ga0495606_0000684 | Ga0495606_0000684_34_1812 | 564 |
| 785 | 3300046507 | Ga0495606_0002075 | Ga0495606_0002075_22471_24246 | 564 |
| 786 | 3300046507 | Ga0495606_0012296 | Ga0495606_0012296_4131_5906 | 564 |
| 787 | 3300046512 | Ga0495610_0004091 | Ga0495610_0004091_1134_2909 | 564 |
| 788 | 3300046515 | Ga0495620_0000314 | Ga0495620_0000314_3715_5490 | 564 |
| 789 | 3300046515 | Ga0495620_0004729 | Ga0495620_0004729_5448_7223 | 564 |
| 790 | 3300046518 | Ga0495631_0000275 | Ga0495631_0000275_16014_17789 | 564 |
| 791 | 3300046520 | Ga0495637_0000027 | Ga0495637_0000027_94848_96623 | 564 |
| 792 | 3300046520 | Ga0495637_0004465 | Ga0495637_0004465_4999_6774 | 564 |
| 793 | 3300046520 | Ga0495637_0014441 | Ga0495637_0014441_1099_2874 | 564 |
| 794 | 3300046523 | Ga0495644_0007674 | Ga0495644_0007674_1812_3587 | 564 |
| 795 | 3300046523 | Ga0495644_0030543 | Ga0495644_0030543_39_1814 | 564 |
| 796 | 3300046524 | Ga0495648_0027650 | Ga0495648_0027650_602_2377 | 564 |
| 797 | 3300046528 | Ga0495642_0000334 | Ga0495642_0000334_15915_17690 | 564 |
| 798 | 3300046530 | Ga0495654_0004194 | Ga0495654_0004194_5076_6851 | 564 |
| 799 | 3300046530 | Ga0495654_0005001 | Ga0495654_0005001_1792_3567 | 564 |
| 800 | 3300046530 | Ga0495654_0044825 | Ga0495654_0044825_180_1955 | 564 |
| 801 | 3300046536 | Ga0495587_0039571 | Ga0495587_0039571_788_2566 | 564 |
| 802 | 3300046536 | Ga0495587_0040769 | Ga0495587_0040769_270_2045 | 564 |
| 803 | 3300046538 | Ga0495609_0000206 | Ga0495609_0000206_29358_31133 | 564 |
| 804 | 3300046538 | Ga0495609_0006540 | Ga0495609_0006540_3470_5245 | 564 |
| 805 | 3300046557 | Ga0495622_0004006 | Ga0495622_0004006_1279_3054 | 564 |
| 806 | 3300046615 | Ga0495656_0007101 | Ga0495656_0007101_2136_3911 | 564 |
| 807 | 3300046616 | Ga0495668_0003932 | Ga0495668_0003932_2623_4398 | 564 |
| 808 | 3300046648 | Ga0495611_0004712 | Ga0495611_0004712_2531_4306 | 564 |
| 809 | 3300046660 | Ga0495625_0000296 | Ga0495625_0000296_70639_72414 | 564 |
| 810 | 3300046663 | Ga0495635_0043568 | Ga0495635_0043568_579_2354 | 564 |
| 811 | 3300046665 | Ga0495661_0000119 | Ga0495661_0000119_31505_33280 | 564 |
| 812 | 3300046665 | Ga0495661_0008680 | Ga0495661_0008680_5012_6787 | 564 |
| 813 | 3300046680 | Ga0495646_0049093 | Ga0495646_0049093_17_1795 | 564 |
| 814 | 3300046691 | Ga0495670_0004075 | Ga0495670_0004075_5007_6782 | 564 |
| 815 | 3300046692 | Ga0495671_0001916 | Ga0495671_0001916_10880_12658 | 564 |
| 816 | 3300046692 | Ga0495671_0002682 | Ga0495671_0002682_497_2272 | 564 |
| 817 | 3300046810 | Ga0495660_0002659 | Ga0495660_0002659_4187_5962 | 564 |
| 818 | 3300047321 | Ga0495676_0000003 | Ga0495676_0000003_53676_55451 | 564 |
| 819 | 3300047323 | Ga0495683_0000382 | Ga0495683_0000382_18180_19955 | 564 |
| 820 | 3300047446 | Ga0495679_001158 | Ga0495679_001158_13922_15697 | 564 |
| 821 | 3300047446 | Ga0495679_003272 | Ga0495679_003272_1957_3732 | 564 |
| 822 | 3300047469 | Ga0495673_0000602 | Ga0495673_0000602_16024_17799 | 564 |
| 823 | 3300047469 | Ga0495673_0000782 | Ga0495673_0000782_8566_10341 | 564 |
| 824 | 3300047469 | Ga0495673_0002393 | Ga0495673_0002393_2169_3944 | 564 |
| 825 | 3300047469 | Ga0495673_0027861 | Ga0495673_0027861_256_2031 | 564 |
| 826 | 3300047470 | Ga0495681_0007269 | Ga0495681_0007269_4308_6083 | 564 |
| 827 | 3300047470 | Ga0495681_0010033 | Ga0495681_0010033_1125_2900 | 564 |
| 828 | 3300048091 | Ga0495626_0000086 | Ga0495626_0000086_27389_29164 | 564 |
| 829 | 3300048913 | Ga0496110_0075255 | Ga0496110_0075255_236_2011 | 564 |
| 830 | 3300048920 | Ga0496117_0004650 | Ga0496117_0004650_40_1815 | 564 |
| 831 | 3300048924 | Ga0496121_0001663 | Ga0496121_0001663_27518_29293 | 564 |
| 832 | 3300048925 | Ga0496122_0000244 | Ga0496122_0000244_75612_77387 | 564 |
| 833 | 3300048925 | Ga0496122_0061191 | Ga0496122_0061191_277_2052 | 564 |
| 834 | 3300048926 | Ga0496123_0000201 | Ga0496123_0000201_75665_77440 | 564 |
| 835 | 3300048926 | Ga0496123_0013135 | Ga0496123_0013135_3940_5715 | 564 |
| 836 | 3300048926 | Ga0496123_0028961 | Ga0496123_0028961_1600_3375 | 564 |
| 837 | 3300048927 | Ga0496124_0018543 | Ga0496124_0018543_3744_5519 | 564 |
| 838 | 3300048927 | Ga0496124_0019143 | Ga0496124_0019143_674_2449 | 564 |
| 839 | 3300048928 | Ga0496125_0000862 | Ga0496125_0000862_21766_23541 | 564 |
| 840 | 3300048928 | Ga0496125_0059744 | Ga0496125_0059744_201_1976 | 564 |
| 841 | 3300048929 | Ga0496126_0004738 | Ga0496126_0004738_4831_6606 | 564 |
| 842 | 3300049459 | Ga0495678_001067 | Ga0495678_001067_12059_13834 | 564 |
| 843 | 3300049459 | Ga0495678_018802 | Ga0495678_018802_279_2054 | 564 |
| 844 | 3300049460 | Ga0495682_0000138 | Ga0495682_0000138_36985_38760 | 564 |
| 845 | 3300049853 | Ga0501226_000017 | Ga0501226_000017_10206_11987 | 564 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6zcv-assembly1.cif.gz_A | crystal structure of lanthanide-dependent alcohol dehydrogenase pedh from pseudomonas putida kt2440 | 0.9676 | 29 | 560 |
| 6zcw-assembly1.cif.gz_A | crystal structure of lanthanide-dependent alcohol dehydrogenase pedh from pseudomonas putida kt2440 | 0.967 | 29 | 560 |
| 1flg-assembly1.cif.gz_B | crystal structure of the quinoprotein ethanol dehydrogenase from pseudomonas aeruginosa | 0.9427 | 28 | 557 |
| 6zcv-assembly1.cif.gz_A | crystal structure of lanthanide-dependent alcohol dehydrogenase pedh from pseudomonas putida kt2440 | 0.9153 | 29 | 560 |
| 6zcw-assembly1.cif.gz_A | crystal structure of lanthanide-dependent alcohol dehydrogenase pedh from pseudomonas putida kt2440 | 0.9148 | 29 | 560 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1flgA00 | Mainly Beta;8 Propeller;Methanol Dehydrogenase; Chain A;Quinoprotein alcohol dehydrogenase-like superfamily | 0.9446 | 28 | 557 | 2.140.10.10 |
| 1flgA00 | Mainly Beta;8 Propeller;Methanol Dehydrogenase; Chain A;Quinoprotein alcohol dehydrogenase-like superfamily | 0.8893 | 28 | 557 | 2.140.10.10 |
| 4tqoD00 | Mainly Beta;8 Propeller;Methanol Dehydrogenase; Chain A;Quinoprotein alcohol dehydrogenase-like superfamily | 0.8775 | 32 | 555 | 2.140.10.10 |
| 6damA00 | Mainly Beta;8 Propeller;Methanol Dehydrogenase; Chain A;Quinoprotein alcohol dehydrogenase-like superfamily | 0.8702 | 32 | 557 | 2.140.10.10 |
| af_D3Z757_2_150_2.40.128.630 | Mainly Beta;Beta Barrel;Lipocalin; | 0.8524 | 92 | 168 | 2.40.128.630 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0I9SGI2-F1-model_v4 | Dehydrogenase | 0.9638 | 64 | 563 |
GO:0005509
GO:0016020 GO:0016614 |
| AF-A0A7H2DPB2-F1-model_v4 | deleted | 0.9608 | 19 | 562 |
|
| AF-A0A6I1NS56-F1-model_v4 | PQQ-dependent dehydrogenase, methanol/ethanol family | 0.9552 | 344 | 492 |
|
| AF-A0A2V8BVC9-F1-model_v4 | PQQ-binding-like beta-propeller repeat protein | 0.9541 | 92 | 173 |
|
| AF-A0A661FFX2-F1-model_v4 | PQQ-dependent dehydrogenase, methanol/ethanol family | 0.9513 | 118 | 557 |
GO:0005509
GO:0016020 GO:0016614 GO:0030288 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar