F483228
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 844 | 355 | 844 | 85 |
Family's Representative Sequence
| Representative Sequence | 3300049570|Ga0501033_0859619|Ga0501033_0859619_298_561 |
| Length | 87 |
| Sequence | MASKKAAGSTKNGRDSQSKRLGVKRFGGQFVLPGTIIIRQRGSKFHVGRNVRMGRDFTIYAVAEGQVKFERVNKDKFKVSVYPKSVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 2 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 3 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 5 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 24 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 33 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 34 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 36 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 37 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 38 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 39 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 40 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 41 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 42 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 43 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 44 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 45 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 47 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 48 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 49 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 50 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 52 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 53 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 54 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 55 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 56 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 57 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 58 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 59 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 60 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 61 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 62 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 64 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Metagenome | Rhizosphere |
| 79 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 92 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 93 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 94 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 95 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 96 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 98 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 99 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 100 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 102 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 139 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 140 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 141 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 142 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 143 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 144 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 145 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 146 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 147 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 148 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 149 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 150 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 151 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 152 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 153 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 154 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 155 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 156 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 157 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 158 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 159 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 160 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 161 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 162 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 163 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 164 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 165 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 166 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 167 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 168 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 169 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 170 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 171 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 172 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 173 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 174 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 175 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 176 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 177 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 178 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 179 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 180 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 181 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 182 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 183 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 184 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 185 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 186 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 187 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 188 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 189 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 190 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 191 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 192 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 193 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 194 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 195 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 196 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 197 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 198 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 199 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 200 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 201 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 202 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 203 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 204 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 205 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 206 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 207 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 208 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 209 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 210 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 211 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 212 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 213 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 214 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 215 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 216 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 217 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 218 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 219 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 220 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 221 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 222 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 223 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 224 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 225 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 226 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 227 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 228 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 229 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 230 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 231 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 232 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 233 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 234 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 235 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 236 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 237 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 238 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 239 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 240 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 241 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 280 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 281 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 282 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 283 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 284 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 287 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 288 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 289 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 290 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 324 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 325 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 326 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 327 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 328 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 329 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 330 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 341 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 342 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 343 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 344 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 345 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 346 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 347 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 349 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 350 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 351 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 352 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 353 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 355 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.38 |
| Metatranscriptomes | 4.62 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.9 |
| Nodule | 0 |
| Rhizoplane | 4.03 |
| Rhizosphere | 81.4 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.67 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25407J50210_10002455 | 3300003373 | Bacteria | 4365 |
| 2 | JGI25405J52794_10012367 | 3300003911 | Bacteria | 1643 |
| 3 | Ga0058863_11585879 | 3300004799 | Bacteria | 573 |
| 4 | Ga0068868_100560352 | 3300005338 | Bacteria | 1008 |
| 5 | Ga0070660_100520149 | 3300005339 | Bacteria | 991 |
| 6 | Ga0070689_101603487 | 3300005340 | Bacteria | 591 |
| 7 | Ga0070668_100149775 | 3300005347 | Bacteria | 1886 |
| 8 | Ga0070668_101180590 | 3300005347 | Bacteria | 693 |
| 9 | Ga0070675_100142130 | 3300005354 | Bacteria | 2052 |
| 10 | Ga0070671_100012872 | 3300005355 | Bacteria | 6745 |
| 11 | Ga0070671_100878342 | 3300005355 | Bacteria | 783 |
| 12 | Ga0070674_100393756 | 3300005356 | Bacteria | 1130 |
| 13 | Ga0070674_100549119 | 3300005356 | Bacteria | 969 |
| 14 | Ga0070673_100774295 | 3300005364 | Bacteria | 885 |
| 15 | Ga0070673_100919186 | 3300005364 | Bacteria | 812 |
| 16 | Ga0070673_101599679 | 3300005364 | Bacteria | 616 |
| 17 | Ga0070688_100532259 | 3300005365 | Bacteria | 891 |
| 18 | Ga0070688_101630180 | 3300005365 | Bacteria | 527 |
| 19 | Ga0070667_100363602 | 3300005367 | Bacteria | 1312 |
| 20 | Ga0070667_101297558 | 3300005367 | Bacteria | 682 |
| 21 | Ga0070714_100152956 | 3300005435 | Bacteria | 2080 |
| 22 | Ga0070714_101582351 | 3300005435 | Bacteria | 640 |
| 23 | Ga0070713_101615909 | 3300005436 | Bacteria | 629 |
| 24 | Ga0070710_11529057 | 3300005437 | Bacteria | 502 |
| 25 | Ga0070711_100768928 | 3300005439 | Bacteria | 815 |
| 26 | Ga0070700_100412032 | 3300005441 | Bacteria | 1019 |
| 27 | Ga0070700_101848570 | 3300005441 | Bacteria | 521 |
| 28 | Ga0070694_101419629 | 3300005444 | Bacteria | 586 |
| 29 | Ga0070708_100013011 | 3300005445 | Bacteria | 6800 |
| 30 | Ga0070678_100762466 | 3300005456 | Bacteria | 876 |
| 31 | Ga0070678_101246724 | 3300005456 | Bacteria | 691 |
| 32 | Ga0070681_10280899 | 3300005458 | Bacteria | 1576 |
| 33 | Ga0068867_100835803 | 3300005459 | Bacteria | 824 |
| 34 | Ga0068867_101873828 | 3300005459 | Bacteria | 565 |
| 35 | Ga0070706_100263522 | 3300005467 | Bacteria | 1609 |
| 36 | Ga0070699_100084446 | 3300005518 | Bacteria | 2771 |
| 37 | Ga0070699_102202719 | 3300005518 | Bacteria | 503 |
| 38 | Ga0070679_100869378 | 3300005530 | Bacteria | 845 |
| 39 | Ga0070684_100685688 | 3300005535 | Bacteria | 955 |
| 40 | Ga0070697_101036572 | 3300005536 | Bacteria | 730 |
| 41 | Ga0070697_101428563 | 3300005536 | Bacteria | 618 |
| 42 | Ga0068853_100488991 | 3300005539 | Bacteria | 1161 |
| 43 | Ga0070686_101493663 | 3300005544 | Bacteria | 569 |
| 44 | Ga0070704_100632936 | 3300005549 | Bacteria | 943 |
| 45 | Ga0070704_101018444 | 3300005549 | Bacteria | 749 |
| 46 | Ga0068854_100459404 | 3300005578 | Bacteria | 1065 |
| 47 | Ga0068856_100496084 | 3300005614 | Bacteria | 1242 |
| 48 | Ga0068856_101967424 | 3300005614 | Bacteria | 595 |
| 49 | Ga0070702_100938899 | 3300005615 | Bacteria | 680 |
| 50 | Ga0068852_100438494 | 3300005616 | Bacteria | 1291 |
| 51 | Ga0068859_100257887 | 3300005617 | Bacteria | 1834 |
| 52 | Ga0068859_101029810 | 3300005617 | Bacteria | 904 |
| 53 | Ga0068861_100031746 | 3300005719 | Bacteria | 3883 |
| 54 | Ga0068861_102466385 | 3300005719 | Bacteria | 523 |
| 55 | Ga0068870_10644374 | 3300005840 | Bacteria | 725 |
| 56 | Ga0068863_100799032 | 3300005841 | Bacteria | 941 |
| 57 | Ga0068858_100667069 | 3300005842 | Bacteria | 1011 |
| 58 | Ga0068858_102170828 | 3300005842 | Bacteria | 549 |
| 59 | Ga0068860_101601005 | 3300005843 | Bacteria | 673 |
| 60 | Ga0081455_10001010 | 3300005937 | Bacteria | 35609 |
| 61 | Ga0081455_10085566 | 3300005937 | Bacteria | 2571 |
| 62 | Ga0081455_10090442 | 3300005937 | Bacteria | 2482 |
| 63 | Ga0081455_10218693 | 3300005937 | Bacteria | 1414 |
| 64 | Ga0081538_10000291 | 3300005981 | Bacteria | 57529 |
| 65 | Ga0081538_10003721 | 3300005981 | Bacteria | 14312 |
| 66 | Ga0081538_10076270 | 3300005981 | Bacteria | 1813 |
| 67 | Ga0081540_1334971 | 3300005983 | Bacteria | 518 |
| 68 | Ga0070717_10733769 | 3300006028 | Bacteria | 898 |
| 69 | Ga0075365_10007031 | 3300006038 | Bacteria | 6265 |
| 70 | Ga0075365_10085467 | 3300006038 | Bacteria | 2143 |
| 71 | Ga0075365_10117420 | 3300006038 | Bacteria | 1833 |
| 72 | Ga0075365_10177594 | 3300006038 | Bacteria | 1488 |
| 73 | Ga0075365_10197118 | 3300006038 | Bacteria | 1410 |
| 74 | Ga0075365_10300961 | 3300006038 | Bacteria | 1129 |
| 75 | Ga0075365_10365571 | 3300006038 | Bacteria | 1017 |
| 76 | Ga0075365_10552168 | 3300006038 | Bacteria | 815 |
| 77 | Ga0075365_10880009 | 3300006038 | Bacteria | 632 |
| 78 | Ga0075368_10106482 | 3300006042 | Bacteria | 1154 |
| 79 | Ga0075368_10165038 | 3300006042 | Bacteria | 929 |
| 80 | Ga0075363_100248941 | 3300006048 | Bacteria | 1023 |
| 81 | Ga0075363_100328801 | 3300006048 | Bacteria | 890 |
| 82 | Ga0075363_100405652 | 3300006048 | Bacteria | 801 |
| 83 | Ga0075363_100411346 | 3300006048 | Bacteria | 796 |
| 84 | Ga0075363_100927299 | 3300006048 | Bacteria | 534 |
| 85 | Ga0075363_101022817 | 3300006048 | Bacteria | 510 |
| 86 | Ga0075364_10010043 | 3300006051 | Bacteria | 5702 |
| 87 | Ga0075364_10045406 | 3300006051 | Bacteria | 2859 |
| 88 | Ga0075364_10162037 | 3300006051 | Bacteria | 1510 |
| 89 | Ga0075364_10178904 | 3300006051 | Bacteria | 1435 |
| 90 | Ga0075364_10252109 | 3300006051 | Bacteria | 1199 |
| 91 | Ga0075364_10330829 | 3300006051 | Bacteria | 1038 |
| 92 | Ga0075364_10490547 | 3300006051 | Bacteria | 840 |
| 93 | Ga0075364_10500995 | 3300006051 | Bacteria | 830 |
| 94 | Ga0075364_10744273 | 3300006051 | Bacteria | 669 |
| 95 | Ga0070712_100908845 | 3300006175 | Bacteria | 759 |
| 96 | Ga0075362_10094242 | 3300006177 | Bacteria | 1393 |
| 97 | Ga0075362_10396908 | 3300006177 | Bacteria | 695 |
| 98 | Ga0075362_10616574 | 3300006177 | Bacteria | 561 |
| 99 | Ga0075367_10031451 | 3300006178 | Bacteria | 3047 |
| 100 | Ga0075367_10264238 | 3300006178 | Bacteria | 1080 |
| 101 | Ga0075367_10373588 | 3300006178 | Bacteria | 901 |
| 102 | Ga0075367_10378820 | 3300006178 | Bacteria | 894 |
| 103 | Ga0075367_10791527 | 3300006178 | Bacteria | 604 |
| 104 | Ga0075367_10835265 | 3300006178 | Bacteria | 587 |
| 105 | Ga0075367_10936652 | 3300006178 | Bacteria | 553 |
| 106 | Ga0075366_10654326 | 3300006195 | Bacteria | 652 |
| 107 | Ga0075370_10190304 | 3300006353 | Bacteria | 1209 |
| 108 | Ga0075370_10296550 | 3300006353 | Bacteria | 961 |
| 109 | Ga0075370_10598358 | 3300006353 | Bacteria | 668 |
| 110 | Ga0075370_10892830 | 3300006353 | Bacteria | 543 |
| 111 | Ga0075428_100000156 | 3300006844 | Bacteria | 62057 |
| 112 | Ga0075428_100000395 | 3300006844 | Bacteria | 43162 |
| 113 | Ga0075428_100085116 | 3300006844 | Bacteria | 3448 |
| 114 | Ga0075428_100174546 | 3300006844 | Bacteria | 2328 |
| 115 | Ga0075428_100363280 | 3300006844 | Bacteria | 1553 |
| 116 | Ga0075430_100001345 | 3300006846 | Bacteria | 19880 |
| 117 | Ga0075430_100026748 | 3300006846 | Bacteria | 4906 |
| 118 | Ga0075430_100108920 | 3300006846 | Bacteria | 2310 |
| 119 | Ga0075430_100138927 | 3300006846 | Bacteria | 2023 |
| 120 | Ga0075431_100011461 | 3300006847 | Bacteria | 8934 |
| 121 | Ga0075431_100062165 | 3300006847 | Bacteria | 3854 |
| 122 | Ga0075431_100170661 | 3300006847 | Bacteria | 2235 |
| 123 | Ga0075431_100593151 | 3300006847 | Bacteria | 1092 |
| 124 | Ga0075431_100894872 | 3300006847 | Bacteria | 857 |
| 125 | Ga0075434_100377383 | 3300006871 | Bacteria | 1439 |
| 126 | Ga0075429_100170935 | 3300006880 | Bacteria | 1904 |
| 127 | Ga0075429_100267714 | 3300006880 | Bacteria | 1496 |
| 128 | Ga0075429_100597455 | 3300006880 | Bacteria | 967 |
| 129 | Ga0075429_101711855 | 3300006880 | Bacteria | 546 |
| 130 | Ga0068865_101090233 | 3300006881 | Bacteria | 703 |
| 131 | Ga0075436_101560546 | 3300006914 | Bacteria | 502 |
| 132 | Ga0097620_100257886 | 3300006931 | Bacteria | 1834 |
| 133 | Ga0097620_101029795 | 3300006931 | Bacteria | 904 |
| 134 | Ga0099795_10148759 | 3300007788 | Bacteria | 958 |
| 135 | Ga0105240_10639363 | 3300009093 | Bacteria | 1167 |
| 136 | Ga0111539_10720186 | 3300009094 | Bacteria | 1161 |
| 137 | Ga0111539_10901451 | 3300009094 | Bacteria | 1028 |
| 138 | Ga0111539_11027103 | 3300009094 | Bacteria | 958 |
| 139 | Ga0111539_12326014 | 3300009094 | Bacteria | 622 |
| 140 | Ga0111539_13159430 | 3300009094 | Bacteria | 531 |
| 141 | Ga0105245_10001646 | 3300009098 | Bacteria | 20330 |
| 142 | Ga0105245_10016863 | 3300009098 | Bacteria | 6376 |
| 143 | Ga0105245_10304022 | 3300009098 | Bacteria | 1566 |
| 144 | Ga0105245_11355597 | 3300009098 | Bacteria | 761 |
| 145 | Ga0105245_11356747 | 3300009098 | Bacteria | 761 |
| 146 | Ga0105245_11981142 | 3300009098 | Bacteria | 636 |
| 147 | Ga0105245_12174315 | 3300009098 | Bacteria | 609 |
| 148 | Ga0105247_11348964 | 3300009101 | Bacteria | 575 |
| 149 | Ga0114129_10000561 | 3300009147 | Bacteria | 45655 |
| 150 | Ga0114129_10005087 | 3300009147 | Bacteria | 18514 |
| 151 | Ga0114129_10006283 | 3300009147 | Bacteria | 16845 |
| 152 | Ga0114129_10160191 | 3300009147 | Bacteria | 3075 |
| 153 | Ga0114129_10319471 | 3300009147 | Bacteria | 2064 |
| 154 | Ga0114129_10364110 | 3300009147 | Bacteria | 1912 |
| 155 | Ga0105243_10395642 | 3300009148 | Bacteria | 1282 |
| 156 | Ga0105243_11744635 | 3300009148 | Bacteria | 652 |
| 157 | Ga0105243_11940106 | 3300009148 | Bacteria | 622 |
| 158 | Ga0105243_12131438 | 3300009148 | Bacteria | 597 |
| 159 | Ga0105241_11288629 | 3300009174 | Bacteria | 695 |
| 160 | Ga0105242_10063603 | 3300009176 | Bacteria | 3039 |
| 161 | Ga0105242_12543478 | 3300009176 | Bacteria | 560 |
| 162 | Ga0105248_11063535 | 3300009177 | Bacteria | 914 |
| 163 | Ga0105248_11399204 | 3300009177 | Bacteria | 791 |
| 164 | Ga0105248_12956788 | 3300009177 | Bacteria | 541 |
| 165 | Ga0105237_11228691 | 3300009545 | Bacteria | 756 |
| 166 | Ga0105238_10936923 | 3300009551 | Bacteria | 885 |
| 167 | Ga0105238_12070115 | 3300009551 | Bacteria | 603 |
| 168 | Ga0105249_11061538 | 3300009553 | Bacteria | 880 |
| 169 | Ga0105249_11469604 | 3300009553 | Bacteria | 754 |
| 170 | Ga0105249_11517633 | 3300009553 | Bacteria | 742 |
| 171 | Ga0105249_12748873 | 3300009553 | Bacteria | 564 |
| 172 | Ga0105249_12773647 | 3300009553 | Bacteria | 562 |
| 173 | Ga0105239_10122168 | 3300010375 | Bacteria | 2893 |
| 174 | Ga0105239_11589461 | 3300010375 | Bacteria | 756 |
| 175 | Ga0105246_10454604 | 3300011119 | Bacteria | 1077 |
| 176 | Ga0105246_11305468 | 3300011119 | Bacteria | 673 |
| 177 | Ga0105246_12110425 | 3300011119 | Bacteria | 546 |
| 178 | Ga0157329_1019916 | 3300012491 | Bacteria | 620 |
| 179 | Ga0157373_11204731 | 3300013100 | Bacteria | 571 |
| 180 | Ga0157369_10392094 | 3300013105 | Bacteria | 1441 |
| 181 | Ga0157378_10440627 | 3300013297 | Bacteria | 1291 |
| 182 | Ga0157378_11802431 | 3300013297 | Bacteria | 660 |
| 183 | Ga0157378_12067775 | 3300013297 | Bacteria | 620 |
| 184 | Ga0157378_12645277 | 3300013297 | Bacteria | 554 |
| 185 | Ga0163162_12721468 | 3300013306 | Bacteria | 569 |
| 186 | Ga0163162_13003394 | 3300013306 | Bacteria | 542 |
| 187 | Ga0157372_10639090 | 3300013307 | Bacteria | 1239 |
| 188 | Ga0157372_11387247 | 3300013307 | Bacteria | 810 |
| 189 | Ga0157375_10537707 | 3300013308 | Bacteria | 1331 |
| 190 | Ga0157375_10615253 | 3300013308 | Bacteria | 1245 |
| 191 | Ga0157375_11209345 | 3300013308 | Bacteria | 887 |
| 192 | Ga0157375_11466250 | 3300013308 | Bacteria | 805 |
| 193 | Ga0157375_12085487 | 3300013308 | Bacteria | 675 |
| 194 | Ga0163163_10289665 | 3300014325 | Bacteria | 1690 |
| 195 | Ga0163163_10441767 | 3300014325 | Bacteria | 1361 |
| 196 | Ga0157380_11122936 | 3300014326 | Bacteria | 826 |
| 197 | Ga0157380_13434909 | 3300014326 | Bacteria | 507 |
| 198 | Ga0157377_11185491 | 3300014745 | Bacteria | 590 |
| 199 | Ga0157379_10469673 | 3300014968 | Bacteria | 1163 |
| 200 | Ga0157379_10528545 | 3300014968 | Bacteria | 1096 |
| 201 | Ga0157379_10734725 | 3300014968 | Bacteria | 928 |
| 202 | Ga0157379_12154360 | 3300014968 | Bacteria | 553 |
| 203 | Ga0157379_12665658 | 3300014968 | Bacteria | 501 |
| 204 | Ga0157376_11265249 | 3300014969 | Bacteria | 767 |
| 205 | Ga0157376_11301485 | 3300014969 | Bacteria | 757 |
| 206 | Ga0157376_12182718 | 3300014969 | Bacteria | 592 |
| 207 | Ga0157376_12954178 | 3300014969 | Bacteria | 515 |
| 208 | Ga0163161_10853542 | 3300017792 | Bacteria | 769 |
| 209 | Ga0163161_10995905 | 3300017792 | Bacteria | 715 |
| 210 | Ga0197907_10137062 | 3300020069 | Bacteria | 705 |
| 211 | Ga0197907_10534594 | 3300020069 | Bacteria | 737 |
| 212 | Ga0197907_10755373 | 3300020069 | Bacteria | 856 |
| 213 | Ga0197907_11464321 | 3300020069 | Bacteria | 681 |
| 214 | Ga0206356_10096014 | 3300020070 | Bacteria | 721 |
| 215 | Ga0206356_10185486 | 3300020070 | Bacteria | 701 |
| 216 | Ga0206356_10416685 | 3300020070 | Bacteria | 820 |
| 217 | Ga0206355_1067193 | 3300020076 | Bacteria | 705 |
| 218 | Ga0206355_1343555 | 3300020076 | Bacteria | 588 |
| 219 | Ga0206355_1525959 | 3300020076 | Bacteria | 607 |
| 220 | Ga0206350_11354471 | 3300020080 | Bacteria | 751 |
| 221 | Ga0206354_10409034 | 3300020081 | Bacteria | 622 |
| 222 | Ga0206354_10451484 | 3300020081 | Bacteria | 609 |
| 223 | Ga0206354_10983743 | 3300020081 | Bacteria | 934 |
| 224 | Ga0206354_11094166 | 3300020081 | Bacteria | 694 |
| 225 | Ga0206353_10258710 | 3300020082 | Bacteria | 584 |
| 226 | Ga0206353_10741550 | 3300020082 | Bacteria | 606 |
| 227 | Ga0206353_11180624 | 3300020082 | Bacteria | 628 |
| 228 | Ga0206353_11556319 | 3300020082 | Bacteria | 1209 |
| 229 | Ga0213873_10086632 | 3300021358 | Bacteria | 884 |
| 230 | Ga0213876_10014910 | 3300021384 | Bacteria | 4119 |
| 231 | Ga0213876_10122461 | 3300021384 | Bacteria | 1381 |
| 232 | Ga0213871_10100891 | 3300021441 | Bacteria | 845 |
| 233 | Ga0224712_10250171 | 3300022467 | Bacteria | 818 |
| 234 | Ga0224712_10305271 | 3300022467 | Bacteria | 745 |
| 235 | Ga0224712_10389241 | 3300022467 | Bacteria | 663 |
| 236 | Ga0224712_10475406 | 3300022467 | Bacteria | 602 |
| 237 | Ga0224572_1008544 | 3300024225 | Bacteria | 1896 |
| 238 | Ga0224572_1046660 | 3300024225 | Unclassified | 811 |
| 239 | Ga0207642_11026322 | 3300025899 | Bacteria | 532 |
| 240 | Ga0207710_10706079 | 3300025900 | Bacteria | 529 |
| 241 | Ga0207688_10259322 | 3300025901 | Bacteria | 1055 |
| 242 | Ga0207680_11038453 | 3300025903 | Bacteria | 587 |
| 243 | Ga0207645_11238244 | 3300025907 | Bacteria | 500 |
| 244 | Ga0207643_10840922 | 3300025908 | Bacteria | 595 |
| 245 | Ga0207684_10150050 | 3300025910 | Bacteria | 2005 |
| 246 | Ga0207684_10962714 | 3300025910 | Bacteria | 715 |
| 247 | Ga0207707_10063579 | 3300025912 | Bacteria | 3212 |
| 248 | Ga0207707_10321453 | 3300025912 | Bacteria | 1336 |
| 249 | Ga0207671_11426262 | 3300025914 | Bacteria | 536 |
| 250 | Ga0207657_10512051 | 3300025919 | Bacteria | 940 |
| 251 | Ga0207657_11046745 | 3300025919 | Bacteria | 625 |
| 252 | Ga0207652_10763828 | 3300025921 | Bacteria | 860 |
| 253 | Ga0207694_10932473 | 3300025924 | Bacteria | 734 |
| 254 | Ga0207694_11606597 | 3300025924 | Bacteria | 548 |
| 255 | Ga0207687_10001297 | 3300025927 | Bacteria | 17042 |
| 256 | Ga0207687_10097629 | 3300025927 | Bacteria | 2155 |
| 257 | Ga0207687_10207911 | 3300025927 | Bacteria | 1534 |
| 258 | Ga0207700_10039060 | 3300025928 | Bacteria | 3451 |
| 259 | Ga0207664_10678625 | 3300025929 | Bacteria | 926 |
| 260 | Ga0207664_10882650 | 3300025929 | Bacteria | 803 |
| 261 | Ga0207644_10038155 | 3300025931 | Bacteria | 3382 |
| 262 | Ga0207644_11540196 | 3300025931 | Bacteria | 558 |
| 263 | Ga0207686_10259147 | 3300025934 | Bacteria | 1274 |
| 264 | Ga0207686_10913885 | 3300025934 | Bacteria | 709 |
| 265 | Ga0207669_10136376 | 3300025937 | Bacteria | 1696 |
| 266 | Ga0207669_11196727 | 3300025937 | Bacteria | 644 |
| 267 | Ga0207669_11419061 | 3300025937 | Bacteria | 591 |
| 268 | Ga0207669_11710850 | 3300025937 | Bacteria | 537 |
| 269 | Ga0207691_11043473 | 3300025940 | Bacteria | 681 |
| 270 | Ga0207689_10720537 | 3300025942 | Bacteria | 841 |
| 271 | Ga0207661_11824925 | 3300025944 | Bacteria | 554 |
| 272 | Ga0207712_10242554 | 3300025961 | Bacteria | 1452 |
| 273 | Ga0207712_11636553 | 3300025961 | Bacteria | 577 |
| 274 | Ga0207668_11120850 | 3300025972 | Bacteria | 706 |
| 275 | Ga0207658_10488939 | 3300025986 | Bacteria | 1095 |
| 276 | Ga0207658_10637560 | 3300025986 | Bacteria | 960 |
| 277 | Ga0207658_11408830 | 3300025986 | Bacteria | 638 |
| 278 | Ga0207677_12301124 | 3300026023 | Bacteria | 501 |
| 279 | Ga0207703_11090416 | 3300026035 | Bacteria | 767 |
| 280 | Ga0207708_10288803 | 3300026075 | Bacteria | 1331 |
| 281 | Ga0207708_10562541 | 3300026075 | Bacteria | 963 |
| 282 | Ga0207708_11362706 | 3300026075 | Bacteria | 622 |
| 283 | Ga0207702_10689435 | 3300026078 | Bacteria | 1006 |
| 284 | Ga0207676_10814303 | 3300026095 | Bacteria | 912 |
| 285 | Ga0207674_10893640 | 3300026116 | Bacteria | 856 |
| 286 | Ga0207674_11365990 | 3300026116 | Bacteria | 678 |
| 287 | Ga0207675_100098435 | 3300026118 | Bacteria | 2754 |
| 288 | Ga0207675_100619913 | 3300026118 | Bacteria | 1086 |
| 289 | Ga0207675_102661102 | 3300026118 | Bacteria | 509 |
| 290 | Ga0207698_10663423 | 3300026142 | Bacteria | 1034 |
| 291 | Ga0207698_10894014 | 3300026142 | Bacteria | 895 |
| 292 | Ga0207698_11962538 | 3300026142 | Bacteria | 600 |
| 293 | Ga0209983_1017203 | 3300027665 | Bacteria | 1495 |
| 294 | Ga0209998_10048650 | 3300027717 | Bacteria | 977 |
| 295 | Ga0209813_10102835 | 3300027866 | Bacteria | 974 |
| 296 | Ga0209813_10426505 | 3300027866 | Bacteria | 539 |
| 297 | Ga0209813_10453802 | 3300027866 | Bacteria | 525 |
| 298 | Ga0268264_11438524 | 3300028381 | Bacteria | 700 |
| 299 | Ga0265337_1098151 | 3300028556 | Bacteria | 798 |
| 300 | Ga0265336_10107662 | 3300028666 | Unclassified | 830 |
| 301 | Ga0307517_10361990 | 3300028786 | Bacteria | 783 |
| 302 | Ga0265338_10000474 | 3300028800 | Bacteria | 71713 |
| 303 | Ga0265338_10092624 | 3300028800 | Bacteria | 2492 |
| 304 | Ga0265762_1017921 | 3300030760 | Bacteria | 1291 |
| 305 | Ga0265762_1088324 | 3300030760 | Unclassified | 673 |
| 306 | Ga0265766_1019740 | 3300030863 | Bacteria | 548 |
| 307 | Ga0307408_101338105 | 3300031548 | Bacteria | 672 |
| 308 | Ga0307408_101545903 | 3300031548 | Bacteria | 629 |
| 309 | Ga0316575_10090209 | 3300031665 | Bacteria | 1241 |
| 310 | Ga0316579_10397336 | 3300031691 | Bacteria | 667 |
| 311 | Ga0316576_10015988 | 3300031727 | Bacteria | 5054 |
| 312 | Ga0316576_10042472 | 3300031727 | Bacteria | 3277 |
| 313 | Ga0316576_10187354 | 3300031727 | Bacteria | 1560 |
| 314 | Ga0316578_10007025 | 3300031728 | Bacteria | 5606 |
| 315 | Ga0316578_10024208 | 3300031728 | Bacteria | 3405 |
| 316 | Ga0316578_10769574 | 3300031728 | Bacteria | 559 |
| 317 | Ga0307405_10179244 | 3300031731 | Bacteria | 1520 |
| 318 | Ga0307405_12009303 | 3300031731 | Bacteria | 517 |
| 319 | Ga0316577_10001440 | 3300031733 | Bacteria | 11253 |
| 320 | Ga0316577_10030042 | 3300031733 | Bacteria | 3033 |
| 321 | Ga0307413_10166923 | 3300031824 | Bacteria | 1553 |
| 322 | Ga0307413_10622400 | 3300031824 | Bacteria | 886 |
| 323 | Ga0307413_11149443 | 3300031824 | Bacteria | 673 |
| 324 | Ga0307410_10043059 | 3300031852 | Bacteria | 2989 |
| 325 | Ga0307406_10537938 | 3300031901 | Bacteria | 954 |
| 326 | Ga0307407_10083806 | 3300031903 | Bacteria | 1935 |
| 327 | Ga0307407_10851567 | 3300031903 | Bacteria | 697 |
| 328 | Ga0307412_10164750 | 3300031911 | Bacteria | 1652 |
| 329 | Ga0307412_11555593 | 3300031911 | Bacteria | 603 |
| 330 | Ga0307409_100139052 | 3300031995 | Bacteria | 2089 |
| 331 | Ga0307409_101704193 | 3300031995 | Bacteria | 659 |
| 332 | Ga0307409_101837109 | 3300031995 | Bacteria | 635 |
| 333 | Ga0307416_100091597 | 3300032002 | Bacteria | 2612 |
| 334 | Ga0307416_101197140 | 3300032002 | Bacteria | 865 |
| 335 | Ga0307416_101377364 | 3300032002 | Bacteria | 811 |
| 336 | Ga0307414_11572274 | 3300032004 | Bacteria | 613 |
| 337 | Ga0307411_10103659 | 3300032005 | Bacteria | 2018 |
| 338 | Ga0307411_10282530 | 3300032005 | Bacteria | 1322 |
| 339 | Ga0307411_12198327 | 3300032005 | Bacteria | 517 |
| 340 | Ga0307415_100073176 | 3300032126 | Bacteria | 2417 |
| 341 | Ga0307415_100190735 | 3300032126 | Bacteria | 1617 |
| 342 | Ga0307415_101595301 | 3300032126 | Bacteria | 627 |
| 343 | Ga0316585_10223551 | 3300032137 | Bacteria | 623 |
| 344 | Ga0316580_10052859 | 3300032139 | Bacteria | 1251 |
| 345 | Ga0316593_10329262 | 3300032168 | Bacteria | 582 |
| 346 | Ga0316592_1036970 | 3300033524 | Bacteria | 1074 |
| 347 | Ga0316592_1152460 | 3300033524 | Bacteria | 545 |
| 348 | Ga0316586_1083426 | 3300033527 | Bacteria | 598 |
| 349 | Ga0316588_1144724 | 3300033528 | Bacteria | 608 |
| 350 | Ga0316596_1163374 | 3300033541 | Bacteria | 614 |
| 351 | Ga0316596_1180039 | 3300033541 | Bacteria | 585 |
| 352 | Ga0316596_1189388 | 3300033541 | Bacteria | 571 |
| 353 | Ga0373930_0001887 | 3300034816 | Bacteria | 3195 |
| 354 | Ga0373928_0001268 | 3300035084 | Bacteria | 4972 |
| 355 | Ga0373929_0000591 | 3300035085 | Bacteria | 7020 |
| 356 | Ga0373929_0154619 | 3300035085 | Bacteria | 617 |
| 357 | Ga0373944_0128090 | 3300035089 | Bacteria | 880 |
| 358 | Ga0373932_0001281 | 3300035112 | Bacteria | 7127 |
| 359 | Ga0373932_0063268 | 3300035112 | Bacteria | 1130 |
| 360 | Ga0373941_0500084 | 3300035115 | Bacteria | 517 |
| 361 | Ga0373945_0316781 | 3300035116 | Bacteria | 671 |
| 362 | Ga0373954_0307492 | 3300035118 | Bacteria | 782 |
| 363 | Ga0373943_0116354 | 3300035170 | Bacteria | 1416 |
| 364 | Ga0373943_0312263 | 3300035170 | Bacteria | 895 |
| 365 | Ga0373946_0580060 | 3300035171 | Bacteria | 580 |
| 366 | Ga0373955_0155501 | 3300035172 | Bacteria | 1347 |
| 367 | Ga0373962_0345757 | 3300035242 | Bacteria | 537 |
| 368 | Ga0316574_0011346 | 3300035398 | Bacteria | 5061 |
| 369 | Ga0316574_0282937 | 3300035398 | Bacteria | 1056 |
| 370 | Ga0316574_0347263 | 3300035398 | Bacteria | 939 |
| 371 | Ga0316574_0492133 | 3300035398 | Bacteria | 765 |
| 372 | Ga0316574_0646473 | 3300035398 | Bacteria | 651 |
| 373 | Ga0316574_0760696 | 3300035398 | Bacteria | 591 |
| 374 | Ga0373931_0000001 | 3300035691 | Bacteria | 634029 |
| 375 | Ga0373931_0000022 | 3300035691 | Bacteria | 137028 |
| 376 | Ga0373931_0562248 | 3300035691 | Bacteria | 742 |
| 377 | Ga0373931_1111611 | 3300035691 | Bacteria | 538 |
| 378 | Ga0373927_0031428 | 3300035695 | Bacteria | 3460 |
| 379 | Ga0373947_0076748 | 3300035725 | Bacteria | 2060 |
| 380 | Ga0373937_0042657 | 3300036401 | Bacteria | 4139 |
| 381 | Ga0373937_1628306 | 3300036401 | Bacteria | 593 |
| 382 | Ga0373937_1903212 | 3300036401 | Bacteria | 541 |
| 383 | Ga0316582_0074008 | 3300036647 | Bacteria | 2211 |
| 384 | Ga0316584_0000836 | 3300036712 | Bacteria | 17377 |
| 385 | Ga0316584_0007820 | 3300036712 | Bacteria | 7333 |
| 386 | Ga0316584_0069518 | 3300036712 | Bacteria | 2640 |
| 387 | Ga0316584_0723085 | 3300036712 | Bacteria | 681 |
| 388 | Ga0316584_0973403 | 3300036712 | Bacteria | 568 |
| 389 | Ga0316584_1139645 | 3300036712 | Bacteria | 516 |
| 390 | Ga0373925_0004578 | 3300037068 | Bacteria | 10453 |
| 391 | Ga0373925_0494241 | 3300037068 | Bacteria | 1004 |
| 392 | Ga0373925_0818717 | 3300037068 | Bacteria | 768 |
| 393 | Ga0395900_0022542 | 3300037418 | Bacteria | 6443 |
| 394 | Ga0395900_1609897 | 3300037418 | Bacteria | 561 |
| 395 | Ga0395905_0000007 | 3300037471 | Bacteria | 521849 |
| 396 | Ga0395905_0006434 | 3300037471 | Bacteria | 11825 |
| 397 | Ga0436364_0500701 | 3300037853 | Bacteria | 1203 |
| 398 | Ga0436364_0987458 | 3300037853 | Bacteria | 657 |
| 399 | Ga0395901_0746351 | 3300038443 | Bacteria | 972 |
| 400 | Ga0400485_18280 | 3300038735 | Bacteria | 3858 |
| 401 | Ga0400485_19625 | 3300038735 | Bacteria | 2620 |
| 402 | Ga0400483_035744 | 3300039062 | Bacteria | 1715 |
| 403 | Ga0400483_041924 | 3300039062 | Bacteria | 43934 |
| 404 | Ga0400483_044723 | 3300039062 | Bacteria | 10274 |
| 405 | Ga0400483_130587 | 3300039062 | Bacteria | 5814 |
| 406 | Ga0400483_164900 | 3300039062 | Bacteria | 35828 |
| 407 | Ga0400483_172438 | 3300039062 | Bacteria | 1023 |
| 408 | Ga0400483_211911 | 3300039062 | Bacteria | 5097 |
| 409 | Ga0400483_241099 | 3300039062 | Bacteria | 13144 |
| 410 | Ga0400483_262734 | 3300039062 | Bacteria | 5322 |
| 411 | Ga0400487_32587 | 3300039110 | Bacteria | 1508 |
| 412 | Ga0436365_0575180 | 3300039437 | Bacteria | 500 |
| 413 | Ga0436365_1602503 | 3300039437 | Bacteria | 11988 |
| 414 | Ga0436365_1603199 | 3300039437 | Bacteria | 1441 |
| 415 | Ga0436360_0999407 | 3300039438 | Bacteria | 1415 |
| 416 | Ga0436360_1009488 | 3300039438 | Bacteria | 1437 |
| 417 | Ga0436360_1039552 | 3300039438 | Bacteria | 905 |
| 418 | Ga0436361_0930879 | 3300039447 | Bacteria | 612 |
| 419 | Ga0436361_1017389 | 3300039447 | Bacteria | 676 |
| 420 | Ga0436363_1696032 | 3300039450 | Bacteria | 547 |
| 421 | Ga0436362_0573681 | 3300039453 | Bacteria | 2702 |
| 422 | Ga0436362_0882125 | 3300039453 | Bacteria | 3406 |
| 423 | Ga0439436_0016276 | 3300041404 | Bacteria | 2232 |
| 424 | Ga0439438_044338 | 3300041405 | Bacteria | 1146 |
| 425 | Ga0439447_085445 | 3300041407 | Bacteria | 727 |
| 426 | Ga0439453_0095971 | 3300041408 | Bacteria | 656 |
| 427 | Ga0439461_0029082 | 3300041410 | Bacteria | 1142 |
| 428 | Ga0439466_0081330 | 3300041411 | Bacteria | 1021 |
| 429 | Ga0439465_0021828 | 3300041413 | Bacteria | 2010 |
| 430 | Ga0439465_0099556 | 3300041413 | Bacteria | 1003 |
| 431 | Ga0451789_0323420 | 3300041443 | Bacteria | 505 |
| 432 | Ga0451791_0570806 | 3300041451 | Bacteria | 646 |
| 433 | Ga0451798_0082647 | 3300041458 | Bacteria | 704 |
| 434 | Ga0451807_1054893 | 3300041486 | Bacteria | 753 |
| 435 | Ga0451835_0171160 | 3300041492 | Bacteria | 692 |
| 436 | Ga0451835_0610512 | 3300041492 | Bacteria | 648 |
| 437 | Ga0451837_0313488 | 3300041494 | Bacteria | 1758 |
| 438 | Ga0451837_0490912 | 3300041494 | Bacteria | 1067 |
| 439 | Ga0451851_0647234 | 3300041507 | Bacteria | 548 |
| 440 | Ga0451843_0279339 | 3300041509 | Bacteria | 706 |
| 441 | Ga0451843_1737218 | 3300041509 | Bacteria | 546 |
| 442 | Ga0451855_0049369 | 3300041511 | Bacteria | 619 |
| 443 | Ga0451853_1052247 | 3300041512 | Bacteria | 1165 |
| 444 | Ga0451853_2024082 | 3300041512 | Bacteria | 544 |
| 445 | Ga0439431_0044634 | 3300041997 | Bacteria | 1137 |
| 446 | Ga0439441_098197 | 3300042001 | Bacteria | 654 |
| 447 | Ga0439443_028026 | 3300042003 | Bacteria | 917 |
| 448 | Ga0439445_0215847 | 3300042004 | Bacteria | 569 |
| 449 | Ga0439448_0009654 | 3300042005 | Bacteria | 2849 |
| 450 | Ga0439450_018538 | 3300042008 | Bacteria | 1463 |
| 451 | Ga0439451_049945 | 3300042009 | Bacteria | 838 |
| 452 | Ga0439452_033903 | 3300042010 | Bacteria | 1237 |
| 453 | Ga0439452_064622 | 3300042010 | Bacteria | 814 |
| 454 | Ga0439454_005383 | 3300042011 | Bacteria | 1526 |
| 455 | Ga0439455_0163356 | 3300042012 | Bacteria | 637 |
| 456 | Ga0439463_006807 | 3300042016 | Bacteria | 2824 |
| 457 | Ga0450905_085587 | 3300042142 | Bacteria | 552 |
| 458 | Ga0439446_0140849 | 3300042156 | Bacteria | 788 |
| 459 | Ga0439434_0004926 | 3300042435 | Bacteria | 3902 |
| 460 | Ga0439434_0016835 | 3300042435 | Bacteria | 2185 |
| 461 | Ga0439464_0003015 | 3300042439 | Bacteria | 4214 |
| 462 | Ga0439464_0271580 | 3300042439 | Bacteria | 550 |
| 463 | Ga0450901_015928 | 3300042533 | Bacteria | 792 |
| 464 | Ga0439440_0003475 | 3300042993 | Bacteria | 3036 |
| 465 | Ga0439440_0259250 | 3300042993 | Bacteria | 531 |
| 466 | Ga0466969_0062836 | 3300044656 | Bacteria | 1801 |
| 467 | Ga0466965_0631123 | 3300044683 | Bacteria | 610 |
| 468 | Ga0466966_0111492 | 3300044684 | Bacteria | 1686 |
| 469 | Ga0466966_0816974 | 3300044684 | Bacteria | 562 |
| 470 | Ga0466961_0152086 | 3300044693 | Bacteria | 1445 |
| 471 | Ga0466959_0855212 | 3300045049 | Bacteria | 607 |
| 472 | Ga0466958_0219504 | 3300045836 | Bacteria | 1213 |
| 473 | Ga0466958_0290882 | 3300045836 | Bacteria | 1048 |
| 474 | Ga0466958_1064496 | 3300045836 | Bacteria | 528 |
| 475 | Ga0466967_1820085 | 3300045976 | Bacteria | 606 |
| 476 | Ga0495603_0727564 | 3300046455 | Bacteria | 567 |
| 477 | Ga0495629_0152007 | 3300046459 | Bacteria | 1609 |
| 478 | Ga0495629_0153892 | 3300046459 | Bacteria | 1598 |
| 479 | Ga0495629_0344632 | 3300046459 | Bacteria | 1017 |
| 480 | Ga0495629_0933647 | 3300046459 | Bacteria | 567 |
| 481 | Ga0495629_1152098 | 3300046459 | Bacteria | 500 |
| 482 | Ga0495641_0259339 | 3300046461 | Bacteria | 782 |
| 483 | Ga0495641_0307255 | 3300046461 | Bacteria | 715 |
| 484 | Ga0495651_0040762 | 3300046462 | Bacteria | 3609 |
| 485 | Ga0495651_0411202 | 3300046462 | Bacteria | 881 |
| 486 | Ga0495653_0022957 | 3300046463 | Bacteria | 5045 |
| 487 | Ga0495653_0560691 | 3300046463 | Bacteria | 706 |
| 488 | Ga0495582_0146902 | 3300046473 | Bacteria | 1338 |
| 489 | Ga0495582_0488008 | 3300046473 | Bacteria | 712 |
| 490 | Ga0495582_0638483 | 3300046473 | Bacteria | 616 |
| 491 | Ga0495582_0844047 | 3300046473 | Bacteria | 530 |
| 492 | Ga0495662_0532100 | 3300046476 | Bacteria | 576 |
| 493 | Ga0495664_0767391 | 3300046477 | Bacteria | 568 |
| 494 | Ga0495608_0619465 | 3300046511 | Bacteria | 648 |
| 495 | Ga0495618_0763917 | 3300046514 | Bacteria | 565 |
| 496 | Ga0495628_0185841 | 3300046516 | Bacteria | 1570 |
| 497 | Ga0495628_0528869 | 3300046516 | Bacteria | 849 |
| 498 | Ga0495630_0062764 | 3300046517 | Bacteria | 2791 |
| 499 | Ga0495630_0576584 | 3300046517 | Bacteria | 863 |
| 500 | Ga0495630_0759359 | 3300046517 | Bacteria | 741 |
| 501 | Ga0495652_0467008 | 3300046529 | Bacteria | 881 |
| 502 | Ga0495652_0771256 | 3300046529 | Bacteria | 642 |
| 503 | Ga0495586_0005559 | 3300046535 | Bacteria | 6743 |
| 504 | Ga0495587_0010276 | 3300046536 | Bacteria | 5967 |
| 505 | Ga0495667_0003836 | 3300046559 | Bacteria | 10098 |
| 506 | Ga0495668_0435922 | 3300046616 | Bacteria | 721 |
| 507 | Ga0495634_0011499 | 3300046642 | Bacteria | 6438 |
| 508 | Ga0495634_0724840 | 3300046642 | Bacteria | 570 |
| 509 | Ga0495635_0263448 | 3300046663 | Bacteria | 1160 |
| 510 | Ga0495635_0339894 | 3300046663 | Bacteria | 1003 |
| 511 | Ga0495588_0417111 | 3300046674 | Bacteria | 705 |
| 512 | Ga0495657_0122267 | 3300046675 | Bacteria | 1638 |
| 513 | Ga0495599_0734234 | 3300046678 | Bacteria | 567 |
| 514 | Ga0495623_0036112 | 3300046679 | Bacteria | 3167 |
| 515 | Ga0495647_0185539 | 3300046681 | Bacteria | 907 |
| 516 | Ga0495647_0432047 | 3300046681 | Bacteria | 608 |
| 517 | Ga0495658_0035790 | 3300046683 | Bacteria | 2735 |
| 518 | Ga0495658_0185667 | 3300046683 | Bacteria | 1291 |
| 519 | Ga0495613_0000239 | 3300046689 | Bacteria | 52322 |
| 520 | Ga0495613_0156711 | 3300046689 | Bacteria | 1622 |
| 521 | Ga0495624_0553907 | 3300046690 | Bacteria | 687 |
| 522 | Ga0495581_0427190 | 3300047315 | Bacteria | 772 |
| 523 | Ga0495604_0103385 | 3300047317 | Bacteria | 2090 |
| 524 | Ga0495604_1057029 | 3300047317 | Bacteria | 500 |
| 525 | Ga0495672_0000785 | 3300047320 | Bacteria | 34425 |
| 526 | Ga0495672_0159553 | 3300047320 | Bacteria | 1161 |
| 527 | Ga0495676_0280111 | 3300047321 | Bacteria | 1129 |
| 528 | Ga0495676_0439902 | 3300047321 | Bacteria | 861 |
| 529 | Ga0495680_0159608 | 3300047322 | Bacteria | 1638 |
| 530 | Ga0495680_0202935 | 3300047322 | Bacteria | 1422 |
| 531 | Ga0495680_0491195 | 3300047322 | Bacteria | 834 |
| 532 | Ga0495675_0078564 | 3300047444 | Bacteria | 2078 |
| 533 | Ga0495675_0805335 | 3300047444 | Bacteria | 520 |
| 534 | Ga0495684_0140370 | 3300047471 | Bacteria | 1812 |
| 535 | Ga0495602_0391754 | 3300048088 | Bacteria | 993 |
| 536 | Ga0495602_1138285 | 3300048088 | Bacteria | 510 |
| 537 | Ga0495614_0035750 | 3300048089 | Bacteria | 2134 |
| 538 | Ga0495614_0187610 | 3300048089 | Bacteria | 932 |
| 539 | Ga0496100_0603265 | 3300048903 | Bacteria | 853 |
| 540 | Ga0496101_0584831 | 3300048904 | Bacteria | 883 |
| 541 | Ga0496102_0599935 | 3300048905 | Bacteria | 1024 |
| 542 | Ga0496103_0395483 | 3300048906 | Bacteria | 888 |
| 543 | Ga0496104_0185724 | 3300048907 | Bacteria | 1990 |
| 544 | Ga0496104_1071685 | 3300048907 | Bacteria | 710 |
| 545 | Ga0496104_1189774 | 3300048907 | Bacteria | 665 |
| 546 | Ga0496104_1264840 | 3300048907 | Bacteria | 641 |
| 547 | Ga0496105_0588620 | 3300048908 | Bacteria | 865 |
| 548 | Ga0496106_1120260 | 3300048909 | Bacteria | 616 |
| 549 | Ga0496108_0056403 | 3300048911 | Bacteria | 3301 |
| 550 | Ga0496108_0446543 | 3300048911 | Bacteria | 1130 |
| 551 | Ga0496108_1213344 | 3300048911 | Bacteria | 637 |
| 552 | Ga0496109_0161568 | 3300048912 | Bacteria | 2099 |
| 553 | Ga0496109_0362602 | 3300048912 | Bacteria | 1369 |
| 554 | Ga0496109_0807624 | 3300048912 | Bacteria | 876 |
| 555 | Ga0496109_1013595 | 3300048912 | Bacteria | 768 |
| 556 | Ga0496109_1860099 | 3300048912 | Bacteria | 535 |
| 557 | Ga0496110_0147681 | 3300048913 | Bacteria | 2128 |
| 558 | Ga0496110_0308210 | 3300048913 | Bacteria | 1442 |
| 559 | Ga0496110_0392609 | 3300048913 | Bacteria | 1265 |
| 560 | Ga0496112_1111614 | 3300048915 | Bacteria | 708 |
| 561 | Ga0496112_1730185 | 3300048915 | Bacteria | 538 |
| 562 | Ga0496113_0167885 | 3300048916 | Bacteria | 1737 |
| 563 | Ga0496113_1048819 | 3300048916 | Bacteria | 641 |
| 564 | Ga0496114_0288111 | 3300048917 | Bacteria | 1449 |
| 565 | Ga0496114_0552586 | 3300048917 | Bacteria | 1017 |
| 566 | Ga0496114_0773764 | 3300048917 | Bacteria | 838 |
| 567 | Ga0496114_0807036 | 3300048917 | Bacteria | 817 |
| 568 | Ga0496114_0896667 | 3300048917 | Bacteria | 768 |
| 569 | Ga0501031_0044900 | 3300049568 | Bacteria | 2884 |
| 570 | Ga0501031_0190847 | 3300049568 | Bacteria | 1338 |
| 571 | Ga0501031_0227059 | 3300049568 | Bacteria | 1215 |
| 572 | Ga0501032_0022556 | 3300049569 | Bacteria | 4363 |
| 573 | Ga0501032_0168272 | 3300049569 | Bacteria | 1438 |
| 574 | Ga0501033_0001944 | 3300049570 | Bacteria | 17985 |
| 575 | Ga0501033_0027002 | 3300049570 | Bacteria | 4318 |
| 576 | Ga0501033_0574636 | 3300049570 | Bacteria | 775 |
| 577 | Ga0501033_0600183 | 3300049570 | Bacteria | 755 |
| 578 | Ga0501033_0696933 | 3300049570 | Bacteria | 691 |
| 579 | Ga0501033_0859619 | 3300049570 | Bacteria | 611 |
| 580 | Ga0501034_0000666 | 3300049571 | Bacteria | 52372 |
| 581 | Ga0501034_0000723 | 3300049571 | Bacteria | 50099 |
| 582 | Ga0501034_0095563 | 3300049571 | Bacteria | 2968 |
| 583 | Ga0501034_0157225 | 3300049571 | Bacteria | 2246 |
| 584 | Ga0501034_0377291 | 3300049571 | Bacteria | 1343 |
| 585 | Ga0501034_0755766 | 3300049571 | Bacteria | 867 |
| 586 | Ga0501034_0958494 | 3300049571 | Bacteria | 741 |
| 587 | Ga0501034_1559769 | 3300049571 | Bacteria | 534 |
| 588 | Ga0501036_0131343 | 3300049572 | Bacteria | 2114 |
| 589 | Ga0501036_0175594 | 3300049572 | Bacteria | 1804 |
| 590 | Ga0501036_0270763 | 3300049572 | Bacteria | 1422 |
| 591 | Ga0501036_0322265 | 3300049572 | Bacteria | 1291 |
| 592 | Ga0501036_0829254 | 3300049572 | Bacteria | 761 |
| 593 | Ga0501036_1469802 | 3300049572 | Bacteria | 552 |
| 594 | Ga0501036_1641915 | 3300049572 | Bacteria | 518 |
| 595 | Ga0501037_0001329 | 3300049573 | Bacteria | 18154 |
| 596 | Ga0501037_0021962 | 3300049573 | Bacteria | 4725 |
| 597 | Ga0501037_0036090 | 3300049573 | Bacteria | 3644 |
| 598 | Ga0501037_1061893 | 3300049573 | Bacteria | 526 |
| 599 | Ga0501038_0013014 | 3300049574 | Bacteria | 7587 |
| 600 | Ga0501038_0558997 | 3300049574 | Bacteria | 869 |
| 601 | Ga0501038_0656242 | 3300049574 | Bacteria | 789 |
| 602 | Ga0501038_0787459 | 3300049574 | Bacteria | 707 |
| 603 | Ga0501039_0021598 | 3300049575 | Bacteria | 4938 |
| 604 | Ga0501039_0116514 | 3300049575 | Bacteria | 2091 |
| 605 | Ga0501039_0142200 | 3300049575 | Bacteria | 1885 |
| 606 | Ga0501039_0272112 | 3300049575 | Bacteria | 1331 |
| 607 | Ga0501039_0319675 | 3300049575 | Bacteria | 1220 |
| 608 | Ga0501040_0002361 | 3300049576 | Bacteria | 12119 |
| 609 | Ga0501040_0037530 | 3300049576 | Bacteria | 3292 |
| 610 | Ga0501040_0179095 | 3300049576 | Bacteria | 1502 |
| 611 | Ga0501040_0315028 | 3300049576 | Bacteria | 1119 |
| 612 | Ga0501040_1006100 | 3300049576 | Bacteria | 604 |
| 613 | Ga0501041_0012177 | 3300049577 | Bacteria | 5094 |
| 614 | Ga0501041_0068902 | 3300049577 | Bacteria | 2169 |
| 615 | Ga0501041_0266706 | 3300049577 | Bacteria | 1077 |
| 616 | Ga0501041_0738147 | 3300049577 | Bacteria | 631 |
| 617 | Ga0501042_0024505 | 3300049578 | Bacteria | 4232 |
| 618 | Ga0501042_0028809 | 3300049578 | Bacteria | 3917 |
| 619 | Ga0501042_0305834 | 3300049578 | Bacteria | 1148 |
| 620 | Ga0501042_0308021 | 3300049578 | Bacteria | 1144 |
| 621 | Ga0501042_0440303 | 3300049578 | Bacteria | 945 |
| 622 | Ga0501042_1424257 | 3300049578 | Bacteria | 505 |
| 623 | Ga0501042_1438933 | 3300049578 | Bacteria | 503 |
| 624 | Ga0501043_0007961 | 3300049579 | Bacteria | 8372 |
| 625 | Ga0501043_0237836 | 3300049579 | Bacteria | 1405 |
| 626 | Ga0501043_0557315 | 3300049579 | Bacteria | 851 |
| 627 | Ga0501046_0051785 | 3300049580 | Bacteria | 3238 |
| 628 | Ga0501046_0119658 | 3300049580 | Bacteria | 2005 |
| 629 | Ga0501046_0522081 | 3300049580 | Bacteria | 849 |
| 630 | Ga0501047_0125874 | 3300049581 | Bacteria | 2443 |
| 631 | Ga0501047_0544965 | 3300049581 | Bacteria | 985 |
| 632 | Ga0501047_0753710 | 3300049581 | Bacteria | 790 |
| 633 | Ga0501048_0033877 | 3300049582 | Bacteria | 3688 |
| 634 | Ga0501048_0633896 | 3300049582 | Bacteria | 767 |
| 635 | Ga0501048_1242708 | 3300049582 | Bacteria | 536 |
| 636 | Ga0501067_0003698 | 3300049583 | Bacteria | 8425 |
| 637 | Ga0501067_0045695 | 3300049583 | Bacteria | 2431 |
| 638 | Ga0501067_0079615 | 3300049583 | Bacteria | 1816 |
| 639 | Ga0501068_0000098 | 3300049584 | Bacteria | 37486 |
| 640 | Ga0501068_0029803 | 3300049584 | Bacteria | 3234 |
| 641 | Ga0501068_0118569 | 3300049584 | Bacteria | 1649 |
| 642 | Ga0501068_0184925 | 3300049584 | Bacteria | 1318 |
| 643 | Ga0501068_0487409 | 3300049584 | Bacteria | 799 |
| 644 | Ga0501068_0714304 | 3300049584 | Bacteria | 655 |
| 645 | Ga0501068_0732288 | 3300049584 | Bacteria | 647 |
| 646 | Ga0501068_1194632 | 3300049584 | Bacteria | 504 |
| 647 | Ga0501069_0000044 | 3300049585 | Bacteria | 75705 |
| 648 | Ga0501069_0009790 | 3300049585 | Bacteria | 5067 |
| 649 | Ga0501069_0012202 | 3300049585 | Bacteria | 4565 |
| 650 | Ga0501069_0212172 | 3300049585 | Bacteria | 1124 |
| 651 | Ga0501069_0414867 | 3300049585 | Bacteria | 798 |
| 652 | Ga0501069_0549518 | 3300049585 | Bacteria | 691 |
| 653 | Ga0501070_0000001 | 3300049586 | Bacteria | 519187 |
| 654 | Ga0501070_0007332 | 3300049586 | Bacteria | 9363 |
| 655 | Ga0501070_0020200 | 3300049586 | Bacteria | 5588 |
| 656 | Ga0501070_0475456 | 3300049586 | Bacteria | 1006 |
| 657 | Ga0501071_0018635 | 3300049587 | Bacteria | 4810 |
| 658 | Ga0501071_0022391 | 3300049587 | Bacteria | 4406 |
| 659 | Ga0501071_0115980 | 3300049587 | Bacteria | 1982 |
| 660 | Ga0501071_0232931 | 3300049587 | Bacteria | 1388 |
| 661 | Ga0501071_0301444 | 3300049587 | Bacteria | 1215 |
| 662 | Ga0501071_0385119 | 3300049587 | Bacteria | 1070 |
| 663 | Ga0501071_0430775 | 3300049587 | Bacteria | 1008 |
| 664 | Ga0501071_1050866 | 3300049587 | Bacteria | 629 |
| 665 | Ga0501072_0003214 | 3300049588 | Bacteria | 12270 |
| 666 | Ga0501072_0007967 | 3300049588 | Bacteria | 8040 |
| 667 | Ga0501072_0060274 | 3300049588 | Bacteria | 2992 |
| 668 | Ga0501072_0101145 | 3300049588 | Bacteria | 2291 |
| 669 | Ga0501072_0173913 | 3300049588 | Bacteria | 1718 |
| 670 | Ga0501072_0647302 | 3300049588 | Bacteria | 832 |
| 671 | Ga0501072_0672592 | 3300049588 | Bacteria | 814 |
| 672 | Ga0501072_0769203 | 3300049588 | Bacteria | 755 |
| 673 | Ga0501073_0001297 | 3300049589 | Bacteria | 18365 |
| 674 | Ga0501073_0024702 | 3300049589 | Bacteria | 4314 |
| 675 | Ga0501073_0313607 | 3300049589 | Bacteria | 1082 |
| 676 | Ga0501073_1005569 | 3300049589 | Bacteria | 574 |
| 677 | Ga0501073_1240907 | 3300049589 | Bacteria | 511 |
| 678 | Ga0501074_0000333 | 3300049590 | Bacteria | 27445 |
| 679 | Ga0501074_0052506 | 3300049590 | Bacteria | 2943 |
| 680 | Ga0501074_0063498 | 3300049590 | Bacteria | 2660 |
| 681 | Ga0501074_0074240 | 3300049590 | Bacteria | 2442 |
| 682 | Ga0501074_0074367 | 3300049590 | Bacteria | 2440 |
| 683 | Ga0501074_0080338 | 3300049590 | Bacteria | 2340 |
| 684 | Ga0501074_0154350 | 3300049590 | Bacteria | 1641 |
| 685 | Ga0501075_0036644 | 3300049591 | Bacteria | 3662 |
| 686 | Ga0501075_0040524 | 3300049591 | Bacteria | 3488 |
| 687 | Ga0501075_0205791 | 3300049591 | Bacteria | 1501 |
| 688 | Ga0501075_0332280 | 3300049591 | Bacteria | 1158 |
| 689 | Ga0501075_0859084 | 3300049591 | Bacteria | 690 |
| 690 | Ga0501075_1475047 | 3300049591 | Bacteria | 515 |
| 691 | Ga0501076_0002575 | 3300049592 | Bacteria | 12469 |
| 692 | Ga0501076_0079570 | 3300049592 | Bacteria | 2630 |
| 693 | Ga0501076_0153094 | 3300049592 | Bacteria | 1876 |
| 694 | Ga0501076_0276981 | 3300049592 | Bacteria | 1374 |
| 695 | Ga0501076_0429255 | 3300049592 | Bacteria | 1088 |
| 696 | Ga0501076_1102197 | 3300049592 | Bacteria | 654 |
| 697 | Ga0501076_1539431 | 3300049592 | Bacteria | 546 |
| 698 | Ga0501077_0024932 | 3300049593 | Bacteria | 3798 |
| 699 | Ga0501077_0026413 | 3300049593 | Bacteria | 3685 |
| 700 | Ga0501077_0611066 | 3300049593 | Bacteria | 700 |
| 701 | Ga0501079_0004476 | 3300049741 | Bacteria | 10364 |
| 702 | Ga0501079_0030769 | 3300049741 | Bacteria | 4125 |
| 703 | Ga0501079_0117657 | 3300049741 | Bacteria | 2066 |
| 704 | Ga0501079_0314780 | 3300049741 | Bacteria | 1225 |
| 705 | Ga0501079_1207667 | 3300049741 | Bacteria | 596 |
| 706 | Ga0501079_1483254 | 3300049741 | Bacteria | 534 |
| 707 | Ga0501079_1556857 | 3300049741 | Bacteria | 520 |
| 708 | Ga0501080_0006808 | 3300049742 | Bacteria | 10305 |
| 709 | Ga0501080_0012513 | 3300049742 | Bacteria | 7782 |
| 710 | Ga0501080_0017310 | 3300049742 | Bacteria | 6662 |
| 711 | Ga0501080_0135968 | 3300049742 | Bacteria | 2275 |
| 712 | Ga0501080_0240745 | 3300049742 | Bacteria | 1651 |
| 713 | Ga0501080_0667782 | 3300049742 | Bacteria | 918 |
| 714 | Ga0501080_1799368 | 3300049742 | Bacteria | 515 |
| 715 | Ga0501081_0048001 | 3300049743 | Bacteria | 2937 |
| 716 | Ga0501081_0667354 | 3300049743 | Bacteria | 780 |
| 717 | Ga0501083_0000154 | 3300049744 | Bacteria | 45503 |
| 718 | Ga0501083_0024299 | 3300049744 | Bacteria | 4199 |
| 719 | Ga0501083_0045673 | 3300049744 | Bacteria | 2963 |
| 720 | Ga0501083_0053285 | 3300049744 | Bacteria | 2716 |
| 721 | Ga0501083_0371774 | 3300049744 | Bacteria | 930 |
| 722 | Ga0501083_0451807 | 3300049744 | Bacteria | 836 |
| 723 | Ga0501035_0186752 | 3300049822 | Bacteria | 1784 |
| 724 | Ga0501035_0282450 | 3300049822 | Bacteria | 1403 |
| 725 | Ga0501035_0485201 | 3300049822 | Bacteria | 1019 |
| 726 | Ga0501035_0725118 | 3300049822 | Bacteria | 800 |
| 727 | Ga0501035_1035463 | 3300049822 | Bacteria | 644 |
| 728 | Ga0501044_0003702 | 3300049823 | Bacteria | 17189 |
| 729 | Ga0501044_0195036 | 3300049823 | Bacteria | 1986 |
| 730 | Ga0501044_0202897 | 3300049823 | Bacteria | 1940 |
| 731 | Ga0501044_1131417 | 3300049823 | Bacteria | 652 |
| 732 | Ga0501045_0002942 | 3300049824 | Bacteria | 11648 |
| 733 | Ga0501045_0249423 | 3300049824 | Bacteria | 1321 |
| 734 | Ga0501045_0614074 | 3300049824 | Bacteria | 805 |
| 735 | Ga0501045_1196664 | 3300049824 | Bacteria | 554 |
| 736 | nmdc:mga03683_22620_c1 | 3300050489 | Bacteria | 2049 |
| 737 | nmdc:mga03683_319695_c1 | 3300050489 | Bacteria | 730 |
| 738 | nmdc:mga03683_338454_c1 | 3300050489 | Bacteria | 710 |
| 739 | nmdc:mga03683_630528_c1 | 3300050489 | Bacteria | 526 |
| 740 | nmdc:mga03n38_146764_c1 | 3300050490 | Bacteria | 1183 |
| 741 | nmdc:mga03n38_279749_c1 | 3300050490 | Bacteria | 890 |
| 742 | nmdc:mga03n38_307875_c1 | 3300050490 | Bacteria | 852 |
| 743 | nmdc:mga03n38_393214_c1 | 3300050490 | Bacteria | 762 |
| 744 | nmdc:mga03n38_848994_c1 | 3300050490 | Bacteria | 534 |
| 745 | nmdc:mga03n38_93673_c1 | 3300050490 | Bacteria | 1435 |
| 746 | nmdc:mga03n38_954088_c1 | 3300050490 | Bacteria | 506 |
| 747 | nmdc:mga00v17_204305_c1 | 3300050491 | Bacteria | 1277 |
| 748 | nmdc:mga00v17_267005_c1 | 3300050491 | Bacteria | 1110 |
| 749 | nmdc:mga00v17_270423_c1 | 3300050491 | Bacteria | 1103 |
| 750 | nmdc:mga00v17_273816_c1 | 3300050491 | Bacteria | 1095 |
| 751 | nmdc:mga00v17_40994_c1 | 3300050491 | Bacteria | 2779 |
| 752 | nmdc:mga00v17_507359_c1 | 3300050491 | Bacteria | 781 |
| 753 | nmdc:mga00v17_7843_c1 | 3300050491 | Bacteria | 5725 |
| 754 | nmdc:mga00v17_896190_c1 | 3300050491 | Bacteria | 562 |
| 755 | nmdc:mga00v17_9780_c1 | 3300050491 | Bacteria | 5208 |
| 756 | nmdc:mga0yw44_105983_c1 | 3300050492 | Bacteria | 1796 |
| 757 | nmdc:mga0yw44_1093801_c1 | 3300050492 | Bacteria | 539 |
| 758 | nmdc:mga0yw44_160570_c1 | 3300050492 | Bacteria | 1471 |
| 759 | nmdc:mga0yw44_180717_c1 | 3300050492 | Bacteria | 1388 |
| 760 | nmdc:mga0yw44_232880_c1 | 3300050492 | Bacteria | 1223 |
| 761 | nmdc:mga0yw44_3611_c1 | 3300050492 | Bacteria | 6900 |
| 762 | nmdc:mga0yw44_375796_c1 | 3300050492 | Bacteria | 959 |
| 763 | nmdc:mga0yw44_636268_c1 | 3300050492 | Bacteria | 725 |
| 764 | nmdc:mga0yw44_83427_c1 | 3300050492 | Bacteria | 2007 |
| 765 | nmdc:mga0yw44_8482_c2 | 3300050492 | Bacteria | 2851 |
| 766 | nmdc:mga0yw44_879653_c1 | 3300050492 | Bacteria | 608 |
| 767 | nmdc:mga0yw44_973317_c1 | 3300050492 | Bacteria | 575 |
| 768 | nmdc:mga06z11_470119_c1 | 3300050494 | Bacteria | 761 |
| 769 | nmdc:mga06z11_55458_c1 | 3300050494 | Bacteria | 2046 |
| 770 | nmdc:mga06z11_67387_c1 | 3300050494 | Bacteria | 1884 |
| 771 | nmdc:mga04h51_256637_c1 | 3300050495 | Bacteria | 702 |
| 772 | nmdc:mga04h51_462409_c1 | 3300050495 | Bacteria | 538 |
| 773 | nmdc:mga04h51_487974_c1 | 3300050495 | Bacteria | 525 |
| 774 | nmdc:mga04h51_90142_c1 | 3300050495 | Bacteria | 1102 |
| 775 | nmdc:mga07m45_234186_c1 | 3300050496 | Bacteria | 1068 |
| 776 | nmdc:mga07m45_256002_c1 | 3300050496 | Bacteria | 1018 |
| 777 | nmdc:mga05p37_352276_c1 | 3300050507 | Bacteria | 1733 |
| 778 | nmdc:mga05p37_455123_c1 | 3300050507 | Bacteria | 1480 |
| 779 | nmdc:mga05p37_6515_c1 | 3300050507 | Bacteria | 13774 |
| 780 | nmdc:mga05p37_7437_c2 | 3300050507 | Bacteria | 10878 |
| 781 | nmdc:mga05p37_89598_c1 | 3300050507 | Bacteria | 3791 |
| 782 | nmdc:mga09592_2389_c1 | 3300050508 | Bacteria | 15165 |
| 783 | nmdc:mga09592_490308_c1 | 3300050508 | Bacteria | 1058 |
| 784 | nmdc:mga09592_593635_c1 | 3300050508 | Bacteria | 949 |
| 785 | nmdc:mga0qj67_163592_c1 | 3300050509 | Bacteria | 1806 |
| 786 | nmdc:mga0qj67_169276_c1 | 3300050509 | Bacteria | 1774 |
| 787 | nmdc:mga0qj67_355247_c1 | 3300050509 | Bacteria | 1185 |
| 788 | nmdc:mga0qj67_613619_c1 | 3300050509 | Bacteria | 869 |
| 789 | nmdc:mga0qj67_98683_c1 | 3300050509 | Bacteria | 2353 |
| 790 | nmdc:mga06r32_142969_c1 | 3300050510 | Bacteria | 2370 |
| 791 | nmdc:mga06r32_1526743_c1 | 3300050510 | Bacteria | 608 |
| 792 | nmdc:mga06r32_24152_c1 | 3300050510 | Bacteria | 5637 |
| 793 | nmdc:mga06r32_49104_c1 | 3300050510 | Bacteria | 4035 |
| 794 | nmdc:mga06r32_52214_c1 | 3300050510 | Bacteria | 3915 |
| 795 | nmdc:mga08y16_1076181_c1 | 3300050511 | Bacteria | 780 |
| 796 | nmdc:mga08y16_640105_c1 | 3300050511 | Bacteria | 1068 |
| 797 | nmdc:mga0n895_1372021_c1 | 3300050512 | Bacteria | 676 |
| 798 | nmdc:mga0rr50_1043450_c1 | 3300050513 | Bacteria | 696 |
| 799 | Ga0495601_0110026 | 3300053077 | Bacteria | 1784 |
| 800 | Ga0495601_0236892 | 3300053077 | Bacteria | 1192 |
| 801 | Ga0495612_0387843 | 3300053078 | Bacteria | 634 |
| 802 | Ga0495595_0252104 | 3300053084 | Bacteria | 884 |
| 803 | Ga0495595_0289116 | 3300053084 | Bacteria | 824 |
| 804 | Ga0495595_0363367 | 3300053084 | Bacteria | 731 |
| 805 | Ga0500583_0110976 | 3300053092 | Bacteria | 1351 |
| 806 | Ga0500566_0000098 | 3300053094 | Bacteria | 43891 |
| 807 | Ga0500593_193474 | 3300053117 | Bacteria | 742 |
| 808 | Ga0500564_302506 | 3300053138 | Bacteria | 613 |
| 809 | Ga0500568_0000182 | 3300053139 | Bacteria | 55216 |
| 810 | Ga0500603_246643 | 3300053150 | Bacteria | 574 |
| 811 | Ga0500616_0048061 | 3300053153 | Bacteria | 2263 |
| 812 | Ga0501084_0004656 | 3300054114 | Bacteria | 11196 |
| 813 | Ga0501084_0027474 | 3300054114 | Bacteria | 4754 |
| 814 | Ga0501084_0268354 | 3300054114 | Bacteria | 1441 |
| 815 | Ga0501084_0305235 | 3300054114 | Bacteria | 1344 |
| 816 | Ga0501084_0507985 | 3300054114 | Bacteria | 1019 |
| 817 | Ga0501084_0796754 | 3300054114 | Bacteria | 796 |
| 818 | Ga0501084_0924940 | 3300054114 | Bacteria | 733 |
| 819 | Ga0501084_1084435 | 3300054114 | Bacteria | 672 |
| 820 | Ga0501084_1278483 | 3300054114 | Bacteria | 615 |
| 821 | Ga0501084_1525640 | 3300054114 | Bacteria | 559 |
| 822 | Ga0590071_218751 | 3300059421 | Bacteria | 503 |
| 823 | Ga0587125_075748 | 3300059607 | Bacteria | 515 |
| 824 | Ga0587128_073125 | 3300059630 | Bacteria | 671 |
| 825 | Ga0587107_069996 | 3300059652 | Bacteria | 638 |
| 826 | Ga0587111_0186347 | 3300060346 | Bacteria | 580 |
| 827 | Ga0501082_0036497 | 3300060353 | Bacteria | 4234 |
| 828 | Ga0501082_0078741 | 3300060353 | Bacteria | 2843 |
| 829 | Ga0501082_0353740 | 3300060353 | Bacteria | 1281 |
| 830 | Ga0501082_0477484 | 3300060353 | Bacteria | 1090 |
| 831 | Ga0501082_0506996 | 3300060353 | Bacteria | 1055 |
| 832 | Ga0501082_0620882 | 3300060353 | Bacteria | 946 |
| 833 | Ga0501082_1016097 | 3300060353 | Bacteria | 725 |
| 834 | Ga0501082_1048330 | 3300060353 | Bacteria | 713 |
| 835 | Ga0501082_1244564 | 3300060353 | Bacteria | 650 |
| 836 | Ga0501082_1976253 | 3300060353 | Bacteria | 508 |
| 837 | Ga0501082_1983771 | 3300060353 | Bacteria | 507 |
| 838 | Ga0466962_0749561 | 3300061719 | Bacteria | 502 |
| 839 | Ga0530510_0021851 | 3300061734 | Bacteria | 4554 |
| 840 | Ga0530510_0170452 | 3300061734 | Bacteria | 1612 |
| 841 | Ga0530510_0745595 | 3300061734 | Bacteria | 747 |
| 842 | Ga0530510_0853216 | 3300061734 | Bacteria | 695 |
| 843 | Ga0530510_0999835 | 3300061734 | Bacteria | 640 |
| 844 | Ga0530510_1450423 | 3300061734 | Bacteria | 527 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005578 | Ga0068854_100459404 | Ga0068854_1004594042 | 81 |
| 2 | 3300005719 | Ga0068861_102466385 | Ga0068861_1024663852 | 81 |
| 3 | 3300009553 | Ga0105249_12748873 | Ga0105249_127488732 | 81 |
| 4 | 3300020069 | Ga0197907_10137062 | Ga0197907_101370622 | 81 |
| 5 | 3300020070 | Ga0206356_10416685 | Ga0206356_104166852 | 81 |
| 6 | 3300020080 | Ga0206350_11354471 | Ga0206350_113544711 | 81 |
| 7 | 3300020082 | Ga0206353_11556319 | Ga0206353_115563192 | 81 |
| 8 | 3300021384 | Ga0213876_10122461 | Ga0213876_101224612 | 81 |
| 9 | 3300022467 | Ga0224712_10250171 | Ga0224712_102501712 | 81 |
| 10 | 3300039437 | Ga0436365_1603199 | Ga0436365_1603199_768_1028 | 81 |
| 11 | 3300039453 | Ga0436362_0573681 | Ga0436362_0573681_1849_2109 | 81 |
| 12 | 3300041509 | Ga0451843_1737218 | Ga0451843_1737218_269_523 | 81 |
| 13 | 3300045049 | Ga0466959_0855212 | Ga0466959_0855212_142_396 | 81 |
| 14 | 3300045836 | Ga0466958_0290882 | Ga0466958_0290882_525_779 | 81 |
| 15 | 3300006028 | Ga0070717_10733769 | Ga0070717_107337692 | 82 |
| 16 | 3300009094 | Ga0111539_11027103 | Ga0111539_110271032 | 82 |
| 17 | 3300009147 | Ga0114129_10364110 | Ga0114129_103641102 | 82 |
| 18 | 3300009177 | Ga0105248_11063535 | Ga0105248_110635353 | 82 |
| 19 | 3300004799 | Ga0058863_11585879 | Ga0058863_115858791 | 83 |
| 20 | 3300005355 | Ga0070671_100878342 | Ga0070671_1008783421 | 83 |
| 21 | 3300005367 | Ga0070667_100363602 | Ga0070667_1003636022 | 83 |
| 22 | 3300005436 | Ga0070713_101615909 | Ga0070713_1016159092 | 83 |
| 23 | 3300005441 | Ga0070700_100412032 | Ga0070700_1004120322 | 83 |
| 24 | 3300005444 | Ga0070694_101419629 | Ga0070694_1014196291 | 83 |
| 25 | 3300005467 | Ga0070706_100263522 | Ga0070706_1002635222 | 83 |
| 26 | 3300005518 | Ga0070699_100084446 | Ga0070699_1000844463 | 83 |
| 27 | 3300005536 | Ga0070697_101036572 | Ga0070697_1010365721 | 83 |
| 28 | 3300005544 | Ga0070686_101493663 | Ga0070686_1014936632 | 83 |
| 29 | 3300005617 | Ga0068859_101029810 | Ga0068859_1010298101 | 83 |
| 30 | 3300005842 | Ga0068858_100667069 | Ga0068858_1006670692 | 83 |
| 31 | 3300005843 | Ga0068860_101601005 | Ga0068860_1016010051 | 83 |
| 32 | 3300006038 | Ga0075365_10007031 | Ga0075365_100070313 | 83 |
| 33 | 3300006038 | Ga0075365_10197118 | Ga0075365_101971182 | 83 |
| 34 | 3300006038 | Ga0075365_10300961 | Ga0075365_103009612 | 83 |
| 35 | 3300006038 | Ga0075365_10880009 | Ga0075365_108800091 | 83 |
| 36 | 3300006048 | Ga0075363_100248941 | Ga0075363_1002489412 | 83 |
| 37 | 3300006048 | Ga0075363_101022817 | Ga0075363_1010228172 | 83 |
| 38 | 3300006051 | Ga0075364_10010043 | Ga0075364_100100434 | 83 |
| 39 | 3300006051 | Ga0075364_10045406 | Ga0075364_100454062 | 83 |
| 40 | 3300006051 | Ga0075364_10330829 | Ga0075364_103308293 | 83 |
| 41 | 3300006051 | Ga0075364_10500995 | Ga0075364_105009951 | 83 |
| 42 | 3300006177 | Ga0075362_10094242 | Ga0075362_100942423 | 83 |
| 43 | 3300006178 | Ga0075367_10264238 | Ga0075367_102642381 | 83 |
| 44 | 3300006178 | Ga0075367_10791527 | Ga0075367_107915271 | 83 |
| 45 | 3300006353 | Ga0075370_10598358 | Ga0075370_105983581 | 83 |
| 46 | 3300006844 | Ga0075428_100000395 | Ga0075428_10000039521 | 83 |
| 47 | 3300006846 | Ga0075430_100026748 | Ga0075430_1000267483 | 83 |
| 48 | 3300006847 | Ga0075431_100170661 | Ga0075431_1001706612 | 83 |
| 49 | 3300006880 | Ga0075429_100597455 | Ga0075429_1005974552 | 83 |
| 50 | 3300006931 | Ga0097620_101029795 | Ga0097620_1010297953 | 83 |
| 51 | 3300009094 | Ga0111539_10901451 | Ga0111539_109014512 | 83 |
| 52 | 3300009098 | Ga0105245_10001646 | Ga0105245_1000164610 | 83 |
| 53 | 3300009098 | Ga0105245_11355597 | Ga0105245_113555971 | 83 |
| 54 | 3300009101 | Ga0105247_11348964 | Ga0105247_113489641 | 83 |
| 55 | 3300009147 | Ga0114129_10006283 | Ga0114129_100062836 | 83 |
| 56 | 3300009147 | Ga0114129_10319471 | Ga0114129_103194713 | 83 |
| 57 | 3300009177 | Ga0105248_11399204 | Ga0105248_113992042 | 83 |
| 58 | 3300009551 | Ga0105238_10936923 | Ga0105238_109369232 | 83 |
| 59 | 3300009553 | Ga0105249_11517633 | Ga0105249_115176332 | 83 |
| 60 | 3300013306 | Ga0163162_13003394 | Ga0163162_130033941 | 83 |
| 61 | 3300013308 | Ga0157375_10615253 | Ga0157375_106152531 | 83 |
| 62 | 3300013308 | Ga0157375_11466250 | Ga0157375_114662502 | 83 |
| 63 | 3300014968 | Ga0157379_10528545 | Ga0157379_105285452 | 83 |
| 64 | 3300017792 | Ga0163161_10995905 | Ga0163161_109959052 | 83 |
| 65 | 3300020069 | Ga0197907_11464321 | Ga0197907_114643212 | 83 |
| 66 | 3300020082 | Ga0206353_10741550 | Ga0206353_107415502 | 83 |
| 67 | 3300021358 | Ga0213873_10086632 | Ga0213873_100866323 | 83 |
| 68 | 3300021384 | Ga0213876_10014910 | Ga0213876_100149104 | 83 |
| 69 | 3300021441 | Ga0213871_10100891 | Ga0213871_101008912 | 83 |
| 70 | 3300024225 | Ga0224572_1008544 | Ga0224572_10085442 | 83 |
| 71 | 3300024225 | Ga0224572_1046660 | Ga0224572_10466602 | 83 |
| 72 | 3300025899 | Ga0207642_11026322 | Ga0207642_110263222 | 83 |
| 73 | 3300025900 | Ga0207710_10706079 | Ga0207710_107060791 | 83 |
| 74 | 3300025908 | Ga0207643_10840922 | Ga0207643_108409221 | 83 |
| 75 | 3300025910 | Ga0207684_10150050 | Ga0207684_101500502 | 83 |
| 76 | 3300025924 | Ga0207694_10932473 | Ga0207694_109324732 | 83 |
| 77 | 3300025927 | Ga0207687_10001297 | Ga0207687_1000129710 | 83 |
| 78 | 3300025928 | Ga0207700_10039060 | Ga0207700_100390603 | 83 |
| 79 | 3300025929 | Ga0207664_10882650 | Ga0207664_108826503 | 83 |
| 80 | 3300025934 | Ga0207686_10913885 | Ga0207686_109138852 | 83 |
| 81 | 3300025986 | Ga0207658_10488939 | Ga0207658_104889392 | 83 |
| 82 | 3300026035 | Ga0207703_11090416 | Ga0207703_110904161 | 83 |
| 83 | 3300026075 | Ga0207708_10288803 | Ga0207708_102888032 | 83 |
| 84 | 3300026116 | Ga0207674_10893640 | Ga0207674_108936402 | 83 |
| 85 | 3300026142 | Ga0207698_11962538 | Ga0207698_119625382 | 83 |
| 86 | 3300028381 | Ga0268264_11438524 | Ga0268264_114385241 | 83 |
| 87 | 3300028556 | Ga0265337_1098151 | Ga0265337_10981511 | 83 |
| 88 | 3300028800 | Ga0265338_10092624 | Ga0265338_100926242 | 83 |
| 89 | 3300030760 | Ga0265762_1088324 | Ga0265762_10883242 | 83 |
| 90 | 3300030863 | Ga0265766_1019740 | Ga0265766_10197401 | 83 |
| 91 | 3300031548 | Ga0307408_101545903 | Ga0307408_1015459032 | 83 |
| 92 | 3300031731 | Ga0307405_12009303 | Ga0307405_120093032 | 83 |
| 93 | 3300031824 | Ga0307413_10622400 | Ga0307413_106224002 | 83 |
| 94 | 3300031852 | Ga0307410_10043059 | Ga0307410_100430593 | 83 |
| 95 | 3300031901 | Ga0307406_10537938 | Ga0307406_105379382 | 83 |
| 96 | 3300031903 | Ga0307407_10083806 | Ga0307407_100838063 | 83 |
| 97 | 3300031995 | Ga0307409_100139052 | Ga0307409_1001390523 | 83 |
| 98 | 3300032002 | Ga0307416_100091597 | Ga0307416_1000915973 | 83 |
| 99 | 3300032005 | Ga0307411_10103659 | Ga0307411_101036593 | 83 |
| 100 | 3300032126 | Ga0307415_100073176 | Ga0307415_1000731763 | 83 |
| 101 | 3300032126 | Ga0307415_100190735 | Ga0307415_1001907353 | 83 |
| 102 | 3300032126 | Ga0307415_101595301 | Ga0307415_1015953011 | 83 |
| 103 | 3300034816 | Ga0373930_0001887 | Ga0373930_0001887_2087_2338 | 83 |
| 104 | 3300035084 | Ga0373928_0001268 | Ga0373928_0001268_4539_4790 | 83 |
| 105 | 3300035085 | Ga0373929_0000591 | Ga0373929_0000591_4160_4411 | 83 |
| 106 | 3300035085 | Ga0373929_0154619 | Ga0373929_0154619_180_431 | 83 |
| 107 | 3300035112 | Ga0373932_0001281 | Ga0373932_0001281_3988_4239 | 83 |
| 108 | 3300035115 | Ga0373941_0500084 | Ga0373941_0500084_215_466 | 83 |
| 109 | 3300035118 | Ga0373954_0307492 | Ga0373954_0307492_67_318 | 83 |
| 110 | 3300035171 | Ga0373946_0580060 | Ga0373946_0580060_89_340 | 83 |
| 111 | 3300035172 | Ga0373955_0155501 | Ga0373955_0155501_627_878 | 83 |
| 112 | 3300035691 | Ga0373931_0000001 | Ga0373931_0000001_157403_157654 | 83 |
| 113 | 3300035691 | Ga0373931_1111611 | Ga0373931_1111611_134_385 | 83 |
| 114 | 3300036401 | Ga0373937_0042657 | Ga0373937_0042657_454_705 | 83 |
| 115 | 3300036401 | Ga0373937_1628306 | Ga0373937_1628306_198_449 | 83 |
| 116 | 3300036401 | Ga0373937_1903212 | Ga0373937_1903212_131_382 | 83 |
| 117 | 3300037068 | Ga0373925_0494241 | Ga0373925_0494241_262_513 | 83 |
| 118 | 3300039062 | Ga0400483_035744 | Ga0400483_035744_1180_1431 | 83 |
| 119 | 3300039062 | Ga0400483_041924 | Ga0400483_041924_29685_29936 | 83 |
| 120 | 3300039062 | Ga0400483_044723 | Ga0400483_044723_2800_3051 | 83 |
| 121 | 3300039062 | Ga0400483_130587 | Ga0400483_130587_3980_4231 | 83 |
| 122 | 3300039062 | Ga0400483_164900 | Ga0400483_164900_12286_12537 | 83 |
| 123 | 3300039062 | Ga0400483_172438 | Ga0400483_172438_731_982 | 83 |
| 124 | 3300039062 | Ga0400483_211911 | Ga0400483_211911_831_1082 | 83 |
| 125 | 3300039062 | Ga0400483_241099 | Ga0400483_241099_3915_4166 | 83 |
| 126 | 3300039062 | Ga0400483_262734 | Ga0400483_262734_1549_1800 | 83 |
| 127 | 3300039437 | Ga0436365_0575180 | Ga0436365_0575180_77_328 | 83 |
| 128 | 3300039437 | Ga0436365_1602503 | Ga0436365_1602503_4763_5014 | 83 |
| 129 | 3300039438 | Ga0436360_0999407 | Ga0436360_0999407_606_857 | 83 |
| 130 | 3300039438 | Ga0436360_1009488 | Ga0436360_1009488_254_505 | 83 |
| 131 | 3300039438 | Ga0436360_1039552 | Ga0436360_1039552_631_882 | 83 |
| 132 | 3300039447 | Ga0436361_1017389 | Ga0436361_1017389_405_656 | 83 |
| 133 | 3300039450 | Ga0436363_1696032 | Ga0436363_1696032_263_514 | 83 |
| 134 | 3300039453 | Ga0436362_0882125 | Ga0436362_0882125_2886_3137 | 83 |
| 135 | 3300041451 | Ga0451791_0570806 | Ga0451791_0570806_251_502 | 83 |
| 136 | 3300041494 | Ga0451837_0490912 | Ga0451837_0490912_299_550 | 83 |
| 137 | 3300041509 | Ga0451843_0279339 | Ga0451843_0279339_218_469 | 83 |
| 138 | 3300044683 | Ga0466965_0631123 | Ga0466965_0631123_174_425 | 83 |
| 139 | 3300044693 | Ga0466961_0152086 | Ga0466961_0152086_402_653 | 83 |
| 140 | 3300045836 | Ga0466958_0219504 | Ga0466958_0219504_846_1097 | 83 |
| 141 | 3300046459 | Ga0495629_0933647 | Ga0495629_0933647_88_339 | 83 |
| 142 | 3300046461 | Ga0495641_0307255 | Ga0495641_0307255_121_372 | 83 |
| 143 | 3300046462 | Ga0495651_0040762 | Ga0495651_0040762_1504_1755 | 83 |
| 144 | 3300046462 | Ga0495651_0411202 | Ga0495651_0411202_510_761 | 83 |
| 145 | 3300046463 | Ga0495653_0022957 | Ga0495653_0022957_344_595 | 83 |
| 146 | 3300046463 | Ga0495653_0560691 | Ga0495653_0560691_361_612 | 83 |
| 147 | 3300046473 | Ga0495582_0844047 | Ga0495582_0844047_59_310 | 83 |
| 148 | 3300046511 | Ga0495608_0619465 | Ga0495608_0619465_30_281 | 83 |
| 149 | 3300046516 | Ga0495628_0528869 | Ga0495628_0528869_310_561 | 83 |
| 150 | 3300046517 | Ga0495630_0576584 | Ga0495630_0576584_199_450 | 83 |
| 151 | 3300046529 | Ga0495652_0467008 | Ga0495652_0467008_468_719 | 83 |
| 152 | 3300046536 | Ga0495587_0010276 | Ga0495587_0010276_1737_1988 | 83 |
| 153 | 3300046559 | Ga0495667_0003836 | Ga0495667_0003836_2961_3212 | 83 |
| 154 | 3300046663 | Ga0495635_0263448 | Ga0495635_0263448_12_263 | 83 |
| 155 | 3300046675 | Ga0495657_0122267 | Ga0495657_0122267_502_753 | 83 |
| 156 | 3300046678 | Ga0495599_0734234 | Ga0495599_0734234_187_438 | 83 |
| 157 | 3300046679 | Ga0495623_0036112 | Ga0495623_0036112_785_1036 | 83 |
| 158 | 3300047317 | Ga0495604_0103385 | Ga0495604_0103385_624_875 | 83 |
| 159 | 3300047322 | Ga0495680_0491195 | Ga0495680_0491195_203_454 | 83 |
| 160 | 3300047444 | Ga0495675_0078564 | Ga0495675_0078564_1784_2035 | 83 |
| 161 | 3300047444 | Ga0495675_0805335 | Ga0495675_0805335_88_339 | 83 |
| 162 | 3300047471 | Ga0495684_0140370 | Ga0495684_0140370_256_507 | 83 |
| 163 | 3300048088 | Ga0495602_0391754 | Ga0495602_0391754_362_613 | 83 |
| 164 | 3300048088 | Ga0495602_1138285 | Ga0495602_1138285_214_465 | 83 |
| 165 | 3300048903 | Ga0496100_0603265 | Ga0496100_0603265_422_673 | 83 |
| 166 | 3300048904 | Ga0496101_0584831 | Ga0496101_0584831_71_322 | 83 |
| 167 | 3300048905 | Ga0496102_0599935 | Ga0496102_0599935_324_575 | 83 |
| 168 | 3300048906 | Ga0496103_0395483 | Ga0496103_0395483_317_568 | 83 |
| 169 | 3300048907 | Ga0496104_1071685 | Ga0496104_1071685_424_675 | 83 |
| 170 | 3300048909 | Ga0496106_1120260 | Ga0496106_1120260_257_508 | 83 |
| 171 | 3300048911 | Ga0496108_0446543 | Ga0496108_0446543_405_656 | 83 |
| 172 | 3300048912 | Ga0496109_0362602 | Ga0496109_0362602_1086_1337 | 83 |
| 173 | 3300048912 | Ga0496109_1013595 | Ga0496109_1013595_318_584 | 83 |
| 174 | 3300048913 | Ga0496110_0392609 | Ga0496110_0392609_872_1123 | 83 |
| 175 | 3300048916 | Ga0496113_1048819 | Ga0496113_1048819_332_583 | 83 |
| 176 | 3300048917 | Ga0496114_0552586 | Ga0496114_0552586_401_652 | 83 |
| 177 | 3300049569 | Ga0501032_0022556 | Ga0501032_0022556_1440_1691 | 83 |
| 178 | 3300049570 | Ga0501033_0696933 | Ga0501033_0696933_337_588 | 83 |
| 179 | 3300049571 | Ga0501034_0000666 | Ga0501034_0000666_20253_20504 | 83 |
| 180 | 3300049571 | Ga0501034_0377291 | Ga0501034_0377291_590_841 | 83 |
| 181 | 3300049572 | Ga0501036_0175594 | Ga0501036_0175594_304_555 | 83 |
| 182 | 3300049572 | Ga0501036_1469802 | Ga0501036_1469802_203_457 | 83 |
| 183 | 3300049573 | Ga0501037_0001329 | Ga0501037_0001329_17444_17695 | 83 |
| 184 | 3300049573 | Ga0501037_0021962 | Ga0501037_0021962_2293_2544 | 83 |
| 185 | 3300049574 | Ga0501038_0013014 | Ga0501038_0013014_490_741 | 83 |
| 186 | 3300049575 | Ga0501039_0272112 | Ga0501039_0272112_649_900 | 83 |
| 187 | 3300049576 | Ga0501040_1006100 | Ga0501040_1006100_179_430 | 83 |
| 188 | 3300049579 | Ga0501043_0007961 | Ga0501043_0007961_5015_5266 | 83 |
| 189 | 3300049581 | Ga0501047_0753710 | Ga0501047_0753710_415_666 | 83 |
| 190 | 3300049582 | Ga0501048_1242708 | Ga0501048_1242708_255_506 | 83 |
| 191 | 3300049583 | Ga0501067_0045695 | Ga0501067_0045695_1596_1847 | 83 |
| 192 | 3300049583 | Ga0501067_0079615 | Ga0501067_0079615_611_862 | 83 |
| 193 | 3300049584 | Ga0501068_0000098 | Ga0501068_0000098_7488_7739 | 83 |
| 194 | 3300049586 | Ga0501070_0007332 | Ga0501070_0007332_4157_4408 | 83 |
| 195 | 3300049586 | Ga0501070_0020200 | Ga0501070_0020200_4459_4710 | 83 |
| 196 | 3300049588 | Ga0501072_0007967 | Ga0501072_0007967_3017_3268 | 83 |
| 197 | 3300049588 | Ga0501072_0060274 | Ga0501072_0060274_988_1239 | 83 |
| 198 | 3300049588 | Ga0501072_0173913 | Ga0501072_0173913_1430_1681 | 83 |
| 199 | 3300049589 | Ga0501073_0024702 | Ga0501073_0024702_3134_3385 | 83 |
| 200 | 3300049589 | Ga0501073_1240907 | Ga0501073_1240907_176_427 | 83 |
| 201 | 3300049590 | Ga0501074_0000333 | Ga0501074_0000333_2018_2269 | 83 |
| 202 | 3300049590 | Ga0501074_0074367 | Ga0501074_0074367_1387_1638 | 83 |
| 203 | 3300049590 | Ga0501074_0080338 | Ga0501074_0080338_670_921 | 83 |
| 204 | 3300049592 | Ga0501076_0079570 | Ga0501076_0079570_1259_1510 | 83 |
| 205 | 3300049741 | Ga0501079_1483254 | Ga0501079_1483254_33_284 | 83 |
| 206 | 3300049741 | Ga0501079_1556857 | Ga0501079_1556857_86_337 | 83 |
| 207 | 3300049742 | Ga0501080_0012513 | Ga0501080_0012513_914_1165 | 83 |
| 208 | 3300049742 | Ga0501080_0017310 | Ga0501080_0017310_5597_5848 | 83 |
| 209 | 3300049742 | Ga0501080_0240745 | Ga0501080_0240745_422_673 | 83 |
| 210 | 3300049742 | Ga0501080_0667782 | Ga0501080_0667782_243_494 | 83 |
| 211 | 3300049744 | Ga0501083_0045673 | Ga0501083_0045673_550_801 | 83 |
| 212 | 3300049822 | Ga0501035_0282450 | Ga0501035_0282450_887_1138 | 83 |
| 213 | 3300049823 | Ga0501044_0202897 | Ga0501044_0202897_1272_1523 | 83 |
| 214 | 3300050489 | nmdc:mga03683_22620_c1 | nmdc:mga03683_22620_c1_14_265 | 83 |
| 215 | 3300050489 | nmdc:mga03683_338454_c1 | nmdc:mga03683_338454_c1_419_670 | 83 |
| 216 | 3300050489 | nmdc:mga03683_630528_c1 | nmdc:mga03683_630528_c1_63_314 | 83 |
| 217 | 3300050490 | nmdc:mga03n38_307875_c1 | nmdc:mga03n38_307875_c1_114_365 | 83 |
| 218 | 3300050491 | nmdc:mga00v17_270423_c1 | nmdc:mga00v17_270423_c1_101_352 | 83 |
| 219 | 3300050491 | nmdc:mga00v17_40994_c1 | nmdc:mga00v17_40994_c1_583_834 | 83 |
| 220 | 3300050491 | nmdc:mga00v17_507359_c1 | nmdc:mga00v17_507359_c1_474_725 | 83 |
| 221 | 3300050491 | nmdc:mga00v17_7843_c1 | nmdc:mga00v17_7843_c1_3626_3877 | 83 |
| 222 | 3300050491 | nmdc:mga00v17_896190_c1 | nmdc:mga00v17_896190_c1_104_355 | 83 |
| 223 | 3300050491 | nmdc:mga00v17_9780_c1 | nmdc:mga00v17_9780_c1_1072_1323 | 83 |
| 224 | 3300050492 | nmdc:mga0yw44_3611_c1 | nmdc:mga0yw44_3611_c1_4130_4381 | 83 |
| 225 | 3300050492 | nmdc:mga0yw44_375796_c1 | nmdc:mga0yw44_375796_c1_577_828 | 83 |
| 226 | 3300050492 | nmdc:mga0yw44_636268_c1 | nmdc:mga0yw44_636268_c1_422_673 | 83 |
| 227 | 3300050492 | nmdc:mga0yw44_8482_c2 | nmdc:mga0yw44_8482_c2_1073_1324 | 83 |
| 228 | 3300050492 | nmdc:mga0yw44_879653_c1 | nmdc:mga0yw44_879653_c1_280_531 | 83 |
| 229 | 3300050492 | nmdc:mga0yw44_973317_c1 | nmdc:mga0yw44_973317_c1_68_319 | 83 |
| 230 | 3300050494 | nmdc:mga06z11_67387_c1 | nmdc:mga06z11_67387_c1_1497_1748 | 83 |
| 231 | 3300050507 | nmdc:mga05p37_89598_c1 | nmdc:mga05p37_89598_c1_967_1218 | 83 |
| 232 | 3300050508 | nmdc:mga09592_593635_c1 | nmdc:mga09592_593635_c1_157_408 | 83 |
| 233 | 3300050509 | nmdc:mga0qj67_98683_c1 | nmdc:mga0qj67_98683_c1_180_431 | 83 |
| 234 | 3300050510 | nmdc:mga06r32_49104_c1 | nmdc:mga06r32_49104_c1_506_757 | 83 |
| 235 | 3300053077 | Ga0495601_0236892 | Ga0495601_0236892_919_1170 | 83 |
| 236 | 3300053084 | Ga0495595_0363367 | Ga0495595_0363367_185_436 | 83 |
| 237 | 3300053138 | Ga0500564_302506 | Ga0500564_302506_16_267 | 83 |
| 238 | 3300060353 | Ga0501082_0620882 | Ga0501082_0620882_271_522 | 83 |
| 239 | 3300060353 | Ga0501082_1048330 | Ga0501082_1048330_183_434 | 83 |
| 240 | 3300061734 | Ga0530510_0745595 | Ga0530510_0745595_472_723 | 83 |
| 241 | 3300003373 | JGI25407J50210_10002455 | JGI25407J50210_100024552 | 84 |
| 242 | 3300003911 | JGI25405J52794_10012367 | JGI25405J52794_100123671 | 84 |
| 243 | 3300005338 | Ga0068868_100560352 | Ga0068868_1005603522 | 84 |
| 244 | 3300005339 | Ga0070660_100520149 | Ga0070660_1005201492 | 84 |
| 245 | 3300005340 | Ga0070689_101603487 | Ga0070689_1016034871 | 84 |
| 246 | 3300005347 | Ga0070668_100149775 | Ga0070668_1001497753 | 84 |
| 247 | 3300005347 | Ga0070668_101180590 | Ga0070668_1011805901 | 84 |
| 248 | 3300005354 | Ga0070675_100142130 | Ga0070675_1001421302 | 84 |
| 249 | 3300005355 | Ga0070671_100012872 | Ga0070671_1000128726 | 84 |
| 250 | 3300005356 | Ga0070674_100393756 | Ga0070674_1003937562 | 84 |
| 251 | 3300005356 | Ga0070674_100549119 | Ga0070674_1005491191 | 84 |
| 252 | 3300005364 | Ga0070673_100774295 | Ga0070673_1007742953 | 84 |
| 253 | 3300005364 | Ga0070673_100919186 | Ga0070673_1009191861 | 84 |
| 254 | 3300005364 | Ga0070673_101599679 | Ga0070673_1015996792 | 84 |
| 255 | 3300005365 | Ga0070688_100532259 | Ga0070688_1005322593 | 84 |
| 256 | 3300005365 | Ga0070688_101630180 | Ga0070688_1016301801 | 84 |
| 257 | 3300005367 | Ga0070667_101297558 | Ga0070667_1012975582 | 84 |
| 258 | 3300005435 | Ga0070714_100152956 | Ga0070714_1001529563 | 84 |
| 259 | 3300005435 | Ga0070714_101582351 | Ga0070714_1015823511 | 84 |
| 260 | 3300005437 | Ga0070710_11529057 | Ga0070710_115290571 | 84 |
| 261 | 3300005439 | Ga0070711_100768928 | Ga0070711_1007689282 | 84 |
| 262 | 3300005441 | Ga0070700_101848570 | Ga0070700_1018485702 | 84 |
| 263 | 3300005445 | Ga0070708_100013011 | Ga0070708_1000130118 | 84 |
| 264 | 3300005456 | Ga0070678_100762466 | Ga0070678_1007624661 | 84 |
| 265 | 3300005456 | Ga0070678_101246724 | Ga0070678_1012467242 | 84 |
| 266 | 3300005458 | Ga0070681_10280899 | Ga0070681_102808992 | 84 |
| 267 | 3300005459 | Ga0068867_100835803 | Ga0068867_1008358032 | 84 |
| 268 | 3300005459 | Ga0068867_101873828 | Ga0068867_1018738281 | 84 |
| 269 | 3300005518 | Ga0070699_102202719 | Ga0070699_1022027192 | 84 |
| 270 | 3300005530 | Ga0070679_100869378 | Ga0070679_1008693781 | 84 |
| 271 | 3300005535 | Ga0070684_100685688 | Ga0070684_1006856881 | 84 |
| 272 | 3300005536 | Ga0070697_101428563 | Ga0070697_1014285632 | 84 |
| 273 | 3300005539 | Ga0068853_100488991 | Ga0068853_1004889912 | 84 |
| 274 | 3300005549 | Ga0070704_100632936 | Ga0070704_1006329363 | 84 |
| 275 | 3300005549 | Ga0070704_101018444 | Ga0070704_1010184442 | 84 |
| 276 | 3300005614 | Ga0068856_100496084 | Ga0068856_1004960842 | 84 |
| 277 | 3300005614 | Ga0068856_101967424 | Ga0068856_1019674242 | 84 |
| 278 | 3300005615 | Ga0070702_100938899 | Ga0070702_1009388991 | 84 |
| 279 | 3300005616 | Ga0068852_100438494 | Ga0068852_1004384943 | 84 |
| 280 | 3300005617 | Ga0068859_100257887 | Ga0068859_1002578872 | 84 |
| 281 | 3300005719 | Ga0068861_100031746 | Ga0068861_1000317463 | 84 |
| 282 | 3300005840 | Ga0068870_10644374 | Ga0068870_106443742 | 84 |
| 283 | 3300005841 | Ga0068863_100799032 | Ga0068863_1007990322 | 84 |
| 284 | 3300005842 | Ga0068858_102170828 | Ga0068858_1021708282 | 84 |
| 285 | 3300005937 | Ga0081455_10001010 | Ga0081455_1000101015 | 84 |
| 286 | 3300005937 | Ga0081455_10085566 | Ga0081455_100855663 | 84 |
| 287 | 3300005937 | Ga0081455_10090442 | Ga0081455_100904423 | 84 |
| 288 | 3300005937 | Ga0081455_10218693 | Ga0081455_102186932 | 84 |
| 289 | 3300005981 | Ga0081538_10000291 | Ga0081538_1000029126 | 84 |
| 290 | 3300005981 | Ga0081538_10003721 | Ga0081538_100037218 | 84 |
| 291 | 3300005981 | Ga0081538_10076270 | Ga0081538_100762702 | 84 |
| 292 | 3300005983 | Ga0081540_1334971 | Ga0081540_13349712 | 84 |
| 293 | 3300006038 | Ga0075365_10085467 | Ga0075365_100854672 | 84 |
| 294 | 3300006038 | Ga0075365_10117420 | Ga0075365_101174203 | 84 |
| 295 | 3300006038 | Ga0075365_10177594 | Ga0075365_101775942 | 84 |
| 296 | 3300006038 | Ga0075365_10365571 | Ga0075365_103655713 | 84 |
| 297 | 3300006038 | Ga0075365_10552168 | Ga0075365_105521682 | 84 |
| 298 | 3300006042 | Ga0075368_10106482 | Ga0075368_101064822 | 84 |
| 299 | 3300006042 | Ga0075368_10165038 | Ga0075368_101650382 | 84 |
| 300 | 3300006048 | Ga0075363_100328801 | Ga0075363_1003288012 | 84 |
| 301 | 3300006048 | Ga0075363_100405652 | Ga0075363_1004056521 | 84 |
| 302 | 3300006048 | Ga0075363_100411346 | Ga0075363_1004113462 | 84 |
| 303 | 3300006048 | Ga0075363_100927299 | Ga0075363_1009272992 | 84 |
| 304 | 3300006051 | Ga0075364_10162037 | Ga0075364_101620373 | 84 |
| 305 | 3300006051 | Ga0075364_10178904 | Ga0075364_101789042 | 84 |
| 306 | 3300006051 | Ga0075364_10252109 | Ga0075364_102521092 | 84 |
| 307 | 3300006051 | Ga0075364_10490547 | Ga0075364_104905473 | 84 |
| 308 | 3300006051 | Ga0075364_10744273 | Ga0075364_107442731 | 84 |
| 309 | 3300006175 | Ga0070712_100908845 | Ga0070712_1009088452 | 84 |
| 310 | 3300006177 | Ga0075362_10396908 | Ga0075362_103969082 | 84 |
| 311 | 3300006177 | Ga0075362_10616574 | Ga0075362_106165742 | 84 |
| 312 | 3300006178 | Ga0075367_10031451 | Ga0075367_100314514 | 84 |
| 313 | 3300006178 | Ga0075367_10373588 | Ga0075367_103735882 | 84 |
| 314 | 3300006178 | Ga0075367_10378820 | Ga0075367_103788203 | 84 |
| 315 | 3300006178 | Ga0075367_10835265 | Ga0075367_108352651 | 84 |
| 316 | 3300006178 | Ga0075367_10936652 | Ga0075367_109366521 | 84 |
| 317 | 3300006195 | Ga0075366_10654326 | Ga0075366_106543261 | 84 |
| 318 | 3300006353 | Ga0075370_10190304 | Ga0075370_101903043 | 84 |
| 319 | 3300006353 | Ga0075370_10296550 | Ga0075370_102965503 | 84 |
| 320 | 3300006353 | Ga0075370_10892830 | Ga0075370_108928302 | 84 |
| 321 | 3300006844 | Ga0075428_100000156 | Ga0075428_10000015619 | 84 |
| 322 | 3300006844 | Ga0075428_100085116 | Ga0075428_1000851164 | 84 |
| 323 | 3300006844 | Ga0075428_100174546 | Ga0075428_1001745462 | 84 |
| 324 | 3300006844 | Ga0075428_100363280 | Ga0075428_1003632802 | 84 |
| 325 | 3300006846 | Ga0075430_100001345 | Ga0075430_10000134516 | 84 |
| 326 | 3300006846 | Ga0075430_100108920 | Ga0075430_1001089204 | 84 |
| 327 | 3300006846 | Ga0075430_100138927 | Ga0075430_1001389272 | 84 |
| 328 | 3300006847 | Ga0075431_100011461 | Ga0075431_1000114613 | 84 |
| 329 | 3300006847 | Ga0075431_100062165 | Ga0075431_1000621652 | 84 |
| 330 | 3300006847 | Ga0075431_100593151 | Ga0075431_1005931512 | 84 |
| 331 | 3300006847 | Ga0075431_100894872 | Ga0075431_1008948722 | 84 |
| 332 | 3300006871 | Ga0075434_100377383 | Ga0075434_1003773832 | 84 |
| 333 | 3300006880 | Ga0075429_100170935 | Ga0075429_1001709353 | 84 |
| 334 | 3300006880 | Ga0075429_100267714 | Ga0075429_1002677142 | 84 |
| 335 | 3300006880 | Ga0075429_101711855 | Ga0075429_1017118552 | 84 |
| 336 | 3300006881 | Ga0068865_101090233 | Ga0068865_1010902332 | 84 |
| 337 | 3300006914 | Ga0075436_101560546 | Ga0075436_1015605462 | 84 |
| 338 | 3300006931 | Ga0097620_100257886 | Ga0097620_1002578862 | 84 |
| 339 | 3300007788 | Ga0099795_10148759 | Ga0099795_101487592 | 84 |
| 340 | 3300009093 | Ga0105240_10639363 | Ga0105240_106393632 | 84 |
| 341 | 3300009094 | Ga0111539_10720186 | Ga0111539_107201862 | 84 |
| 342 | 3300009094 | Ga0111539_12326014 | Ga0111539_123260141 | 84 |
| 343 | 3300009094 | Ga0111539_13159430 | Ga0111539_131594302 | 84 |
| 344 | 3300009098 | Ga0105245_10016863 | Ga0105245_100168635 | 84 |
| 345 | 3300009098 | Ga0105245_10304022 | Ga0105245_103040222 | 84 |
| 346 | 3300009098 | Ga0105245_11356747 | Ga0105245_113567471 | 84 |
| 347 | 3300009098 | Ga0105245_11981142 | Ga0105245_119811422 | 84 |
| 348 | 3300009098 | Ga0105245_12174315 | Ga0105245_121743152 | 84 |
| 349 | 3300009147 | Ga0114129_10000561 | Ga0114129_1000056114 | 84 |
| 350 | 3300009147 | Ga0114129_10005087 | Ga0114129_1000508718 | 84 |
| 351 | 3300009147 | Ga0114129_10160191 | Ga0114129_101601912 | 84 |
| 352 | 3300009148 | Ga0105243_10395642 | Ga0105243_103956423 | 84 |
| 353 | 3300009148 | Ga0105243_11744635 | Ga0105243_117446351 | 84 |
| 354 | 3300009148 | Ga0105243_11940106 | Ga0105243_119401062 | 84 |
| 355 | 3300009148 | Ga0105243_12131438 | Ga0105243_121314381 | 84 |
| 356 | 3300009174 | Ga0105241_11288629 | Ga0105241_112886292 | 84 |
| 357 | 3300009176 | Ga0105242_10063603 | Ga0105242_100636034 | 84 |
| 358 | 3300009176 | Ga0105242_12543478 | Ga0105242_125434781 | 84 |
| 359 | 3300009177 | Ga0105248_12956788 | Ga0105248_129567882 | 84 |
| 360 | 3300009545 | Ga0105237_11228691 | Ga0105237_112286911 | 84 |
| 361 | 3300009551 | Ga0105238_12070115 | Ga0105238_120701152 | 84 |
| 362 | 3300009553 | Ga0105249_11061538 | Ga0105249_110615381 | 84 |
| 363 | 3300009553 | Ga0105249_11469604 | Ga0105249_114696041 | 84 |
| 364 | 3300009553 | Ga0105249_12773647 | Ga0105249_127736471 | 84 |
| 365 | 3300010375 | Ga0105239_10122168 | Ga0105239_101221683 | 84 |
| 366 | 3300010375 | Ga0105239_11589461 | Ga0105239_115894612 | 84 |
| 367 | 3300011119 | Ga0105246_10454604 | Ga0105246_104546042 | 84 |
| 368 | 3300011119 | Ga0105246_11305468 | Ga0105246_113054681 | 84 |
| 369 | 3300011119 | Ga0105246_12110425 | Ga0105246_121104251 | 84 |
| 370 | 3300012491 | Ga0157329_1019916 | Ga0157329_10199162 | 84 |
| 371 | 3300013100 | Ga0157373_11204731 | Ga0157373_112047312 | 84 |
| 372 | 3300013105 | Ga0157369_10392094 | Ga0157369_103920941 | 84 |
| 373 | 3300013297 | Ga0157378_10440627 | Ga0157378_104406272 | 84 |
| 374 | 3300013297 | Ga0157378_11802431 | Ga0157378_118024311 | 84 |
| 375 | 3300013297 | Ga0157378_12067775 | Ga0157378_120677751 | 84 |
| 376 | 3300013297 | Ga0157378_12645277 | Ga0157378_126452772 | 84 |
| 377 | 3300013306 | Ga0163162_12721468 | Ga0163162_127214682 | 84 |
| 378 | 3300013307 | Ga0157372_10639090 | Ga0157372_106390902 | 84 |
| 379 | 3300013307 | Ga0157372_11387247 | Ga0157372_113872473 | 84 |
| 380 | 3300013308 | Ga0157375_10537707 | Ga0157375_105377072 | 84 |
| 381 | 3300013308 | Ga0157375_11209345 | Ga0157375_112093451 | 84 |
| 382 | 3300013308 | Ga0157375_12085487 | Ga0157375_120854871 | 84 |
| 383 | 3300014325 | Ga0163163_10289665 | Ga0163163_102896653 | 84 |
| 384 | 3300014325 | Ga0163163_10441767 | Ga0163163_104417673 | 84 |
| 385 | 3300014326 | Ga0157380_11122936 | Ga0157380_111229363 | 84 |
| 386 | 3300014326 | Ga0157380_13434909 | Ga0157380_134349092 | 84 |
| 387 | 3300014745 | Ga0157377_11185491 | Ga0157377_111854912 | 84 |
| 388 | 3300014968 | Ga0157379_10469673 | Ga0157379_104696732 | 84 |
| 389 | 3300014968 | Ga0157379_10734725 | Ga0157379_107347252 | 84 |
| 390 | 3300014968 | Ga0157379_12154360 | Ga0157379_121543601 | 84 |
| 391 | 3300014968 | Ga0157379_12665658 | Ga0157379_126656582 | 84 |
| 392 | 3300014969 | Ga0157376_11265249 | Ga0157376_112652492 | 84 |
| 393 | 3300014969 | Ga0157376_11301485 | Ga0157376_113014851 | 84 |
| 394 | 3300014969 | Ga0157376_12182718 | Ga0157376_121827182 | 84 |
| 395 | 3300014969 | Ga0157376_12954178 | Ga0157376_129541781 | 84 |
| 396 | 3300017792 | Ga0163161_10853542 | Ga0163161_108535421 | 84 |
| 397 | 3300020069 | Ga0197907_10534594 | Ga0197907_105345941 | 84 |
| 398 | 3300020069 | Ga0197907_10755373 | Ga0197907_107553732 | 84 |
| 399 | 3300020070 | Ga0206356_10096014 | Ga0206356_100960142 | 84 |
| 400 | 3300020070 | Ga0206356_10185486 | Ga0206356_101854861 | 84 |
| 401 | 3300020076 | Ga0206355_1067193 | Ga0206355_10671932 | 84 |
| 402 | 3300020076 | Ga0206355_1343555 | Ga0206355_13435551 | 84 |
| 403 | 3300020076 | Ga0206355_1525959 | Ga0206355_15259592 | 84 |
| 404 | 3300020081 | Ga0206354_10409034 | Ga0206354_104090342 | 84 |
| 405 | 3300020081 | Ga0206354_10451484 | Ga0206354_104514842 | 84 |
| 406 | 3300020081 | Ga0206354_10983743 | Ga0206354_109837432 | 84 |
| 407 | 3300020081 | Ga0206354_11094166 | Ga0206354_110941662 | 84 |
| 408 | 3300020082 | Ga0206353_10258710 | Ga0206353_102587101 | 84 |
| 409 | 3300020082 | Ga0206353_11180624 | Ga0206353_111806241 | 84 |
| 410 | 3300022467 | Ga0224712_10305271 | Ga0224712_103052712 | 84 |
| 411 | 3300022467 | Ga0224712_10389241 | Ga0224712_103892411 | 84 |
| 412 | 3300022467 | Ga0224712_10475406 | Ga0224712_104754062 | 84 |
| 413 | 3300025901 | Ga0207688_10259322 | Ga0207688_102593222 | 84 |
| 414 | 3300025903 | Ga0207680_11038453 | Ga0207680_110384531 | 84 |
| 415 | 3300025907 | Ga0207645_11238244 | Ga0207645_112382441 | 84 |
| 416 | 3300025910 | Ga0207684_10962714 | Ga0207684_109627142 | 84 |
| 417 | 3300025912 | Ga0207707_10063579 | Ga0207707_100635793 | 84 |
| 418 | 3300025912 | Ga0207707_10321453 | Ga0207707_103214532 | 84 |
| 419 | 3300025914 | Ga0207671_11426262 | Ga0207671_114262622 | 84 |
| 420 | 3300025919 | Ga0207657_10512051 | Ga0207657_105120512 | 84 |
| 421 | 3300025919 | Ga0207657_11046745 | Ga0207657_110467451 | 84 |
| 422 | 3300025921 | Ga0207652_10763828 | Ga0207652_107638282 | 84 |
| 423 | 3300025924 | Ga0207694_11606597 | Ga0207694_116065972 | 84 |
| 424 | 3300025927 | Ga0207687_10097629 | Ga0207687_100976292 | 84 |
| 425 | 3300025927 | Ga0207687_10207911 | Ga0207687_102079112 | 84 |
| 426 | 3300025929 | Ga0207664_10678625 | Ga0207664_106786252 | 84 |
| 427 | 3300025931 | Ga0207644_10038155 | Ga0207644_100381552 | 84 |
| 428 | 3300025931 | Ga0207644_11540196 | Ga0207644_115401962 | 84 |
| 429 | 3300025934 | Ga0207686_10259147 | Ga0207686_102591472 | 84 |
| 430 | 3300025937 | Ga0207669_10136376 | Ga0207669_101363763 | 84 |
| 431 | 3300025937 | Ga0207669_11196727 | Ga0207669_111967271 | 84 |
| 432 | 3300025937 | Ga0207669_11419061 | Ga0207669_114190611 | 84 |
| 433 | 3300025937 | Ga0207669_11710850 | Ga0207669_117108501 | 84 |
| 434 | 3300025940 | Ga0207691_11043473 | Ga0207691_110434732 | 84 |
| 435 | 3300025942 | Ga0207689_10720537 | Ga0207689_107205371 | 84 |
| 436 | 3300025944 | Ga0207661_11824925 | Ga0207661_118249252 | 84 |
| 437 | 3300025961 | Ga0207712_10242554 | Ga0207712_102425543 | 84 |
| 438 | 3300025961 | Ga0207712_11636553 | Ga0207712_116365532 | 84 |
| 439 | 3300025972 | Ga0207668_11120850 | Ga0207668_111208502 | 84 |
| 440 | 3300025986 | Ga0207658_10637560 | Ga0207658_106375602 | 84 |
| 441 | 3300025986 | Ga0207658_11408830 | Ga0207658_114088302 | 84 |
| 442 | 3300026023 | Ga0207677_12301124 | Ga0207677_123011241 | 84 |
| 443 | 3300026075 | Ga0207708_10562541 | Ga0207708_105625413 | 84 |
| 444 | 3300026075 | Ga0207708_11362706 | Ga0207708_113627062 | 84 |
| 445 | 3300026078 | Ga0207702_10689435 | Ga0207702_106894352 | 84 |
| 446 | 3300026095 | Ga0207676_10814303 | Ga0207676_108143031 | 84 |
| 447 | 3300026116 | Ga0207674_11365990 | Ga0207674_113659902 | 84 |
| 448 | 3300026118 | Ga0207675_100098435 | Ga0207675_1000984353 | 84 |
| 449 | 3300026118 | Ga0207675_100619913 | Ga0207675_1006199132 | 84 |
| 450 | 3300026118 | Ga0207675_102661102 | Ga0207675_1026611021 | 84 |
| 451 | 3300026142 | Ga0207698_10663423 | Ga0207698_106634231 | 84 |
| 452 | 3300026142 | Ga0207698_10894014 | Ga0207698_108940142 | 84 |
| 453 | 3300027665 | Ga0209983_1017203 | Ga0209983_10172033 | 84 |
| 454 | 3300027717 | Ga0209998_10048650 | Ga0209998_100486504 | 84 |
| 455 | 3300027866 | Ga0209813_10102835 | Ga0209813_101028353 | 84 |
| 456 | 3300027866 | Ga0209813_10426505 | Ga0209813_104265051 | 84 |
| 457 | 3300027866 | Ga0209813_10453802 | Ga0209813_104538022 | 84 |
| 458 | 3300028666 | Ga0265336_10107662 | Ga0265336_101076622 | 84 |
| 459 | 3300028786 | Ga0307517_10361990 | Ga0307517_103619902 | 84 |
| 460 | 3300028800 | Ga0265338_10000474 | Ga0265338_1000047424 | 84 |
| 461 | 3300030760 | Ga0265762_1017921 | Ga0265762_10179212 | 84 |
| 462 | 3300031548 | Ga0307408_101338105 | Ga0307408_1013381052 | 84 |
| 463 | 3300031665 | Ga0316575_10090209 | Ga0316575_100902093 | 84 |
| 464 | 3300031691 | Ga0316579_10397336 | Ga0316579_103973361 | 84 |
| 465 | 3300031727 | Ga0316576_10015988 | Ga0316576_100159882 | 84 |
| 466 | 3300031727 | Ga0316576_10042472 | Ga0316576_100424723 | 84 |
| 467 | 3300031727 | Ga0316576_10187354 | Ga0316576_101873543 | 84 |
| 468 | 3300031728 | Ga0316578_10007025 | Ga0316578_100070253 | 84 |
| 469 | 3300031728 | Ga0316578_10024208 | Ga0316578_100242083 | 84 |
| 470 | 3300031728 | Ga0316578_10769574 | Ga0316578_107695741 | 84 |
| 471 | 3300031731 | Ga0307405_10179244 | Ga0307405_101792442 | 84 |
| 472 | 3300031733 | Ga0316577_10001440 | Ga0316577_100014406 | 84 |
| 473 | 3300031733 | Ga0316577_10030042 | Ga0316577_100300423 | 84 |
| 474 | 3300031824 | Ga0307413_10166923 | Ga0307413_101669233 | 84 |
| 475 | 3300031824 | Ga0307413_11149443 | Ga0307413_111494432 | 84 |
| 476 | 3300031903 | Ga0307407_10851567 | Ga0307407_108515672 | 84 |
| 477 | 3300031911 | Ga0307412_10164750 | Ga0307412_101647502 | 84 |
| 478 | 3300031911 | Ga0307412_11555593 | Ga0307412_115555932 | 84 |
| 479 | 3300031995 | Ga0307409_101704193 | Ga0307409_1017041932 | 84 |
| 480 | 3300031995 | Ga0307409_101837109 | Ga0307409_1018371092 | 84 |
| 481 | 3300032002 | Ga0307416_101197140 | Ga0307416_1011971402 | 84 |
| 482 | 3300032002 | Ga0307416_101377364 | Ga0307416_1013773642 | 84 |
| 483 | 3300032004 | Ga0307414_11572274 | Ga0307414_115722742 | 84 |
| 484 | 3300032005 | Ga0307411_10282530 | Ga0307411_102825302 | 84 |
| 485 | 3300032005 | Ga0307411_12198327 | Ga0307411_121983272 | 84 |
| 486 | 3300032137 | Ga0316585_10223551 | Ga0316585_102235511 | 84 |
| 487 | 3300032139 | Ga0316580_10052859 | Ga0316580_100528592 | 84 |
| 488 | 3300032168 | Ga0316593_10329262 | Ga0316593_103292622 | 84 |
| 489 | 3300033524 | Ga0316592_1036970 | Ga0316592_10369702 | 84 |
| 490 | 3300033524 | Ga0316592_1152460 | Ga0316592_11524602 | 84 |
| 491 | 3300033527 | Ga0316586_1083426 | Ga0316586_10834262 | 84 |
| 492 | 3300033528 | Ga0316588_1144724 | Ga0316588_11447241 | 84 |
| 493 | 3300033541 | Ga0316596_1163374 | Ga0316596_11633742 | 84 |
| 494 | 3300033541 | Ga0316596_1180039 | Ga0316596_11800392 | 84 |
| 495 | 3300033541 | Ga0316596_1189388 | Ga0316596_11893881 | 84 |
| 496 | 3300035089 | Ga0373944_0128090 | Ga0373944_0128090_155_412 | 84 |
| 497 | 3300035112 | Ga0373932_0063268 | Ga0373932_0063268_142_399 | 84 |
| 498 | 3300035116 | Ga0373945_0316781 | Ga0373945_0316781_356_613 | 84 |
| 499 | 3300035170 | Ga0373943_0116354 | Ga0373943_0116354_829_1086 | 84 |
| 500 | 3300035170 | Ga0373943_0312263 | Ga0373943_0312263_495_752 | 84 |
| 501 | 3300035242 | Ga0373962_0345757 | Ga0373962_0345757_120_374 | 84 |
| 502 | 3300035398 | Ga0316574_0011346 | Ga0316574_0011346_2031_2285 | 84 |
| 503 | 3300035398 | Ga0316574_0282937 | Ga0316574_0282937_675_932 | 84 |
| 504 | 3300035398 | Ga0316574_0347263 | Ga0316574_0347263_72_329 | 84 |
| 505 | 3300035398 | Ga0316574_0492133 | Ga0316574_0492133_334_588 | 84 |
| 506 | 3300035398 | Ga0316574_0646473 | Ga0316574_0646473_45_311 | 84 |
| 507 | 3300035398 | Ga0316574_0760696 | Ga0316574_0760696_13_270 | 84 |
| 508 | 3300035691 | Ga0373931_0000022 | Ga0373931_0000022_85985_86242 | 84 |
| 509 | 3300035691 | Ga0373931_0562248 | Ga0373931_0562248_360_617 | 84 |
| 510 | 3300035695 | Ga0373927_0031428 | Ga0373927_0031428_942_1199 | 84 |
| 511 | 3300035725 | Ga0373947_0076748 | Ga0373947_0076748_1351_1608 | 84 |
| 512 | 3300036647 | Ga0316582_0074008 | Ga0316582_0074008_1310_1564 | 84 |
| 513 | 3300036712 | Ga0316584_0000836 | Ga0316584_0000836_14333_14599 | 84 |
| 514 | 3300036712 | Ga0316584_0007820 | Ga0316584_0007820_6855_7109 | 84 |
| 515 | 3300036712 | Ga0316584_0069518 | Ga0316584_0069518_1551_1805 | 84 |
| 516 | 3300036712 | Ga0316584_0723085 | Ga0316584_0723085_389_646 | 84 |
| 517 | 3300036712 | Ga0316584_0973403 | Ga0316584_0973403_189_446 | 84 |
| 518 | 3300036712 | Ga0316584_1139645 | Ga0316584_1139645_205_462 | 84 |
| 519 | 3300037068 | Ga0373925_0004578 | Ga0373925_0004578_9675_9932 | 84 |
| 520 | 3300037068 | Ga0373925_0818717 | Ga0373925_0818717_353_613 | 84 |
| 521 | 3300037418 | Ga0395900_0022542 | Ga0395900_0022542_1735_1995 | 84 |
| 522 | 3300037418 | Ga0395900_1609897 | Ga0395900_1609897_198_452 | 84 |
| 523 | 3300037471 | Ga0395905_0000007 | Ga0395905_0000007_249047_249307 | 84 |
| 524 | 3300037471 | Ga0395905_0006434 | Ga0395905_0006434_4152_4412 | 84 |
| 525 | 3300037853 | Ga0436364_0500701 | Ga0436364_0500701_121_387 | 84 |
| 526 | 3300037853 | Ga0436364_0987458 | Ga0436364_0987458_273_530 | 84 |
| 527 | 3300038443 | Ga0395901_0746351 | Ga0395901_0746351_697_951 | 84 |
| 528 | 3300038735 | Ga0400485_18280 | Ga0400485_18280_159_413 | 84 |
| 529 | 3300038735 | Ga0400485_19625 | Ga0400485_19625_2142_2396 | 84 |
| 530 | 3300039110 | Ga0400487_32587 | Ga0400487_32587_882_1136 | 84 |
| 531 | 3300039447 | Ga0436361_0930879 | Ga0436361_0930879_168_452 | 84 |
| 532 | 3300041404 | Ga0439436_0016276 | Ga0439436_0016276_421_675 | 84 |
| 533 | 3300041405 | Ga0439438_044338 | Ga0439438_044338_67_321 | 84 |
| 534 | 3300041407 | Ga0439447_085445 | Ga0439447_085445_427_681 | 84 |
| 535 | 3300041408 | Ga0439453_0095971 | Ga0439453_0095971_202_456 | 84 |
| 536 | 3300041410 | Ga0439461_0029082 | Ga0439461_0029082_260_514 | 84 |
| 537 | 3300041411 | Ga0439466_0081330 | Ga0439466_0081330_528_782 | 84 |
| 538 | 3300041413 | Ga0439465_0021828 | Ga0439465_0021828_595_849 | 84 |
| 539 | 3300041413 | Ga0439465_0099556 | Ga0439465_0099556_324_578 | 84 |
| 540 | 3300041443 | Ga0451789_0323420 | Ga0451789_0323420_197_451 | 84 |
| 541 | 3300041458 | Ga0451798_0082647 | Ga0451798_0082647_196_450 | 84 |
| 542 | 3300041486 | Ga0451807_1054893 | Ga0451807_1054893_437_706 | 84 |
| 543 | 3300041492 | Ga0451835_0171160 | Ga0451835_0171160_21_287 | 84 |
| 544 | 3300041492 | Ga0451835_0610512 | Ga0451835_0610512_123_392 | 84 |
| 545 | 3300041494 | Ga0451837_0313488 | Ga0451837_0313488_176_433 | 84 |
| 546 | 3300041507 | Ga0451851_0647234 | Ga0451851_0647234_181_459 | 84 |
| 547 | 3300041511 | Ga0451855_0049369 | Ga0451855_0049369_29_283 | 84 |
| 548 | 3300041512 | Ga0451853_1052247 | Ga0451853_1052247_244_501 | 84 |
| 549 | 3300041512 | Ga0451853_2024082 | Ga0451853_2024082_20_277 | 84 |
| 550 | 3300041997 | Ga0439431_0044634 | Ga0439431_0044634_254_508 | 84 |
| 551 | 3300042001 | Ga0439441_098197 | Ga0439441_098197_276_530 | 84 |
| 552 | 3300042003 | Ga0439443_028026 | Ga0439443_028026_282_536 | 84 |
| 553 | 3300042004 | Ga0439445_0215847 | Ga0439445_0215847_144_416 | 84 |
| 554 | 3300042005 | Ga0439448_0009654 | Ga0439448_0009654_816_1070 | 84 |
| 555 | 3300042008 | Ga0439450_018538 | Ga0439450_018538_525_779 | 84 |
| 556 | 3300042009 | Ga0439451_049945 | Ga0439451_049945_473_727 | 84 |
| 557 | 3300042010 | Ga0439452_033903 | Ga0439452_033903_801_1055 | 84 |
| 558 | 3300042010 | Ga0439452_064622 | Ga0439452_064622_311_565 | 84 |
| 559 | 3300042011 | Ga0439454_005383 | Ga0439454_005383_420_674 | 84 |
| 560 | 3300042012 | Ga0439455_0163356 | Ga0439455_0163356_207_461 | 84 |
| 561 | 3300042016 | Ga0439463_006807 | Ga0439463_006807_1683_1937 | 84 |
| 562 | 3300042142 | Ga0450905_085587 | Ga0450905_085587_146_400 | 84 |
| 563 | 3300042156 | Ga0439446_0140849 | Ga0439446_0140849_384_638 | 84 |
| 564 | 3300042435 | Ga0439434_0004926 | Ga0439434_0004926_2670_2924 | 84 |
| 565 | 3300042435 | Ga0439434_0016835 | Ga0439434_0016835_1537_1791 | 84 |
| 566 | 3300042439 | Ga0439464_0003015 | Ga0439464_0003015_1787_2041 | 84 |
| 567 | 3300042439 | Ga0439464_0271580 | Ga0439464_0271580_278_532 | 84 |
| 568 | 3300042533 | Ga0450901_015928 | Ga0450901_015928_346_600 | 84 |
| 569 | 3300042993 | Ga0439440_0003475 | Ga0439440_0003475_705_959 | 84 |
| 570 | 3300042993 | Ga0439440_0259250 | Ga0439440_0259250_199_453 | 84 |
| 571 | 3300044656 | Ga0466969_0062836 | Ga0466969_0062836_1415_1669 | 84 |
| 572 | 3300044684 | Ga0466966_0111492 | Ga0466966_0111492_497_751 | 84 |
| 573 | 3300044684 | Ga0466966_0816974 | Ga0466966_0816974_257_514 | 84 |
| 574 | 3300045836 | Ga0466958_1064496 | Ga0466958_1064496_92_346 | 84 |
| 575 | 3300045976 | Ga0466967_1820085 | Ga0466967_1820085_198_452 | 84 |
| 576 | 3300046455 | Ga0495603_0727564 | Ga0495603_0727564_256_510 | 84 |
| 577 | 3300046459 | Ga0495629_0152007 | Ga0495629_0152007_864_1133 | 84 |
| 578 | 3300046459 | Ga0495629_0153892 | Ga0495629_0153892_714_968 | 84 |
| 579 | 3300046459 | Ga0495629_0344632 | Ga0495629_0344632_342_596 | 84 |
| 580 | 3300046459 | Ga0495629_1152098 | Ga0495629_1152098_148_402 | 84 |
| 581 | 3300046461 | Ga0495641_0259339 | Ga0495641_0259339_397_654 | 84 |
| 582 | 3300046473 | Ga0495582_0146902 | Ga0495582_0146902_287_541 | 84 |
| 583 | 3300046473 | Ga0495582_0488008 | Ga0495582_0488008_108_362 | 84 |
| 584 | 3300046473 | Ga0495582_0638483 | Ga0495582_0638483_173_442 | 84 |
| 585 | 3300046476 | Ga0495662_0532100 | Ga0495662_0532100_266_520 | 84 |
| 586 | 3300046477 | Ga0495664_0767391 | Ga0495664_0767391_201_455 | 84 |
| 587 | 3300046514 | Ga0495618_0763917 | Ga0495618_0763917_236_493 | 84 |
| 588 | 3300046516 | Ga0495628_0185841 | Ga0495628_0185841_867_1124 | 84 |
| 589 | 3300046517 | Ga0495630_0062764 | Ga0495630_0062764_370_624 | 84 |
| 590 | 3300046517 | Ga0495630_0759359 | Ga0495630_0759359_461_715 | 84 |
| 591 | 3300046529 | Ga0495652_0771256 | Ga0495652_0771256_182_436 | 84 |
| 592 | 3300046535 | Ga0495586_0005559 | Ga0495586_0005559_2499_2753 | 84 |
| 593 | 3300046616 | Ga0495668_0435922 | Ga0495668_0435922_417_677 | 84 |
| 594 | 3300046642 | Ga0495634_0011499 | Ga0495634_0011499_4608_4862 | 84 |
| 595 | 3300046642 | Ga0495634_0724840 | Ga0495634_0724840_173_427 | 84 |
| 596 | 3300046663 | Ga0495635_0339894 | Ga0495635_0339894_71_325 | 84 |
| 597 | 3300046674 | Ga0495588_0417111 | Ga0495588_0417111_381_635 | 84 |
| 598 | 3300046681 | Ga0495647_0185539 | Ga0495647_0185539_519_773 | 84 |
| 599 | 3300046681 | Ga0495647_0432047 | Ga0495647_0432047_46_315 | 84 |
| 600 | 3300046683 | Ga0495658_0035790 | Ga0495658_0035790_2283_2552 | 84 |
| 601 | 3300046683 | Ga0495658_0185667 | Ga0495658_0185667_61_315 | 84 |
| 602 | 3300046689 | Ga0495613_0000239 | Ga0495613_0000239_20850_21104 | 84 |
| 603 | 3300046689 | Ga0495613_0156711 | Ga0495613_0156711_318_587 | 84 |
| 604 | 3300046690 | Ga0495624_0553907 | Ga0495624_0553907_356_610 | 84 |
| 605 | 3300047315 | Ga0495581_0427190 | Ga0495581_0427190_370_624 | 84 |
| 606 | 3300047317 | Ga0495604_1057029 | Ga0495604_1057029_199_453 | 84 |
| 607 | 3300047320 | Ga0495672_0000785 | Ga0495672_0000785_125_379 | 84 |
| 608 | 3300047320 | Ga0495672_0159553 | Ga0495672_0159553_724_981 | 84 |
| 609 | 3300047321 | Ga0495676_0280111 | Ga0495676_0280111_836_1096 | 84 |
| 610 | 3300047321 | Ga0495676_0439902 | Ga0495676_0439902_367_621 | 84 |
| 611 | 3300047322 | Ga0495680_0159608 | Ga0495680_0159608_462_716 | 84 |
| 612 | 3300047322 | Ga0495680_0202935 | Ga0495680_0202935_705_959 | 84 |
| 613 | 3300048089 | Ga0495614_0035750 | Ga0495614_0035750_1100_1369 | 84 |
| 614 | 3300048089 | Ga0495614_0187610 | Ga0495614_0187610_337_591 | 84 |
| 615 | 3300048907 | Ga0496104_0185724 | Ga0496104_0185724_524_802 | 84 |
| 616 | 3300048907 | Ga0496104_1189774 | Ga0496104_1189774_20_283 | 84 |
| 617 | 3300048907 | Ga0496104_1264840 | Ga0496104_1264840_214_489 | 84 |
| 618 | 3300048908 | Ga0496105_0588620 | Ga0496105_0588620_433_708 | 84 |
| 619 | 3300048911 | Ga0496108_0056403 | Ga0496108_0056403_2166_2444 | 84 |
| 620 | 3300048911 | Ga0496108_1213344 | Ga0496108_1213344_33_290 | 84 |
| 621 | 3300048912 | Ga0496109_0161568 | Ga0496109_0161568_418_696 | 84 |
| 622 | 3300048912 | Ga0496109_0807624 | Ga0496109_0807624_15_275 | 84 |
| 623 | 3300048912 | Ga0496109_1860099 | Ga0496109_1860099_125_403 | 84 |
| 624 | 3300048913 | Ga0496110_0147681 | Ga0496110_0147681_1100_1375 | 84 |
| 625 | 3300048913 | Ga0496110_0308210 | Ga0496110_0308210_657_911 | 84 |
| 626 | 3300048915 | Ga0496112_1111614 | Ga0496112_1111614_227_484 | 84 |
| 627 | 3300048915 | Ga0496112_1730185 | Ga0496112_1730185_18_293 | 84 |
| 628 | 3300048916 | Ga0496113_0167885 | Ga0496113_0167885_773_1051 | 84 |
| 629 | 3300048917 | Ga0496114_0288111 | Ga0496114_0288111_722_1000 | 84 |
| 630 | 3300048917 | Ga0496114_0773764 | Ga0496114_0773764_155_409 | 84 |
| 631 | 3300048917 | Ga0496114_0807036 | Ga0496114_0807036_71_325 | 84 |
| 632 | 3300048917 | Ga0496114_0896667 | Ga0496114_0896667_433_687 | 84 |
| 633 | 3300049568 | Ga0501031_0044900 | Ga0501031_0044900_288_542 | 84 |
| 634 | 3300049568 | Ga0501031_0190847 | Ga0501031_0190847_1045_1299 | 84 |
| 635 | 3300049568 | Ga0501031_0227059 | Ga0501031_0227059_331_585 | 84 |
| 636 | 3300049569 | Ga0501032_0168272 | Ga0501032_0168272_1003_1257 | 84 |
| 637 | 3300049570 | Ga0501033_0001944 | Ga0501033_0001944_10217_10471 | 84 |
| 638 | 3300049570 | Ga0501033_0027002 | Ga0501033_0027002_1454_1708 | 84 |
| 639 | 3300049570 | Ga0501033_0574636 | Ga0501033_0574636_430_684 | 84 |
| 640 | 3300049570 | Ga0501033_0600183 | Ga0501033_0600183_176_430 | 84 |
| 641 | 3300049570 | Ga0501033_0859619 | Ga0501033_0859619_298_561 | 84 |
| 642 | 3300049571 | Ga0501034_0000723 | Ga0501034_0000723_22535_22789 | 84 |
| 643 | 3300049571 | Ga0501034_0095563 | Ga0501034_0095563_2364_2618 | 84 |
| 644 | 3300049571 | Ga0501034_0157225 | Ga0501034_0157225_1766_2020 | 84 |
| 645 | 3300049571 | Ga0501034_0755766 | Ga0501034_0755766_177_437 | 84 |
| 646 | 3300049571 | Ga0501034_0958494 | Ga0501034_0958494_122_376 | 84 |
| 647 | 3300049571 | Ga0501034_1559769 | Ga0501034_1559769_25_279 | 84 |
| 648 | 3300049572 | Ga0501036_0131343 | Ga0501036_0131343_423_677 | 84 |
| 649 | 3300049572 | Ga0501036_0270763 | Ga0501036_0270763_1069_1323 | 84 |
| 650 | 3300049572 | Ga0501036_0322265 | Ga0501036_0322265_994_1248 | 84 |
| 651 | 3300049572 | Ga0501036_0829254 | Ga0501036_0829254_233_487 | 84 |
| 652 | 3300049572 | Ga0501036_1641915 | Ga0501036_1641915_253_507 | 84 |
| 653 | 3300049573 | Ga0501037_0036090 | Ga0501037_0036090_2365_2619 | 84 |
| 654 | 3300049573 | Ga0501037_1061893 | Ga0501037_1061893_14_271 | 84 |
| 655 | 3300049574 | Ga0501038_0558997 | Ga0501038_0558997_570_824 | 84 |
| 656 | 3300049574 | Ga0501038_0656242 | Ga0501038_0656242_394_648 | 84 |
| 657 | 3300049574 | Ga0501038_0787459 | Ga0501038_0787459_402_656 | 84 |
| 658 | 3300049575 | Ga0501039_0021598 | Ga0501039_0021598_2076_2330 | 84 |
| 659 | 3300049575 | Ga0501039_0116514 | Ga0501039_0116514_784_1038 | 84 |
| 660 | 3300049575 | Ga0501039_0142200 | Ga0501039_0142200_1359_1613 | 84 |
| 661 | 3300049575 | Ga0501039_0319675 | Ga0501039_0319675_212_466 | 84 |
| 662 | 3300049576 | Ga0501040_0002361 | Ga0501040_0002361_9457_9711 | 84 |
| 663 | 3300049576 | Ga0501040_0037530 | Ga0501040_0037530_401_655 | 84 |
| 664 | 3300049576 | Ga0501040_0179095 | Ga0501040_0179095_1012_1266 | 84 |
| 665 | 3300049576 | Ga0501040_0315028 | Ga0501040_0315028_669_923 | 84 |
| 666 | 3300049577 | Ga0501041_0012177 | Ga0501041_0012177_219_473 | 84 |
| 667 | 3300049577 | Ga0501041_0068902 | Ga0501041_0068902_1500_1754 | 84 |
| 668 | 3300049577 | Ga0501041_0266706 | Ga0501041_0266706_715_969 | 84 |
| 669 | 3300049577 | Ga0501041_0738147 | Ga0501041_0738147_192_446 | 84 |
| 670 | 3300049578 | Ga0501042_0024505 | Ga0501042_0024505_2398_2652 | 84 |
| 671 | 3300049578 | Ga0501042_0028809 | Ga0501042_0028809_290_544 | 84 |
| 672 | 3300049578 | Ga0501042_0305834 | Ga0501042_0305834_122_376 | 84 |
| 673 | 3300049578 | Ga0501042_0308021 | Ga0501042_0308021_839_1093 | 84 |
| 674 | 3300049578 | Ga0501042_0440303 | Ga0501042_0440303_665_919 | 84 |
| 675 | 3300049578 | Ga0501042_1424257 | Ga0501042_1424257_10_264 | 84 |
| 676 | 3300049578 | Ga0501042_1438933 | Ga0501042_1438933_27_293 | 84 |
| 677 | 3300049579 | Ga0501043_0237836 | Ga0501043_0237836_422_676 | 84 |
| 678 | 3300049579 | Ga0501043_0557315 | Ga0501043_0557315_252_506 | 84 |
| 679 | 3300049580 | Ga0501046_0051785 | Ga0501046_0051785_1716_1970 | 84 |
| 680 | 3300049580 | Ga0501046_0119658 | Ga0501046_0119658_1722_1976 | 84 |
| 681 | 3300049580 | Ga0501046_0522081 | Ga0501046_0522081_357_611 | 84 |
| 682 | 3300049581 | Ga0501047_0125874 | Ga0501047_0125874_844_1098 | 84 |
| 683 | 3300049581 | Ga0501047_0544965 | Ga0501047_0544965_720_974 | 84 |
| 684 | 3300049582 | Ga0501048_0033877 | Ga0501048_0033877_2977_3231 | 84 |
| 685 | 3300049582 | Ga0501048_0633896 | Ga0501048_0633896_420_674 | 84 |
| 686 | 3300049583 | Ga0501067_0003698 | Ga0501067_0003698_6119_6373 | 84 |
| 687 | 3300049584 | Ga0501068_0029803 | Ga0501068_0029803_1069_1323 | 84 |
| 688 | 3300049584 | Ga0501068_0118569 | Ga0501068_0118569_786_1043 | 84 |
| 689 | 3300049584 | Ga0501068_0184925 | Ga0501068_0184925_198_452 | 84 |
| 690 | 3300049584 | Ga0501068_0487409 | Ga0501068_0487409_366_620 | 84 |
| 691 | 3300049584 | Ga0501068_0714304 | Ga0501068_0714304_138_392 | 84 |
| 692 | 3300049584 | Ga0501068_0732288 | Ga0501068_0732288_320_574 | 84 |
| 693 | 3300049584 | Ga0501068_1194632 | Ga0501068_1194632_194_448 | 84 |
| 694 | 3300049585 | Ga0501069_0000044 | Ga0501069_0000044_68096_68368 | 84 |
| 695 | 3300049585 | Ga0501069_0009790 | Ga0501069_0009790_4524_4778 | 84 |
| 696 | 3300049585 | Ga0501069_0012202 | Ga0501069_0012202_1704_1958 | 84 |
| 697 | 3300049585 | Ga0501069_0212172 | Ga0501069_0212172_369_623 | 84 |
| 698 | 3300049585 | Ga0501069_0414867 | Ga0501069_0414867_47_304 | 84 |
| 699 | 3300049585 | Ga0501069_0549518 | Ga0501069_0549518_49_303 | 84 |
| 700 | 3300049586 | Ga0501070_0000001 | Ga0501070_0000001_219381_219653 | 84 |
| 701 | 3300049586 | Ga0501070_0475456 | Ga0501070_0475456_69_323 | 84 |
| 702 | 3300049587 | Ga0501071_0018635 | Ga0501071_0018635_694_948 | 84 |
| 703 | 3300049587 | Ga0501071_0022391 | Ga0501071_0022391_612_866 | 84 |
| 704 | 3300049587 | Ga0501071_0115980 | Ga0501071_0115980_1229_1483 | 84 |
| 705 | 3300049587 | Ga0501071_0232931 | Ga0501071_0232931_1046_1300 | 84 |
| 706 | 3300049587 | Ga0501071_0301444 | Ga0501071_0301444_505_759 | 84 |
| 707 | 3300049587 | Ga0501071_0385119 | Ga0501071_0385119_136_408 | 84 |
| 708 | 3300049587 | Ga0501071_0430775 | Ga0501071_0430775_381_635 | 84 |
| 709 | 3300049587 | Ga0501071_1050866 | Ga0501071_1050866_242_496 | 84 |
| 710 | 3300049588 | Ga0501072_0003214 | Ga0501072_0003214_9465_9719 | 84 |
| 711 | 3300049588 | Ga0501072_0101145 | Ga0501072_0101145_1790_2044 | 84 |
| 712 | 3300049588 | Ga0501072_0647302 | Ga0501072_0647302_250_504 | 84 |
| 713 | 3300049588 | Ga0501072_0672592 | Ga0501072_0672592_354_608 | 84 |
| 714 | 3300049588 | Ga0501072_0769203 | Ga0501072_0769203_100_366 | 84 |
| 715 | 3300049589 | Ga0501073_0001297 | Ga0501073_0001297_8554_8808 | 84 |
| 716 | 3300049589 | Ga0501073_0313607 | Ga0501073_0313607_444_698 | 84 |
| 717 | 3300049589 | Ga0501073_1005569 | Ga0501073_1005569_23_277 | 84 |
| 718 | 3300049590 | Ga0501074_0052506 | Ga0501074_0052506_1985_2239 | 84 |
| 719 | 3300049590 | Ga0501074_0063498 | Ga0501074_0063498_866_1138 | 84 |
| 720 | 3300049590 | Ga0501074_0074240 | Ga0501074_0074240_1220_1474 | 84 |
| 721 | 3300049590 | Ga0501074_0154350 | Ga0501074_0154350_820_1074 | 84 |
| 722 | 3300049591 | Ga0501075_0036644 | Ga0501075_0036644_2942_3196 | 84 |
| 723 | 3300049591 | Ga0501075_0040524 | Ga0501075_0040524_572_826 | 84 |
| 724 | 3300049591 | Ga0501075_0205791 | Ga0501075_0205791_1075_1329 | 84 |
| 725 | 3300049591 | Ga0501075_0332280 | Ga0501075_0332280_687_941 | 84 |
| 726 | 3300049591 | Ga0501075_0859084 | Ga0501075_0859084_405_659 | 84 |
| 727 | 3300049591 | Ga0501075_1475047 | Ga0501075_1475047_141_395 | 84 |
| 728 | 3300049592 | Ga0501076_0002575 | Ga0501076_0002575_2743_2997 | 84 |
| 729 | 3300049592 | Ga0501076_0153094 | Ga0501076_0153094_68_322 | 84 |
| 730 | 3300049592 | Ga0501076_0276981 | Ga0501076_0276981_499_753 | 84 |
| 731 | 3300049592 | Ga0501076_0429255 | Ga0501076_0429255_206_460 | 84 |
| 732 | 3300049592 | Ga0501076_1102197 | Ga0501076_1102197_337_591 | 84 |
| 733 | 3300049592 | Ga0501076_1539431 | Ga0501076_1539431_276_530 | 84 |
| 734 | 3300049593 | Ga0501077_0024932 | Ga0501077_0024932_1348_1602 | 84 |
| 735 | 3300049593 | Ga0501077_0026413 | Ga0501077_0026413_357_611 | 84 |
| 736 | 3300049593 | Ga0501077_0611066 | Ga0501077_0611066_100_354 | 84 |
| 737 | 3300049741 | Ga0501079_0004476 | Ga0501079_0004476_10056_10310 | 84 |
| 738 | 3300049741 | Ga0501079_0030769 | Ga0501079_0030769_2382_2636 | 84 |
| 739 | 3300049741 | Ga0501079_0117657 | Ga0501079_0117657_431_685 | 84 |
| 740 | 3300049741 | Ga0501079_0314780 | Ga0501079_0314780_911_1165 | 84 |
| 741 | 3300049741 | Ga0501079_1207667 | Ga0501079_1207667_28_282 | 84 |
| 742 | 3300049742 | Ga0501080_0006808 | Ga0501080_0006808_7749_8021 | 84 |
| 743 | 3300049742 | Ga0501080_0135968 | Ga0501080_0135968_950_1216 | 84 |
| 744 | 3300049742 | Ga0501080_1799368 | Ga0501080_1799368_222_476 | 84 |
| 745 | 3300049743 | Ga0501081_0048001 | Ga0501081_0048001_2616_2870 | 84 |
| 746 | 3300049743 | Ga0501081_0667354 | Ga0501081_0667354_294_548 | 84 |
| 747 | 3300049744 | Ga0501083_0000154 | Ga0501083_0000154_30905_31159 | 84 |
| 748 | 3300049744 | Ga0501083_0024299 | Ga0501083_0024299_2713_2967 | 84 |
| 749 | 3300049744 | Ga0501083_0053285 | Ga0501083_0053285_183_437 | 84 |
| 750 | 3300049744 | Ga0501083_0371774 | Ga0501083_0371774_146_400 | 84 |
| 751 | 3300049744 | Ga0501083_0451807 | Ga0501083_0451807_482_736 | 84 |
| 752 | 3300049822 | Ga0501035_0186752 | Ga0501035_0186752_465_719 | 84 |
| 753 | 3300049822 | Ga0501035_0485201 | Ga0501035_0485201_326_580 | 84 |
| 754 | 3300049822 | Ga0501035_0725118 | Ga0501035_0725118_16_270 | 84 |
| 755 | 3300049822 | Ga0501035_1035463 | Ga0501035_1035463_90_344 | 84 |
| 756 | 3300049823 | Ga0501044_0003702 | Ga0501044_0003702_10256_10510 | 84 |
| 757 | 3300049823 | Ga0501044_0195036 | Ga0501044_0195036_961_1215 | 84 |
| 758 | 3300049823 | Ga0501044_1131417 | Ga0501044_1131417_219_473 | 84 |
| 759 | 3300049824 | Ga0501045_0002942 | Ga0501045_0002942_10039_10293 | 84 |
| 760 | 3300049824 | Ga0501045_0249423 | Ga0501045_0249423_419_673 | 84 |
| 761 | 3300049824 | Ga0501045_0614074 | Ga0501045_0614074_17_271 | 84 |
| 762 | 3300049824 | Ga0501045_1196664 | Ga0501045_1196664_281_535 | 84 |
| 763 | 3300050489 | nmdc:mga03683_319695_c1 | nmdc:mga03683_319695_c1_33_287 | 84 |
| 764 | 3300050490 | nmdc:mga03n38_146764_c1 | nmdc:mga03n38_146764_c1_181_435 | 84 |
| 765 | 3300050490 | nmdc:mga03n38_279749_c1 | nmdc:mga03n38_279749_c1_409_663 | 84 |
| 766 | 3300050490 | nmdc:mga03n38_393214_c1 | nmdc:mga03n38_393214_c1_425_679 | 84 |
| 767 | 3300050490 | nmdc:mga03n38_848994_c1 | nmdc:mga03n38_848994_c1_203_457 | 84 |
| 768 | 3300050490 | nmdc:mga03n38_93673_c1 | nmdc:mga03n38_93673_c1_510_764 | 84 |
| 769 | 3300050490 | nmdc:mga03n38_954088_c1 | nmdc:mga03n38_954088_c1_208_462 | 84 |
| 770 | 3300050491 | nmdc:mga00v17_204305_c1 | nmdc:mga00v17_204305_c1_162_416 | 84 |
| 771 | 3300050491 | nmdc:mga00v17_267005_c1 | nmdc:mga00v17_267005_c1_252_506 | 84 |
| 772 | 3300050491 | nmdc:mga00v17_273816_c1 | nmdc:mga00v17_273816_c1_31_285 | 84 |
| 773 | 3300050492 | nmdc:mga0yw44_105983_c1 | nmdc:mga0yw44_105983_c1_721_975 | 84 |
| 774 | 3300050492 | nmdc:mga0yw44_1093801_c1 | nmdc:mga0yw44_1093801_c1_210_464 | 84 |
| 775 | 3300050492 | nmdc:mga0yw44_160570_c1 | nmdc:mga0yw44_160570_c1_337_591 | 84 |
| 776 | 3300050492 | nmdc:mga0yw44_180717_c1 | nmdc:mga0yw44_180717_c1_607_864 | 84 |
| 777 | 3300050492 | nmdc:mga0yw44_232880_c1 | nmdc:mga0yw44_232880_c1_917_1171 | 84 |
| 778 | 3300050492 | nmdc:mga0yw44_83427_c1 | nmdc:mga0yw44_83427_c1_1442_1696 | 84 |
| 779 | 3300050494 | nmdc:mga06z11_470119_c1 | nmdc:mga06z11_470119_c1_220_474 | 84 |
| 780 | 3300050494 | nmdc:mga06z11_55458_c1 | nmdc:mga06z11_55458_c1_1164_1418 | 84 |
| 781 | 3300050495 | nmdc:mga04h51_256637_c1 | nmdc:mga04h51_256637_c1_35_289 | 84 |
| 782 | 3300050495 | nmdc:mga04h51_462409_c1 | nmdc:mga04h51_462409_c1_203_457 | 84 |
| 783 | 3300050495 | nmdc:mga04h51_487974_c1 | nmdc:mga04h51_487974_c1_233_487 | 84 |
| 784 | 3300050495 | nmdc:mga04h51_90142_c1 | nmdc:mga04h51_90142_c1_589_843 | 84 |
| 785 | 3300050496 | nmdc:mga07m45_234186_c1 | nmdc:mga07m45_234186_c1_53_307 | 84 |
| 786 | 3300050496 | nmdc:mga07m45_256002_c1 | nmdc:mga07m45_256002_c1_584_838 | 84 |
| 787 | 3300050507 | nmdc:mga05p37_352276_c1 | nmdc:mga05p37_352276_c1_519_773 | 84 |
| 788 | 3300050507 | nmdc:mga05p37_455123_c1 | nmdc:mga05p37_455123_c1_843_1100 | 84 |
| 789 | 3300050507 | nmdc:mga05p37_6515_c1 | nmdc:mga05p37_6515_c1_2259_2513 | 84 |
| 790 | 3300050507 | nmdc:mga05p37_7437_c2 | nmdc:mga05p37_7437_c2_1684_1944 | 84 |
| 791 | 3300050508 | nmdc:mga09592_2389_c1 | nmdc:mga09592_2389_c1_660_914 | 84 |
| 792 | 3300050508 | nmdc:mga09592_490308_c1 | nmdc:mga09592_490308_c1_342_596 | 84 |
| 793 | 3300050509 | nmdc:mga0qj67_163592_c1 | nmdc:mga0qj67_163592_c1_78_335 | 84 |
| 794 | 3300050509 | nmdc:mga0qj67_169276_c1 | nmdc:mga0qj67_169276_c1_967_1221 | 84 |
| 795 | 3300050509 | nmdc:mga0qj67_355247_c1 | nmdc:mga0qj67_355247_c1_575_829 | 84 |
| 796 | 3300050509 | nmdc:mga0qj67_613619_c1 | nmdc:mga0qj67_613619_c1_31_288 | 84 |
| 797 | 3300050510 | nmdc:mga06r32_142969_c1 | nmdc:mga06r32_142969_c1_1655_1909 | 84 |
| 798 | 3300050510 | nmdc:mga06r32_1526743_c1 | nmdc:mga06r32_1526743_c1_258_512 | 84 |
| 799 | 3300050510 | nmdc:mga06r32_24152_c1 | nmdc:mga06r32_24152_c1_3670_3924 | 84 |
| 800 | 3300050510 | nmdc:mga06r32_52214_c1 | nmdc:mga06r32_52214_c1_129_386 | 84 |
| 801 | 3300050511 | nmdc:mga08y16_1076181_c1 | nmdc:mga08y16_1076181_c1_71_325 | 84 |
| 802 | 3300050511 | nmdc:mga08y16_640105_c1 | nmdc:mga08y16_640105_c1_460_714 | 84 |
| 803 | 3300050512 | nmdc:mga0n895_1372021_c1 | nmdc:mga0n895_1372021_c1_251_508 | 84 |
| 804 | 3300050513 | nmdc:mga0rr50_1043450_c1 | nmdc:mga0rr50_1043450_c1_161_466 | 84 |
| 805 | 3300053077 | Ga0495601_0110026 | Ga0495601_0110026_1392_1649 | 84 |
| 806 | 3300053078 | Ga0495612_0387843 | Ga0495612_0387843_40_297 | 84 |
| 807 | 3300053084 | Ga0495595_0252104 | Ga0495595_0252104_140_409 | 84 |
| 808 | 3300053084 | Ga0495595_0289116 | Ga0495595_0289116_227_481 | 84 |
| 809 | 3300053092 | Ga0500583_0110976 | Ga0500583_0110976_323_577 | 84 |
| 810 | 3300053094 | Ga0500566_0000098 | Ga0500566_0000098_563_817 | 84 |
| 811 | 3300053117 | Ga0500593_193474 | Ga0500593_193474_151_408 | 84 |
| 812 | 3300053139 | Ga0500568_0000182 | Ga0500568_0000182_27437_27691 | 84 |
| 813 | 3300053150 | Ga0500603_246643 | Ga0500603_246643_308_562 | 84 |
| 814 | 3300053153 | Ga0500616_0048061 | Ga0500616_0048061_10_264 | 84 |
| 815 | 3300054114 | Ga0501084_0004656 | Ga0501084_0004656_2401_2655 | 84 |
| 816 | 3300054114 | Ga0501084_0027474 | Ga0501084_0027474_1433_1687 | 84 |
| 817 | 3300054114 | Ga0501084_0268354 | Ga0501084_0268354_466_720 | 84 |
| 818 | 3300054114 | Ga0501084_0305235 | Ga0501084_0305235_766_1020 | 84 |
| 819 | 3300054114 | Ga0501084_0507985 | Ga0501084_0507985_354_608 | 84 |
| 820 | 3300054114 | Ga0501084_0796754 | Ga0501084_0796754_158_442 | 84 |
| 821 | 3300054114 | Ga0501084_0924940 | Ga0501084_0924940_336_590 | 84 |
| 822 | 3300054114 | Ga0501084_1084435 | Ga0501084_1084435_368_622 | 84 |
| 823 | 3300054114 | Ga0501084_1278483 | Ga0501084_1278483_10_264 | 84 |
| 824 | 3300054114 | Ga0501084_1525640 | Ga0501084_1525640_288_542 | 84 |
| 825 | 3300059421 | Ga0590071_218751 | Ga0590071_218751_165_419 | 84 |
| 826 | 3300059607 | Ga0587125_075748 | Ga0587125_075748_94_348 | 84 |
| 827 | 3300059630 | Ga0587128_073125 | Ga0587128_073125_397_651 | 84 |
| 828 | 3300059652 | Ga0587107_069996 | Ga0587107_069996_293_550 | 84 |
| 829 | 3300060346 | Ga0587111_0186347 | Ga0587111_0186347_301_558 | 84 |
| 830 | 3300060353 | Ga0501082_0036497 | Ga0501082_0036497_1408_1662 | 84 |
| 831 | 3300060353 | Ga0501082_0078741 | Ga0501082_0078741_2249_2503 | 84 |
| 832 | 3300060353 | Ga0501082_0353740 | Ga0501082_0353740_288_554 | 84 |
| 833 | 3300060353 | Ga0501082_0477484 | Ga0501082_0477484_59_313 | 84 |
| 834 | 3300060353 | Ga0501082_0506996 | Ga0501082_0506996_402_656 | 84 |
| 835 | 3300060353 | Ga0501082_1016097 | Ga0501082_1016097_400_654 | 84 |
| 836 | 3300060353 | Ga0501082_1244564 | Ga0501082_1244564_102_356 | 84 |
| 837 | 3300060353 | Ga0501082_1976253 | Ga0501082_1976253_14_268 | 84 |
| 838 | 3300060353 | Ga0501082_1983771 | Ga0501082_1983771_14_280 | 84 |
| 839 | 3300061719 | Ga0466962_0749561 | Ga0466962_0749561_124_378 | 84 |
| 840 | 3300061734 | Ga0530510_0021851 | Ga0530510_0021851_2806_3060 | 84 |
| 841 | 3300061734 | Ga0530510_0170452 | Ga0530510_0170452_203_457 | 84 |
| 842 | 3300061734 | Ga0530510_0853216 | Ga0530510_0853216_142_396 | 84 |
| 843 | 3300061734 | Ga0530510_0999835 | Ga0530510_0999835_216_470 | 84 |
| 844 | 3300061734 | Ga0530510_1450423 | Ga0530510_1450423_251_511 | 84 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6ywy-assembly1.cif.gz_R | the structure of the mitoribosome from neurospora crassa with bound trna at the p-site | 0.9589 | 19 | 81 |
| 6yws-assembly1.cif.gz_R | the structure of the large subunit of the mitoribosome from neurospora crassa | 0.9568 | 19 | 81 |
| 7pkt-assembly1.cif.gz_u | large subunit of the chlamydomonas reinhardtii mitoribosome | 0.9527 | 18 | 82 |
| 6ywv-assembly1.cif.gz_R | the structure of the atp25 bound assembly intermediate of the mitoribosome from neurospora crassa | 0.9488 | 19 | 81 |
| 1v8q-assembly1.cif.gz_A | crystal structure of ribosomal protein l27 from thermus thermophilus hb8 | 0.9333 | 20 | 84 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1v8qA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9333 | 20 | 84 | 2.40.50.100 |
| 1v8qA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9065 | 20 | 84 | 2.40.50.100 |
| af_C0Z3L6_20_123_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9055 | 17 | 84 | 2.40.50.100 |
| 2ba1A01 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.857 | 30 | 84 | 2.40.50.100 |
| af_Q8IBQ2_8_59_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.84 | 29 | 82 | 2.40.50.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D3VUF3-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9876 | 23 | 84 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A421K8E4-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9835 | 21 | 84 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A7Y5TEY2-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9763 | 19 | 84 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A847H8S3-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9741 | 21 | 84 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A420Z9C1-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9705 | 19 | 83 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar