F483228

General Info

Members Datasets Scaffolds Average Seq Length
844 355 844 85

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0859619|Ga0501033_0859619_298_561
Length 87
Sequence MASKKAAGSTKNGRDSQSKRLGVKRFGGQFVLPGTIIIRQRGSKFHVGRNVRMGRDFTIYAVAEGQVKFERVNKDKFKVSVYPKSVA

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
94 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
98 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
99 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
100 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
139 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
140 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
141 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
142 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
146 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
147 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
148 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
149 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
150 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
151 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
152 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
153 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
154 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
155 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
159 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
160 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
161 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
162 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
163 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
169 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
170 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
171 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
172 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
173 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
174 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
175 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
176 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
177 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
178 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
179 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
180 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
181 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
182 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
183 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
184 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
185 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
186 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
187 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
189 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
190 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
191 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
192 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
193 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
194 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
195 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
196 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
197 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
198 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
199 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
200 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
201 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
202 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
203 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
204 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
205 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
206 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
207 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
208 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
209 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
210 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
211 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
212 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
213 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
214 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
215 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
216 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
217 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
218 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
219 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
220 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
221 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
222 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
223 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
224 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
225 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
226 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
227 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
228 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
229 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
230 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
231 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
232 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
233 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
234 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
235 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
236 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
237 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
238 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
239 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
240 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
241 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
242 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
243 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
244 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
245 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
246 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
247 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
248 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
249 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
250 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
251 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
252 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
253 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
254 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
255 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
256 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
257 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
258 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
259 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
260 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
261 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
262 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
263 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
264 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
265 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
266 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
267 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
268 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
269 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
270 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
271 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
272 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
273 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
274 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
275 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
276 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
277 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
278 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
279 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
280 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
281 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
282 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
283 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
284 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
285 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
286 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
287 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
288 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
289 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
290 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
306 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
307 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
308 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
309 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
310 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
311 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
312 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
313 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
314 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
315 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
316 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
317 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
318 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
319 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
320 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
323 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
324 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
325 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
326 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
327 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
328 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
329 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
330 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
331 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
332 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
333 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
334 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
335 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
336 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
337 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
338 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
339 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
340 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
341 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
342 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
343 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
344 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
345 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
346 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
347 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
348 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
349 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
352 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
354 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
355 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.38
Metatranscriptomes 4.62
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.9
Nodule 0
Rhizoplane 4.03
Rhizosphere 81.4
Stem 0
Stem Tuber 0
Unclassified 3.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10002455 3300003373 Bacteria 4365
2 JGI25405J52794_10012367 3300003911 Bacteria 1643
3 Ga0058863_11585879 3300004799 Bacteria 573
4 Ga0068868_100560352 3300005338 Bacteria 1008
5 Ga0070660_100520149 3300005339 Bacteria 991
6 Ga0070689_101603487 3300005340 Bacteria 591
7 Ga0070668_100149775 3300005347 Bacteria 1886
8 Ga0070668_101180590 3300005347 Bacteria 693
9 Ga0070675_100142130 3300005354 Bacteria 2052
10 Ga0070671_100012872 3300005355 Bacteria 6745
11 Ga0070671_100878342 3300005355 Bacteria 783
12 Ga0070674_100393756 3300005356 Bacteria 1130
13 Ga0070674_100549119 3300005356 Bacteria 969
14 Ga0070673_100774295 3300005364 Bacteria 885
15 Ga0070673_100919186 3300005364 Bacteria 812
16 Ga0070673_101599679 3300005364 Bacteria 616
17 Ga0070688_100532259 3300005365 Bacteria 891
18 Ga0070688_101630180 3300005365 Bacteria 527
19 Ga0070667_100363602 3300005367 Bacteria 1312
20 Ga0070667_101297558 3300005367 Bacteria 682
21 Ga0070714_100152956 3300005435 Bacteria 2080
22 Ga0070714_101582351 3300005435 Bacteria 640
23 Ga0070713_101615909 3300005436 Bacteria 629
24 Ga0070710_11529057 3300005437 Bacteria 502
25 Ga0070711_100768928 3300005439 Bacteria 815
26 Ga0070700_100412032 3300005441 Bacteria 1019
27 Ga0070700_101848570 3300005441 Bacteria 521
28 Ga0070694_101419629 3300005444 Bacteria 586
29 Ga0070708_100013011 3300005445 Bacteria 6800
30 Ga0070678_100762466 3300005456 Bacteria 876
31 Ga0070678_101246724 3300005456 Bacteria 691
32 Ga0070681_10280899 3300005458 Bacteria 1576
33 Ga0068867_100835803 3300005459 Bacteria 824
34 Ga0068867_101873828 3300005459 Bacteria 565
35 Ga0070706_100263522 3300005467 Bacteria 1609
36 Ga0070699_100084446 3300005518 Bacteria 2771
37 Ga0070699_102202719 3300005518 Bacteria 503
38 Ga0070679_100869378 3300005530 Bacteria 845
39 Ga0070684_100685688 3300005535 Bacteria 955
40 Ga0070697_101036572 3300005536 Bacteria 730
41 Ga0070697_101428563 3300005536 Bacteria 618
42 Ga0068853_100488991 3300005539 Bacteria 1161
43 Ga0070686_101493663 3300005544 Bacteria 569
44 Ga0070704_100632936 3300005549 Bacteria 943
45 Ga0070704_101018444 3300005549 Bacteria 749
46 Ga0068854_100459404 3300005578 Bacteria 1065
47 Ga0068856_100496084 3300005614 Bacteria 1242
48 Ga0068856_101967424 3300005614 Bacteria 595
49 Ga0070702_100938899 3300005615 Bacteria 680
50 Ga0068852_100438494 3300005616 Bacteria 1291
51 Ga0068859_100257887 3300005617 Bacteria 1834
52 Ga0068859_101029810 3300005617 Bacteria 904
53 Ga0068861_100031746 3300005719 Bacteria 3883
54 Ga0068861_102466385 3300005719 Bacteria 523
55 Ga0068870_10644374 3300005840 Bacteria 725
56 Ga0068863_100799032 3300005841 Bacteria 941
57 Ga0068858_100667069 3300005842 Bacteria 1011
58 Ga0068858_102170828 3300005842 Bacteria 549
59 Ga0068860_101601005 3300005843 Bacteria 673
60 Ga0081455_10001010 3300005937 Bacteria 35609
61 Ga0081455_10085566 3300005937 Bacteria 2571
62 Ga0081455_10090442 3300005937 Bacteria 2482
63 Ga0081455_10218693 3300005937 Bacteria 1414
64 Ga0081538_10000291 3300005981 Bacteria 57529
65 Ga0081538_10003721 3300005981 Bacteria 14312
66 Ga0081538_10076270 3300005981 Bacteria 1813
67 Ga0081540_1334971 3300005983 Bacteria 518
68 Ga0070717_10733769 3300006028 Bacteria 898
69 Ga0075365_10007031 3300006038 Bacteria 6265
70 Ga0075365_10085467 3300006038 Bacteria 2143
71 Ga0075365_10117420 3300006038 Bacteria 1833
72 Ga0075365_10177594 3300006038 Bacteria 1488
73 Ga0075365_10197118 3300006038 Bacteria 1410
74 Ga0075365_10300961 3300006038 Bacteria 1129
75 Ga0075365_10365571 3300006038 Bacteria 1017
76 Ga0075365_10552168 3300006038 Bacteria 815
77 Ga0075365_10880009 3300006038 Bacteria 632
78 Ga0075368_10106482 3300006042 Bacteria 1154
79 Ga0075368_10165038 3300006042 Bacteria 929
80 Ga0075363_100248941 3300006048 Bacteria 1023
81 Ga0075363_100328801 3300006048 Bacteria 890
82 Ga0075363_100405652 3300006048 Bacteria 801
83 Ga0075363_100411346 3300006048 Bacteria 796
84 Ga0075363_100927299 3300006048 Bacteria 534
85 Ga0075363_101022817 3300006048 Bacteria 510
86 Ga0075364_10010043 3300006051 Bacteria 5702
87 Ga0075364_10045406 3300006051 Bacteria 2859
88 Ga0075364_10162037 3300006051 Bacteria 1510
89 Ga0075364_10178904 3300006051 Bacteria 1435
90 Ga0075364_10252109 3300006051 Bacteria 1199
91 Ga0075364_10330829 3300006051 Bacteria 1038
92 Ga0075364_10490547 3300006051 Bacteria 840
93 Ga0075364_10500995 3300006051 Bacteria 830
94 Ga0075364_10744273 3300006051 Bacteria 669
95 Ga0070712_100908845 3300006175 Bacteria 759
96 Ga0075362_10094242 3300006177 Bacteria 1393
97 Ga0075362_10396908 3300006177 Bacteria 695
98 Ga0075362_10616574 3300006177 Bacteria 561
99 Ga0075367_10031451 3300006178 Bacteria 3047
100 Ga0075367_10264238 3300006178 Bacteria 1080
101 Ga0075367_10373588 3300006178 Bacteria 901
102 Ga0075367_10378820 3300006178 Bacteria 894
103 Ga0075367_10791527 3300006178 Bacteria 604
104 Ga0075367_10835265 3300006178 Bacteria 587
105 Ga0075367_10936652 3300006178 Bacteria 553
106 Ga0075366_10654326 3300006195 Bacteria 652
107 Ga0075370_10190304 3300006353 Bacteria 1209
108 Ga0075370_10296550 3300006353 Bacteria 961
109 Ga0075370_10598358 3300006353 Bacteria 668
110 Ga0075370_10892830 3300006353 Bacteria 543
111 Ga0075428_100000156 3300006844 Bacteria 62057
112 Ga0075428_100000395 3300006844 Bacteria 43162
113 Ga0075428_100085116 3300006844 Bacteria 3448
114 Ga0075428_100174546 3300006844 Bacteria 2328
115 Ga0075428_100363280 3300006844 Bacteria 1553
116 Ga0075430_100001345 3300006846 Bacteria 19880
117 Ga0075430_100026748 3300006846 Bacteria 4906
118 Ga0075430_100108920 3300006846 Bacteria 2310
119 Ga0075430_100138927 3300006846 Bacteria 2023
120 Ga0075431_100011461 3300006847 Bacteria 8934
121 Ga0075431_100062165 3300006847 Bacteria 3854
122 Ga0075431_100170661 3300006847 Bacteria 2235
123 Ga0075431_100593151 3300006847 Bacteria 1092
124 Ga0075431_100894872 3300006847 Bacteria 857
125 Ga0075434_100377383 3300006871 Bacteria 1439
126 Ga0075429_100170935 3300006880 Bacteria 1904
127 Ga0075429_100267714 3300006880 Bacteria 1496
128 Ga0075429_100597455 3300006880 Bacteria 967
129 Ga0075429_101711855 3300006880 Bacteria 546
130 Ga0068865_101090233 3300006881 Bacteria 703
131 Ga0075436_101560546 3300006914 Bacteria 502
132 Ga0097620_100257886 3300006931 Bacteria 1834
133 Ga0097620_101029795 3300006931 Bacteria 904
134 Ga0099795_10148759 3300007788 Bacteria 958
135 Ga0105240_10639363 3300009093 Bacteria 1167
136 Ga0111539_10720186 3300009094 Bacteria 1161
137 Ga0111539_10901451 3300009094 Bacteria 1028
138 Ga0111539_11027103 3300009094 Bacteria 958
139 Ga0111539_12326014 3300009094 Bacteria 622
140 Ga0111539_13159430 3300009094 Bacteria 531
141 Ga0105245_10001646 3300009098 Bacteria 20330
142 Ga0105245_10016863 3300009098 Bacteria 6376
143 Ga0105245_10304022 3300009098 Bacteria 1566
144 Ga0105245_11355597 3300009098 Bacteria 761
145 Ga0105245_11356747 3300009098 Bacteria 761
146 Ga0105245_11981142 3300009098 Bacteria 636
147 Ga0105245_12174315 3300009098 Bacteria 609
148 Ga0105247_11348964 3300009101 Bacteria 575
149 Ga0114129_10000561 3300009147 Bacteria 45655
150 Ga0114129_10005087 3300009147 Bacteria 18514
151 Ga0114129_10006283 3300009147 Bacteria 16845
152 Ga0114129_10160191 3300009147 Bacteria 3075
153 Ga0114129_10319471 3300009147 Bacteria 2064
154 Ga0114129_10364110 3300009147 Bacteria 1912
155 Ga0105243_10395642 3300009148 Bacteria 1282
156 Ga0105243_11744635 3300009148 Bacteria 652
157 Ga0105243_11940106 3300009148 Bacteria 622
158 Ga0105243_12131438 3300009148 Bacteria 597
159 Ga0105241_11288629 3300009174 Bacteria 695
160 Ga0105242_10063603 3300009176 Bacteria 3039
161 Ga0105242_12543478 3300009176 Bacteria 560
162 Ga0105248_11063535 3300009177 Bacteria 914
163 Ga0105248_11399204 3300009177 Bacteria 791
164 Ga0105248_12956788 3300009177 Bacteria 541
165 Ga0105237_11228691 3300009545 Bacteria 756
166 Ga0105238_10936923 3300009551 Bacteria 885
167 Ga0105238_12070115 3300009551 Bacteria 603
168 Ga0105249_11061538 3300009553 Bacteria 880
169 Ga0105249_11469604 3300009553 Bacteria 754
170 Ga0105249_11517633 3300009553 Bacteria 742
171 Ga0105249_12748873 3300009553 Bacteria 564
172 Ga0105249_12773647 3300009553 Bacteria 562
173 Ga0105239_10122168 3300010375 Bacteria 2893
174 Ga0105239_11589461 3300010375 Bacteria 756
175 Ga0105246_10454604 3300011119 Bacteria 1077
176 Ga0105246_11305468 3300011119 Bacteria 673
177 Ga0105246_12110425 3300011119 Bacteria 546
178 Ga0157329_1019916 3300012491 Bacteria 620
179 Ga0157373_11204731 3300013100 Bacteria 571
180 Ga0157369_10392094 3300013105 Bacteria 1441
181 Ga0157378_10440627 3300013297 Bacteria 1291
182 Ga0157378_11802431 3300013297 Bacteria 660
183 Ga0157378_12067775 3300013297 Bacteria 620
184 Ga0157378_12645277 3300013297 Bacteria 554
185 Ga0163162_12721468 3300013306 Bacteria 569
186 Ga0163162_13003394 3300013306 Bacteria 542
187 Ga0157372_10639090 3300013307 Bacteria 1239
188 Ga0157372_11387247 3300013307 Bacteria 810
189 Ga0157375_10537707 3300013308 Bacteria 1331
190 Ga0157375_10615253 3300013308 Bacteria 1245
191 Ga0157375_11209345 3300013308 Bacteria 887
192 Ga0157375_11466250 3300013308 Bacteria 805
193 Ga0157375_12085487 3300013308 Bacteria 675
194 Ga0163163_10289665 3300014325 Bacteria 1690
195 Ga0163163_10441767 3300014325 Bacteria 1361
196 Ga0157380_11122936 3300014326 Bacteria 826
197 Ga0157380_13434909 3300014326 Bacteria 507
198 Ga0157377_11185491 3300014745 Bacteria 590
199 Ga0157379_10469673 3300014968 Bacteria 1163
200 Ga0157379_10528545 3300014968 Bacteria 1096
201 Ga0157379_10734725 3300014968 Bacteria 928
202 Ga0157379_12154360 3300014968 Bacteria 553
203 Ga0157379_12665658 3300014968 Bacteria 501
204 Ga0157376_11265249 3300014969 Bacteria 767
205 Ga0157376_11301485 3300014969 Bacteria 757
206 Ga0157376_12182718 3300014969 Bacteria 592
207 Ga0157376_12954178 3300014969 Bacteria 515
208 Ga0163161_10853542 3300017792 Bacteria 769
209 Ga0163161_10995905 3300017792 Bacteria 715
210 Ga0197907_10137062 3300020069 Bacteria 705
211 Ga0197907_10534594 3300020069 Bacteria 737
212 Ga0197907_10755373 3300020069 Bacteria 856
213 Ga0197907_11464321 3300020069 Bacteria 681
214 Ga0206356_10096014 3300020070 Bacteria 721
215 Ga0206356_10185486 3300020070 Bacteria 701
216 Ga0206356_10416685 3300020070 Bacteria 820
217 Ga0206355_1067193 3300020076 Bacteria 705
218 Ga0206355_1343555 3300020076 Bacteria 588
219 Ga0206355_1525959 3300020076 Bacteria 607
220 Ga0206350_11354471 3300020080 Bacteria 751
221 Ga0206354_10409034 3300020081 Bacteria 622
222 Ga0206354_10451484 3300020081 Bacteria 609
223 Ga0206354_10983743 3300020081 Bacteria 934
224 Ga0206354_11094166 3300020081 Bacteria 694
225 Ga0206353_10258710 3300020082 Bacteria 584
226 Ga0206353_10741550 3300020082 Bacteria 606
227 Ga0206353_11180624 3300020082 Bacteria 628
228 Ga0206353_11556319 3300020082 Bacteria 1209
229 Ga0213873_10086632 3300021358 Bacteria 884
230 Ga0213876_10014910 3300021384 Bacteria 4119
231 Ga0213876_10122461 3300021384 Bacteria 1381
232 Ga0213871_10100891 3300021441 Bacteria 845
233 Ga0224712_10250171 3300022467 Bacteria 818
234 Ga0224712_10305271 3300022467 Bacteria 745
235 Ga0224712_10389241 3300022467 Bacteria 663
236 Ga0224712_10475406 3300022467 Bacteria 602
237 Ga0224572_1008544 3300024225 Bacteria 1896
238 Ga0224572_1046660 3300024225 Unclassified 811
239 Ga0207642_11026322 3300025899 Bacteria 532
240 Ga0207710_10706079 3300025900 Bacteria 529
241 Ga0207688_10259322 3300025901 Bacteria 1055
242 Ga0207680_11038453 3300025903 Bacteria 587
243 Ga0207645_11238244 3300025907 Bacteria 500
244 Ga0207643_10840922 3300025908 Bacteria 595
245 Ga0207684_10150050 3300025910 Bacteria 2005
246 Ga0207684_10962714 3300025910 Bacteria 715
247 Ga0207707_10063579 3300025912 Bacteria 3212
248 Ga0207707_10321453 3300025912 Bacteria 1336
249 Ga0207671_11426262 3300025914 Bacteria 536
250 Ga0207657_10512051 3300025919 Bacteria 940
251 Ga0207657_11046745 3300025919 Bacteria 625
252 Ga0207652_10763828 3300025921 Bacteria 860
253 Ga0207694_10932473 3300025924 Bacteria 734
254 Ga0207694_11606597 3300025924 Bacteria 548
255 Ga0207687_10001297 3300025927 Bacteria 17042
256 Ga0207687_10097629 3300025927 Bacteria 2155
257 Ga0207687_10207911 3300025927 Bacteria 1534
258 Ga0207700_10039060 3300025928 Bacteria 3451
259 Ga0207664_10678625 3300025929 Bacteria 926
260 Ga0207664_10882650 3300025929 Bacteria 803
261 Ga0207644_10038155 3300025931 Bacteria 3382
262 Ga0207644_11540196 3300025931 Bacteria 558
263 Ga0207686_10259147 3300025934 Bacteria 1274
264 Ga0207686_10913885 3300025934 Bacteria 709
265 Ga0207669_10136376 3300025937 Bacteria 1696
266 Ga0207669_11196727 3300025937 Bacteria 644
267 Ga0207669_11419061 3300025937 Bacteria 591
268 Ga0207669_11710850 3300025937 Bacteria 537
269 Ga0207691_11043473 3300025940 Bacteria 681
270 Ga0207689_10720537 3300025942 Bacteria 841
271 Ga0207661_11824925 3300025944 Bacteria 554
272 Ga0207712_10242554 3300025961 Bacteria 1452
273 Ga0207712_11636553 3300025961 Bacteria 577
274 Ga0207668_11120850 3300025972 Bacteria 706
275 Ga0207658_10488939 3300025986 Bacteria 1095
276 Ga0207658_10637560 3300025986 Bacteria 960
277 Ga0207658_11408830 3300025986 Bacteria 638
278 Ga0207677_12301124 3300026023 Bacteria 501
279 Ga0207703_11090416 3300026035 Bacteria 767
280 Ga0207708_10288803 3300026075 Bacteria 1331
281 Ga0207708_10562541 3300026075 Bacteria 963
282 Ga0207708_11362706 3300026075 Bacteria 622
283 Ga0207702_10689435 3300026078 Bacteria 1006
284 Ga0207676_10814303 3300026095 Bacteria 912
285 Ga0207674_10893640 3300026116 Bacteria 856
286 Ga0207674_11365990 3300026116 Bacteria 678
287 Ga0207675_100098435 3300026118 Bacteria 2754
288 Ga0207675_100619913 3300026118 Bacteria 1086
289 Ga0207675_102661102 3300026118 Bacteria 509
290 Ga0207698_10663423 3300026142 Bacteria 1034
291 Ga0207698_10894014 3300026142 Bacteria 895
292 Ga0207698_11962538 3300026142 Bacteria 600
293 Ga0209983_1017203 3300027665 Bacteria 1495
294 Ga0209998_10048650 3300027717 Bacteria 977
295 Ga0209813_10102835 3300027866 Bacteria 974
296 Ga0209813_10426505 3300027866 Bacteria 539
297 Ga0209813_10453802 3300027866 Bacteria 525
298 Ga0268264_11438524 3300028381 Bacteria 700
299 Ga0265337_1098151 3300028556 Bacteria 798
300 Ga0265336_10107662 3300028666 Unclassified 830
301 Ga0307517_10361990 3300028786 Bacteria 783
302 Ga0265338_10000474 3300028800 Bacteria 71713
303 Ga0265338_10092624 3300028800 Bacteria 2492
304 Ga0265762_1017921 3300030760 Bacteria 1291
305 Ga0265762_1088324 3300030760 Unclassified 673
306 Ga0265766_1019740 3300030863 Bacteria 548
307 Ga0307408_101338105 3300031548 Bacteria 672
308 Ga0307408_101545903 3300031548 Bacteria 629
309 Ga0316575_10090209 3300031665 Bacteria 1241
310 Ga0316579_10397336 3300031691 Bacteria 667
311 Ga0316576_10015988 3300031727 Bacteria 5054
312 Ga0316576_10042472 3300031727 Bacteria 3277
313 Ga0316576_10187354 3300031727 Bacteria 1560
314 Ga0316578_10007025 3300031728 Bacteria 5606
315 Ga0316578_10024208 3300031728 Bacteria 3405
316 Ga0316578_10769574 3300031728 Bacteria 559
317 Ga0307405_10179244 3300031731 Bacteria 1520
318 Ga0307405_12009303 3300031731 Bacteria 517
319 Ga0316577_10001440 3300031733 Bacteria 11253
320 Ga0316577_10030042 3300031733 Bacteria 3033
321 Ga0307413_10166923 3300031824 Bacteria 1553
322 Ga0307413_10622400 3300031824 Bacteria 886
323 Ga0307413_11149443 3300031824 Bacteria 673
324 Ga0307410_10043059 3300031852 Bacteria 2989
325 Ga0307406_10537938 3300031901 Bacteria 954
326 Ga0307407_10083806 3300031903 Bacteria 1935
327 Ga0307407_10851567 3300031903 Bacteria 697
328 Ga0307412_10164750 3300031911 Bacteria 1652
329 Ga0307412_11555593 3300031911 Bacteria 603
330 Ga0307409_100139052 3300031995 Bacteria 2089
331 Ga0307409_101704193 3300031995 Bacteria 659
332 Ga0307409_101837109 3300031995 Bacteria 635
333 Ga0307416_100091597 3300032002 Bacteria 2612
334 Ga0307416_101197140 3300032002 Bacteria 865
335 Ga0307416_101377364 3300032002 Bacteria 811
336 Ga0307414_11572274 3300032004 Bacteria 613
337 Ga0307411_10103659 3300032005 Bacteria 2018
338 Ga0307411_10282530 3300032005 Bacteria 1322
339 Ga0307411_12198327 3300032005 Bacteria 517
340 Ga0307415_100073176 3300032126 Bacteria 2417
341 Ga0307415_100190735 3300032126 Bacteria 1617
342 Ga0307415_101595301 3300032126 Bacteria 627
343 Ga0316585_10223551 3300032137 Bacteria 623
344 Ga0316580_10052859 3300032139 Bacteria 1251
345 Ga0316593_10329262 3300032168 Bacteria 582
346 Ga0316592_1036970 3300033524 Bacteria 1074
347 Ga0316592_1152460 3300033524 Bacteria 545
348 Ga0316586_1083426 3300033527 Bacteria 598
349 Ga0316588_1144724 3300033528 Bacteria 608
350 Ga0316596_1163374 3300033541 Bacteria 614
351 Ga0316596_1180039 3300033541 Bacteria 585
352 Ga0316596_1189388 3300033541 Bacteria 571
353 Ga0373930_0001887 3300034816 Bacteria 3195
354 Ga0373928_0001268 3300035084 Bacteria 4972
355 Ga0373929_0000591 3300035085 Bacteria 7020
356 Ga0373929_0154619 3300035085 Bacteria 617
357 Ga0373944_0128090 3300035089 Bacteria 880
358 Ga0373932_0001281 3300035112 Bacteria 7127
359 Ga0373932_0063268 3300035112 Bacteria 1130
360 Ga0373941_0500084 3300035115 Bacteria 517
361 Ga0373945_0316781 3300035116 Bacteria 671
362 Ga0373954_0307492 3300035118 Bacteria 782
363 Ga0373943_0116354 3300035170 Bacteria 1416
364 Ga0373943_0312263 3300035170 Bacteria 895
365 Ga0373946_0580060 3300035171 Bacteria 580
366 Ga0373955_0155501 3300035172 Bacteria 1347
367 Ga0373962_0345757 3300035242 Bacteria 537
368 Ga0316574_0011346 3300035398 Bacteria 5061
369 Ga0316574_0282937 3300035398 Bacteria 1056
370 Ga0316574_0347263 3300035398 Bacteria 939
371 Ga0316574_0492133 3300035398 Bacteria 765
372 Ga0316574_0646473 3300035398 Bacteria 651
373 Ga0316574_0760696 3300035398 Bacteria 591
374 Ga0373931_0000001 3300035691 Bacteria 634029
375 Ga0373931_0000022 3300035691 Bacteria 137028
376 Ga0373931_0562248 3300035691 Bacteria 742
377 Ga0373931_1111611 3300035691 Bacteria 538
378 Ga0373927_0031428 3300035695 Bacteria 3460
379 Ga0373947_0076748 3300035725 Bacteria 2060
380 Ga0373937_0042657 3300036401 Bacteria 4139
381 Ga0373937_1628306 3300036401 Bacteria 593
382 Ga0373937_1903212 3300036401 Bacteria 541
383 Ga0316582_0074008 3300036647 Bacteria 2211
384 Ga0316584_0000836 3300036712 Bacteria 17377
385 Ga0316584_0007820 3300036712 Bacteria 7333
386 Ga0316584_0069518 3300036712 Bacteria 2640
387 Ga0316584_0723085 3300036712 Bacteria 681
388 Ga0316584_0973403 3300036712 Bacteria 568
389 Ga0316584_1139645 3300036712 Bacteria 516
390 Ga0373925_0004578 3300037068 Bacteria 10453
391 Ga0373925_0494241 3300037068 Bacteria 1004
392 Ga0373925_0818717 3300037068 Bacteria 768
393 Ga0395900_0022542 3300037418 Bacteria 6443
394 Ga0395900_1609897 3300037418 Bacteria 561
395 Ga0395905_0000007 3300037471 Bacteria 521849
396 Ga0395905_0006434 3300037471 Bacteria 11825
397 Ga0436364_0500701 3300037853 Bacteria 1203
398 Ga0436364_0987458 3300037853 Bacteria 657
399 Ga0395901_0746351 3300038443 Bacteria 972
400 Ga0400485_18280 3300038735 Bacteria 3858
401 Ga0400485_19625 3300038735 Bacteria 2620
402 Ga0400483_035744 3300039062 Bacteria 1715
403 Ga0400483_041924 3300039062 Bacteria 43934
404 Ga0400483_044723 3300039062 Bacteria 10274
405 Ga0400483_130587 3300039062 Bacteria 5814
406 Ga0400483_164900 3300039062 Bacteria 35828
407 Ga0400483_172438 3300039062 Bacteria 1023
408 Ga0400483_211911 3300039062 Bacteria 5097
409 Ga0400483_241099 3300039062 Bacteria 13144
410 Ga0400483_262734 3300039062 Bacteria 5322
411 Ga0400487_32587 3300039110 Bacteria 1508
412 Ga0436365_0575180 3300039437 Bacteria 500
413 Ga0436365_1602503 3300039437 Bacteria 11988
414 Ga0436365_1603199 3300039437 Bacteria 1441
415 Ga0436360_0999407 3300039438 Bacteria 1415
416 Ga0436360_1009488 3300039438 Bacteria 1437
417 Ga0436360_1039552 3300039438 Bacteria 905
418 Ga0436361_0930879 3300039447 Bacteria 612
419 Ga0436361_1017389 3300039447 Bacteria 676
420 Ga0436363_1696032 3300039450 Bacteria 547
421 Ga0436362_0573681 3300039453 Bacteria 2702
422 Ga0436362_0882125 3300039453 Bacteria 3406
423 Ga0439436_0016276 3300041404 Bacteria 2232
424 Ga0439438_044338 3300041405 Bacteria 1146
425 Ga0439447_085445 3300041407 Bacteria 727
426 Ga0439453_0095971 3300041408 Bacteria 656
427 Ga0439461_0029082 3300041410 Bacteria 1142
428 Ga0439466_0081330 3300041411 Bacteria 1021
429 Ga0439465_0021828 3300041413 Bacteria 2010
430 Ga0439465_0099556 3300041413 Bacteria 1003
431 Ga0451789_0323420 3300041443 Bacteria 505
432 Ga0451791_0570806 3300041451 Bacteria 646
433 Ga0451798_0082647 3300041458 Bacteria 704
434 Ga0451807_1054893 3300041486 Bacteria 753
435 Ga0451835_0171160 3300041492 Bacteria 692
436 Ga0451835_0610512 3300041492 Bacteria 648
437 Ga0451837_0313488 3300041494 Bacteria 1758
438 Ga0451837_0490912 3300041494 Bacteria 1067
439 Ga0451851_0647234 3300041507 Bacteria 548
440 Ga0451843_0279339 3300041509 Bacteria 706
441 Ga0451843_1737218 3300041509 Bacteria 546
442 Ga0451855_0049369 3300041511 Bacteria 619
443 Ga0451853_1052247 3300041512 Bacteria 1165
444 Ga0451853_2024082 3300041512 Bacteria 544
445 Ga0439431_0044634 3300041997 Bacteria 1137
446 Ga0439441_098197 3300042001 Bacteria 654
447 Ga0439443_028026 3300042003 Bacteria 917
448 Ga0439445_0215847 3300042004 Bacteria 569
449 Ga0439448_0009654 3300042005 Bacteria 2849
450 Ga0439450_018538 3300042008 Bacteria 1463
451 Ga0439451_049945 3300042009 Bacteria 838
452 Ga0439452_033903 3300042010 Bacteria 1237
453 Ga0439452_064622 3300042010 Bacteria 814
454 Ga0439454_005383 3300042011 Bacteria 1526
455 Ga0439455_0163356 3300042012 Bacteria 637
456 Ga0439463_006807 3300042016 Bacteria 2824
457 Ga0450905_085587 3300042142 Bacteria 552
458 Ga0439446_0140849 3300042156 Bacteria 788
459 Ga0439434_0004926 3300042435 Bacteria 3902
460 Ga0439434_0016835 3300042435 Bacteria 2185
461 Ga0439464_0003015 3300042439 Bacteria 4214
462 Ga0439464_0271580 3300042439 Bacteria 550
463 Ga0450901_015928 3300042533 Bacteria 792
464 Ga0439440_0003475 3300042993 Bacteria 3036
465 Ga0439440_0259250 3300042993 Bacteria 531
466 Ga0466969_0062836 3300044656 Bacteria 1801
467 Ga0466965_0631123 3300044683 Bacteria 610
468 Ga0466966_0111492 3300044684 Bacteria 1686
469 Ga0466966_0816974 3300044684 Bacteria 562
470 Ga0466961_0152086 3300044693 Bacteria 1445
471 Ga0466959_0855212 3300045049 Bacteria 607
472 Ga0466958_0219504 3300045836 Bacteria 1213
473 Ga0466958_0290882 3300045836 Bacteria 1048
474 Ga0466958_1064496 3300045836 Bacteria 528
475 Ga0466967_1820085 3300045976 Bacteria 606
476 Ga0495603_0727564 3300046455 Bacteria 567
477 Ga0495629_0152007 3300046459 Bacteria 1609
478 Ga0495629_0153892 3300046459 Bacteria 1598
479 Ga0495629_0344632 3300046459 Bacteria 1017
480 Ga0495629_0933647 3300046459 Bacteria 567
481 Ga0495629_1152098 3300046459 Bacteria 500
482 Ga0495641_0259339 3300046461 Bacteria 782
483 Ga0495641_0307255 3300046461 Bacteria 715
484 Ga0495651_0040762 3300046462 Bacteria 3609
485 Ga0495651_0411202 3300046462 Bacteria 881
486 Ga0495653_0022957 3300046463 Bacteria 5045
487 Ga0495653_0560691 3300046463 Bacteria 706
488 Ga0495582_0146902 3300046473 Bacteria 1338
489 Ga0495582_0488008 3300046473 Bacteria 712
490 Ga0495582_0638483 3300046473 Bacteria 616
491 Ga0495582_0844047 3300046473 Bacteria 530
492 Ga0495662_0532100 3300046476 Bacteria 576
493 Ga0495664_0767391 3300046477 Bacteria 568
494 Ga0495608_0619465 3300046511 Bacteria 648
495 Ga0495618_0763917 3300046514 Bacteria 565
496 Ga0495628_0185841 3300046516 Bacteria 1570
497 Ga0495628_0528869 3300046516 Bacteria 849
498 Ga0495630_0062764 3300046517 Bacteria 2791
499 Ga0495630_0576584 3300046517 Bacteria 863
500 Ga0495630_0759359 3300046517 Bacteria 741
501 Ga0495652_0467008 3300046529 Bacteria 881
502 Ga0495652_0771256 3300046529 Bacteria 642
503 Ga0495586_0005559 3300046535 Bacteria 6743
504 Ga0495587_0010276 3300046536 Bacteria 5967
505 Ga0495667_0003836 3300046559 Bacteria 10098
506 Ga0495668_0435922 3300046616 Bacteria 721
507 Ga0495634_0011499 3300046642 Bacteria 6438
508 Ga0495634_0724840 3300046642 Bacteria 570
509 Ga0495635_0263448 3300046663 Bacteria 1160
510 Ga0495635_0339894 3300046663 Bacteria 1003
511 Ga0495588_0417111 3300046674 Bacteria 705
512 Ga0495657_0122267 3300046675 Bacteria 1638
513 Ga0495599_0734234 3300046678 Bacteria 567
514 Ga0495623_0036112 3300046679 Bacteria 3167
515 Ga0495647_0185539 3300046681 Bacteria 907
516 Ga0495647_0432047 3300046681 Bacteria 608
517 Ga0495658_0035790 3300046683 Bacteria 2735
518 Ga0495658_0185667 3300046683 Bacteria 1291
519 Ga0495613_0000239 3300046689 Bacteria 52322
520 Ga0495613_0156711 3300046689 Bacteria 1622
521 Ga0495624_0553907 3300046690 Bacteria 687
522 Ga0495581_0427190 3300047315 Bacteria 772
523 Ga0495604_0103385 3300047317 Bacteria 2090
524 Ga0495604_1057029 3300047317 Bacteria 500
525 Ga0495672_0000785 3300047320 Bacteria 34425
526 Ga0495672_0159553 3300047320 Bacteria 1161
527 Ga0495676_0280111 3300047321 Bacteria 1129
528 Ga0495676_0439902 3300047321 Bacteria 861
529 Ga0495680_0159608 3300047322 Bacteria 1638
530 Ga0495680_0202935 3300047322 Bacteria 1422
531 Ga0495680_0491195 3300047322 Bacteria 834
532 Ga0495675_0078564 3300047444 Bacteria 2078
533 Ga0495675_0805335 3300047444 Bacteria 520
534 Ga0495684_0140370 3300047471 Bacteria 1812
535 Ga0495602_0391754 3300048088 Bacteria 993
536 Ga0495602_1138285 3300048088 Bacteria 510
537 Ga0495614_0035750 3300048089 Bacteria 2134
538 Ga0495614_0187610 3300048089 Bacteria 932
539 Ga0496100_0603265 3300048903 Bacteria 853
540 Ga0496101_0584831 3300048904 Bacteria 883
541 Ga0496102_0599935 3300048905 Bacteria 1024
542 Ga0496103_0395483 3300048906 Bacteria 888
543 Ga0496104_0185724 3300048907 Bacteria 1990
544 Ga0496104_1071685 3300048907 Bacteria 710
545 Ga0496104_1189774 3300048907 Bacteria 665
546 Ga0496104_1264840 3300048907 Bacteria 641
547 Ga0496105_0588620 3300048908 Bacteria 865
548 Ga0496106_1120260 3300048909 Bacteria 616
549 Ga0496108_0056403 3300048911 Bacteria 3301
550 Ga0496108_0446543 3300048911 Bacteria 1130
551 Ga0496108_1213344 3300048911 Bacteria 637
552 Ga0496109_0161568 3300048912 Bacteria 2099
553 Ga0496109_0362602 3300048912 Bacteria 1369
554 Ga0496109_0807624 3300048912 Bacteria 876
555 Ga0496109_1013595 3300048912 Bacteria 768
556 Ga0496109_1860099 3300048912 Bacteria 535
557 Ga0496110_0147681 3300048913 Bacteria 2128
558 Ga0496110_0308210 3300048913 Bacteria 1442
559 Ga0496110_0392609 3300048913 Bacteria 1265
560 Ga0496112_1111614 3300048915 Bacteria 708
561 Ga0496112_1730185 3300048915 Bacteria 538
562 Ga0496113_0167885 3300048916 Bacteria 1737
563 Ga0496113_1048819 3300048916 Bacteria 641
564 Ga0496114_0288111 3300048917 Bacteria 1449
565 Ga0496114_0552586 3300048917 Bacteria 1017
566 Ga0496114_0773764 3300048917 Bacteria 838
567 Ga0496114_0807036 3300048917 Bacteria 817
568 Ga0496114_0896667 3300048917 Bacteria 768
569 Ga0501031_0044900 3300049568 Bacteria 2884
570 Ga0501031_0190847 3300049568 Bacteria 1338
571 Ga0501031_0227059 3300049568 Bacteria 1215
572 Ga0501032_0022556 3300049569 Bacteria 4363
573 Ga0501032_0168272 3300049569 Bacteria 1438
574 Ga0501033_0001944 3300049570 Bacteria 17985
575 Ga0501033_0027002 3300049570 Bacteria 4318
576 Ga0501033_0574636 3300049570 Bacteria 775
577 Ga0501033_0600183 3300049570 Bacteria 755
578 Ga0501033_0696933 3300049570 Bacteria 691
579 Ga0501033_0859619 3300049570 Bacteria 611
580 Ga0501034_0000666 3300049571 Bacteria 52372
581 Ga0501034_0000723 3300049571 Bacteria 50099
582 Ga0501034_0095563 3300049571 Bacteria 2968
583 Ga0501034_0157225 3300049571 Bacteria 2246
584 Ga0501034_0377291 3300049571 Bacteria 1343
585 Ga0501034_0755766 3300049571 Bacteria 867
586 Ga0501034_0958494 3300049571 Bacteria 741
587 Ga0501034_1559769 3300049571 Bacteria 534
588 Ga0501036_0131343 3300049572 Bacteria 2114
589 Ga0501036_0175594 3300049572 Bacteria 1804
590 Ga0501036_0270763 3300049572 Bacteria 1422
591 Ga0501036_0322265 3300049572 Bacteria 1291
592 Ga0501036_0829254 3300049572 Bacteria 761
593 Ga0501036_1469802 3300049572 Bacteria 552
594 Ga0501036_1641915 3300049572 Bacteria 518
595 Ga0501037_0001329 3300049573 Bacteria 18154
596 Ga0501037_0021962 3300049573 Bacteria 4725
597 Ga0501037_0036090 3300049573 Bacteria 3644
598 Ga0501037_1061893 3300049573 Bacteria 526
599 Ga0501038_0013014 3300049574 Bacteria 7587
600 Ga0501038_0558997 3300049574 Bacteria 869
601 Ga0501038_0656242 3300049574 Bacteria 789
602 Ga0501038_0787459 3300049574 Bacteria 707
603 Ga0501039_0021598 3300049575 Bacteria 4938
604 Ga0501039_0116514 3300049575 Bacteria 2091
605 Ga0501039_0142200 3300049575 Bacteria 1885
606 Ga0501039_0272112 3300049575 Bacteria 1331
607 Ga0501039_0319675 3300049575 Bacteria 1220
608 Ga0501040_0002361 3300049576 Bacteria 12119
609 Ga0501040_0037530 3300049576 Bacteria 3292
610 Ga0501040_0179095 3300049576 Bacteria 1502
611 Ga0501040_0315028 3300049576 Bacteria 1119
612 Ga0501040_1006100 3300049576 Bacteria 604
613 Ga0501041_0012177 3300049577 Bacteria 5094
614 Ga0501041_0068902 3300049577 Bacteria 2169
615 Ga0501041_0266706 3300049577 Bacteria 1077
616 Ga0501041_0738147 3300049577 Bacteria 631
617 Ga0501042_0024505 3300049578 Bacteria 4232
618 Ga0501042_0028809 3300049578 Bacteria 3917
619 Ga0501042_0305834 3300049578 Bacteria 1148
620 Ga0501042_0308021 3300049578 Bacteria 1144
621 Ga0501042_0440303 3300049578 Bacteria 945
622 Ga0501042_1424257 3300049578 Bacteria 505
623 Ga0501042_1438933 3300049578 Bacteria 503
624 Ga0501043_0007961 3300049579 Bacteria 8372
625 Ga0501043_0237836 3300049579 Bacteria 1405
626 Ga0501043_0557315 3300049579 Bacteria 851
627 Ga0501046_0051785 3300049580 Bacteria 3238
628 Ga0501046_0119658 3300049580 Bacteria 2005
629 Ga0501046_0522081 3300049580 Bacteria 849
630 Ga0501047_0125874 3300049581 Bacteria 2443
631 Ga0501047_0544965 3300049581 Bacteria 985
632 Ga0501047_0753710 3300049581 Bacteria 790
633 Ga0501048_0033877 3300049582 Bacteria 3688
634 Ga0501048_0633896 3300049582 Bacteria 767
635 Ga0501048_1242708 3300049582 Bacteria 536
636 Ga0501067_0003698 3300049583 Bacteria 8425
637 Ga0501067_0045695 3300049583 Bacteria 2431
638 Ga0501067_0079615 3300049583 Bacteria 1816
639 Ga0501068_0000098 3300049584 Bacteria 37486
640 Ga0501068_0029803 3300049584 Bacteria 3234
641 Ga0501068_0118569 3300049584 Bacteria 1649
642 Ga0501068_0184925 3300049584 Bacteria 1318
643 Ga0501068_0487409 3300049584 Bacteria 799
644 Ga0501068_0714304 3300049584 Bacteria 655
645 Ga0501068_0732288 3300049584 Bacteria 647
646 Ga0501068_1194632 3300049584 Bacteria 504
647 Ga0501069_0000044 3300049585 Bacteria 75705
648 Ga0501069_0009790 3300049585 Bacteria 5067
649 Ga0501069_0012202 3300049585 Bacteria 4565
650 Ga0501069_0212172 3300049585 Bacteria 1124
651 Ga0501069_0414867 3300049585 Bacteria 798
652 Ga0501069_0549518 3300049585 Bacteria 691
653 Ga0501070_0000001 3300049586 Bacteria 519187
654 Ga0501070_0007332 3300049586 Bacteria 9363
655 Ga0501070_0020200 3300049586 Bacteria 5588
656 Ga0501070_0475456 3300049586 Bacteria 1006
657 Ga0501071_0018635 3300049587 Bacteria 4810
658 Ga0501071_0022391 3300049587 Bacteria 4406
659 Ga0501071_0115980 3300049587 Bacteria 1982
660 Ga0501071_0232931 3300049587 Bacteria 1388
661 Ga0501071_0301444 3300049587 Bacteria 1215
662 Ga0501071_0385119 3300049587 Bacteria 1070
663 Ga0501071_0430775 3300049587 Bacteria 1008
664 Ga0501071_1050866 3300049587 Bacteria 629
665 Ga0501072_0003214 3300049588 Bacteria 12270
666 Ga0501072_0007967 3300049588 Bacteria 8040
667 Ga0501072_0060274 3300049588 Bacteria 2992
668 Ga0501072_0101145 3300049588 Bacteria 2291
669 Ga0501072_0173913 3300049588 Bacteria 1718
670 Ga0501072_0647302 3300049588 Bacteria 832
671 Ga0501072_0672592 3300049588 Bacteria 814
672 Ga0501072_0769203 3300049588 Bacteria 755
673 Ga0501073_0001297 3300049589 Bacteria 18365
674 Ga0501073_0024702 3300049589 Bacteria 4314
675 Ga0501073_0313607 3300049589 Bacteria 1082
676 Ga0501073_1005569 3300049589 Bacteria 574
677 Ga0501073_1240907 3300049589 Bacteria 511
678 Ga0501074_0000333 3300049590 Bacteria 27445
679 Ga0501074_0052506 3300049590 Bacteria 2943
680 Ga0501074_0063498 3300049590 Bacteria 2660
681 Ga0501074_0074240 3300049590 Bacteria 2442
682 Ga0501074_0074367 3300049590 Bacteria 2440
683 Ga0501074_0080338 3300049590 Bacteria 2340
684 Ga0501074_0154350 3300049590 Bacteria 1641
685 Ga0501075_0036644 3300049591 Bacteria 3662
686 Ga0501075_0040524 3300049591 Bacteria 3488
687 Ga0501075_0205791 3300049591 Bacteria 1501
688 Ga0501075_0332280 3300049591 Bacteria 1158
689 Ga0501075_0859084 3300049591 Bacteria 690
690 Ga0501075_1475047 3300049591 Bacteria 515
691 Ga0501076_0002575 3300049592 Bacteria 12469
692 Ga0501076_0079570 3300049592 Bacteria 2630
693 Ga0501076_0153094 3300049592 Bacteria 1876
694 Ga0501076_0276981 3300049592 Bacteria 1374
695 Ga0501076_0429255 3300049592 Bacteria 1088
696 Ga0501076_1102197 3300049592 Bacteria 654
697 Ga0501076_1539431 3300049592 Bacteria 546
698 Ga0501077_0024932 3300049593 Bacteria 3798
699 Ga0501077_0026413 3300049593 Bacteria 3685
700 Ga0501077_0611066 3300049593 Bacteria 700
701 Ga0501079_0004476 3300049741 Bacteria 10364
702 Ga0501079_0030769 3300049741 Bacteria 4125
703 Ga0501079_0117657 3300049741 Bacteria 2066
704 Ga0501079_0314780 3300049741 Bacteria 1225
705 Ga0501079_1207667 3300049741 Bacteria 596
706 Ga0501079_1483254 3300049741 Bacteria 534
707 Ga0501079_1556857 3300049741 Bacteria 520
708 Ga0501080_0006808 3300049742 Bacteria 10305
709 Ga0501080_0012513 3300049742 Bacteria 7782
710 Ga0501080_0017310 3300049742 Bacteria 6662
711 Ga0501080_0135968 3300049742 Bacteria 2275
712 Ga0501080_0240745 3300049742 Bacteria 1651
713 Ga0501080_0667782 3300049742 Bacteria 918
714 Ga0501080_1799368 3300049742 Bacteria 515
715 Ga0501081_0048001 3300049743 Bacteria 2937
716 Ga0501081_0667354 3300049743 Bacteria 780
717 Ga0501083_0000154 3300049744 Bacteria 45503
718 Ga0501083_0024299 3300049744 Bacteria 4199
719 Ga0501083_0045673 3300049744 Bacteria 2963
720 Ga0501083_0053285 3300049744 Bacteria 2716
721 Ga0501083_0371774 3300049744 Bacteria 930
722 Ga0501083_0451807 3300049744 Bacteria 836
723 Ga0501035_0186752 3300049822 Bacteria 1784
724 Ga0501035_0282450 3300049822 Bacteria 1403
725 Ga0501035_0485201 3300049822 Bacteria 1019
726 Ga0501035_0725118 3300049822 Bacteria 800
727 Ga0501035_1035463 3300049822 Bacteria 644
728 Ga0501044_0003702 3300049823 Bacteria 17189
729 Ga0501044_0195036 3300049823 Bacteria 1986
730 Ga0501044_0202897 3300049823 Bacteria 1940
731 Ga0501044_1131417 3300049823 Bacteria 652
732 Ga0501045_0002942 3300049824 Bacteria 11648
733 Ga0501045_0249423 3300049824 Bacteria 1321
734 Ga0501045_0614074 3300049824 Bacteria 805
735 Ga0501045_1196664 3300049824 Bacteria 554
736 nmdc:mga03683_22620_c1 3300050489 Bacteria 2049
737 nmdc:mga03683_319695_c1 3300050489 Bacteria 730
738 nmdc:mga03683_338454_c1 3300050489 Bacteria 710
739 nmdc:mga03683_630528_c1 3300050489 Bacteria 526
740 nmdc:mga03n38_146764_c1 3300050490 Bacteria 1183
741 nmdc:mga03n38_279749_c1 3300050490 Bacteria 890
742 nmdc:mga03n38_307875_c1 3300050490 Bacteria 852
743 nmdc:mga03n38_393214_c1 3300050490 Bacteria 762
744 nmdc:mga03n38_848994_c1 3300050490 Bacteria 534
745 nmdc:mga03n38_93673_c1 3300050490 Bacteria 1435
746 nmdc:mga03n38_954088_c1 3300050490 Bacteria 506
747 nmdc:mga00v17_204305_c1 3300050491 Bacteria 1277
748 nmdc:mga00v17_267005_c1 3300050491 Bacteria 1110
749 nmdc:mga00v17_270423_c1 3300050491 Bacteria 1103
750 nmdc:mga00v17_273816_c1 3300050491 Bacteria 1095
751 nmdc:mga00v17_40994_c1 3300050491 Bacteria 2779
752 nmdc:mga00v17_507359_c1 3300050491 Bacteria 781
753 nmdc:mga00v17_7843_c1 3300050491 Bacteria 5725
754 nmdc:mga00v17_896190_c1 3300050491 Bacteria 562
755 nmdc:mga00v17_9780_c1 3300050491 Bacteria 5208
756 nmdc:mga0yw44_105983_c1 3300050492 Bacteria 1796
757 nmdc:mga0yw44_1093801_c1 3300050492 Bacteria 539
758 nmdc:mga0yw44_160570_c1 3300050492 Bacteria 1471
759 nmdc:mga0yw44_180717_c1 3300050492 Bacteria 1388
760 nmdc:mga0yw44_232880_c1 3300050492 Bacteria 1223
761 nmdc:mga0yw44_3611_c1 3300050492 Bacteria 6900
762 nmdc:mga0yw44_375796_c1 3300050492 Bacteria 959
763 nmdc:mga0yw44_636268_c1 3300050492 Bacteria 725
764 nmdc:mga0yw44_83427_c1 3300050492 Bacteria 2007
765 nmdc:mga0yw44_8482_c2 3300050492 Bacteria 2851
766 nmdc:mga0yw44_879653_c1 3300050492 Bacteria 608
767 nmdc:mga0yw44_973317_c1 3300050492 Bacteria 575
768 nmdc:mga06z11_470119_c1 3300050494 Bacteria 761
769 nmdc:mga06z11_55458_c1 3300050494 Bacteria 2046
770 nmdc:mga06z11_67387_c1 3300050494 Bacteria 1884
771 nmdc:mga04h51_256637_c1 3300050495 Bacteria 702
772 nmdc:mga04h51_462409_c1 3300050495 Bacteria 538
773 nmdc:mga04h51_487974_c1 3300050495 Bacteria 525
774 nmdc:mga04h51_90142_c1 3300050495 Bacteria 1102
775 nmdc:mga07m45_234186_c1 3300050496 Bacteria 1068
776 nmdc:mga07m45_256002_c1 3300050496 Bacteria 1018
777 nmdc:mga05p37_352276_c1 3300050507 Bacteria 1733
778 nmdc:mga05p37_455123_c1 3300050507 Bacteria 1480
779 nmdc:mga05p37_6515_c1 3300050507 Bacteria 13774
780 nmdc:mga05p37_7437_c2 3300050507 Bacteria 10878
781 nmdc:mga05p37_89598_c1 3300050507 Bacteria 3791
782 nmdc:mga09592_2389_c1 3300050508 Bacteria 15165
783 nmdc:mga09592_490308_c1 3300050508 Bacteria 1058
784 nmdc:mga09592_593635_c1 3300050508 Bacteria 949
785 nmdc:mga0qj67_163592_c1 3300050509 Bacteria 1806
786 nmdc:mga0qj67_169276_c1 3300050509 Bacteria 1774
787 nmdc:mga0qj67_355247_c1 3300050509 Bacteria 1185
788 nmdc:mga0qj67_613619_c1 3300050509 Bacteria 869
789 nmdc:mga0qj67_98683_c1 3300050509 Bacteria 2353
790 nmdc:mga06r32_142969_c1 3300050510 Bacteria 2370
791 nmdc:mga06r32_1526743_c1 3300050510 Bacteria 608
792 nmdc:mga06r32_24152_c1 3300050510 Bacteria 5637
793 nmdc:mga06r32_49104_c1 3300050510 Bacteria 4035
794 nmdc:mga06r32_52214_c1 3300050510 Bacteria 3915
795 nmdc:mga08y16_1076181_c1 3300050511 Bacteria 780
796 nmdc:mga08y16_640105_c1 3300050511 Bacteria 1068
797 nmdc:mga0n895_1372021_c1 3300050512 Bacteria 676
798 nmdc:mga0rr50_1043450_c1 3300050513 Bacteria 696
799 Ga0495601_0110026 3300053077 Bacteria 1784
800 Ga0495601_0236892 3300053077 Bacteria 1192
801 Ga0495612_0387843 3300053078 Bacteria 634
802 Ga0495595_0252104 3300053084 Bacteria 884
803 Ga0495595_0289116 3300053084 Bacteria 824
804 Ga0495595_0363367 3300053084 Bacteria 731
805 Ga0500583_0110976 3300053092 Bacteria 1351
806 Ga0500566_0000098 3300053094 Bacteria 43891
807 Ga0500593_193474 3300053117 Bacteria 742
808 Ga0500564_302506 3300053138 Bacteria 613
809 Ga0500568_0000182 3300053139 Bacteria 55216
810 Ga0500603_246643 3300053150 Bacteria 574
811 Ga0500616_0048061 3300053153 Bacteria 2263
812 Ga0501084_0004656 3300054114 Bacteria 11196
813 Ga0501084_0027474 3300054114 Bacteria 4754
814 Ga0501084_0268354 3300054114 Bacteria 1441
815 Ga0501084_0305235 3300054114 Bacteria 1344
816 Ga0501084_0507985 3300054114 Bacteria 1019
817 Ga0501084_0796754 3300054114 Bacteria 796
818 Ga0501084_0924940 3300054114 Bacteria 733
819 Ga0501084_1084435 3300054114 Bacteria 672
820 Ga0501084_1278483 3300054114 Bacteria 615
821 Ga0501084_1525640 3300054114 Bacteria 559
822 Ga0590071_218751 3300059421 Bacteria 503
823 Ga0587125_075748 3300059607 Bacteria 515
824 Ga0587128_073125 3300059630 Bacteria 671
825 Ga0587107_069996 3300059652 Bacteria 638
826 Ga0587111_0186347 3300060346 Bacteria 580
827 Ga0501082_0036497 3300060353 Bacteria 4234
828 Ga0501082_0078741 3300060353 Bacteria 2843
829 Ga0501082_0353740 3300060353 Bacteria 1281
830 Ga0501082_0477484 3300060353 Bacteria 1090
831 Ga0501082_0506996 3300060353 Bacteria 1055
832 Ga0501082_0620882 3300060353 Bacteria 946
833 Ga0501082_1016097 3300060353 Bacteria 725
834 Ga0501082_1048330 3300060353 Bacteria 713
835 Ga0501082_1244564 3300060353 Bacteria 650
836 Ga0501082_1976253 3300060353 Bacteria 508
837 Ga0501082_1983771 3300060353 Bacteria 507
838 Ga0466962_0749561 3300061719 Bacteria 502
839 Ga0530510_0021851 3300061734 Bacteria 4554
840 Ga0530510_0170452 3300061734 Bacteria 1612
841 Ga0530510_0745595 3300061734 Bacteria 747
842 Ga0530510_0853216 3300061734 Bacteria 695
843 Ga0530510_0999835 3300061734 Bacteria 640
844 Ga0530510_1450423 3300061734 Bacteria 527

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005578 Ga0068854_100459404 Ga0068854_1004594042 81
2 3300005719 Ga0068861_102466385 Ga0068861_1024663852 81
3 3300009553 Ga0105249_12748873 Ga0105249_127488732 81
4 3300020069 Ga0197907_10137062 Ga0197907_101370622 81
5 3300020070 Ga0206356_10416685 Ga0206356_104166852 81
6 3300020080 Ga0206350_11354471 Ga0206350_113544711 81
7 3300020082 Ga0206353_11556319 Ga0206353_115563192 81
8 3300021384 Ga0213876_10122461 Ga0213876_101224612 81
9 3300022467 Ga0224712_10250171 Ga0224712_102501712 81
10 3300039437 Ga0436365_1603199 Ga0436365_1603199_768_1028 81
11 3300039453 Ga0436362_0573681 Ga0436362_0573681_1849_2109 81
12 3300041509 Ga0451843_1737218 Ga0451843_1737218_269_523 81
13 3300045049 Ga0466959_0855212 Ga0466959_0855212_142_396 81
14 3300045836 Ga0466958_0290882 Ga0466958_0290882_525_779 81
15 3300006028 Ga0070717_10733769 Ga0070717_107337692 82
16 3300009094 Ga0111539_11027103 Ga0111539_110271032 82
17 3300009147 Ga0114129_10364110 Ga0114129_103641102 82
18 3300009177 Ga0105248_11063535 Ga0105248_110635353 82
19 3300004799 Ga0058863_11585879 Ga0058863_115858791 83
20 3300005355 Ga0070671_100878342 Ga0070671_1008783421 83
21 3300005367 Ga0070667_100363602 Ga0070667_1003636022 83
22 3300005436 Ga0070713_101615909 Ga0070713_1016159092 83
23 3300005441 Ga0070700_100412032 Ga0070700_1004120322 83
24 3300005444 Ga0070694_101419629 Ga0070694_1014196291 83
25 3300005467 Ga0070706_100263522 Ga0070706_1002635222 83
26 3300005518 Ga0070699_100084446 Ga0070699_1000844463 83
27 3300005536 Ga0070697_101036572 Ga0070697_1010365721 83
28 3300005544 Ga0070686_101493663 Ga0070686_1014936632 83
29 3300005617 Ga0068859_101029810 Ga0068859_1010298101 83
30 3300005842 Ga0068858_100667069 Ga0068858_1006670692 83
31 3300005843 Ga0068860_101601005 Ga0068860_1016010051 83
32 3300006038 Ga0075365_10007031 Ga0075365_100070313 83
33 3300006038 Ga0075365_10197118 Ga0075365_101971182 83
34 3300006038 Ga0075365_10300961 Ga0075365_103009612 83
35 3300006038 Ga0075365_10880009 Ga0075365_108800091 83
36 3300006048 Ga0075363_100248941 Ga0075363_1002489412 83
37 3300006048 Ga0075363_101022817 Ga0075363_1010228172 83
38 3300006051 Ga0075364_10010043 Ga0075364_100100434 83
39 3300006051 Ga0075364_10045406 Ga0075364_100454062 83
40 3300006051 Ga0075364_10330829 Ga0075364_103308293 83
41 3300006051 Ga0075364_10500995 Ga0075364_105009951 83
42 3300006177 Ga0075362_10094242 Ga0075362_100942423 83
43 3300006178 Ga0075367_10264238 Ga0075367_102642381 83
44 3300006178 Ga0075367_10791527 Ga0075367_107915271 83
45 3300006353 Ga0075370_10598358 Ga0075370_105983581 83
46 3300006844 Ga0075428_100000395 Ga0075428_10000039521 83
47 3300006846 Ga0075430_100026748 Ga0075430_1000267483 83
48 3300006847 Ga0075431_100170661 Ga0075431_1001706612 83
49 3300006880 Ga0075429_100597455 Ga0075429_1005974552 83
50 3300006931 Ga0097620_101029795 Ga0097620_1010297953 83
51 3300009094 Ga0111539_10901451 Ga0111539_109014512 83
52 3300009098 Ga0105245_10001646 Ga0105245_1000164610 83
53 3300009098 Ga0105245_11355597 Ga0105245_113555971 83
54 3300009101 Ga0105247_11348964 Ga0105247_113489641 83
55 3300009147 Ga0114129_10006283 Ga0114129_100062836 83
56 3300009147 Ga0114129_10319471 Ga0114129_103194713 83
57 3300009177 Ga0105248_11399204 Ga0105248_113992042 83
58 3300009551 Ga0105238_10936923 Ga0105238_109369232 83
59 3300009553 Ga0105249_11517633 Ga0105249_115176332 83
60 3300013306 Ga0163162_13003394 Ga0163162_130033941 83
61 3300013308 Ga0157375_10615253 Ga0157375_106152531 83
62 3300013308 Ga0157375_11466250 Ga0157375_114662502 83
63 3300014968 Ga0157379_10528545 Ga0157379_105285452 83
64 3300017792 Ga0163161_10995905 Ga0163161_109959052 83
65 3300020069 Ga0197907_11464321 Ga0197907_114643212 83
66 3300020082 Ga0206353_10741550 Ga0206353_107415502 83
67 3300021358 Ga0213873_10086632 Ga0213873_100866323 83
68 3300021384 Ga0213876_10014910 Ga0213876_100149104 83
69 3300021441 Ga0213871_10100891 Ga0213871_101008912 83
70 3300024225 Ga0224572_1008544 Ga0224572_10085442 83
71 3300024225 Ga0224572_1046660 Ga0224572_10466602 83
72 3300025899 Ga0207642_11026322 Ga0207642_110263222 83
73 3300025900 Ga0207710_10706079 Ga0207710_107060791 83
74 3300025908 Ga0207643_10840922 Ga0207643_108409221 83
75 3300025910 Ga0207684_10150050 Ga0207684_101500502 83
76 3300025924 Ga0207694_10932473 Ga0207694_109324732 83
77 3300025927 Ga0207687_10001297 Ga0207687_1000129710 83
78 3300025928 Ga0207700_10039060 Ga0207700_100390603 83
79 3300025929 Ga0207664_10882650 Ga0207664_108826503 83
80 3300025934 Ga0207686_10913885 Ga0207686_109138852 83
81 3300025986 Ga0207658_10488939 Ga0207658_104889392 83
82 3300026035 Ga0207703_11090416 Ga0207703_110904161 83
83 3300026075 Ga0207708_10288803 Ga0207708_102888032 83
84 3300026116 Ga0207674_10893640 Ga0207674_108936402 83
85 3300026142 Ga0207698_11962538 Ga0207698_119625382 83
86 3300028381 Ga0268264_11438524 Ga0268264_114385241 83
87 3300028556 Ga0265337_1098151 Ga0265337_10981511 83
88 3300028800 Ga0265338_10092624 Ga0265338_100926242 83
89 3300030760 Ga0265762_1088324 Ga0265762_10883242 83
90 3300030863 Ga0265766_1019740 Ga0265766_10197401 83
91 3300031548 Ga0307408_101545903 Ga0307408_1015459032 83
92 3300031731 Ga0307405_12009303 Ga0307405_120093032 83
93 3300031824 Ga0307413_10622400 Ga0307413_106224002 83
94 3300031852 Ga0307410_10043059 Ga0307410_100430593 83
95 3300031901 Ga0307406_10537938 Ga0307406_105379382 83
96 3300031903 Ga0307407_10083806 Ga0307407_100838063 83
97 3300031995 Ga0307409_100139052 Ga0307409_1001390523 83
98 3300032002 Ga0307416_100091597 Ga0307416_1000915973 83
99 3300032005 Ga0307411_10103659 Ga0307411_101036593 83
100 3300032126 Ga0307415_100073176 Ga0307415_1000731763 83
101 3300032126 Ga0307415_100190735 Ga0307415_1001907353 83
102 3300032126 Ga0307415_101595301 Ga0307415_1015953011 83
103 3300034816 Ga0373930_0001887 Ga0373930_0001887_2087_2338 83
104 3300035084 Ga0373928_0001268 Ga0373928_0001268_4539_4790 83
105 3300035085 Ga0373929_0000591 Ga0373929_0000591_4160_4411 83
106 3300035085 Ga0373929_0154619 Ga0373929_0154619_180_431 83
107 3300035112 Ga0373932_0001281 Ga0373932_0001281_3988_4239 83
108 3300035115 Ga0373941_0500084 Ga0373941_0500084_215_466 83
109 3300035118 Ga0373954_0307492 Ga0373954_0307492_67_318 83
110 3300035171 Ga0373946_0580060 Ga0373946_0580060_89_340 83
111 3300035172 Ga0373955_0155501 Ga0373955_0155501_627_878 83
112 3300035691 Ga0373931_0000001 Ga0373931_0000001_157403_157654 83
113 3300035691 Ga0373931_1111611 Ga0373931_1111611_134_385 83
114 3300036401 Ga0373937_0042657 Ga0373937_0042657_454_705 83
115 3300036401 Ga0373937_1628306 Ga0373937_1628306_198_449 83
116 3300036401 Ga0373937_1903212 Ga0373937_1903212_131_382 83
117 3300037068 Ga0373925_0494241 Ga0373925_0494241_262_513 83
118 3300039062 Ga0400483_035744 Ga0400483_035744_1180_1431 83
119 3300039062 Ga0400483_041924 Ga0400483_041924_29685_29936 83
120 3300039062 Ga0400483_044723 Ga0400483_044723_2800_3051 83
121 3300039062 Ga0400483_130587 Ga0400483_130587_3980_4231 83
122 3300039062 Ga0400483_164900 Ga0400483_164900_12286_12537 83
123 3300039062 Ga0400483_172438 Ga0400483_172438_731_982 83
124 3300039062 Ga0400483_211911 Ga0400483_211911_831_1082 83
125 3300039062 Ga0400483_241099 Ga0400483_241099_3915_4166 83
126 3300039062 Ga0400483_262734 Ga0400483_262734_1549_1800 83
127 3300039437 Ga0436365_0575180 Ga0436365_0575180_77_328 83
128 3300039437 Ga0436365_1602503 Ga0436365_1602503_4763_5014 83
129 3300039438 Ga0436360_0999407 Ga0436360_0999407_606_857 83
130 3300039438 Ga0436360_1009488 Ga0436360_1009488_254_505 83
131 3300039438 Ga0436360_1039552 Ga0436360_1039552_631_882 83
132 3300039447 Ga0436361_1017389 Ga0436361_1017389_405_656 83
133 3300039450 Ga0436363_1696032 Ga0436363_1696032_263_514 83
134 3300039453 Ga0436362_0882125 Ga0436362_0882125_2886_3137 83
135 3300041451 Ga0451791_0570806 Ga0451791_0570806_251_502 83
136 3300041494 Ga0451837_0490912 Ga0451837_0490912_299_550 83
137 3300041509 Ga0451843_0279339 Ga0451843_0279339_218_469 83
138 3300044683 Ga0466965_0631123 Ga0466965_0631123_174_425 83
139 3300044693 Ga0466961_0152086 Ga0466961_0152086_402_653 83
140 3300045836 Ga0466958_0219504 Ga0466958_0219504_846_1097 83
141 3300046459 Ga0495629_0933647 Ga0495629_0933647_88_339 83
142 3300046461 Ga0495641_0307255 Ga0495641_0307255_121_372 83
143 3300046462 Ga0495651_0040762 Ga0495651_0040762_1504_1755 83
144 3300046462 Ga0495651_0411202 Ga0495651_0411202_510_761 83
145 3300046463 Ga0495653_0022957 Ga0495653_0022957_344_595 83
146 3300046463 Ga0495653_0560691 Ga0495653_0560691_361_612 83
147 3300046473 Ga0495582_0844047 Ga0495582_0844047_59_310 83
148 3300046511 Ga0495608_0619465 Ga0495608_0619465_30_281 83
149 3300046516 Ga0495628_0528869 Ga0495628_0528869_310_561 83
150 3300046517 Ga0495630_0576584 Ga0495630_0576584_199_450 83
151 3300046529 Ga0495652_0467008 Ga0495652_0467008_468_719 83
152 3300046536 Ga0495587_0010276 Ga0495587_0010276_1737_1988 83
153 3300046559 Ga0495667_0003836 Ga0495667_0003836_2961_3212 83
154 3300046663 Ga0495635_0263448 Ga0495635_0263448_12_263 83
155 3300046675 Ga0495657_0122267 Ga0495657_0122267_502_753 83
156 3300046678 Ga0495599_0734234 Ga0495599_0734234_187_438 83
157 3300046679 Ga0495623_0036112 Ga0495623_0036112_785_1036 83
158 3300047317 Ga0495604_0103385 Ga0495604_0103385_624_875 83
159 3300047322 Ga0495680_0491195 Ga0495680_0491195_203_454 83
160 3300047444 Ga0495675_0078564 Ga0495675_0078564_1784_2035 83
161 3300047444 Ga0495675_0805335 Ga0495675_0805335_88_339 83
162 3300047471 Ga0495684_0140370 Ga0495684_0140370_256_507 83
163 3300048088 Ga0495602_0391754 Ga0495602_0391754_362_613 83
164 3300048088 Ga0495602_1138285 Ga0495602_1138285_214_465 83
165 3300048903 Ga0496100_0603265 Ga0496100_0603265_422_673 83
166 3300048904 Ga0496101_0584831 Ga0496101_0584831_71_322 83
167 3300048905 Ga0496102_0599935 Ga0496102_0599935_324_575 83
168 3300048906 Ga0496103_0395483 Ga0496103_0395483_317_568 83
169 3300048907 Ga0496104_1071685 Ga0496104_1071685_424_675 83
170 3300048909 Ga0496106_1120260 Ga0496106_1120260_257_508 83
171 3300048911 Ga0496108_0446543 Ga0496108_0446543_405_656 83
172 3300048912 Ga0496109_0362602 Ga0496109_0362602_1086_1337 83
173 3300048912 Ga0496109_1013595 Ga0496109_1013595_318_584 83
174 3300048913 Ga0496110_0392609 Ga0496110_0392609_872_1123 83
175 3300048916 Ga0496113_1048819 Ga0496113_1048819_332_583 83
176 3300048917 Ga0496114_0552586 Ga0496114_0552586_401_652 83
177 3300049569 Ga0501032_0022556 Ga0501032_0022556_1440_1691 83
178 3300049570 Ga0501033_0696933 Ga0501033_0696933_337_588 83
179 3300049571 Ga0501034_0000666 Ga0501034_0000666_20253_20504 83
180 3300049571 Ga0501034_0377291 Ga0501034_0377291_590_841 83
181 3300049572 Ga0501036_0175594 Ga0501036_0175594_304_555 83
182 3300049572 Ga0501036_1469802 Ga0501036_1469802_203_457 83
183 3300049573 Ga0501037_0001329 Ga0501037_0001329_17444_17695 83
184 3300049573 Ga0501037_0021962 Ga0501037_0021962_2293_2544 83
185 3300049574 Ga0501038_0013014 Ga0501038_0013014_490_741 83
186 3300049575 Ga0501039_0272112 Ga0501039_0272112_649_900 83
187 3300049576 Ga0501040_1006100 Ga0501040_1006100_179_430 83
188 3300049579 Ga0501043_0007961 Ga0501043_0007961_5015_5266 83
189 3300049581 Ga0501047_0753710 Ga0501047_0753710_415_666 83
190 3300049582 Ga0501048_1242708 Ga0501048_1242708_255_506 83
191 3300049583 Ga0501067_0045695 Ga0501067_0045695_1596_1847 83
192 3300049583 Ga0501067_0079615 Ga0501067_0079615_611_862 83
193 3300049584 Ga0501068_0000098 Ga0501068_0000098_7488_7739 83
194 3300049586 Ga0501070_0007332 Ga0501070_0007332_4157_4408 83
195 3300049586 Ga0501070_0020200 Ga0501070_0020200_4459_4710 83
196 3300049588 Ga0501072_0007967 Ga0501072_0007967_3017_3268 83
197 3300049588 Ga0501072_0060274 Ga0501072_0060274_988_1239 83
198 3300049588 Ga0501072_0173913 Ga0501072_0173913_1430_1681 83
199 3300049589 Ga0501073_0024702 Ga0501073_0024702_3134_3385 83
200 3300049589 Ga0501073_1240907 Ga0501073_1240907_176_427 83
201 3300049590 Ga0501074_0000333 Ga0501074_0000333_2018_2269 83
202 3300049590 Ga0501074_0074367 Ga0501074_0074367_1387_1638 83
203 3300049590 Ga0501074_0080338 Ga0501074_0080338_670_921 83
204 3300049592 Ga0501076_0079570 Ga0501076_0079570_1259_1510 83
205 3300049741 Ga0501079_1483254 Ga0501079_1483254_33_284 83
206 3300049741 Ga0501079_1556857 Ga0501079_1556857_86_337 83
207 3300049742 Ga0501080_0012513 Ga0501080_0012513_914_1165 83
208 3300049742 Ga0501080_0017310 Ga0501080_0017310_5597_5848 83
209 3300049742 Ga0501080_0240745 Ga0501080_0240745_422_673 83
210 3300049742 Ga0501080_0667782 Ga0501080_0667782_243_494 83
211 3300049744 Ga0501083_0045673 Ga0501083_0045673_550_801 83
212 3300049822 Ga0501035_0282450 Ga0501035_0282450_887_1138 83
213 3300049823 Ga0501044_0202897 Ga0501044_0202897_1272_1523 83
214 3300050489 nmdc:mga03683_22620_c1 nmdc:mga03683_22620_c1_14_265 83
215 3300050489 nmdc:mga03683_338454_c1 nmdc:mga03683_338454_c1_419_670 83
216 3300050489 nmdc:mga03683_630528_c1 nmdc:mga03683_630528_c1_63_314 83
217 3300050490 nmdc:mga03n38_307875_c1 nmdc:mga03n38_307875_c1_114_365 83
218 3300050491 nmdc:mga00v17_270423_c1 nmdc:mga00v17_270423_c1_101_352 83
219 3300050491 nmdc:mga00v17_40994_c1 nmdc:mga00v17_40994_c1_583_834 83
220 3300050491 nmdc:mga00v17_507359_c1 nmdc:mga00v17_507359_c1_474_725 83
221 3300050491 nmdc:mga00v17_7843_c1 nmdc:mga00v17_7843_c1_3626_3877 83
222 3300050491 nmdc:mga00v17_896190_c1 nmdc:mga00v17_896190_c1_104_355 83
223 3300050491 nmdc:mga00v17_9780_c1 nmdc:mga00v17_9780_c1_1072_1323 83
224 3300050492 nmdc:mga0yw44_3611_c1 nmdc:mga0yw44_3611_c1_4130_4381 83
225 3300050492 nmdc:mga0yw44_375796_c1 nmdc:mga0yw44_375796_c1_577_828 83
226 3300050492 nmdc:mga0yw44_636268_c1 nmdc:mga0yw44_636268_c1_422_673 83
227 3300050492 nmdc:mga0yw44_8482_c2 nmdc:mga0yw44_8482_c2_1073_1324 83
228 3300050492 nmdc:mga0yw44_879653_c1 nmdc:mga0yw44_879653_c1_280_531 83
229 3300050492 nmdc:mga0yw44_973317_c1 nmdc:mga0yw44_973317_c1_68_319 83
230 3300050494 nmdc:mga06z11_67387_c1 nmdc:mga06z11_67387_c1_1497_1748 83
231 3300050507 nmdc:mga05p37_89598_c1 nmdc:mga05p37_89598_c1_967_1218 83
232 3300050508 nmdc:mga09592_593635_c1 nmdc:mga09592_593635_c1_157_408 83
233 3300050509 nmdc:mga0qj67_98683_c1 nmdc:mga0qj67_98683_c1_180_431 83
234 3300050510 nmdc:mga06r32_49104_c1 nmdc:mga06r32_49104_c1_506_757 83
235 3300053077 Ga0495601_0236892 Ga0495601_0236892_919_1170 83
236 3300053084 Ga0495595_0363367 Ga0495595_0363367_185_436 83
237 3300053138 Ga0500564_302506 Ga0500564_302506_16_267 83
238 3300060353 Ga0501082_0620882 Ga0501082_0620882_271_522 83
239 3300060353 Ga0501082_1048330 Ga0501082_1048330_183_434 83
240 3300061734 Ga0530510_0745595 Ga0530510_0745595_472_723 83
241 3300003373 JGI25407J50210_10002455 JGI25407J50210_100024552 84
242 3300003911 JGI25405J52794_10012367 JGI25405J52794_100123671 84
243 3300005338 Ga0068868_100560352 Ga0068868_1005603522 84
244 3300005339 Ga0070660_100520149 Ga0070660_1005201492 84
245 3300005340 Ga0070689_101603487 Ga0070689_1016034871 84
246 3300005347 Ga0070668_100149775 Ga0070668_1001497753 84
247 3300005347 Ga0070668_101180590 Ga0070668_1011805901 84
248 3300005354 Ga0070675_100142130 Ga0070675_1001421302 84
249 3300005355 Ga0070671_100012872 Ga0070671_1000128726 84
250 3300005356 Ga0070674_100393756 Ga0070674_1003937562 84
251 3300005356 Ga0070674_100549119 Ga0070674_1005491191 84
252 3300005364 Ga0070673_100774295 Ga0070673_1007742953 84
253 3300005364 Ga0070673_100919186 Ga0070673_1009191861 84
254 3300005364 Ga0070673_101599679 Ga0070673_1015996792 84
255 3300005365 Ga0070688_100532259 Ga0070688_1005322593 84
256 3300005365 Ga0070688_101630180 Ga0070688_1016301801 84
257 3300005367 Ga0070667_101297558 Ga0070667_1012975582 84
258 3300005435 Ga0070714_100152956 Ga0070714_1001529563 84
259 3300005435 Ga0070714_101582351 Ga0070714_1015823511 84
260 3300005437 Ga0070710_11529057 Ga0070710_115290571 84
261 3300005439 Ga0070711_100768928 Ga0070711_1007689282 84
262 3300005441 Ga0070700_101848570 Ga0070700_1018485702 84
263 3300005445 Ga0070708_100013011 Ga0070708_1000130118 84
264 3300005456 Ga0070678_100762466 Ga0070678_1007624661 84
265 3300005456 Ga0070678_101246724 Ga0070678_1012467242 84
266 3300005458 Ga0070681_10280899 Ga0070681_102808992 84
267 3300005459 Ga0068867_100835803 Ga0068867_1008358032 84
268 3300005459 Ga0068867_101873828 Ga0068867_1018738281 84
269 3300005518 Ga0070699_102202719 Ga0070699_1022027192 84
270 3300005530 Ga0070679_100869378 Ga0070679_1008693781 84
271 3300005535 Ga0070684_100685688 Ga0070684_1006856881 84
272 3300005536 Ga0070697_101428563 Ga0070697_1014285632 84
273 3300005539 Ga0068853_100488991 Ga0068853_1004889912 84
274 3300005549 Ga0070704_100632936 Ga0070704_1006329363 84
275 3300005549 Ga0070704_101018444 Ga0070704_1010184442 84
276 3300005614 Ga0068856_100496084 Ga0068856_1004960842 84
277 3300005614 Ga0068856_101967424 Ga0068856_1019674242 84
278 3300005615 Ga0070702_100938899 Ga0070702_1009388991 84
279 3300005616 Ga0068852_100438494 Ga0068852_1004384943 84
280 3300005617 Ga0068859_100257887 Ga0068859_1002578872 84
281 3300005719 Ga0068861_100031746 Ga0068861_1000317463 84
282 3300005840 Ga0068870_10644374 Ga0068870_106443742 84
283 3300005841 Ga0068863_100799032 Ga0068863_1007990322 84
284 3300005842 Ga0068858_102170828 Ga0068858_1021708282 84
285 3300005937 Ga0081455_10001010 Ga0081455_1000101015 84
286 3300005937 Ga0081455_10085566 Ga0081455_100855663 84
287 3300005937 Ga0081455_10090442 Ga0081455_100904423 84
288 3300005937 Ga0081455_10218693 Ga0081455_102186932 84
289 3300005981 Ga0081538_10000291 Ga0081538_1000029126 84
290 3300005981 Ga0081538_10003721 Ga0081538_100037218 84
291 3300005981 Ga0081538_10076270 Ga0081538_100762702 84
292 3300005983 Ga0081540_1334971 Ga0081540_13349712 84
293 3300006038 Ga0075365_10085467 Ga0075365_100854672 84
294 3300006038 Ga0075365_10117420 Ga0075365_101174203 84
295 3300006038 Ga0075365_10177594 Ga0075365_101775942 84
296 3300006038 Ga0075365_10365571 Ga0075365_103655713 84
297 3300006038 Ga0075365_10552168 Ga0075365_105521682 84
298 3300006042 Ga0075368_10106482 Ga0075368_101064822 84
299 3300006042 Ga0075368_10165038 Ga0075368_101650382 84
300 3300006048 Ga0075363_100328801 Ga0075363_1003288012 84
301 3300006048 Ga0075363_100405652 Ga0075363_1004056521 84
302 3300006048 Ga0075363_100411346 Ga0075363_1004113462 84
303 3300006048 Ga0075363_100927299 Ga0075363_1009272992 84
304 3300006051 Ga0075364_10162037 Ga0075364_101620373 84
305 3300006051 Ga0075364_10178904 Ga0075364_101789042 84
306 3300006051 Ga0075364_10252109 Ga0075364_102521092 84
307 3300006051 Ga0075364_10490547 Ga0075364_104905473 84
308 3300006051 Ga0075364_10744273 Ga0075364_107442731 84
309 3300006175 Ga0070712_100908845 Ga0070712_1009088452 84
310 3300006177 Ga0075362_10396908 Ga0075362_103969082 84
311 3300006177 Ga0075362_10616574 Ga0075362_106165742 84
312 3300006178 Ga0075367_10031451 Ga0075367_100314514 84
313 3300006178 Ga0075367_10373588 Ga0075367_103735882 84
314 3300006178 Ga0075367_10378820 Ga0075367_103788203 84
315 3300006178 Ga0075367_10835265 Ga0075367_108352651 84
316 3300006178 Ga0075367_10936652 Ga0075367_109366521 84
317 3300006195 Ga0075366_10654326 Ga0075366_106543261 84
318 3300006353 Ga0075370_10190304 Ga0075370_101903043 84
319 3300006353 Ga0075370_10296550 Ga0075370_102965503 84
320 3300006353 Ga0075370_10892830 Ga0075370_108928302 84
321 3300006844 Ga0075428_100000156 Ga0075428_10000015619 84
322 3300006844 Ga0075428_100085116 Ga0075428_1000851164 84
323 3300006844 Ga0075428_100174546 Ga0075428_1001745462 84
324 3300006844 Ga0075428_100363280 Ga0075428_1003632802 84
325 3300006846 Ga0075430_100001345 Ga0075430_10000134516 84
326 3300006846 Ga0075430_100108920 Ga0075430_1001089204 84
327 3300006846 Ga0075430_100138927 Ga0075430_1001389272 84
328 3300006847 Ga0075431_100011461 Ga0075431_1000114613 84
329 3300006847 Ga0075431_100062165 Ga0075431_1000621652 84
330 3300006847 Ga0075431_100593151 Ga0075431_1005931512 84
331 3300006847 Ga0075431_100894872 Ga0075431_1008948722 84
332 3300006871 Ga0075434_100377383 Ga0075434_1003773832 84
333 3300006880 Ga0075429_100170935 Ga0075429_1001709353 84
334 3300006880 Ga0075429_100267714 Ga0075429_1002677142 84
335 3300006880 Ga0075429_101711855 Ga0075429_1017118552 84
336 3300006881 Ga0068865_101090233 Ga0068865_1010902332 84
337 3300006914 Ga0075436_101560546 Ga0075436_1015605462 84
338 3300006931 Ga0097620_100257886 Ga0097620_1002578862 84
339 3300007788 Ga0099795_10148759 Ga0099795_101487592 84
340 3300009093 Ga0105240_10639363 Ga0105240_106393632 84
341 3300009094 Ga0111539_10720186 Ga0111539_107201862 84
342 3300009094 Ga0111539_12326014 Ga0111539_123260141 84
343 3300009094 Ga0111539_13159430 Ga0111539_131594302 84
344 3300009098 Ga0105245_10016863 Ga0105245_100168635 84
345 3300009098 Ga0105245_10304022 Ga0105245_103040222 84
346 3300009098 Ga0105245_11356747 Ga0105245_113567471 84
347 3300009098 Ga0105245_11981142 Ga0105245_119811422 84
348 3300009098 Ga0105245_12174315 Ga0105245_121743152 84
349 3300009147 Ga0114129_10000561 Ga0114129_1000056114 84
350 3300009147 Ga0114129_10005087 Ga0114129_1000508718 84
351 3300009147 Ga0114129_10160191 Ga0114129_101601912 84
352 3300009148 Ga0105243_10395642 Ga0105243_103956423 84
353 3300009148 Ga0105243_11744635 Ga0105243_117446351 84
354 3300009148 Ga0105243_11940106 Ga0105243_119401062 84
355 3300009148 Ga0105243_12131438 Ga0105243_121314381 84
356 3300009174 Ga0105241_11288629 Ga0105241_112886292 84
357 3300009176 Ga0105242_10063603 Ga0105242_100636034 84
358 3300009176 Ga0105242_12543478 Ga0105242_125434781 84
359 3300009177 Ga0105248_12956788 Ga0105248_129567882 84
360 3300009545 Ga0105237_11228691 Ga0105237_112286911 84
361 3300009551 Ga0105238_12070115 Ga0105238_120701152 84
362 3300009553 Ga0105249_11061538 Ga0105249_110615381 84
363 3300009553 Ga0105249_11469604 Ga0105249_114696041 84
364 3300009553 Ga0105249_12773647 Ga0105249_127736471 84
365 3300010375 Ga0105239_10122168 Ga0105239_101221683 84
366 3300010375 Ga0105239_11589461 Ga0105239_115894612 84
367 3300011119 Ga0105246_10454604 Ga0105246_104546042 84
368 3300011119 Ga0105246_11305468 Ga0105246_113054681 84
369 3300011119 Ga0105246_12110425 Ga0105246_121104251 84
370 3300012491 Ga0157329_1019916 Ga0157329_10199162 84
371 3300013100 Ga0157373_11204731 Ga0157373_112047312 84
372 3300013105 Ga0157369_10392094 Ga0157369_103920941 84
373 3300013297 Ga0157378_10440627 Ga0157378_104406272 84
374 3300013297 Ga0157378_11802431 Ga0157378_118024311 84
375 3300013297 Ga0157378_12067775 Ga0157378_120677751 84
376 3300013297 Ga0157378_12645277 Ga0157378_126452772 84
377 3300013306 Ga0163162_12721468 Ga0163162_127214682 84
378 3300013307 Ga0157372_10639090 Ga0157372_106390902 84
379 3300013307 Ga0157372_11387247 Ga0157372_113872473 84
380 3300013308 Ga0157375_10537707 Ga0157375_105377072 84
381 3300013308 Ga0157375_11209345 Ga0157375_112093451 84
382 3300013308 Ga0157375_12085487 Ga0157375_120854871 84
383 3300014325 Ga0163163_10289665 Ga0163163_102896653 84
384 3300014325 Ga0163163_10441767 Ga0163163_104417673 84
385 3300014326 Ga0157380_11122936 Ga0157380_111229363 84
386 3300014326 Ga0157380_13434909 Ga0157380_134349092 84
387 3300014745 Ga0157377_11185491 Ga0157377_111854912 84
388 3300014968 Ga0157379_10469673 Ga0157379_104696732 84
389 3300014968 Ga0157379_10734725 Ga0157379_107347252 84
390 3300014968 Ga0157379_12154360 Ga0157379_121543601 84
391 3300014968 Ga0157379_12665658 Ga0157379_126656582 84
392 3300014969 Ga0157376_11265249 Ga0157376_112652492 84
393 3300014969 Ga0157376_11301485 Ga0157376_113014851 84
394 3300014969 Ga0157376_12182718 Ga0157376_121827182 84
395 3300014969 Ga0157376_12954178 Ga0157376_129541781 84
396 3300017792 Ga0163161_10853542 Ga0163161_108535421 84
397 3300020069 Ga0197907_10534594 Ga0197907_105345941 84
398 3300020069 Ga0197907_10755373 Ga0197907_107553732 84
399 3300020070 Ga0206356_10096014 Ga0206356_100960142 84
400 3300020070 Ga0206356_10185486 Ga0206356_101854861 84
401 3300020076 Ga0206355_1067193 Ga0206355_10671932 84
402 3300020076 Ga0206355_1343555 Ga0206355_13435551 84
403 3300020076 Ga0206355_1525959 Ga0206355_15259592 84
404 3300020081 Ga0206354_10409034 Ga0206354_104090342 84
405 3300020081 Ga0206354_10451484 Ga0206354_104514842 84
406 3300020081 Ga0206354_10983743 Ga0206354_109837432 84
407 3300020081 Ga0206354_11094166 Ga0206354_110941662 84
408 3300020082 Ga0206353_10258710 Ga0206353_102587101 84
409 3300020082 Ga0206353_11180624 Ga0206353_111806241 84
410 3300022467 Ga0224712_10305271 Ga0224712_103052712 84
411 3300022467 Ga0224712_10389241 Ga0224712_103892411 84
412 3300022467 Ga0224712_10475406 Ga0224712_104754062 84
413 3300025901 Ga0207688_10259322 Ga0207688_102593222 84
414 3300025903 Ga0207680_11038453 Ga0207680_110384531 84
415 3300025907 Ga0207645_11238244 Ga0207645_112382441 84
416 3300025910 Ga0207684_10962714 Ga0207684_109627142 84
417 3300025912 Ga0207707_10063579 Ga0207707_100635793 84
418 3300025912 Ga0207707_10321453 Ga0207707_103214532 84
419 3300025914 Ga0207671_11426262 Ga0207671_114262622 84
420 3300025919 Ga0207657_10512051 Ga0207657_105120512 84
421 3300025919 Ga0207657_11046745 Ga0207657_110467451 84
422 3300025921 Ga0207652_10763828 Ga0207652_107638282 84
423 3300025924 Ga0207694_11606597 Ga0207694_116065972 84
424 3300025927 Ga0207687_10097629 Ga0207687_100976292 84
425 3300025927 Ga0207687_10207911 Ga0207687_102079112 84
426 3300025929 Ga0207664_10678625 Ga0207664_106786252 84
427 3300025931 Ga0207644_10038155 Ga0207644_100381552 84
428 3300025931 Ga0207644_11540196 Ga0207644_115401962 84
429 3300025934 Ga0207686_10259147 Ga0207686_102591472 84
430 3300025937 Ga0207669_10136376 Ga0207669_101363763 84
431 3300025937 Ga0207669_11196727 Ga0207669_111967271 84
432 3300025937 Ga0207669_11419061 Ga0207669_114190611 84
433 3300025937 Ga0207669_11710850 Ga0207669_117108501 84
434 3300025940 Ga0207691_11043473 Ga0207691_110434732 84
435 3300025942 Ga0207689_10720537 Ga0207689_107205371 84
436 3300025944 Ga0207661_11824925 Ga0207661_118249252 84
437 3300025961 Ga0207712_10242554 Ga0207712_102425543 84
438 3300025961 Ga0207712_11636553 Ga0207712_116365532 84
439 3300025972 Ga0207668_11120850 Ga0207668_111208502 84
440 3300025986 Ga0207658_10637560 Ga0207658_106375602 84
441 3300025986 Ga0207658_11408830 Ga0207658_114088302 84
442 3300026023 Ga0207677_12301124 Ga0207677_123011241 84
443 3300026075 Ga0207708_10562541 Ga0207708_105625413 84
444 3300026075 Ga0207708_11362706 Ga0207708_113627062 84
445 3300026078 Ga0207702_10689435 Ga0207702_106894352 84
446 3300026095 Ga0207676_10814303 Ga0207676_108143031 84
447 3300026116 Ga0207674_11365990 Ga0207674_113659902 84
448 3300026118 Ga0207675_100098435 Ga0207675_1000984353 84
449 3300026118 Ga0207675_100619913 Ga0207675_1006199132 84
450 3300026118 Ga0207675_102661102 Ga0207675_1026611021 84
451 3300026142 Ga0207698_10663423 Ga0207698_106634231 84
452 3300026142 Ga0207698_10894014 Ga0207698_108940142 84
453 3300027665 Ga0209983_1017203 Ga0209983_10172033 84
454 3300027717 Ga0209998_10048650 Ga0209998_100486504 84
455 3300027866 Ga0209813_10102835 Ga0209813_101028353 84
456 3300027866 Ga0209813_10426505 Ga0209813_104265051 84
457 3300027866 Ga0209813_10453802 Ga0209813_104538022 84
458 3300028666 Ga0265336_10107662 Ga0265336_101076622 84
459 3300028786 Ga0307517_10361990 Ga0307517_103619902 84
460 3300028800 Ga0265338_10000474 Ga0265338_1000047424 84
461 3300030760 Ga0265762_1017921 Ga0265762_10179212 84
462 3300031548 Ga0307408_101338105 Ga0307408_1013381052 84
463 3300031665 Ga0316575_10090209 Ga0316575_100902093 84
464 3300031691 Ga0316579_10397336 Ga0316579_103973361 84
465 3300031727 Ga0316576_10015988 Ga0316576_100159882 84
466 3300031727 Ga0316576_10042472 Ga0316576_100424723 84
467 3300031727 Ga0316576_10187354 Ga0316576_101873543 84
468 3300031728 Ga0316578_10007025 Ga0316578_100070253 84
469 3300031728 Ga0316578_10024208 Ga0316578_100242083 84
470 3300031728 Ga0316578_10769574 Ga0316578_107695741 84
471 3300031731 Ga0307405_10179244 Ga0307405_101792442 84
472 3300031733 Ga0316577_10001440 Ga0316577_100014406 84
473 3300031733 Ga0316577_10030042 Ga0316577_100300423 84
474 3300031824 Ga0307413_10166923 Ga0307413_101669233 84
475 3300031824 Ga0307413_11149443 Ga0307413_111494432 84
476 3300031903 Ga0307407_10851567 Ga0307407_108515672 84
477 3300031911 Ga0307412_10164750 Ga0307412_101647502 84
478 3300031911 Ga0307412_11555593 Ga0307412_115555932 84
479 3300031995 Ga0307409_101704193 Ga0307409_1017041932 84
480 3300031995 Ga0307409_101837109 Ga0307409_1018371092 84
481 3300032002 Ga0307416_101197140 Ga0307416_1011971402 84
482 3300032002 Ga0307416_101377364 Ga0307416_1013773642 84
483 3300032004 Ga0307414_11572274 Ga0307414_115722742 84
484 3300032005 Ga0307411_10282530 Ga0307411_102825302 84
485 3300032005 Ga0307411_12198327 Ga0307411_121983272 84
486 3300032137 Ga0316585_10223551 Ga0316585_102235511 84
487 3300032139 Ga0316580_10052859 Ga0316580_100528592 84
488 3300032168 Ga0316593_10329262 Ga0316593_103292622 84
489 3300033524 Ga0316592_1036970 Ga0316592_10369702 84
490 3300033524 Ga0316592_1152460 Ga0316592_11524602 84
491 3300033527 Ga0316586_1083426 Ga0316586_10834262 84
492 3300033528 Ga0316588_1144724 Ga0316588_11447241 84
493 3300033541 Ga0316596_1163374 Ga0316596_11633742 84
494 3300033541 Ga0316596_1180039 Ga0316596_11800392 84
495 3300033541 Ga0316596_1189388 Ga0316596_11893881 84
496 3300035089 Ga0373944_0128090 Ga0373944_0128090_155_412 84
497 3300035112 Ga0373932_0063268 Ga0373932_0063268_142_399 84
498 3300035116 Ga0373945_0316781 Ga0373945_0316781_356_613 84
499 3300035170 Ga0373943_0116354 Ga0373943_0116354_829_1086 84
500 3300035170 Ga0373943_0312263 Ga0373943_0312263_495_752 84
501 3300035242 Ga0373962_0345757 Ga0373962_0345757_120_374 84
502 3300035398 Ga0316574_0011346 Ga0316574_0011346_2031_2285 84
503 3300035398 Ga0316574_0282937 Ga0316574_0282937_675_932 84
504 3300035398 Ga0316574_0347263 Ga0316574_0347263_72_329 84
505 3300035398 Ga0316574_0492133 Ga0316574_0492133_334_588 84
506 3300035398 Ga0316574_0646473 Ga0316574_0646473_45_311 84
507 3300035398 Ga0316574_0760696 Ga0316574_0760696_13_270 84
508 3300035691 Ga0373931_0000022 Ga0373931_0000022_85985_86242 84
509 3300035691 Ga0373931_0562248 Ga0373931_0562248_360_617 84
510 3300035695 Ga0373927_0031428 Ga0373927_0031428_942_1199 84
511 3300035725 Ga0373947_0076748 Ga0373947_0076748_1351_1608 84
512 3300036647 Ga0316582_0074008 Ga0316582_0074008_1310_1564 84
513 3300036712 Ga0316584_0000836 Ga0316584_0000836_14333_14599 84
514 3300036712 Ga0316584_0007820 Ga0316584_0007820_6855_7109 84
515 3300036712 Ga0316584_0069518 Ga0316584_0069518_1551_1805 84
516 3300036712 Ga0316584_0723085 Ga0316584_0723085_389_646 84
517 3300036712 Ga0316584_0973403 Ga0316584_0973403_189_446 84
518 3300036712 Ga0316584_1139645 Ga0316584_1139645_205_462 84
519 3300037068 Ga0373925_0004578 Ga0373925_0004578_9675_9932 84
520 3300037068 Ga0373925_0818717 Ga0373925_0818717_353_613 84
521 3300037418 Ga0395900_0022542 Ga0395900_0022542_1735_1995 84
522 3300037418 Ga0395900_1609897 Ga0395900_1609897_198_452 84
523 3300037471 Ga0395905_0000007 Ga0395905_0000007_249047_249307 84
524 3300037471 Ga0395905_0006434 Ga0395905_0006434_4152_4412 84
525 3300037853 Ga0436364_0500701 Ga0436364_0500701_121_387 84
526 3300037853 Ga0436364_0987458 Ga0436364_0987458_273_530 84
527 3300038443 Ga0395901_0746351 Ga0395901_0746351_697_951 84
528 3300038735 Ga0400485_18280 Ga0400485_18280_159_413 84
529 3300038735 Ga0400485_19625 Ga0400485_19625_2142_2396 84
530 3300039110 Ga0400487_32587 Ga0400487_32587_882_1136 84
531 3300039447 Ga0436361_0930879 Ga0436361_0930879_168_452 84
532 3300041404 Ga0439436_0016276 Ga0439436_0016276_421_675 84
533 3300041405 Ga0439438_044338 Ga0439438_044338_67_321 84
534 3300041407 Ga0439447_085445 Ga0439447_085445_427_681 84
535 3300041408 Ga0439453_0095971 Ga0439453_0095971_202_456 84
536 3300041410 Ga0439461_0029082 Ga0439461_0029082_260_514 84
537 3300041411 Ga0439466_0081330 Ga0439466_0081330_528_782 84
538 3300041413 Ga0439465_0021828 Ga0439465_0021828_595_849 84
539 3300041413 Ga0439465_0099556 Ga0439465_0099556_324_578 84
540 3300041443 Ga0451789_0323420 Ga0451789_0323420_197_451 84
541 3300041458 Ga0451798_0082647 Ga0451798_0082647_196_450 84
542 3300041486 Ga0451807_1054893 Ga0451807_1054893_437_706 84
543 3300041492 Ga0451835_0171160 Ga0451835_0171160_21_287 84
544 3300041492 Ga0451835_0610512 Ga0451835_0610512_123_392 84
545 3300041494 Ga0451837_0313488 Ga0451837_0313488_176_433 84
546 3300041507 Ga0451851_0647234 Ga0451851_0647234_181_459 84
547 3300041511 Ga0451855_0049369 Ga0451855_0049369_29_283 84
548 3300041512 Ga0451853_1052247 Ga0451853_1052247_244_501 84
549 3300041512 Ga0451853_2024082 Ga0451853_2024082_20_277 84
550 3300041997 Ga0439431_0044634 Ga0439431_0044634_254_508 84
551 3300042001 Ga0439441_098197 Ga0439441_098197_276_530 84
552 3300042003 Ga0439443_028026 Ga0439443_028026_282_536 84
553 3300042004 Ga0439445_0215847 Ga0439445_0215847_144_416 84
554 3300042005 Ga0439448_0009654 Ga0439448_0009654_816_1070 84
555 3300042008 Ga0439450_018538 Ga0439450_018538_525_779 84
556 3300042009 Ga0439451_049945 Ga0439451_049945_473_727 84
557 3300042010 Ga0439452_033903 Ga0439452_033903_801_1055 84
558 3300042010 Ga0439452_064622 Ga0439452_064622_311_565 84
559 3300042011 Ga0439454_005383 Ga0439454_005383_420_674 84
560 3300042012 Ga0439455_0163356 Ga0439455_0163356_207_461 84
561 3300042016 Ga0439463_006807 Ga0439463_006807_1683_1937 84
562 3300042142 Ga0450905_085587 Ga0450905_085587_146_400 84
563 3300042156 Ga0439446_0140849 Ga0439446_0140849_384_638 84
564 3300042435 Ga0439434_0004926 Ga0439434_0004926_2670_2924 84
565 3300042435 Ga0439434_0016835 Ga0439434_0016835_1537_1791 84
566 3300042439 Ga0439464_0003015 Ga0439464_0003015_1787_2041 84
567 3300042439 Ga0439464_0271580 Ga0439464_0271580_278_532 84
568 3300042533 Ga0450901_015928 Ga0450901_015928_346_600 84
569 3300042993 Ga0439440_0003475 Ga0439440_0003475_705_959 84
570 3300042993 Ga0439440_0259250 Ga0439440_0259250_199_453 84
571 3300044656 Ga0466969_0062836 Ga0466969_0062836_1415_1669 84
572 3300044684 Ga0466966_0111492 Ga0466966_0111492_497_751 84
573 3300044684 Ga0466966_0816974 Ga0466966_0816974_257_514 84
574 3300045836 Ga0466958_1064496 Ga0466958_1064496_92_346 84
575 3300045976 Ga0466967_1820085 Ga0466967_1820085_198_452 84
576 3300046455 Ga0495603_0727564 Ga0495603_0727564_256_510 84
577 3300046459 Ga0495629_0152007 Ga0495629_0152007_864_1133 84
578 3300046459 Ga0495629_0153892 Ga0495629_0153892_714_968 84
579 3300046459 Ga0495629_0344632 Ga0495629_0344632_342_596 84
580 3300046459 Ga0495629_1152098 Ga0495629_1152098_148_402 84
581 3300046461 Ga0495641_0259339 Ga0495641_0259339_397_654 84
582 3300046473 Ga0495582_0146902 Ga0495582_0146902_287_541 84
583 3300046473 Ga0495582_0488008 Ga0495582_0488008_108_362 84
584 3300046473 Ga0495582_0638483 Ga0495582_0638483_173_442 84
585 3300046476 Ga0495662_0532100 Ga0495662_0532100_266_520 84
586 3300046477 Ga0495664_0767391 Ga0495664_0767391_201_455 84
587 3300046514 Ga0495618_0763917 Ga0495618_0763917_236_493 84
588 3300046516 Ga0495628_0185841 Ga0495628_0185841_867_1124 84
589 3300046517 Ga0495630_0062764 Ga0495630_0062764_370_624 84
590 3300046517 Ga0495630_0759359 Ga0495630_0759359_461_715 84
591 3300046529 Ga0495652_0771256 Ga0495652_0771256_182_436 84
592 3300046535 Ga0495586_0005559 Ga0495586_0005559_2499_2753 84
593 3300046616 Ga0495668_0435922 Ga0495668_0435922_417_677 84
594 3300046642 Ga0495634_0011499 Ga0495634_0011499_4608_4862 84
595 3300046642 Ga0495634_0724840 Ga0495634_0724840_173_427 84
596 3300046663 Ga0495635_0339894 Ga0495635_0339894_71_325 84
597 3300046674 Ga0495588_0417111 Ga0495588_0417111_381_635 84
598 3300046681 Ga0495647_0185539 Ga0495647_0185539_519_773 84
599 3300046681 Ga0495647_0432047 Ga0495647_0432047_46_315 84
600 3300046683 Ga0495658_0035790 Ga0495658_0035790_2283_2552 84
601 3300046683 Ga0495658_0185667 Ga0495658_0185667_61_315 84
602 3300046689 Ga0495613_0000239 Ga0495613_0000239_20850_21104 84
603 3300046689 Ga0495613_0156711 Ga0495613_0156711_318_587 84
604 3300046690 Ga0495624_0553907 Ga0495624_0553907_356_610 84
605 3300047315 Ga0495581_0427190 Ga0495581_0427190_370_624 84
606 3300047317 Ga0495604_1057029 Ga0495604_1057029_199_453 84
607 3300047320 Ga0495672_0000785 Ga0495672_0000785_125_379 84
608 3300047320 Ga0495672_0159553 Ga0495672_0159553_724_981 84
609 3300047321 Ga0495676_0280111 Ga0495676_0280111_836_1096 84
610 3300047321 Ga0495676_0439902 Ga0495676_0439902_367_621 84
611 3300047322 Ga0495680_0159608 Ga0495680_0159608_462_716 84
612 3300047322 Ga0495680_0202935 Ga0495680_0202935_705_959 84
613 3300048089 Ga0495614_0035750 Ga0495614_0035750_1100_1369 84
614 3300048089 Ga0495614_0187610 Ga0495614_0187610_337_591 84
615 3300048907 Ga0496104_0185724 Ga0496104_0185724_524_802 84
616 3300048907 Ga0496104_1189774 Ga0496104_1189774_20_283 84
617 3300048907 Ga0496104_1264840 Ga0496104_1264840_214_489 84
618 3300048908 Ga0496105_0588620 Ga0496105_0588620_433_708 84
619 3300048911 Ga0496108_0056403 Ga0496108_0056403_2166_2444 84
620 3300048911 Ga0496108_1213344 Ga0496108_1213344_33_290 84
621 3300048912 Ga0496109_0161568 Ga0496109_0161568_418_696 84
622 3300048912 Ga0496109_0807624 Ga0496109_0807624_15_275 84
623 3300048912 Ga0496109_1860099 Ga0496109_1860099_125_403 84
624 3300048913 Ga0496110_0147681 Ga0496110_0147681_1100_1375 84
625 3300048913 Ga0496110_0308210 Ga0496110_0308210_657_911 84
626 3300048915 Ga0496112_1111614 Ga0496112_1111614_227_484 84
627 3300048915 Ga0496112_1730185 Ga0496112_1730185_18_293 84
628 3300048916 Ga0496113_0167885 Ga0496113_0167885_773_1051 84
629 3300048917 Ga0496114_0288111 Ga0496114_0288111_722_1000 84
630 3300048917 Ga0496114_0773764 Ga0496114_0773764_155_409 84
631 3300048917 Ga0496114_0807036 Ga0496114_0807036_71_325 84
632 3300048917 Ga0496114_0896667 Ga0496114_0896667_433_687 84
633 3300049568 Ga0501031_0044900 Ga0501031_0044900_288_542 84
634 3300049568 Ga0501031_0190847 Ga0501031_0190847_1045_1299 84
635 3300049568 Ga0501031_0227059 Ga0501031_0227059_331_585 84
636 3300049569 Ga0501032_0168272 Ga0501032_0168272_1003_1257 84
637 3300049570 Ga0501033_0001944 Ga0501033_0001944_10217_10471 84
638 3300049570 Ga0501033_0027002 Ga0501033_0027002_1454_1708 84
639 3300049570 Ga0501033_0574636 Ga0501033_0574636_430_684 84
640 3300049570 Ga0501033_0600183 Ga0501033_0600183_176_430 84
641 3300049570 Ga0501033_0859619 Ga0501033_0859619_298_561 84
642 3300049571 Ga0501034_0000723 Ga0501034_0000723_22535_22789 84
643 3300049571 Ga0501034_0095563 Ga0501034_0095563_2364_2618 84
644 3300049571 Ga0501034_0157225 Ga0501034_0157225_1766_2020 84
645 3300049571 Ga0501034_0755766 Ga0501034_0755766_177_437 84
646 3300049571 Ga0501034_0958494 Ga0501034_0958494_122_376 84
647 3300049571 Ga0501034_1559769 Ga0501034_1559769_25_279 84
648 3300049572 Ga0501036_0131343 Ga0501036_0131343_423_677 84
649 3300049572 Ga0501036_0270763 Ga0501036_0270763_1069_1323 84
650 3300049572 Ga0501036_0322265 Ga0501036_0322265_994_1248 84
651 3300049572 Ga0501036_0829254 Ga0501036_0829254_233_487 84
652 3300049572 Ga0501036_1641915 Ga0501036_1641915_253_507 84
653 3300049573 Ga0501037_0036090 Ga0501037_0036090_2365_2619 84
654 3300049573 Ga0501037_1061893 Ga0501037_1061893_14_271 84
655 3300049574 Ga0501038_0558997 Ga0501038_0558997_570_824 84
656 3300049574 Ga0501038_0656242 Ga0501038_0656242_394_648 84
657 3300049574 Ga0501038_0787459 Ga0501038_0787459_402_656 84
658 3300049575 Ga0501039_0021598 Ga0501039_0021598_2076_2330 84
659 3300049575 Ga0501039_0116514 Ga0501039_0116514_784_1038 84
660 3300049575 Ga0501039_0142200 Ga0501039_0142200_1359_1613 84
661 3300049575 Ga0501039_0319675 Ga0501039_0319675_212_466 84
662 3300049576 Ga0501040_0002361 Ga0501040_0002361_9457_9711 84
663 3300049576 Ga0501040_0037530 Ga0501040_0037530_401_655 84
664 3300049576 Ga0501040_0179095 Ga0501040_0179095_1012_1266 84
665 3300049576 Ga0501040_0315028 Ga0501040_0315028_669_923 84
666 3300049577 Ga0501041_0012177 Ga0501041_0012177_219_473 84
667 3300049577 Ga0501041_0068902 Ga0501041_0068902_1500_1754 84
668 3300049577 Ga0501041_0266706 Ga0501041_0266706_715_969 84
669 3300049577 Ga0501041_0738147 Ga0501041_0738147_192_446 84
670 3300049578 Ga0501042_0024505 Ga0501042_0024505_2398_2652 84
671 3300049578 Ga0501042_0028809 Ga0501042_0028809_290_544 84
672 3300049578 Ga0501042_0305834 Ga0501042_0305834_122_376 84
673 3300049578 Ga0501042_0308021 Ga0501042_0308021_839_1093 84
674 3300049578 Ga0501042_0440303 Ga0501042_0440303_665_919 84
675 3300049578 Ga0501042_1424257 Ga0501042_1424257_10_264 84
676 3300049578 Ga0501042_1438933 Ga0501042_1438933_27_293 84
677 3300049579 Ga0501043_0237836 Ga0501043_0237836_422_676 84
678 3300049579 Ga0501043_0557315 Ga0501043_0557315_252_506 84
679 3300049580 Ga0501046_0051785 Ga0501046_0051785_1716_1970 84
680 3300049580 Ga0501046_0119658 Ga0501046_0119658_1722_1976 84
681 3300049580 Ga0501046_0522081 Ga0501046_0522081_357_611 84
682 3300049581 Ga0501047_0125874 Ga0501047_0125874_844_1098 84
683 3300049581 Ga0501047_0544965 Ga0501047_0544965_720_974 84
684 3300049582 Ga0501048_0033877 Ga0501048_0033877_2977_3231 84
685 3300049582 Ga0501048_0633896 Ga0501048_0633896_420_674 84
686 3300049583 Ga0501067_0003698 Ga0501067_0003698_6119_6373 84
687 3300049584 Ga0501068_0029803 Ga0501068_0029803_1069_1323 84
688 3300049584 Ga0501068_0118569 Ga0501068_0118569_786_1043 84
689 3300049584 Ga0501068_0184925 Ga0501068_0184925_198_452 84
690 3300049584 Ga0501068_0487409 Ga0501068_0487409_366_620 84
691 3300049584 Ga0501068_0714304 Ga0501068_0714304_138_392 84
692 3300049584 Ga0501068_0732288 Ga0501068_0732288_320_574 84
693 3300049584 Ga0501068_1194632 Ga0501068_1194632_194_448 84
694 3300049585 Ga0501069_0000044 Ga0501069_0000044_68096_68368 84
695 3300049585 Ga0501069_0009790 Ga0501069_0009790_4524_4778 84
696 3300049585 Ga0501069_0012202 Ga0501069_0012202_1704_1958 84
697 3300049585 Ga0501069_0212172 Ga0501069_0212172_369_623 84
698 3300049585 Ga0501069_0414867 Ga0501069_0414867_47_304 84
699 3300049585 Ga0501069_0549518 Ga0501069_0549518_49_303 84
700 3300049586 Ga0501070_0000001 Ga0501070_0000001_219381_219653 84
701 3300049586 Ga0501070_0475456 Ga0501070_0475456_69_323 84
702 3300049587 Ga0501071_0018635 Ga0501071_0018635_694_948 84
703 3300049587 Ga0501071_0022391 Ga0501071_0022391_612_866 84
704 3300049587 Ga0501071_0115980 Ga0501071_0115980_1229_1483 84
705 3300049587 Ga0501071_0232931 Ga0501071_0232931_1046_1300 84
706 3300049587 Ga0501071_0301444 Ga0501071_0301444_505_759 84
707 3300049587 Ga0501071_0385119 Ga0501071_0385119_136_408 84
708 3300049587 Ga0501071_0430775 Ga0501071_0430775_381_635 84
709 3300049587 Ga0501071_1050866 Ga0501071_1050866_242_496 84
710 3300049588 Ga0501072_0003214 Ga0501072_0003214_9465_9719 84
711 3300049588 Ga0501072_0101145 Ga0501072_0101145_1790_2044 84
712 3300049588 Ga0501072_0647302 Ga0501072_0647302_250_504 84
713 3300049588 Ga0501072_0672592 Ga0501072_0672592_354_608 84
714 3300049588 Ga0501072_0769203 Ga0501072_0769203_100_366 84
715 3300049589 Ga0501073_0001297 Ga0501073_0001297_8554_8808 84
716 3300049589 Ga0501073_0313607 Ga0501073_0313607_444_698 84
717 3300049589 Ga0501073_1005569 Ga0501073_1005569_23_277 84
718 3300049590 Ga0501074_0052506 Ga0501074_0052506_1985_2239 84
719 3300049590 Ga0501074_0063498 Ga0501074_0063498_866_1138 84
720 3300049590 Ga0501074_0074240 Ga0501074_0074240_1220_1474 84
721 3300049590 Ga0501074_0154350 Ga0501074_0154350_820_1074 84
722 3300049591 Ga0501075_0036644 Ga0501075_0036644_2942_3196 84
723 3300049591 Ga0501075_0040524 Ga0501075_0040524_572_826 84
724 3300049591 Ga0501075_0205791 Ga0501075_0205791_1075_1329 84
725 3300049591 Ga0501075_0332280 Ga0501075_0332280_687_941 84
726 3300049591 Ga0501075_0859084 Ga0501075_0859084_405_659 84
727 3300049591 Ga0501075_1475047 Ga0501075_1475047_141_395 84
728 3300049592 Ga0501076_0002575 Ga0501076_0002575_2743_2997 84
729 3300049592 Ga0501076_0153094 Ga0501076_0153094_68_322 84
730 3300049592 Ga0501076_0276981 Ga0501076_0276981_499_753 84
731 3300049592 Ga0501076_0429255 Ga0501076_0429255_206_460 84
732 3300049592 Ga0501076_1102197 Ga0501076_1102197_337_591 84
733 3300049592 Ga0501076_1539431 Ga0501076_1539431_276_530 84
734 3300049593 Ga0501077_0024932 Ga0501077_0024932_1348_1602 84
735 3300049593 Ga0501077_0026413 Ga0501077_0026413_357_611 84
736 3300049593 Ga0501077_0611066 Ga0501077_0611066_100_354 84
737 3300049741 Ga0501079_0004476 Ga0501079_0004476_10056_10310 84
738 3300049741 Ga0501079_0030769 Ga0501079_0030769_2382_2636 84
739 3300049741 Ga0501079_0117657 Ga0501079_0117657_431_685 84
740 3300049741 Ga0501079_0314780 Ga0501079_0314780_911_1165 84
741 3300049741 Ga0501079_1207667 Ga0501079_1207667_28_282 84
742 3300049742 Ga0501080_0006808 Ga0501080_0006808_7749_8021 84
743 3300049742 Ga0501080_0135968 Ga0501080_0135968_950_1216 84
744 3300049742 Ga0501080_1799368 Ga0501080_1799368_222_476 84
745 3300049743 Ga0501081_0048001 Ga0501081_0048001_2616_2870 84
746 3300049743 Ga0501081_0667354 Ga0501081_0667354_294_548 84
747 3300049744 Ga0501083_0000154 Ga0501083_0000154_30905_31159 84
748 3300049744 Ga0501083_0024299 Ga0501083_0024299_2713_2967 84
749 3300049744 Ga0501083_0053285 Ga0501083_0053285_183_437 84
750 3300049744 Ga0501083_0371774 Ga0501083_0371774_146_400 84
751 3300049744 Ga0501083_0451807 Ga0501083_0451807_482_736 84
752 3300049822 Ga0501035_0186752 Ga0501035_0186752_465_719 84
753 3300049822 Ga0501035_0485201 Ga0501035_0485201_326_580 84
754 3300049822 Ga0501035_0725118 Ga0501035_0725118_16_270 84
755 3300049822 Ga0501035_1035463 Ga0501035_1035463_90_344 84
756 3300049823 Ga0501044_0003702 Ga0501044_0003702_10256_10510 84
757 3300049823 Ga0501044_0195036 Ga0501044_0195036_961_1215 84
758 3300049823 Ga0501044_1131417 Ga0501044_1131417_219_473 84
759 3300049824 Ga0501045_0002942 Ga0501045_0002942_10039_10293 84
760 3300049824 Ga0501045_0249423 Ga0501045_0249423_419_673 84
761 3300049824 Ga0501045_0614074 Ga0501045_0614074_17_271 84
762 3300049824 Ga0501045_1196664 Ga0501045_1196664_281_535 84
763 3300050489 nmdc:mga03683_319695_c1 nmdc:mga03683_319695_c1_33_287 84
764 3300050490 nmdc:mga03n38_146764_c1 nmdc:mga03n38_146764_c1_181_435 84
765 3300050490 nmdc:mga03n38_279749_c1 nmdc:mga03n38_279749_c1_409_663 84
766 3300050490 nmdc:mga03n38_393214_c1 nmdc:mga03n38_393214_c1_425_679 84
767 3300050490 nmdc:mga03n38_848994_c1 nmdc:mga03n38_848994_c1_203_457 84
768 3300050490 nmdc:mga03n38_93673_c1 nmdc:mga03n38_93673_c1_510_764 84
769 3300050490 nmdc:mga03n38_954088_c1 nmdc:mga03n38_954088_c1_208_462 84
770 3300050491 nmdc:mga00v17_204305_c1 nmdc:mga00v17_204305_c1_162_416 84
771 3300050491 nmdc:mga00v17_267005_c1 nmdc:mga00v17_267005_c1_252_506 84
772 3300050491 nmdc:mga00v17_273816_c1 nmdc:mga00v17_273816_c1_31_285 84
773 3300050492 nmdc:mga0yw44_105983_c1 nmdc:mga0yw44_105983_c1_721_975 84
774 3300050492 nmdc:mga0yw44_1093801_c1 nmdc:mga0yw44_1093801_c1_210_464 84
775 3300050492 nmdc:mga0yw44_160570_c1 nmdc:mga0yw44_160570_c1_337_591 84
776 3300050492 nmdc:mga0yw44_180717_c1 nmdc:mga0yw44_180717_c1_607_864 84
777 3300050492 nmdc:mga0yw44_232880_c1 nmdc:mga0yw44_232880_c1_917_1171 84
778 3300050492 nmdc:mga0yw44_83427_c1 nmdc:mga0yw44_83427_c1_1442_1696 84
779 3300050494 nmdc:mga06z11_470119_c1 nmdc:mga06z11_470119_c1_220_474 84
780 3300050494 nmdc:mga06z11_55458_c1 nmdc:mga06z11_55458_c1_1164_1418 84
781 3300050495 nmdc:mga04h51_256637_c1 nmdc:mga04h51_256637_c1_35_289 84
782 3300050495 nmdc:mga04h51_462409_c1 nmdc:mga04h51_462409_c1_203_457 84
783 3300050495 nmdc:mga04h51_487974_c1 nmdc:mga04h51_487974_c1_233_487 84
784 3300050495 nmdc:mga04h51_90142_c1 nmdc:mga04h51_90142_c1_589_843 84
785 3300050496 nmdc:mga07m45_234186_c1 nmdc:mga07m45_234186_c1_53_307 84
786 3300050496 nmdc:mga07m45_256002_c1 nmdc:mga07m45_256002_c1_584_838 84
787 3300050507 nmdc:mga05p37_352276_c1 nmdc:mga05p37_352276_c1_519_773 84
788 3300050507 nmdc:mga05p37_455123_c1 nmdc:mga05p37_455123_c1_843_1100 84
789 3300050507 nmdc:mga05p37_6515_c1 nmdc:mga05p37_6515_c1_2259_2513 84
790 3300050507 nmdc:mga05p37_7437_c2 nmdc:mga05p37_7437_c2_1684_1944 84
791 3300050508 nmdc:mga09592_2389_c1 nmdc:mga09592_2389_c1_660_914 84
792 3300050508 nmdc:mga09592_490308_c1 nmdc:mga09592_490308_c1_342_596 84
793 3300050509 nmdc:mga0qj67_163592_c1 nmdc:mga0qj67_163592_c1_78_335 84
794 3300050509 nmdc:mga0qj67_169276_c1 nmdc:mga0qj67_169276_c1_967_1221 84
795 3300050509 nmdc:mga0qj67_355247_c1 nmdc:mga0qj67_355247_c1_575_829 84
796 3300050509 nmdc:mga0qj67_613619_c1 nmdc:mga0qj67_613619_c1_31_288 84
797 3300050510 nmdc:mga06r32_142969_c1 nmdc:mga06r32_142969_c1_1655_1909 84
798 3300050510 nmdc:mga06r32_1526743_c1 nmdc:mga06r32_1526743_c1_258_512 84
799 3300050510 nmdc:mga06r32_24152_c1 nmdc:mga06r32_24152_c1_3670_3924 84
800 3300050510 nmdc:mga06r32_52214_c1 nmdc:mga06r32_52214_c1_129_386 84
801 3300050511 nmdc:mga08y16_1076181_c1 nmdc:mga08y16_1076181_c1_71_325 84
802 3300050511 nmdc:mga08y16_640105_c1 nmdc:mga08y16_640105_c1_460_714 84
803 3300050512 nmdc:mga0n895_1372021_c1 nmdc:mga0n895_1372021_c1_251_508 84
804 3300050513 nmdc:mga0rr50_1043450_c1 nmdc:mga0rr50_1043450_c1_161_466 84
805 3300053077 Ga0495601_0110026 Ga0495601_0110026_1392_1649 84
806 3300053078 Ga0495612_0387843 Ga0495612_0387843_40_297 84
807 3300053084 Ga0495595_0252104 Ga0495595_0252104_140_409 84
808 3300053084 Ga0495595_0289116 Ga0495595_0289116_227_481 84
809 3300053092 Ga0500583_0110976 Ga0500583_0110976_323_577 84
810 3300053094 Ga0500566_0000098 Ga0500566_0000098_563_817 84
811 3300053117 Ga0500593_193474 Ga0500593_193474_151_408 84
812 3300053139 Ga0500568_0000182 Ga0500568_0000182_27437_27691 84
813 3300053150 Ga0500603_246643 Ga0500603_246643_308_562 84
814 3300053153 Ga0500616_0048061 Ga0500616_0048061_10_264 84
815 3300054114 Ga0501084_0004656 Ga0501084_0004656_2401_2655 84
816 3300054114 Ga0501084_0027474 Ga0501084_0027474_1433_1687 84
817 3300054114 Ga0501084_0268354 Ga0501084_0268354_466_720 84
818 3300054114 Ga0501084_0305235 Ga0501084_0305235_766_1020 84
819 3300054114 Ga0501084_0507985 Ga0501084_0507985_354_608 84
820 3300054114 Ga0501084_0796754 Ga0501084_0796754_158_442 84
821 3300054114 Ga0501084_0924940 Ga0501084_0924940_336_590 84
822 3300054114 Ga0501084_1084435 Ga0501084_1084435_368_622 84
823 3300054114 Ga0501084_1278483 Ga0501084_1278483_10_264 84
824 3300054114 Ga0501084_1525640 Ga0501084_1525640_288_542 84
825 3300059421 Ga0590071_218751 Ga0590071_218751_165_419 84
826 3300059607 Ga0587125_075748 Ga0587125_075748_94_348 84
827 3300059630 Ga0587128_073125 Ga0587128_073125_397_651 84
828 3300059652 Ga0587107_069996 Ga0587107_069996_293_550 84
829 3300060346 Ga0587111_0186347 Ga0587111_0186347_301_558 84
830 3300060353 Ga0501082_0036497 Ga0501082_0036497_1408_1662 84
831 3300060353 Ga0501082_0078741 Ga0501082_0078741_2249_2503 84
832 3300060353 Ga0501082_0353740 Ga0501082_0353740_288_554 84
833 3300060353 Ga0501082_0477484 Ga0501082_0477484_59_313 84
834 3300060353 Ga0501082_0506996 Ga0501082_0506996_402_656 84
835 3300060353 Ga0501082_1016097 Ga0501082_1016097_400_654 84
836 3300060353 Ga0501082_1244564 Ga0501082_1244564_102_356 84
837 3300060353 Ga0501082_1976253 Ga0501082_1976253_14_268 84
838 3300060353 Ga0501082_1983771 Ga0501082_1983771_14_280 84
839 3300061719 Ga0466962_0749561 Ga0466962_0749561_124_378 84
840 3300061734 Ga0530510_0021851 Ga0530510_0021851_2806_3060 84
841 3300061734 Ga0530510_0170452 Ga0530510_0170452_203_457 84
842 3300061734 Ga0530510_0853216 Ga0530510_0853216_142_396 84
843 3300061734 Ga0530510_0999835 Ga0530510_0999835_216_470 84
844 3300061734 Ga0530510_1450423 Ga0530510_1450423_251_511 84

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01016

Ribosomal_L27

Ribosomal L27 protein

2

81

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ywy-assembly1.cif.gz_R the structure of the mitoribosome from neurospora crassa with bound trna at the p-site 0.9589 19 81
6yws-assembly1.cif.gz_R the structure of the large subunit of the mitoribosome from neurospora crassa 0.9568 19 81
7pkt-assembly1.cif.gz_u large subunit of the chlamydomonas reinhardtii mitoribosome 0.9527 18 82
6ywv-assembly1.cif.gz_R the structure of the atp25 bound assembly intermediate of the mitoribosome from neurospora crassa 0.9488 19 81
1v8q-assembly1.cif.gz_A crystal structure of ribosomal protein l27 from thermus thermophilus hb8 0.9333 20 84
ID Description Score Start End Superfamily
1v8qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9333 20 84 2.40.50.100
1v8qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9065 20 84 2.40.50.100
af_C0Z3L6_20_123_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9055 17 84 2.40.50.100
2ba1A01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.857 30 84 2.40.50.100
af_Q8IBQ2_8_59_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.84 29 82 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A3D3VUF3-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9876 23 84 GO:0003735
GO:0006412
GO:0022625
AF-A0A421K8E4-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9835 21 84 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A7Y5TEY2-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9763 19 84 GO:0003735
GO:0006412
GO:0022625
AF-A0A847H8S3-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9741 21 84 GO:0003735
GO:0006412
GO:0022625
AF-A0A420Z9C1-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9705 19 83 GO:0003735
GO:0005840
GO:0006412
GO:1990904

Feature Viewer

pLDDT pTM Quality
88.34 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map