F482987

General Info

Members Datasets Scaffolds Average Seq Length
838 384 819 549

Family's Representative Sequence

Representative Sequence 3300031995|Ga0307409_100066755|Ga0307409_1000667552
Length 613
Sequence MAAGRARQYDFVIVGGGSAGCALANRLSADRSNRVLVLEAGRPDYRFDVFIHMPAALAYPIGSRFYDWQYESEPEPFMNGRRIYHARGKVLGGSSSINGMIFQRGNPLDYERWAADSGMETWDYAHCLPYFRRMEDCLAAEPDDPFRGHGGPLGLERGPATNPLFTAFFEATKEAGYPPTHDVNGYRQEGFAKFDRNIRRARRLSAARAYLHPVMKRPNLKVRTRTLVTRIIFEGTRAVGVEIERQGGGTETIRAGEVILAGGAIASPQILQLSGVGNAAELGAVGITPVVDVPGVGEHLQDHLEVYIQHRSTKPVSMQPALAHWRKPWIGFQWLFLRRGPGATNHFEGGGFVRSNDEVRYPNLMFHFLPLSIRYDGSGDKSGHGYQVHVGPMYSDARGSVKIVSTDPRRHPALRFNYLSTDQDRREWVEAIRVARRILGQPALAEFDGGETSPGASVETDEEILAWVARDAETALHPSCTTRMGTDAMSVLDPLTMRVHGVGGLRVVDAGSMPYVTNGNIYAPVMMLAEKAADLILDNTPLAPEPVEFYRHAATRAVSNVTTWRPRSGWGVPDRGRGASGEKGGSVIRAQATGAVAPAGVSQPSWGSTVPTR

Samples

Sample ID Description Type Environment
1 2558860280 Kutzneria sp. 744 Isolate Unclassified
2 2565956521 Vibrio rhizosphaerae DSM 18581 Isolate Rhizosphere
3 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
4 2599185353 Staphylococcus sp. NFPP34 Isolate Rhizoplane
5 2600254943 Staphylococcus pasteuri NFIX07 Isolate Rhizoplane
6 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
7 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
8 2858950400 Achromobacter sp. K91 Isolate Unclassified
9 2867428634 Streptomyces sp. RP5T Isolate Unclassified
10 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
11 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
12 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
13 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
14 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
15 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
16 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
17 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
74 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
78 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
82 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
119 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
120 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
169 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
173 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
174 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
175 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
176 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
177 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
178 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
179 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
180 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
181 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
182 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
183 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
184 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
185 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
186 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
187 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
188 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
189 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
190 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
191 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
192 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
193 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
194 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
195 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
196 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
197 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
198 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
199 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
200 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
201 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
202 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
203 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
204 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
205 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
206 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
207 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
208 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
209 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
210 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
211 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
212 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
213 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
214 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
215 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
216 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
217 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
218 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
219 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
220 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
221 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
222 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
223 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
224 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
225 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
226 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
227 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
228 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
229 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
230 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
231 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
232 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
233 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
234 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
235 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
236 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
237 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
238 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
239 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
240 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
241 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
242 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
243 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
244 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
245 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
246 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
247 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
248 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
249 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
250 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
251 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
252 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
253 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
254 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
255 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
256 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
257 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
258 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
259 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
260 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
261 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
262 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
263 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
264 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
265 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
266 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
267 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
268 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
269 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
270 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
271 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
272 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
273 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
274 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
275 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
276 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
277 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
278 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
279 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
280 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
281 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
282 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
283 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
284 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
285 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
286 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
287 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
288 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
289 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
290 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
291 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
292 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
293 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
294 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
295 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
296 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
297 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
298 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
299 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
300 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
301 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
302 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
303 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
304 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
305 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
306 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
307 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
308 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
309 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
310 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
311 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
312 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
313 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
314 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
315 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
316 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
317 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
318 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
319 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
320 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
321 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
322 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
323 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
328 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
338 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
339 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
340 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
341 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
342 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
343 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
344 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
345 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
346 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
347 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
348 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
349 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
350 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
351 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
352 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
354 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
355 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
356 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
357 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
358 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
359 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
360 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
361 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
362 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
363 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
364 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
365 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
366 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
367 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
368 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
369 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
370 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
371 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
372 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
373 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
374 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
375 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
376 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
377 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
378 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
379 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
380 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
381 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
382 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
383 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
384 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.85
Metatranscriptomes 0
Isolates 2.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.15
Nodule 0
Rhizoplane 7.88
Rhizosphere 84.25
Stem 0
Stem Tuber 0
Unclassified 5.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10030136 3300001979 Bacteria 1771
2 JGI24744J21845_10002908 3300002077 Bacteria 3501
3 JGI25407J50210_10000506 3300003373 Bacteria 7842
4 JGI25407J50210_10005943 3300003373 Bacteria 3020
5 Ga0070683_100122150 3300005329 Bacteria 2461
6 Ga0070690_100004217 3300005330 Bacteria 7959
7 Ga0070690_100048860 3300005330 Bacteria 2696
8 Ga0070690_100061574 3300005330 Bacteria 2418
9 Ga0070670_100045779 3300005331 Bacteria 3761
10 Ga0070680_100028450 3300005336 Bacteria 4483
11 Ga0070682_100006888 3300005337 Bacteria 6389
12 Ga0068868_100002478 3300005338 Bacteria 12805
13 Ga0070660_100083828 3300005339 Bacteria 2505
14 Ga0070689_100014522 3300005340 Bacteria 5723
15 Ga0070691_10004433 3300005341 Bacteria 6380
16 Ga0070661_100026200 3300005344 Bacteria 4191
17 Ga0070675_100025862 3300005354 Bacteria 4707
18 Ga0070675_100028655 3300005354 Bacteria 4482
19 Ga0070671_100000903 3300005355 Bacteria 21644
20 Ga0070671_100015031 3300005355 Bacteria 6252
21 Ga0070674_100004418 3300005356 Bacteria 8017
22 Ga0070674_100027833 3300005356 Bacteria 3707
23 Ga0070673_100133716 3300005364 Unclassified 2085
24 Ga0070688_100018703 3300005365 Bacteria 4003
25 Ga0070688_100031062 3300005365 Bacteria 3211
26 Ga0070659_100010975 3300005366 Bacteria 6689
27 Ga0070709_10003538 3300005434 Bacteria 8393
28 Ga0070709_10008433 3300005434 Bacteria 5664
29 Ga0070709_10059357 3300005434 Bacteria 2428
30 Ga0070714_100000698 3300005435 Bacteria 23770
31 Ga0070714_100001289 3300005435 Bacteria 18147
32 Ga0070714_100002238 3300005435 Bacteria 14230
33 Ga0070714_100004075 3300005435 Bacteria 10982
34 Ga0070714_100084332 3300005435 Bacteria 2772
35 Ga0070713_100002106 3300005436 Bacteria 12865
36 Ga0070713_100121165 3300005436 Bacteria 2294
37 Ga0070710_10000632 3300005437 Bacteria 16754
38 Ga0070701_10003882 3300005438 Bacteria 5971
39 Ga0070711_100000406 3300005439 Bacteria 22315
40 Ga0070711_100004936 3300005439 Bacteria 7921
41 Ga0070705_100002591 3300005440 Bacteria 9062
42 Ga0070700_100017870 3300005441 Bacteria 4066
43 Ga0070708_100003878 3300005445 Bacteria 11736
44 Ga0070708_100045096 3300005445 Bacteria 3882
45 Ga0070663_100002095 3300005455 Bacteria 11160
46 Ga0070678_100003212 3300005456 Bacteria 9072
47 Ga0070678_100068119 3300005456 Bacteria 2652
48 Ga0070662_100072803 3300005457 Bacteria 2538
49 Ga0068867_100009134 3300005459 Bacteria 6994
50 Ga0068867_100009948 3300005459 Bacteria 6700
51 Ga0070706_100000465 3300005467 Bacteria 48000
52 Ga0070706_100047123 3300005467 Bacteria 3978
53 Ga0070707_100001997 3300005468 Bacteria 19526
54 Ga0070707_100002860 3300005468 Bacteria 16441
55 Ga0070707_100009423 3300005468 Bacteria 9063
56 Ga0070707_100019210 3300005468 Bacteria 6438
57 Ga0070707_100020654 3300005468 Bacteria 6216
58 Ga0070698_100000317 3300005471 Bacteria 49042
59 Ga0070698_100008135 3300005471 Bacteria 11337
60 Ga0070698_100050894 3300005471 Bacteria 4220
61 Ga0070698_100059773 3300005471 Bacteria 3848
62 Ga0070698_100060038 3300005471 Bacteria 3838
63 Ga0070699_100006322 3300005518 Bacteria 10330
64 Ga0070699_100017960 3300005518 Bacteria 6075
65 Ga0070679_100086969 3300005530 Bacteria 3112
66 Ga0070697_100055802 3300005536 Bacteria 3212
67 Ga0070697_100089700 3300005536 Bacteria 2540
68 Ga0070672_100015506 3300005543 Bacteria 5428
69 Ga0070686_100043391 3300005544 Bacteria 2821
70 Ga0070686_100057768 3300005544 Bacteria 2494
71 Ga0070696_100018879 3300005546 Bacteria 4668
72 Ga0070696_100067887 3300005546 Bacteria 2503
73 Ga0070665_100008498 3300005548 Bacteria 10384
74 Ga0070665_100040944 3300005548 Bacteria 4656
75 Ga0070704_100060943 3300005549 Bacteria 2698
76 Ga0070664_100067880 3300005564 Bacteria 3048
77 Ga0068854_100003077 3300005578 Bacteria 10390
78 Ga0068856_100014225 3300005614 Bacteria 7694
79 Ga0070702_100015201 3300005615 Bacteria 3923
80 Ga0070702_100031922 3300005615 Bacteria 2886
81 Ga0070702_100042026 3300005615 Bacteria 2568
82 Ga0068852_100024953 3300005616 Bacteria 4838
83 Ga0068859_100016083 3300005617 Bacteria 7516
84 Ga0068859_100083643 3300005617 Bacteria 3235
85 Ga0068864_100036797 3300005618 Bacteria 4174
86 Ga0068866_10004888 3300005718 Bacteria 5505
87 Ga0068861_100030100 3300005719 Bacteria 3977
88 Ga0068851_10044626 3300005834 Bacteria 2238
89 Ga0068863_100003945 3300005841 Bacteria 14662
90 Ga0068863_100023726 3300005841 Bacteria 5853
91 Ga0068858_100005598 3300005842 Bacteria 12287
92 Ga0068858_100046336 3300005842 Bacteria 4031
93 Ga0068858_100062741 3300005842 Bacteria 3437
94 Ga0068858_100176383 3300005842 Bacteria 2017
95 Ga0068860_100019495 3300005843 Bacteria 6576
96 Ga0068860_100125179 3300005843 Bacteria 2463
97 Ga0068860_100125205 3300005843 Bacteria 2463
98 Ga0068862_100006418 3300005844 Bacteria 9780
99 Ga0068862_100019587 3300005844 Bacteria 5650
100 Ga0081455_10006576 3300005937 Bacteria 12434
101 Ga0081455_10028351 3300005937 Bacteria 5116
102 Ga0081538_10001053 3300005981 Bacteria 29391
103 Ga0081538_10007573 3300005981 Bacteria 9368
104 Ga0081538_10028282 3300005981 Bacteria 3860
105 Ga0081538_10048950 3300005981 Bacteria 2570
106 Ga0081538_10050535 3300005981 Bacteria 2509
107 Ga0081540_1000497 3300005983 Bacteria 38627
108 Ga0081540_1001419 3300005983 Bacteria 20728
109 Ga0081540_1023832 3300005983 Bacteria 3567
110 Ga0081540_1054752 3300005983 Bacteria 1947
111 Ga0081539_10004219 3300005985 Bacteria 16194
112 Ga0081539_10004838 3300005985 Bacteria 14427
113 Ga0081539_10005582 3300005985 Bacteria 12712
114 Ga0081539_10008727 3300005985 Bacteria 8711
115 Ga0081539_10016782 3300005985 Bacteria 5197
116 Ga0070717_10001937 3300006028 Bacteria 14441
117 Ga0070717_10005007 3300006028 Bacteria 9642
118 Ga0070717_10026431 3300006028 Bacteria 4629
119 Ga0075365_10000949 3300006038 Bacteria 12296
120 Ga0075365_10022144 3300006038 Bacteria 3977
121 Ga0075432_10011415 3300006058 Bacteria 3017
122 Ga0075432_10016161 3300006058 Bacteria 2548
123 Ga0070716_100001381 3300006173 Bacteria 10777
124 Ga0070712_100001909 3300006175 Bacteria 12744
125 Ga0070712_100001990 3300006175 Bacteria 12512
126 Ga0070712_100042084 3300006175 Bacteria 3140
127 Ga0075367_10008041 3300006178 Bacteria 5439
128 Ga0075369_10005130 3300006186 Bacteria 4879
129 Ga0075370_10044479 3300006353 Bacteria 2510
130 Ga0068871_100017985 3300006358 Bacteria 5362
131 Ga0068871_100021915 3300006358 Bacteria 4920
132 Ga0075428_100018814 3300006844 Bacteria 7637
133 Ga0075428_100051074 3300006844 Bacteria 4533
134 Ga0075428_100063647 3300006844 Bacteria 4039
135 Ga0075428_100073189 3300006844 Bacteria 3742
136 Ga0075428_100099806 3300006844 Bacteria 3165
137 Ga0075428_100247981 3300006844 Bacteria 1920
138 Ga0075430_100013964 3300006846 Bacteria 6845
139 Ga0075431_100131223 3300006847 Bacteria 2584
140 Ga0075433_10007584 3300006852 Bacteria 8611
141 Ga0075433_10066589 3300006852 Bacteria 3161
142 Ga0075434_100015242 3300006871 Bacteria 7366
143 Ga0075429_100012045 3300006880 Bacteria 7495
144 Ga0068865_100000375 3300006881 Bacteria 24788
145 Ga0075436_100004003 3300006914 Bacteria 10108
146 Ga0097620_100016083 3300006931 Bacteria 7516
147 Ga0097620_100083646 3300006931 Bacteria 3235
148 Ga0105240_10015116 3300009093 Bacteria 10506
149 Ga0111539_10007294 3300009094 Bacteria 14156
150 Ga0111539_10011179 3300009094 Bacteria 11283
151 Ga0111539_10024604 3300009094 Bacteria 7386
152 Ga0111539_10035023 3300009094 Bacteria 6080
153 Ga0111539_10125427 3300009094 Bacteria 3008
154 Ga0105245_10001215 3300009098 Bacteria 23288
155 Ga0105245_10003604 3300009098 Bacteria 13814
156 Ga0105245_10014855 3300009098 Bacteria 6782
157 Ga0105245_10036528 3300009098 Bacteria 4365
158 Ga0105245_10065975 3300009098 Bacteria 3275
159 Ga0114129_10001397 3300009147 Bacteria 32537
160 Ga0114129_10004699 3300009147 Bacteria 19283
161 Ga0114129_10006183 3300009147 Bacteria 16987
162 Ga0114129_10008528 3300009147 Bacteria 14609
163 Ga0114129_10012644 3300009147 Bacteria 12019
164 Ga0114129_10066310 3300009147 Bacteria 5036
165 Ga0114129_10068328 3300009147 Bacteria 4955
166 Ga0105243_10001235 3300009148 Bacteria 23033
167 Ga0105243_10007668 3300009148 Bacteria 8292
168 Ga0105243_10036568 3300009148 Bacteria 3812
169 Ga0105243_10077905 3300009148 Bacteria 2697
170 Ga0105241_10019585 3300009174 Bacteria 4991
171 Ga0105242_10001832 3300009176 Bacteria 16690
172 Ga0105248_10068535 3300009177 Bacteria 3983
173 Ga0105248_10191886 3300009177 Bacteria 2302
174 Ga0105237_10017504 3300009545 Bacteria 7427
175 Ga0105238_10136809 3300009551 Bacteria 2427
176 Ga0105249_10002953 3300009553 Bacteria 14671
177 Ga0105249_10041023 3300009553 Bacteria 4206
178 Ga0105249_10100879 3300009553 Bacteria 2714
179 Ga0105249_10103066 3300009553 Bacteria 2687
180 Ga0105239_10009715 3300010375 Bacteria 10816
181 Ga0105239_10035997 3300010375 Bacteria 5434
182 Ga0105246_10010694 3300011119 Bacteria 5684
183 Ga0157370_10053348 3300013104 Bacteria 3855
184 Ga0157374_10014687 3300013296 Bacteria 6855
185 Ga0157374_10127575 3300013296 Bacteria 2460
186 Ga0157374_10179230 3300013296 Bacteria 2069
187 Ga0157378_10001840 3300013297 Bacteria 19047
188 Ga0157378_10008800 3300013297 Bacteria 8787
189 Ga0163162_10000494 3300013306 Bacteria 36629
190 Ga0157372_10075798 3300013307 Bacteria 3796
191 Ga0157372_10104916 3300013307 Bacteria 3232
192 Ga0157375_10008831 3300013308 Bacteria 8826
193 Ga0157375_10029612 3300013308 Bacteria 5152
194 Ga0157375_10142663 3300013308 Bacteria 2523
195 Ga0157375_10175379 3300013308 Bacteria 2293
196 Ga0163163_10007568 3300014325 Bacteria 9592
197 Ga0163163_10021438 3300014325 Bacteria 6098
198 Ga0163163_10065692 3300014325 Bacteria 3602
199 Ga0163163_10074270 3300014325 Bacteria 3392
200 Ga0163163_10146027 3300014325 Bacteria 2409
201 Ga0157377_10002124 3300014745 Bacteria 8717
202 Ga0157377_10010091 3300014745 Bacteria 4661
203 Ga0157379_10006431 3300014968 Bacteria 10122
204 Ga0157379_10008017 3300014968 Bacteria 9165
205 Ga0157379_10014462 3300014968 Bacteria 6926
206 Ga0157379_10018624 3300014968 Bacteria 6123
207 Ga0157379_10111505 3300014968 Bacteria 2457
208 Ga0183367_1003 3300015688 Bacteria 814276
209 Ga0163161_10035175 3300017792 Bacteria 3585
210 Ga0213876_10002282 3300021384 Bacteria 11313
211 Ga0213876_10058644 3300021384 Bacteria 2032
212 Ga0213875_10011690 3300021388 Bacteria 4359
213 Ga0207692_10000452 3300025898 Bacteria 14540
214 Ga0207692_10002895 3300025898 Bacteria 6647
215 Ga0207642_10017626 3300025899 Bacteria 2721
216 Ga0207642_10018821 3300025899 Bacteria 2660
217 Ga0207688_10013588 3300025901 Bacteria 4426
218 Ga0207688_10014132 3300025901 Bacteria 4343
219 Ga0207685_10005361 3300025905 Bacteria 3378
220 Ga0207699_10000483 3300025906 Bacteria 20176
221 Ga0207645_10003459 3300025907 Bacteria 11981
222 Ga0207645_10029832 3300025907 Bacteria 3515
223 Ga0207643_10003535 3300025908 Bacteria 8410
224 Ga0207643_10052124 3300025908 Bacteria 2323
225 Ga0207684_10000514 3300025910 Bacteria 48078
226 Ga0207684_10016825 3300025910 Bacteria 6278
227 Ga0207654_10025416 3300025911 Bacteria 3195
228 Ga0207707_10001291 3300025912 Bacteria 23352
229 Ga0207671_10093013 3300025914 Bacteria 2274
230 Ga0207693_10001043 3300025915 Bacteria 24769
231 Ga0207693_10001547 3300025915 Bacteria 20327
232 Ga0207693_10010139 3300025915 Bacteria 7654
233 Ga0207693_10119372 3300025915 Bacteria 2071
234 Ga0207662_10020897 3300025918 Bacteria 3737
235 Ga0207662_10032228 3300025918 Bacteria 3049
236 Ga0207657_10015512 3300025919 Bacteria 7379
237 Ga0207657_10097186 3300025919 Bacteria 2449
238 Ga0207646_10000129 3300025922 Bacteria 102411
239 Ga0207646_10004171 3300025922 Bacteria 15853
240 Ga0207646_10005395 3300025922 Bacteria 13449
241 Ga0207646_10017861 3300025922 Bacteria 6625
242 Ga0207681_10047349 3300025923 Bacteria 2896
243 Ga0207681_10062876 3300025923 Bacteria 2558
244 Ga0207659_10109988 3300025926 Bacteria 2093
245 Ga0207687_10076834 3300025927 Bacteria 2400
246 Ga0207700_10000175 3300025928 Bacteria 38523
247 Ga0207700_10009976 3300025928 Bacteria 5966
248 Ga0207700_10010122 3300025928 Bacteria 5930
249 Ga0207700_10116515 3300025928 Bacteria 2159
250 Ga0207664_10000254 3300025929 Bacteria 40157
251 Ga0207664_10001718 3300025929 Bacteria 14423
252 Ga0207664_10002051 3300025929 Bacteria 13269
253 Ga0207664_10012653 3300025929 Bacteria 6036
254 Ga0207664_10036714 3300025929 Bacteria 3787
255 Ga0207664_10048060 3300025929 Bacteria 3354
256 Ga0207644_10002738 3300025931 Bacteria 11352
257 Ga0207644_10007437 3300025931 Bacteria 7141
258 Ga0207706_10007704 3300025933 Bacteria 9942
259 Ga0207706_10008035 3300025933 Bacteria 9737
260 Ga0207706_10008590 3300025933 Bacteria 9410
261 Ga0207706_10014602 3300025933 Bacteria 7113
262 Ga0207709_10024884 3300025935 Bacteria 3424
263 Ga0207669_10001964 3300025937 Bacteria 8718
264 Ga0207669_10013429 3300025937 Bacteria 4067
265 Ga0207669_10013760 3300025937 Bacteria 4033
266 Ga0207669_10040474 3300025937 Bacteria 2704
267 Ga0207704_10001568 3300025938 Bacteria 10248
268 Ga0207704_10016428 3300025938 Bacteria 3804
269 Ga0207665_10001164 3300025939 Bacteria 17674
270 Ga0207665_10018547 3300025939 Bacteria 4570
271 Ga0207691_10013938 3300025940 Bacteria 7670
272 Ga0207691_10098945 3300025940 Bacteria 2605
273 Ga0207689_10012298 3300025942 Bacteria 7324
274 Ga0207689_10077000 3300025942 Bacteria 2742
275 Ga0207661_10031948 3300025944 Bacteria 4073
276 Ga0207679_10037788 3300025945 Bacteria 3435
277 Ga0207651_10033192 3300025960 Bacteria 3326
278 Ga0207712_10020248 3300025961 Bacteria 4355
279 Ga0207712_10089524 3300025961 Bacteria 2263
280 Ga0207668_10018510 3300025972 Unclassified 4386
281 Ga0207640_10005102 3300025981 Bacteria 7139
282 Ga0207640_10095710 3300025981 Bacteria 2068
283 Ga0207658_10058603 3300025986 Bacteria 2866
284 Ga0207677_10009676 3300026023 Bacteria 5429
285 Ga0207677_10065235 3300026023 Bacteria 2540
286 Ga0207703_10096103 3300026035 Bacteria 2501
287 Ga0207678_10000785 3300026067 Bacteria 29030
288 Ga0207708_10003064 3300026075 Bacteria 12311
289 Ga0207708_10006612 3300026075 Bacteria 8580
290 Ga0207708_10010618 3300026075 Bacteria 6838
291 Ga0207708_10014167 3300026075 Bacteria 5961
292 Ga0207708_10020237 3300026075 Bacteria 5018
293 Ga0207708_10020421 3300026075 Bacteria 4997
294 Ga0207708_10023068 3300026075 Bacteria 4701
295 Ga0207708_10123887 3300026075 Bacteria 2016
296 Ga0207702_10041502 3300026078 Bacteria 3859
297 Ga0207641_10000855 3300026088 Bacteria 32290
298 Ga0207641_10003504 3300026088 Bacteria 13892
299 Ga0207648_10001438 3300026089 Bacteria 26210
300 Ga0207648_10005064 3300026089 Bacteria 13362
301 Ga0207676_10076934 3300026095 Bacteria 2698
302 Ga0207676_10179998 3300026095 Bacteria 1850
303 Ga0207674_10029446 3300026116 Bacteria 5780
304 Ga0207675_100010338 3300026118 Bacteria 8746
305 Ga0207675_100026000 3300026118 Bacteria 5448
306 Ga0207675_100026454 3300026118 Bacteria 5401
307 Ga0207675_100033823 3300026118 Bacteria 4763
308 Ga0207675_100055493 3300026118 Bacteria 3696
309 Ga0207683_10000829 3300026121 Bacteria 28292
310 Ga0207683_10098091 3300026121 Bacteria 2614
311 Ga0207683_10119508 3300026121 Bacteria 2365
312 Ga0207683_10157822 3300026121 Bacteria 2049
313 Ga0207698_10008461 3300026142 Bacteria 6511
314 Ga0209971_1003082 3300027682 Bacteria 3979
315 Ga0207428_10000479 3300027907 Bacteria 48258
316 Ga0207428_10002318 3300027907 Bacteria 19059
317 Ga0207428_10063239 3300027907 Bacteria 2924
318 Ga0268266_10009794 3300028379 Bacteria 8430
319 Ga0268266_10011782 3300028379 Bacteria 7582
320 Ga0268266_10034951 3300028379 Bacteria 4275
321 Ga0268265_10003009 3300028380 Bacteria 12311
322 Ga0268265_10023176 3300028380 Bacteria 4373
323 Ga0268264_10008529 3300028381 Bacteria 8519
324 Ga0268264_10020902 3300028381 Bacteria 5347
325 Ga0268264_10060150 3300028381 Bacteria 3184
326 Ga0268264_10183701 3300028381 Bacteria 1901
327 Ga0265337_1000333 3300028556 Bacteria 25123
328 Ga0265319_1009164 3300028563 Bacteria 4244
329 Ga0265319_1020020 3300028563 Bacteria 2488
330 Ga0265334_10001755 3300028573 Bacteria 10365
331 Ga0265334_10002151 3300028573 Bacteria 9278
332 Ga0265334_10019876 3300028573 Bacteria 2756
333 Ga0265318_10000251 3300028577 Bacteria 46650
334 Ga0265323_10003405 3300028653 Bacteria 7030
335 Ga0265336_10002602 3300028666 Bacteria 7363
336 Ga0307515_10014050 3300028794 Bacteria 14895
337 Ga0265338_10000457 3300028800 Bacteria 72848
338 Ga0265338_10000956 3300028800 Bacteria 48667
339 Ga0265338_10033814 3300028800 Bacteria 4954
340 Ga0265338_10071040 3300028800 Bacteria 2981
341 Ga0265324_10004705 3300029957 Bacteria 6058
342 Ga0265324_10008566 3300029957 Bacteria 4058
343 Ga0307511_10001274 3300030521 Bacteria 26705
344 Ga0307511_10015850 3300030521 Bacteria 7285
345 Ga0265330_10000873 3300031235 Bacteria 18828
346 Ga0265320_10006834 3300031240 Bacteria 7148
347 Ga0265320_10013270 3300031240 Bacteria 4745
348 Ga0265325_10006532 3300031241 Bacteria 7073
349 Ga0265325_10018232 3300031241 Bacteria 3892
350 Ga0265325_10018618 3300031241 Bacteria 3851
351 Ga0265329_10004447 3300031242 Bacteria 5824
352 Ga0265340_10000078 3300031247 Bacteria 46872
353 Ga0265340_10000733 3300031247 Bacteria 18632
354 Ga0265340_10031769 3300031247 Bacteria 2639
355 Ga0265339_10001224 3300031249 Bacteria 19295
356 Ga0265316_10006833 3300031344 Bacteria 10841
357 Ga0265316_10064553 3300031344 Bacteria 2836
358 Ga0307513_10103500 3300031456 Bacteria 2863
359 Ga0307509_10050248 3300031507 Bacteria 4465
360 Ga0307509_10103837 3300031507 Bacteria 2869
361 Ga0265313_10008095 3300031595 Bacteria 7037
362 Ga0265313_10033973 3300031595 Bacteria 2585
363 Ga0307508_10008110 3300031616 Bacteria 9738
364 Ga0316579_10000086 3300031691 Bacteria 23939
365 Ga0265314_10006206 3300031711 Bacteria 10615
366 Ga0265314_10027558 3300031711 Bacteria 4253
367 Ga0265342_10004595 3300031712 Bacteria 10772
368 Ga0307516_10033431 3300031730 Bacteria 5174
369 Ga0307518_10016097 3300031838 Bacteria 5356
370 Ga0307406_10010429 3300031901 Bacteria 5239
371 Ga0307406_10075309 3300031901 Bacteria 2226
372 Ga0307409_100033750 3300031995 Bacteria 3728
373 Ga0307409_100066755 3300031995 Bacteria 2838
374 Ga0307416_100033472 3300032002 Bacteria 3896
375 Ga0307416_100068330 3300032002 Bacteria 2936
376 Ga0307416_100131868 3300032002 Bacteria 2251
377 Ga0307414_10050944 3300032004 Bacteria 2871
378 Ga0307415_100033745 3300032126 Bacteria 3324
379 Ga0307415_100060467 3300032126 Bacteria 2618
380 Ga0307507_10012829 3300033179 Bacteria 10281
381 Ga0307507_10029090 3300033179 Bacteria 5868
382 Ga0307510_10049577 3300033180 Bacteria 4464
383 Ga0307510_10060675 3300033180 Bacteria 3888
384 Ga0373926_0004470 3300035083 Bacteria 4586
385 Ga0373926_0021691 3300035083 Bacteria 2224
386 Ga0373944_0007068 3300035089 Bacteria 2999
387 Ga0373932_0016335 3300035112 Bacteria 1894
388 Ga0373945_0001574 3300035116 Bacteria 6987
389 Ga0373953_0030098 3300035117 Bacteria 2103
390 Ga0373956_0039452 3300035119 Bacteria 2093
391 Ga0373943_0029801 3300035170 Bacteria 2579
392 Ga0373946_0004588 3300035171 Bacteria 4950
393 Ga0373955_0030234 3300035172 Bacteria 2825
394 Ga0373924_0018278 3300035410 Bacteria 2698
395 Ga0373927_0004175 3300035695 Bacteria 10152
396 Ga0373933_0011345 3300035724 Bacteria 4908
397 Ga0373947_0033495 3300035725 Bacteria 3033
398 Ga0373947_0040116 3300035725 Bacteria 2788
399 Ga0373937_0000758 3300036401 Bacteria 27855
400 Ga0316584_0001021 3300036712 Bacteria 16185
401 Ga0395899_0008636 3300037312 Bacteria 7838
402 Ga0395899_0088272 3300037312 Bacteria 2250
403 Ga0395900_0002757 3300037418 Bacteria 19197
404 Ga0395900_0032163 3300037418 Bacteria 5394
405 Ga0395898_0027247 3300037466 Bacteria 5739
406 Ga0395905_0003288 3300037471 Bacteria 17363
407 Ga0436364_0433954 3300037853 Bacteria 9412
408 Ga0436364_0667900 3300037853 Bacteria 105608
409 Ga0436364_1303368 3300037853 Bacteria 3783
410 Ga0395901_0001240 3300038443 Bacteria 27243
411 Ga0395901_0081927 3300038443 Bacteria 3371
412 Ga0400485_04221 3300038735 Bacteria 54088
413 Ga0400488_22792 3300038741 Bacteria 6610
414 Ga0400486_21479 3300038742 Bacteria 1828
415 Ga0400486_29215 3300038742 Bacteria 140932
416 Ga0400483_126970 3300039062 Bacteria 6998
417 Ga0400483_164544 3300039062 Bacteria 12959
418 Ga0436365_0269776 3300039437 Bacteria 3610
419 Ga0436365_0542570 3300039437 Bacteria 2423
420 Ga0436365_0658475 3300039437 Bacteria 2033
421 Ga0436365_1210809 3300039437 Bacteria 15025
422 Ga0439466_0015543 3300041411 Bacteria 2764
423 Ga0451853_3098222 3300041512 Bacteria 2406
424 Ga0439442_001772 3300042002 Bacteria 4225
425 Ga0439458_0008770 3300042157 Bacteria 2256
426 Ga0466969_0000608 3300044656 Bacteria 19404
427 Ga0466972_0005806 3300044658 Bacteria 6186
428 Ga0466972_0007692 3300044658 Bacteria 5410
429 Ga0466965_0002461 3300044683 Bacteria 7873
430 Ga0466966_0056568 3300044684 Bacteria 2481
431 Ga0466961_0065115 3300044693 Bacteria 2316
432 Ga0466961_0123528 3300044693 Bacteria 1624
433 Ga0466963_0000392 3300044694 Bacteria 19966
434 Ga0466963_0002439 3300044694 Bacteria 10401
435 Ga0466963_0023881 3300044694 Bacteria 3888
436 Ga0466964_0007175 3300044706 Bacteria 4167
437 Ga0453684_0122256 3300044712 Bacteria 3141
438 Ga0466968_0001536 3300044735 Bacteria 8296
439 Ga0466968_0020084 3300044735 Bacteria 2693
440 Ga0466970_0039847 3300044765 Bacteria 2494
441 Ga0466970_0052942 3300044765 Bacteria 2167
442 Ga0466957_0000936 3300044842 Bacteria 14934
443 Ga0466957_0017303 3300044842 Bacteria 4220
444 Ga0466960_0002342 3300044901 Bacteria 7120
445 Ga0466960_0009385 3300044901 Bacteria 4031
446 Ga0466960_0016566 3300044901 Bacteria 3200
447 Ga0466959_0011612 3300045049 Bacteria 6331
448 Ga0466959_0018712 3300045049 Bacteria 5087
449 Ga0466959_0137576 3300045049 Bacteria 1728
450 Ga0466958_0005643 3300045836 Bacteria 6754
451 Ga0466958_0018228 3300045836 Bacteria 4071
452 Ga0466958_0036699 3300045836 Bacteria 2935
453 Ga0466967_0008724 3300045976 Bacteria 7464
454 Ga0466967_0033419 3300045976 Bacteria 4354
455 Ga0466967_0035213 3300045976 Bacteria 4258
456 Ga0466967_0037277 3300045976 Bacteria 4159
457 Ga0466967_0054572 3300045976 Bacteria 3517
458 Ga0466967_0138476 3300045976 Bacteria 2265
459 Ga0495592_0030629 3300046454 Bacteria 4069
460 Ga0495603_0012348 3300046455 Bacteria 5170
461 Ga0495603_0026749 3300046455 Bacteria 3484
462 Ga0495603_0056579 3300046455 Bacteria 2321
463 Ga0495629_0006511 3300046459 Bacteria 8654
464 Ga0495629_0014218 3300046459 Bacteria 5731
465 Ga0495629_0039341 3300046459 Bacteria 3328
466 Ga0495629_0054628 3300046459 Bacteria 2793
467 Ga0495641_0002361 3300046461 Bacteria 14980
468 Ga0495651_0000950 3300046462 Bacteria 22399
469 Ga0495651_0007217 3300046462 Bacteria 8494
470 Ga0495651_0096619 3300046462 Bacteria 2207
471 Ga0495653_0019344 3300046463 Bacteria 5523
472 Ga0495653_0045102 3300046463 Bacteria 3419
473 Ga0495653_0046817 3300046463 Bacteria 3347
474 Ga0495653_0067812 3300046463 Bacteria 2677
475 Ga0495653_0083576 3300046463 Bacteria 2353
476 Ga0495580_0029450 3300046472 Bacteria 3985
477 Ga0495582_0008058 3300046473 Bacteria 5813
478 Ga0495582_0023960 3300046473 Bacteria 3337
479 Ga0495582_0028686 3300046473 Bacteria 3054
480 Ga0495639_0000733 3300046475 Bacteria 15007
481 Ga0495662_0000347 3300046476 Bacteria 20264
482 Ga0495662_0013965 3300046476 Bacteria 3909
483 Ga0495664_0000303 3300046477 Bacteria 23601
484 Ga0495664_0001037 3300046477 Bacteria 14354
485 Ga0495664_0064639 3300046477 Bacteria 2181
486 Ga0495585_0039114 3300046492 Bacteria 2667
487 Ga0495594_0027407 3300046499 Bacteria 3070
488 Ga0495594_0028449 3300046499 Bacteria 3016
489 Ga0495596_0027897 3300046500 Bacteria 2268
490 Ga0495608_0003824 3300046511 Bacteria 10820
491 Ga0495608_0019225 3300046511 Bacteria 4703
492 Ga0495618_0007289 3300046514 Bacteria 6693
493 Ga0495630_0013431 3300046517 Bacteria 5958
494 Ga0495630_0030223 3300046517 Bacteria 4029
495 Ga0495630_0034901 3300046517 Bacteria 3757
496 Ga0495630_0098504 3300046517 Bacteria 2211
497 Ga0495630_0127132 3300046517 Bacteria 1935
498 Ga0495666_0021425 3300046526 Bacteria 3198
499 Ga0495652_0022175 3300046529 Bacteria 5638
500 Ga0495652_0076320 3300046529 Bacteria 2780
501 Ga0495665_0002021 3300046531 Bacteria 10966
502 Ga0495640_0013894 3300046533 Bacteria 6111
503 Ga0495586_0019919 3300046535 Bacteria 3573
504 Ga0495586_0042115 3300046535 Bacteria 2459
505 Ga0495587_0000345 3300046536 Bacteria 33064
506 Ga0495587_0025860 3300046536 Bacteria 3583
507 Ga0495645_0015832 3300046543 Bacteria 5369
508 Ga0495645_0072139 3300046543 Bacteria 2488
509 Ga0495667_0015707 3300046559 Bacteria 5118
510 Ga0495667_0017683 3300046559 Bacteria 4816
511 Ga0495667_0022575 3300046559 Bacteria 4239
512 Ga0495667_0038867 3300046559 Bacteria 3168
513 Ga0495634_0022495 3300046642 Bacteria 4441
514 Ga0495634_0039088 3300046642 Bacteria 3233
515 Ga0495634_0064380 3300046642 Bacteria 2431
516 Ga0495634_0092707 3300046642 Bacteria 1959
517 Ga0495625_0004664 3300046660 Bacteria 12869
518 Ga0495635_0001067 3300046663 Bacteria 18162
519 Ga0495635_0008048 3300046663 Bacteria 7366
520 Ga0495635_0009805 3300046663 Bacteria 6695
521 Ga0495635_0013373 3300046663 Bacteria 5744
522 Ga0495635_0036741 3300046663 Bacteria 3393
523 Ga0495635_0069328 3300046663 Bacteria 2418
524 Ga0495661_0035179 3300046665 Bacteria 3146
525 Ga0495588_0008979 3300046674 Bacteria 4603
526 Ga0495588_0037805 3300046674 Bacteria 2453
527 Ga0495657_0001313 3300046675 Bacteria 21641
528 Ga0495657_0004405 3300046675 Bacteria 11240
529 Ga0495657_0006378 3300046675 Bacteria 9232
530 Ga0495657_0041563 3300046675 Bacteria 3145
531 Ga0495599_0000694 3300046678 Bacteria 19041
532 Ga0495599_0015132 3300046678 Bacteria 4783
533 Ga0495646_0025660 3300046680 Bacteria 3705
534 Ga0495646_0048465 3300046680 Bacteria 2580
535 Ga0495646_0074831 3300046680 Bacteria 1986
536 Ga0495647_0018457 3300046681 Bacteria 2484
537 Ga0495658_0002328 3300046683 Bacteria 9588
538 Ga0495658_0035130 3300046683 Bacteria 2756
539 Ga0495658_0047831 3300046683 Bacteria 2410
540 Ga0495613_0001143 3300046689 Bacteria 20228
541 Ga0495613_0070184 3300046689 Bacteria 2554
542 Ga0495613_0096637 3300046689 Bacteria 2136
543 Ga0495613_0179107 3300046689 Bacteria 1501
544 Ga0495624_0005587 3300046690 Bacteria 9042
545 Ga0495624_0104552 3300046690 Bacteria 1742
546 Ga0495589_0072396 3300046794 Bacteria 1683
547 Ga0495600_0007929 3300046809 Bacteria 6508
548 Ga0495600_0012911 3300046809 Bacteria 5234
549 Ga0495600_0074867 3300046809 Bacteria 2211
550 Ga0495600_0089928 3300046809 Bacteria 2002
551 Ga0495581_0003375 3300047315 Bacteria 9173
552 Ga0495581_0015264 3300047315 Bacteria 4459
553 Ga0495604_0001245 3300047317 Bacteria 20863
554 Ga0495604_0003847 3300047317 Bacteria 11959
555 Ga0495604_0011912 3300047317 Bacteria 6916
556 Ga0495604_0104871 3300047317 Bacteria 2070
557 Ga0495604_0124074 3300047317 Bacteria 1865
558 Ga0495674_0006495 3300047319 Bacteria 11215
559 Ga0495674_0044931 3300047319 Bacteria 3925
560 Ga0495674_0074318 3300047319 Bacteria 2928
561 Ga0495674_0101419 3300047319 Bacteria 2448
562 Ga0495674_0115650 3300047319 Bacteria 2270
563 Ga0495676_0022869 3300047321 Bacteria 5432
564 Ga0495680_0015800 3300047322 Bacteria 6498
565 Ga0495680_0021408 3300047322 Bacteria 5413
566 Ga0495680_0054812 3300047322 Bacteria 3094
567 Ga0495687_004554 3300047443 Bacteria 9299
568 Ga0495681_0011848 3300047470 Bacteria 5159
569 Ga0495684_0014181 3300047471 Bacteria 6131
570 Ga0495684_0017936 3300047471 Bacteria 5452
571 Ga0495686_0128754 3300047472 Bacteria 1502
572 Ga0495593_0003591 3300047673 Bacteria 9268
573 Ga0495593_0010305 3300047673 Bacteria 5403
574 Ga0495593_0014442 3300047673 Bacteria 4489
575 Ga0495593_0049227 3300047673 Bacteria 2237
576 Ga0495602_0021341 3300048088 Bacteria 6378
577 Ga0495602_0049002 3300048088 Bacteria 3788
578 Ga0496100_0000191 3300048903 Bacteria 34073
579 Ga0496100_0035465 3300048903 Bacteria 3137
580 Ga0496101_0001168 3300048904 Bacteria 15708
581 Ga0496101_0005663 3300048904 Bacteria 7970
582 Ga0496101_0050691 3300048904 Bacteria 2989
583 Ga0496101_0122493 3300048904 Bacteria 1967
584 Ga0496102_0000046 3300048905 Bacteria 184899
585 Ga0496102_0005921 3300048905 Bacteria 10411
586 Ga0496102_0022609 3300048905 Bacteria 5572
587 Ga0496102_0029801 3300048905 Bacteria 4883
588 Ga0496102_0044821 3300048905 Bacteria 4014
589 Ga0496102_0090280 3300048905 Bacteria 2835
590 Ga0496102_0201370 3300048905 Bacteria 1877
591 Ga0496103_0000011 3300048906 Bacteria 304506
592 Ga0496103_0013712 3300048906 Bacteria 4809
593 Ga0496104_0007997 3300048907 Bacteria 9375
594 Ga0496104_0008921 3300048907 Bacteria 8911
595 Ga0496104_0015678 3300048907 Bacteria 6872
596 Ga0496104_0017596 3300048907 Bacteria 6512
597 Ga0496104_0018432 3300048907 Bacteria 6367
598 Ga0496104_0026568 3300048907 Bacteria 5349
599 Ga0496104_0040751 3300048907 Bacteria 4354
600 Ga0496104_0092219 3300048907 Bacteria 2896
601 Ga0496105_0003832 3300048908 Bacteria 11220
602 Ga0496105_0046616 3300048908 Bacteria 3578
603 Ga0496105_0085986 3300048908 Bacteria 2599
604 Ga0496106_0004991 3300048909 Bacteria 9820
605 Ga0496106_0050790 3300048909 Bacteria 3126
606 Ga0496106_0118121 3300048909 Bacteria 2070
607 Ga0496107_0009722 3300048910 Bacteria 6669
608 Ga0496107_0049444 3300048910 Bacteria 3030
609 Ga0496108_0005691 3300048911 Bacteria 10088
610 Ga0496108_0009029 3300048911 Bacteria 8077
611 Ga0496108_0015621 3300048911 Bacteria 6193
612 Ga0496108_0018664 3300048911 Bacteria 5683
613 Ga0496108_0019797 3300048911 Bacteria 5529
614 Ga0496108_0121974 3300048911 Bacteria 2236
615 Ga0496108_0197530 3300048911 Bacteria 1745
616 Ga0496108_0211082 3300048911 Bacteria 1685
617 Ga0496109_0008259 3300048912 Bacteria 8841
618 Ga0496109_0010930 3300048912 Bacteria 7777
619 Ga0496109_0030042 3300048912 Bacteria 4870
620 Ga0496109_0036432 3300048912 Bacteria 4440
621 Ga0496109_0085764 3300048912 Bacteria 2907
622 Ga0496109_0094620 3300048912 Bacteria 2765
623 Ga0496110_0004537 3300048913 Bacteria 10778
624 Ga0496110_0016480 3300048913 Bacteria 6172
625 Ga0496110_0023113 3300048913 Bacteria 5287
626 Ga0496110_0065705 3300048913 Bacteria 3208
627 Ga0496110_0073023 3300048913 Bacteria 3045
628 Ga0496110_0244438 3300048913 Bacteria 1633
629 Ga0496111_0007741 3300048914 Bacteria 7068
630 Ga0496111_0086388 3300048914 Bacteria 2295
631 Ga0496112_0000001 3300048915 Bacteria 1346031
632 Ga0496112_0011769 3300048915 Bacteria 8011
633 Ga0496112_0099267 3300048915 Bacteria 2881
634 Ga0496113_0028175 3300048916 Bacteria 4037
635 Ga0496113_0046370 3300048916 Bacteria 3226
636 Ga0496113_0053244 3300048916 Bacteria 3026
637 Ga0496114_0002035 3300048917 Bacteria 15389
638 Ga0496114_0033573 3300048917 Bacteria 4229
639 Ga0496114_0060739 3300048917 Bacteria 3159
640 Ga0496115_0003896 3300048918 Bacteria 10751
641 Ga0496115_0008417 3300048918 Bacteria 7632
642 Ga0496116_0000328 3300048919 Bacteria 76892
643 Ga0496117_0000109 3300048920 Bacteria 184635
644 Ga0496118_0000132 3300048921 Bacteria 131401
645 Ga0496119_0001399 3300048922 Bacteria 29247
646 Ga0496121_0007631 3300048924 Bacteria 13001
647 Ga0496124_0032677 3300048927 Bacteria 4589
648 Ga0496126_0000345 3300048929 Bacteria 97255
649 Ga0501031_0015248 3300049568 Bacteria 4990
650 Ga0501032_0012338 3300049569 Bacteria 6109
651 Ga0501032_0019527 3300049569 Bacteria 4740
652 Ga0501032_0026363 3300049569 Bacteria 3998
653 Ga0501032_0083472 3300049569 Bacteria 2125
654 Ga0501033_0019272 3300049570 Bacteria 5156
655 Ga0501033_0019493 3300049570 Bacteria 5128
656 Ga0501034_0074058 3300049571 Bacteria 3414
657 Ga0501034_0167845 3300049571 Bacteria 2163
658 Ga0501034_0233664 3300049571 Bacteria 1787
659 Ga0501036_0030166 3300049572 Bacteria 4581
660 Ga0501036_0050785 3300049572 Bacteria 3512
661 Ga0501036_0123814 3300049572 Bacteria 2183
662 Ga0501036_0150937 3300049572 Bacteria 1960
663 Ga0501038_0017754 3300049574 Bacteria 6431
664 Ga0501038_0072031 3300049574 Bacteria 2929
665 Ga0501038_0133099 3300049574 Bacteria 2039
666 Ga0501039_0025403 3300049575 Bacteria 4551
667 Ga0501039_0048018 3300049575 Bacteria 3299
668 Ga0501039_0085814 3300049575 Bacteria 2452
669 Ga0501040_0006932 3300049576 Bacteria 7336
670 Ga0501040_0006995 3300049576 Bacteria 7309
671 Ga0501040_0010049 3300049576 Bacteria 6180
672 Ga0501040_0023090 3300049576 Bacteria 4169
673 Ga0501040_0080299 3300049576 Bacteria 2259
674 Ga0501040_0099548 3300049576 Bacteria 2027
675 Ga0501041_0001057 3300049577 Bacteria 15059
676 Ga0501041_0023558 3300049577 Bacteria 3691
677 Ga0501041_0054318 3300049577 Bacteria 2444
678 Ga0501041_0072344 3300049577 Bacteria 2118
679 Ga0501042_0006956 3300049578 Bacteria 7384
680 Ga0501042_0033706 3300049578 Bacteria 3631
681 Ga0501042_0035034 3300049578 Bacteria 3561
682 Ga0501042_0040422 3300049578 Bacteria 3316
683 Ga0501042_0049128 3300049578 Bacteria 3009
684 Ga0501042_0099081 3300049578 Bacteria 2095
685 Ga0501043_0005321 3300049579 Bacteria 10403
686 Ga0501043_0008879 3300049579 Bacteria 7909
687 Ga0501043_0022479 3300049579 Bacteria 4944
688 Ga0501046_0003729 3300049580 Bacteria 13948
689 Ga0501046_0006046 3300049580 Bacteria 10768
690 Ga0501046_0023391 3300049580 Bacteria 5085
691 Ga0501047_0037176 3300049581 Bacteria 4707
692 Ga0501048_0013979 3300049582 Bacteria 5950
693 Ga0501048_0016916 3300049582 Bacteria 5376
694 Ga0501048_0108819 3300049582 Bacteria 1957
695 Ga0501067_0004408 3300049583 Bacteria 7762
696 Ga0501067_0006119 3300049583 Bacteria 6672
697 Ga0501067_0036155 3300049583 Bacteria 2743
698 Ga0501068_0005364 3300049584 Bacteria 7008
699 Ga0501068_0012307 3300049584 Bacteria 4844
700 Ga0501068_0013175 3300049584 Bacteria 4702
701 Ga0501068_0018379 3300049584 Bacteria 4049
702 Ga0501068_0019749 3300049584 Bacteria 3917
703 Ga0501069_0001443 3300049585 Bacteria 11670
704 Ga0501069_0007943 3300049585 Bacteria 5570
705 Ga0501069_0098137 3300049585 Bacteria 1661
706 Ga0501070_0005012 3300049586 Bacteria 11298
707 Ga0501070_0005087 3300049586 Bacteria 11205
708 Ga0501071_0007051 3300049587 Bacteria 7344
709 Ga0501071_0055272 3300049587 Bacteria 2866
710 Ga0501071_0055437 3300049587 Bacteria 2861
711 Ga0501071_0055776 3300049587 Bacteria 2853
712 Ga0501071_0064774 3300049587 Bacteria 2652
713 Ga0501071_0099626 3300049587 Bacteria 2141
714 Ga0501072_0001813 3300049588 Bacteria 15907
715 Ga0501072_0003167 3300049588 Bacteria 12382
716 Ga0501072_0011366 3300049588 Bacteria 6804
717 Ga0501072_0037586 3300049588 Bacteria 3797
718 Ga0501072_0115812 3300049588 Bacteria 2134
719 Ga0501073_0005971 3300049589 Bacteria 9085
720 Ga0501073_0009990 3300049589 Bacteria 6981
721 Ga0501074_0004289 3300049590 Bacteria 10181
722 Ga0501074_0042826 3300049590 Bacteria 3275
723 Ga0501074_0048048 3300049590 Bacteria 3083
724 Ga0501074_0056828 3300049590 Bacteria 2820
725 Ga0501074_0067950 3300049590 Bacteria 2562
726 Ga0501074_0075051 3300049590 Bacteria 2427
727 Ga0501075_0006451 3300049591 Bacteria 8074
728 Ga0501075_0008537 3300049591 Bacteria 7140
729 Ga0501075_0012788 3300049591 Bacteria 5973
730 Ga0501075_0028112 3300049591 Bacteria 4148
731 Ga0501075_0115973 3300049591 Bacteria 2036
732 Ga0501076_0003449 3300049592 Bacteria 11091
733 Ga0501076_0003785 3300049592 Bacteria 10652
734 Ga0501076_0025140 3300049592 Bacteria 4606
735 Ga0501076_0046607 3300049592 Bacteria 3426
736 Ga0501076_0098255 3300049592 Bacteria 2358
737 Ga0501077_0007458 3300049593 Bacteria 6748
738 Ga0501077_0035599 3300049593 Bacteria 3169
739 Ga0501077_0110492 3300049593 Bacteria 1742
740 Ga0501079_0047322 3300049741 Bacteria 3318
741 Ga0501079_0064175 3300049741 Bacteria 2833
742 Ga0501079_0067731 3300049741 Bacteria 2755
743 Ga0501079_0069935 3300049741 Bacteria 2709
744 Ga0501079_0086456 3300049741 Bacteria 2427
745 Ga0501079_0112909 3300049741 Bacteria 2112
746 Ga0501080_0045989 3300049742 Bacteria 4065
747 Ga0501080_0050432 3300049742 Bacteria 3873
748 Ga0501080_0073319 3300049742 Bacteria 3185
749 Ga0501080_0112681 3300049742 Bacteria 2522
750 Ga0501080_0140453 3300049742 Bacteria 2233
751 Ga0501081_0009027 3300049743 Bacteria 6482
752 Ga0501081_0021138 3300049743 Bacteria 4342
753 Ga0501083_0009973 3300049744 Bacteria 6702
754 Ga0501083_0084544 3300049744 Bacteria 2101
755 Ga0501035_0011103 3300049822 Bacteria 8340
756 Ga0501035_0105190 3300049822 Bacteria 2475
757 Ga0501044_0069444 3300049823 Bacteria 3586
758 Ga0501044_0134802 3300049823 Bacteria 2461
759 Ga0501045_0005816 3300049824 Bacteria 8537
760 Ga0501045_0008101 3300049824 Bacteria 7317
761 Ga0501045_0012189 3300049824 Bacteria 6053
762 Ga0501045_0018554 3300049824 Bacteria 4949
763 nmdc:mga03n38_9379_c1 3300050490 Bacteria 3559
764 nmdc:mga00v17_2906_c1 3300050491 Bacteria 8786
765 nmdc:mga00v17_75049_c1 3300050491 Bacteria 2102
766 nmdc:mga07m45_62683_c1 3300050496 Bacteria 2107
767 nmdc:mga05p37_109354_c1 3300050507 Bacteria 3401
768 nmdc:mga05p37_13837_c1 3300050507 Bacteria 9667
769 nmdc:mga05p37_14857_c1 3300050507 Bacteria 9352
770 nmdc:mga05p37_19768_c1 3300050507 Bacteria 8148
771 nmdc:mga05p37_21425_c1 3300050507 Bacteria 7829
772 nmdc:mga05p37_232554_c1 3300050507 Bacteria 2220
773 nmdc:mga05p37_30168_c1 3300050507 Bacteria 6616
774 nmdc:mga05p37_3241_c1 3300050507 Bacteria 18962
775 nmdc:mga0qj67_21147_c1 3300050509 Bacteria 4990
776 nmdc:mga0qj67_21404_c1 3300050509 Bacteria 4961
777 nmdc:mga06r32_154516_c1 3300050510 Bacteria 2275
778 nmdc:mga08y16_103422_c1 3300050511 Bacteria 2966
779 nmdc:mga08y16_184773_c1 3300050511 Bacteria 2164
780 nmdc:mga08y16_19707_c1 3300050511 Bacteria 7111
781 nmdc:mga08y16_31657_c1 3300050511 Bacteria 5561
782 nmdc:mga08y16_43231_c1 3300050511 Bacteria 4721
783 nmdc:mga08y16_5124_c1 3300050511 Bacteria 13695
784 nmdc:mga0n895_16661_c1 3300050512 Bacteria 6750
785 nmdc:mga0n895_24304_c1 3300050512 Bacteria 5708
786 nmdc:mga0rr50_62396_c1 3300050513 Bacteria 2811
787 nmdc:mga0a205_225981_c1 3300050515 Bacteria 1756
788 nmdc:mga0a205_27287_c1 3300050515 Bacteria 5453
789 nmdc:mga0a205_90017_c1 3300050515 Bacteria 2966
790 nmdc:mga0sz30_888_c1 3300050516 Bacteria 10776
791 Ga0495601_0030555 3300053077 Bacteria 3345
792 Ga0495612_0000045 3300053078 Bacteria 60489
793 Ga0495612_0004734 3300053078 Bacteria 5632
794 Ga0495612_0011410 3300053078 Bacteria 3582
795 Ga0495619_0008129 3300053085 Bacteria 6640
796 Ga0495619_0048434 3300053085 Bacteria 2800
797 Ga0500644_0017802 3300053088 Bacteria 2070
798 Ga0500646_0000089 3300053090 Bacteria 25903
799 Ga0500583_0052625 3300053092 Bacteria 1895
800 Ga0500608_060318 3300053122 Bacteria 1814
801 Ga0500588_0002793 3300053146 Bacteria 3609
802 Ga0500603_008820 3300053150 Bacteria 2248
803 Ga0500616_0000116 3300053153 Bacteria 145790
804 Ga0501084_0005964 3300054114 Bacteria 10029
805 Ga0501084_0022217 3300054114 Bacteria 5294
806 Ga0501084_0059362 3300054114 Bacteria 3202
807 Ga0501084_0072999 3300054114 Bacteria 2873
808 Ga0590074_000702 3300059423 Bacteria 5102
809 Ga0501082_0006285 3300060353 Bacteria 10302
810 Ga0501082_0013204 3300060353 Bacteria 7103
811 Ga0501082_0021996 3300060353 Bacteria 5498
812 Ga0501082_0051802 3300060353 Bacteria 3538
813 Ga0501082_0115399 3300060353 Bacteria 2326
814 Ga0501082_0122215 3300060353 Bacteria 2257
815 Ga0466962_0002813 3300061719 Bacteria 8283
816 Ga0530510_0011003 3300061734 Bacteria 6346
817 Ga0530510_0030015 3300061734 Bacteria 3904
818 Ga0530510_0035018 3300061734 Bacteria 3618
819 Ga0530510_0065041 3300061734 Bacteria 2642

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049580 Ga0501046_0023391 Ga0501046_0023391_3681_5072 420
2 3300035119 Ga0373956_0039452 Ga0373956_0039452_18_1421 423
3 3300046454 Ga0495592_0030629 Ga0495592_0030629_17_1372 423
4 3300046663 Ga0495635_0069328 Ga0495635_0069328_1049_2404 423
5 3300047317 Ga0495604_0124074 Ga0495604_0124074_17_1357 423
6 3300050515 nmdc:mga0a205_225981_c1 nmdc:mga0a205_225981_c1_33_1442 423
7 3300044693 Ga0466961_0123528 Ga0466961_0123528_24_1379 426
8 3300046809 Ga0495600_0074867 Ga0495600_0074867_811_2190 431
9 3300053092 Ga0500583_0052625 Ga0500583_0052625_444_1868 431
10 3300049585 Ga0501069_0098137 Ga0501069_0098137_11_1414 432
11 3300047472 Ga0495686_0128754 Ga0495686_0128754_18_1421 435
12 3300044735 Ga0466968_0020084 Ga0466968_0020084_21_1445 449
13 3300046689 Ga0495613_0179107 Ga0495613_0179107_20_1465 453
14 3300048910 Ga0496107_0049444 Ga0496107_0049444_1507_2985 453
15 3300048913 Ga0496110_0244438 Ga0496110_0244438_23_1510 453
16 3300048911 Ga0496108_0211082 Ga0496108_0211082_233_1666 454
17 3300049576 Ga0501040_0080299 Ga0501040_0080299_735_2228 454
18 3300045049 Ga0466959_0137576 Ga0466959_0137576_12_1484 455
19 3300049576 Ga0501040_0099548 Ga0501040_0099548_513_2000 455
20 3300050511 nmdc:mga08y16_5124_c1 nmdc:mga08y16_5124_c1_14_1426 457
21 3300049593 Ga0501077_0035599 Ga0501077_0035599_1705_3159 460
22 3300046642 Ga0495634_0064380 Ga0495634_0064380_855_2393 463
23 3300035117 Ga0373953_0030098 Ga0373953_0030098_244_1731 470
24 3300046463 Ga0495653_0067812 Ga0495653_0067812_22_1566 470
25 3300049577 Ga0501041_0054318 Ga0501041_0054318_13_1542 471
26 3300048904 Ga0496101_0050691 Ga0496101_0050691_1418_2971 473
27 3300048911 Ga0496108_0197530 Ga0496108_0197530_177_1712 474
28 3300048905 Ga0496102_0201370 Ga0496102_0201370_12_1634 476
29 3300049742 Ga0501080_0140453 Ga0501080_0140453_649_2151 476
30 3300046794 Ga0495589_0072396 Ga0495589_0072396_39_1559 478
31 3300046663 Ga0495635_0009805 Ga0495635_0009805_5166_6683 479
32 3300048909 Ga0496106_0118121 Ga0496106_0118121_25_1548 479
33 3300049571 Ga0501034_0233664 Ga0501034_0233664_251_1777 479
34 3300049590 Ga0501074_0042826 Ga0501074_0042826_15_1544 480
35 3300049591 Ga0501075_0115973 Ga0501075_0115973_509_2011 480
36 3300046535 Ga0495586_0042115 Ga0495586_0042115_25_1602 484
37 3300049584 Ga0501068_0019749 Ga0501068_0019749_351_2015 485
38 3300047322 Ga0495680_0054812 Ga0495680_0054812_1471_3069 488
39 3300005468 Ga0070707_100019210 Ga0070707_1000192105 489
40 3300025922 Ga0207646_10017861 Ga0207646_100178614 489
41 3300005445 Ga0070708_100003878 Ga0070708_1000038789 490
42 3300048915 Ga0496112_0000001 Ga0496112_0000001_445733_447394 494
43 3300005985 Ga0081539_10004219 Ga0081539_100042197 496
44 3300005435 Ga0070714_100004075 Ga0070714_1000040758 497
45 3300025928 Ga0207700_10010122 Ga0207700_100101223 497
46 3300025929 Ga0207664_10001718 Ga0207664_100017182 497
47 3300028556 Ga0265337_1000333 Ga0265337_10003339 497
48 3300028563 Ga0265319_1009164 Ga0265319_10091642 497
49 3300028573 Ga0265334_10002151 Ga0265334_100021517 497
50 3300028653 Ga0265323_10003405 Ga0265323_100034052 497
51 3300028666 Ga0265336_10002602 Ga0265336_100026025 497
52 3300028800 Ga0265338_10000956 Ga0265338_1000095618 497
53 3300029957 Ga0265324_10004705 Ga0265324_100047053 497
54 3300029957 Ga0265324_10008566 Ga0265324_100085662 497
55 3300031240 Ga0265320_10006834 Ga0265320_100068344 497
56 3300031241 Ga0265325_10018618 Ga0265325_100186183 497
57 3300031242 Ga0265329_10004447 Ga0265329_100044473 497
58 3300031247 Ga0265340_10000733 Ga0265340_100007333 497
59 3300031344 Ga0265316_10006833 Ga0265316_100068335 497
60 3300031595 Ga0265313_10008095 Ga0265313_100080953 497
61 3300031711 Ga0265314_10006206 Ga0265314_100062063 497
62 3300031712 Ga0265342_10004595 Ga0265342_100045954 497
63 3300046809 Ga0495600_0089928 Ga0495600_0089928_368_1966 497
64 3300031241 Ga0265325_10018232 Ga0265325_100182321 498
65 3300038443 Ga0395901_0081927 Ga0395901_0081927_24_1601 498
66 3300049576 Ga0501040_0010049 Ga0501040_0010049_4292_5935 498
67 3300049578 Ga0501042_0040422 Ga0501042_0040422_1044_2687 498
68 3300025922 Ga0207646_10005395 Ga0207646_100053958 499
69 iso_pu_bacteria 2858950400 2858952339 499
70 3300005435 Ga0070714_100000698 Ga0070714_10000069810 500
71 3300005536 Ga0070697_100055802 Ga0070697_1000558023 500
72 3300005549 Ga0070704_100060943 Ga0070704_1000609432 500
73 3300005983 Ga0081540_1023832 Ga0081540_10238323 500
74 3300005985 Ga0081539_10016782 Ga0081539_100167823 500
75 3300009098 Ga0105245_10065975 Ga0105245_100659752 500
76 3300025929 Ga0207664_10002051 Ga0207664_100020515 500
77 3300005467 Ga0070706_100000465 Ga0070706_10000046513 501
78 3300005468 Ga0070707_100002860 Ga0070707_1000028607 501
79 3300025910 Ga0207684_10000514 Ga0207684_1000051414 501
80 3300009147 Ga0114129_10066310 Ga0114129_100663105 502
81 3300031247 Ga0265340_10031769 Ga0265340_100317692 502
82 3300048907 Ga0496104_0092219 Ga0496104_0092219_75_1805 502
83 3300048914 Ga0496111_0086388 Ga0496111_0086388_477_2207 502
84 3300048915 Ga0496112_0099267 Ga0496112_0099267_333_2063 502
85 3300048916 Ga0496113_0028175 Ga0496113_0028175_2213_3943 502
86 3300002077 JGI24744J21845_10002908 JGI24744J21845_100029082 503
87 3300005338 Ga0068868_100002478 Ga0068868_1000024785 503
88 3300005341 Ga0070691_10004433 Ga0070691_100044336 503
89 3300005354 Ga0070675_100028655 Ga0070675_1000286552 503
90 3300005441 Ga0070700_100017870 Ga0070700_1000178702 503
91 3300005456 Ga0070678_100003212 Ga0070678_1000032126 503
92 3300005471 Ga0070698_100059773 Ga0070698_1000597733 503
93 3300005578 Ga0068854_100003077 Ga0068854_1000030773 503
94 3300005616 Ga0068852_100024953 Ga0068852_1000249532 503
95 3300005718 Ga0068866_10004888 Ga0068866_100048883 503
96 3300005719 Ga0068861_100030100 Ga0068861_1000301003 503
97 3300005842 Ga0068858_100005598 Ga0068858_1000055985 503
98 3300005843 Ga0068860_100019495 Ga0068860_1000194951 503
99 3300006058 Ga0075432_10016161 Ga0075432_100161612 503
100 3300006175 Ga0070712_100001909 Ga0070712_1000019096 503
101 3300006358 Ga0068871_100017985 Ga0068871_1000179854 503
102 3300006871 Ga0075434_100015242 Ga0075434_1000152423 503
103 3300006881 Ga0068865_100000375 Ga0068865_1000003756 503
104 3300009094 Ga0111539_10125427 Ga0111539_101254273 503
105 3300009098 Ga0105245_10001215 Ga0105245_1000121517 503
106 3300009148 Ga0105243_10001235 Ga0105243_1000123522 503
107 3300009148 Ga0105243_10007668 Ga0105243_100076686 503
108 3300009174 Ga0105241_10019585 Ga0105241_100195852 503
109 3300009176 Ga0105242_10001832 Ga0105242_100018328 503
110 3300009553 Ga0105249_10002953 Ga0105249_100029537 503
111 3300009553 Ga0105249_10100879 Ga0105249_101008793 503
112 3300010375 Ga0105239_10009715 Ga0105239_100097154 503
113 3300013297 Ga0157378_10001840 Ga0157378_1000184013 503
114 3300013307 Ga0157372_10075798 Ga0157372_100757982 503
115 3300013308 Ga0157375_10008831 Ga0157375_100088316 503
116 3300014325 Ga0163163_10074270 Ga0163163_100742702 503
117 3300014968 Ga0157379_10006431 Ga0157379_100064313 503
118 3300025898 Ga0207692_10002895 Ga0207692_100028954 503
119 3300025915 Ga0207693_10001043 Ga0207693_100010436 503
120 3300025926 Ga0207659_10109988 Ga0207659_101099882 503
121 3300025933 Ga0207706_10007704 Ga0207706_100077044 503
122 3300025937 Ga0207669_10001964 Ga0207669_100019646 503
123 3300025938 Ga0207704_10001568 Ga0207704_100015682 503
124 3300025961 Ga0207712_10020248 Ga0207712_100202481 503
125 3300025981 Ga0207640_10005102 Ga0207640_100051026 503
126 3300025986 Ga0207658_10058603 Ga0207658_100586032 503
127 3300026023 Ga0207677_10009676 Ga0207677_100096762 503
128 3300026075 Ga0207708_10010618 Ga0207708_100106186 503
129 3300026118 Ga0207675_100026454 Ga0207675_1000264544 503
130 3300026121 Ga0207683_10000829 Ga0207683_1000082929 503
131 3300026142 Ga0207698_10008461 Ga0207698_100084612 503
132 3300027907 Ga0207428_10000479 Ga0207428_1000047929 503
133 3300028379 Ga0268266_10034951 Ga0268266_100349512 503
134 3300028381 Ga0268264_10008529 Ga0268264_100085294 503
135 3300031901 Ga0307406_10075309 Ga0307406_100753092 503
136 3300032002 Ga0307416_100131868 Ga0307416_1001318682 503
137 3300032126 Ga0307415_100060467 Ga0307415_1000604673 503
138 3300048904 Ga0496101_0005663 Ga0496101_0005663_5337_7043 503
139 3300048905 Ga0496102_0005921 Ga0496102_0005921_4426_6132 503
140 3300048909 Ga0496106_0004991 Ga0496106_0004991_4486_6192 503
141 3300048911 Ga0496108_0121974 Ga0496108_0121974_44_1738 503
142 3300048917 Ga0496114_0002035 Ga0496114_0002035_7266_8972 503
143 3300048918 Ga0496115_0003896 Ga0496115_0003896_4432_6138 503
144 3300049571 Ga0501034_0167845 Ga0501034_0167845_95_1786 503
145 3300049592 Ga0501076_0025140 Ga0501076_0025140_2145_3818 503
146 3300050507 nmdc:mga05p37_30168_c1 nmdc:mga05p37_30168_c1_4515_6167 503
147 3300050509 nmdc:mga0qj67_21147_c1 nmdc:mga0qj67_21147_c1_1697_3349 503
148 3300050511 nmdc:mga08y16_103422_c1 nmdc:mga08y16_103422_c1_861_2513 503
149 3300050512 nmdc:mga0n895_16661_c1 nmdc:mga0n895_16661_c1_1226_2878 503
150 3300050515 nmdc:mga0a205_90017_c1 nmdc:mga0a205_90017_c1_454_2106 503
151 3300021388 Ga0213875_10011690 Ga0213875_100116902 504
152 3300037853 Ga0436364_0667900 Ga0436364_0667900_9589_11253 504
153 3300009094 Ga0111539_10007294 Ga0111539_1000729414 505
154 3300028577 Ga0265318_10000251 Ga0265318_1000025128 505
155 3300028800 Ga0265338_10033814 Ga0265338_100338143 505
156 3300031235 Ga0265330_10000873 Ga0265330_1000087314 505
157 3300031241 Ga0265325_10006532 Ga0265325_100065324 505
158 3300048907 Ga0496104_0017596 Ga0496104_0017596_2489_4210 505
159 3300048908 Ga0496105_0003832 Ga0496105_0003832_5482_7203 505
160 3300048911 Ga0496108_0009029 Ga0496108_0009029_3835_5556 505
161 3300048912 Ga0496109_0008259 Ga0496109_0008259_4618_6339 505
162 3300048915 Ga0496112_0011769 Ga0496112_0011769_2603_4324 505
163 3300006844 Ga0075428_100073189 Ga0075428_1000731893 506
164 3300009094 Ga0111539_10035023 Ga0111539_100350233 506
165 3300048913 Ga0496110_0023113 Ga0496110_0023113_3122_4843 506
166 3300050511 nmdc:mga08y16_31657_c1 nmdc:mga08y16_31657_c1_2748_4361 506
167 3300053078 Ga0495612_0004734 Ga0495612_0004734_1145_2794 506
168 3300005330 Ga0070690_100048860 Ga0070690_1000488603 507
169 3300026075 Ga0207708_10014167 Ga0207708_100141672 508
170 3300005937 Ga0081455_10028351 Ga0081455_100283514 509
171 3300028573 Ga0265334_10001755 Ga0265334_100017552 509
172 3300031249 Ga0265339_10001224 Ga0265339_1000122414 509
173 3300044694 Ga0466963_0000392 Ga0466963_0000392_13561_15195 509
174 3300045836 Ga0466958_0036699 Ga0466958_0036699_37_1671 509
175 3300005983 Ga0081540_1000497 Ga0081540_100049732 510
176 3300028573 Ga0265334_10019876 Ga0265334_100198762 510
177 3300028800 Ga0265338_10071040 Ga0265338_100710401 510
178 3300031240 Ga0265320_10013270 Ga0265320_100132702 510
179 3300031344 Ga0265316_10064553 Ga0265316_100645531 510
180 3300031595 Ga0265313_10033973 Ga0265313_100339732 510
181 3300031711 Ga0265314_10027558 Ga0265314_100275581 510
182 3300044842 Ga0466957_0000936 Ga0466957_0000936_8039_9673 510
183 3300046517 Ga0495630_0127132 Ga0495630_0127132_233_1903 511
184 3300005536 Ga0070697_100089700 Ga0070697_1000897002 512
185 3300039437 Ga0436365_0658475 Ga0436365_0658475_41_1714 513
186 iso_pu_bacteria 8055066027 8055069796 513
187 3300049569 Ga0501032_0012338 Ga0501032_0012338_363_2042 514
188 3300049574 Ga0501038_0017754 Ga0501038_0017754_1416_3095 514
189 3300049575 Ga0501039_0025403 Ga0501039_0025403_2772_4451 514
190 3300049577 Ga0501041_0001057 Ga0501041_0001057_1363_3042 514
191 3300049578 Ga0501042_0099081 Ga0501042_0099081_73_1752 514
192 3300049579 Ga0501043_0022479 Ga0501043_0022479_1034_2713 514
193 3300049584 Ga0501068_0013175 Ga0501068_0013175_2135_3814 514
194 3300049587 Ga0501071_0007051 Ga0501071_0007051_88_1767 514
195 3300049588 Ga0501072_0003167 Ga0501072_0003167_6897_8576 514
196 3300049590 Ga0501074_0004289 Ga0501074_0004289_542_2221 514
197 3300049591 Ga0501075_0012788 Ga0501075_0012788_3431_5110 514
198 3300049593 Ga0501077_0007458 Ga0501077_0007458_4960_6639 514
199 3300049742 Ga0501080_0073319 Ga0501080_0073319_1366_3045 514
200 3300049744 Ga0501083_0084544 Ga0501083_0084544_231_1916 514
201 3300049824 Ga0501045_0012189 Ga0501045_0012189_2952_4631 514
202 3300054114 Ga0501084_0005964 Ga0501084_0005964_5310_6989 514
203 3300060353 Ga0501082_0013204 Ga0501082_0013204_948_2627 514
204 3300005365 Ga0070688_100018703 Ga0070688_1000187033 515
205 3300005436 Ga0070713_100121165 Ga0070713_1001211652 515
206 3300005983 Ga0081540_1001419 Ga0081540_100141918 515
207 3300006028 Ga0070717_10005007 Ga0070717_100050076 515
208 3300025928 Ga0207700_10009976 Ga0207700_100099766 515
209 3300049570 Ga0501033_0019493 Ga0501033_0019493_2896_4566 515
210 3300049576 Ga0501040_0006995 Ga0501040_0006995_2352_4022 515
211 3300049579 Ga0501043_0005321 Ga0501043_0005321_1935_3605 515
212 3300049584 Ga0501068_0005364 Ga0501068_0005364_2102_3772 515
213 3300049585 Ga0501069_0001443 Ga0501069_0001443_1965_3635 515
214 3300049586 Ga0501070_0005012 Ga0501070_0005012_8855_10525 515
215 3300049591 Ga0501075_0028112 Ga0501075_0028112_1935_3605 515
216 3300049744 Ga0501083_0009973 Ga0501083_0009973_1813_3483 515
217 3300049823 Ga0501044_0134802 Ga0501044_0134802_712_2382 515
218 iso_pu_bacteria 8055172936 8055180705 515
219 3300005468 Ga0070707_100020654 Ga0070707_1000206542 516
220 3300005471 Ga0070698_100050894 Ga0070698_1000508943 516
221 3300005842 Ga0068858_100176383 Ga0068858_1001763831 516
222 3300006844 Ga0075428_100063647 Ga0075428_1000636473 516
223 3300009094 Ga0111539_10024604 Ga0111539_100246045 516
224 3300009147 Ga0114129_10004699 Ga0114129_1000469912 516
225 3300013308 Ga0157375_10175379 Ga0157375_101753792 516
226 3300025929 Ga0207664_10012653 Ga0207664_100126537 516
227 3300031901 Ga0307406_10010429 Ga0307406_100104294 516
228 3300032004 Ga0307414_10050944 Ga0307414_100509442 516
229 3300045976 Ga0466967_0138476 Ga0466967_0138476_235_1854 516
230 3300046463 Ga0495653_0045102 Ga0495653_0045102_637_2256 516
231 3300046477 Ga0495664_0064639 Ga0495664_0064639_72_1691 516
232 3300046517 Ga0495630_0098504 Ga0495630_0098504_288_1907 516
233 3300046559 Ga0495667_0017683 Ga0495667_0017683_2468_4087 516
234 3300046663 Ga0495635_0013373 Ga0495635_0013373_1052_2671 516
235 3300046675 Ga0495657_0004405 Ga0495657_0004405_393_2012 516
236 3300046681 Ga0495647_0018457 Ga0495647_0018457_746_2365 516
237 3300046689 Ga0495613_0096637 Ga0495613_0096637_465_2084 516
238 3300047319 Ga0495674_0074318 Ga0495674_0074318_537_2156 516
239 3300047471 Ga0495684_0017936 Ga0495684_0017936_510_2129 516
240 3300048907 Ga0496104_0015678 Ga0496104_0015678_891_2510 516
241 3300048912 Ga0496109_0010930 Ga0496109_0010930_400_2019 516
242 3300048918 Ga0496115_0008417 Ga0496115_0008417_2162_3781 516
243 3300049569 Ga0501032_0026363 Ga0501032_0026363_394_2064 516
244 3300049571 Ga0501034_0074058 Ga0501034_0074058_696_2366 516
245 3300049572 Ga0501036_0030166 Ga0501036_0030166_2102_3772 516
246 3300049574 Ga0501038_0133099 Ga0501038_0133099_156_1766 516
247 3300049576 Ga0501040_0023090 Ga0501040_0023090_461_2071 516
248 3300049578 Ga0501042_0049128 Ga0501042_0049128_1190_2800 516
249 3300049587 Ga0501071_0055437 Ga0501071_0055437_847_2457 516
250 3300049589 Ga0501073_0009990 Ga0501073_0009990_2075_3745 516
251 3300049590 Ga0501074_0075051 Ga0501074_0075051_599_2269 516
252 3300049741 Ga0501079_0064175 Ga0501079_0064175_1059_2669 516
253 3300049741 Ga0501079_0067731 Ga0501079_0067731_828_2438 516
254 3300049743 Ga0501081_0021138 Ga0501081_0021138_737_2407 516
255 3300049822 Ga0501035_0011103 Ga0501035_0011103_1962_3632 516
256 3300050507 nmdc:mga05p37_14857_c1 nmdc:mga05p37_14857_c1_2044_3708 516
257 3300050511 nmdc:mga08y16_19707_c1 nmdc:mga08y16_19707_c1_4354_6018 516
258 3300050515 nmdc:mga0a205_27287_c1 nmdc:mga0a205_27287_c1_3496_5160 516
259 3300053077 Ga0495601_0030555 Ga0495601_0030555_1556_3175 516
260 3300053085 Ga0495619_0048434 Ga0495619_0048434_410_2029 516
261 3300060353 Ga0501082_0122215 Ga0501082_0122215_74_1684 516
262 3300061734 Ga0530510_0030015 Ga0530510_0030015_1315_2925 516
263 3300061734 Ga0530510_0065041 Ga0530510_0065041_488_2098 516
264 iso_pu_bacteria 2558860280 2559431391 516
265 3300005330 Ga0070690_100061574 Ga0070690_1000615742 517
266 3300005434 Ga0070709_10059357 Ga0070709_100593571 517
267 3300005435 Ga0070714_100084332 Ga0070714_1000843322 517
268 3300005467 Ga0070706_100047123 Ga0070706_1000471233 517
269 3300005471 Ga0070698_100000317 Ga0070698_10000031753 517
270 3300005983 Ga0081540_1054752 Ga0081540_10547522 517
271 3300006358 Ga0068871_100021915 Ga0068871_1000219152 517
272 3300006914 Ga0075436_100004003 Ga0075436_10000400310 517
273 3300013296 Ga0157374_10127575 Ga0157374_101275752 517
274 3300025910 Ga0207684_10016825 Ga0207684_100168251 517
275 3300026023 Ga0207677_10065235 Ga0207677_100652354 517
276 3300026121 Ga0207683_10157822 Ga0207683_101578222 517
277 3300031995 Ga0307409_100033750 Ga0307409_1000337503 517
278 3300046559 Ga0495667_0015707 Ga0495667_0015707_1287_2978 517
279 3300046642 Ga0495634_0039088 Ga0495634_0039088_105_1799 517
280 3300046675 Ga0495657_0041563 Ga0495657_0041563_908_2599 517
281 3300048912 Ga0496109_0085764 Ga0496109_0085764_292_1989 517
282 3300049577 Ga0501041_0072344 Ga0501041_0072344_82_1782 517
283 3300049587 Ga0501071_0055776 Ga0501071_0055776_190_1890 517
284 3300049741 Ga0501079_0112909 Ga0501079_0112909_82_1782 517
285 3300050512 nmdc:mga0n895_24304_c1 nmdc:mga0n895_24304_c1_1957_3654 517
286 3300005434 Ga0070709_10008433 Ga0070709_100084332 518
287 3300031247 Ga0265340_10000078 Ga0265340_100000781 518
288 3300049572 Ga0501036_0150937 Ga0501036_0150937_31_1731 518
289 3300049575 Ga0501039_0085814 Ga0501039_0085814_546_2222 518
290 3300049583 Ga0501067_0004408 Ga0501067_0004408_5980_7728 518
291 3300049584 Ga0501068_0012307 Ga0501068_0012307_2995_4743 518
292 3300049593 Ga0501077_0110492 Ga0501077_0110492_29_1705 518
293 3300049741 Ga0501079_0086456 Ga0501079_0086456_71_1747 518
294 3300005435 Ga0070714_100002238 Ga0070714_10000223811 519
295 3300025929 Ga0207664_10048060 Ga0207664_100480602 519
296 3300032002 Ga0307416_100033472 Ga0307416_1000334722 519
297 3300032002 Ga0307416_100068330 Ga0307416_1000683301 519
298 3300032126 Ga0307415_100033745 Ga0307415_1000337452 519
299 3300045049 Ga0466959_0011612 Ga0466959_0011612_2178_3812 519
300 iso_pu_bacteria 2884693830 2884695748 519
301 iso_pu_bacteria 2895427314 2895438810 519
302 iso_pu_bacteria 2895442618 2895445540 519
303 3300005468 Ga0070707_100001997 Ga0070707_1000019978 520
304 3300005985 Ga0081539_10004838 Ga0081539_100048389 520
305 3300025922 Ga0207646_10000129 Ga0207646_1000012953 520
306 3300044694 Ga0466963_0002439 Ga0466963_0002439_8206_9840 520
307 3300044706 Ga0466964_0007175 Ga0466964_0007175_1462_3096 520
308 3300044842 Ga0466957_0017303 Ga0466957_0017303_486_2120 520
309 3300044901 Ga0466960_0009385 Ga0466960_0009385_1911_3545 520
310 3300045976 Ga0466967_0008724 Ga0466967_0008724_5269_6903 520
311 3300045976 Ga0466967_0035213 Ga0466967_0035213_953_2587 520
312 3300045976 Ga0466967_0054572 Ga0466967_0054572_491_2122 520
313 3300061719 Ga0466962_0002813 Ga0466962_0002813_5741_7378 520
314 iso_pu_bacteria 2599185353 2600200095 520
315 iso_pu_bacteria 2600254943 2600401272 520
316 3300030521 Ga0307511_10001274 Ga0307511_100012745 521
317 3300044656 Ga0466969_0000608 Ga0466969_0000608_12102_13739 521
318 3300044684 Ga0466966_0056568 Ga0466966_0056568_56_1693 521
319 3300044735 Ga0466968_0001536 Ga0466968_0001536_2199_3836 521
320 3300045049 Ga0466959_0018712 Ga0466959_0018712_1080_2717 521
321 3300045836 Ga0466958_0005643 Ga0466958_0005643_1607_3244 521
322 3300045976 Ga0466967_0033419 Ga0466967_0033419_2670_4307 521
323 3300045976 Ga0466967_0037277 Ga0466967_0037277_232_1869 521
324 3300048903 Ga0496100_0000191 Ga0496100_0000191_8717_10417 521
325 3300049568 Ga0501031_0015248 Ga0501031_0015248_3172_4821 521
326 3300049574 Ga0501038_0072031 Ga0501038_0072031_390_2039 521
327 3300049575 Ga0501039_0048018 Ga0501039_0048018_53_1702 521
328 3300049576 Ga0501040_0006932 Ga0501040_0006932_4810_6459 521
329 3300049577 Ga0501041_0023558 Ga0501041_0023558_1863_3512 521
330 3300049578 Ga0501042_0006956 Ga0501042_0006956_4429_6078 521
331 3300049580 Ga0501046_0006046 Ga0501046_0006046_5280_6929 521
332 3300049582 Ga0501048_0013979 Ga0501048_0013979_1244_2893 521
333 3300049588 Ga0501072_0001813 Ga0501072_0001813_2423_4072 521
334 3300049590 Ga0501074_0067950 Ga0501074_0067950_795_2444 521
335 3300049591 Ga0501075_0008537 Ga0501075_0008537_1923_3572 521
336 3300049592 Ga0501076_0003449 Ga0501076_0003449_1956_3605 521
337 3300049743 Ga0501081_0009027 Ga0501081_0009027_3899_5548 521
338 3300049822 Ga0501035_0105190 Ga0501035_0105190_81_1730 521
339 3300049824 Ga0501045_0008101 Ga0501045_0008101_3709_5358 521
340 3300054114 Ga0501084_0022217 Ga0501084_0022217_632_2281 521
341 3300060353 Ga0501082_0006285 Ga0501082_0006285_1736_3385 521
342 3300061734 Ga0530510_0035018 Ga0530510_0035018_691_2340 521
343 iso_pu_bacteria 2675903059 2676479758 521
344 iso_pu_bacteria 2915358134 2915359072 521
345 iso_pu_bacteria 8054472261 8054474043 521
346 3300048913 Ga0496110_0065705 Ga0496110_0065705_719_2371 522
347 3300049582 Ga0501048_0108819 Ga0501048_0108819_88_1737 522
348 3300049588 Ga0501072_0115812 Ga0501072_0115812_73_1719 522
349 iso_pu_bacteria 8003314358 8003317089 522
350 3300005330 Ga0070690_100004217 Ga0070690_1000042173 523
351 3300005340 Ga0070689_100014522 Ga0070689_1000145222 523
352 3300005356 Ga0070674_100004418 Ga0070674_1000044185 523
353 3300005365 Ga0070688_100031062 Ga0070688_1000310623 523
354 3300005459 Ga0068867_100009948 Ga0068867_1000099482 523
355 3300005544 Ga0070686_100057768 Ga0070686_1000577682 523
356 3300009177 Ga0105248_10068535 Ga0105248_100685352 523
357 3300013297 Ga0157378_10008800 Ga0157378_100088002 523
358 3300014968 Ga0157379_10008017 Ga0157379_100080174 523
359 3300025899 Ga0207642_10018821 Ga0207642_100188212 523
360 3300025937 Ga0207669_10013429 Ga0207669_100134293 523
361 3300025940 Ga0207691_10098945 Ga0207691_100989452 523
362 3300026089 Ga0207648_10001438 Ga0207648_1000143817 523
363 3300028800 Ga0265338_10000457 Ga0265338_1000045772 523
364 3300044901 Ga0466960_0016566 Ga0466960_0016566_907_2679 523
365 3300046463 Ga0495653_0046817 Ga0495653_0046817_462_2114 523
366 3300046476 Ga0495662_0000347 Ga0495662_0000347_3912_5564 523
367 3300046477 Ga0495664_0000303 Ga0495664_0000303_17910_19562 523
368 3300046511 Ga0495608_0003824 Ga0495608_0003824_2516_4168 523
369 3300046526 Ga0495666_0021425 Ga0495666_0021425_30_1682 523
370 3300046529 Ga0495652_0022175 Ga0495652_0022175_1921_3573 523
371 3300046559 Ga0495667_0022575 Ga0495667_0022575_1884_3536 523
372 3300046663 Ga0495635_0036741 Ga0495635_0036741_462_2114 523
373 3300046680 Ga0495646_0025660 Ga0495646_0025660_1377_3029 523
374 3300046689 Ga0495613_0001143 Ga0495613_0001143_832_2484 523
375 3300047315 Ga0495581_0015264 Ga0495581_0015264_13_1665 523
376 3300047317 Ga0495604_0001245 Ga0495604_0001245_12052_13704 523
377 3300047673 Ga0495593_0049227 Ga0495593_0049227_55_1707 523
378 3300048905 Ga0496102_0044821 Ga0496102_0044821_865_2514 523
379 3300048907 Ga0496104_0008921 Ga0496104_0008921_1865_3514 523
380 3300048913 Ga0496110_0016480 Ga0496110_0016480_2626_4275 523
381 3300048916 Ga0496113_0046370 Ga0496113_0046370_1499_3199 523
382 3300053088 Ga0500644_0017802 Ga0500644_0017802_309_1994 523
383 3300053122 Ga0500608_060318 Ga0500608_060318_98_1753 523
384 iso_pu_bacteria 2565956521 2566036260 523
385 iso_pu_bacteria 2582581314 2585312144 523
386 iso_pu_bacteria 2616644814 2616693834 523
387 iso_pu_bacteria 2867428634 2867438005 523
388 iso_pu_bacteria 2995463766 2995464033 523
389 3300005355 Ga0070671_100000903 Ga0070671_10000090310 524
390 3300005356 Ga0070674_100027833 Ga0070674_1000278333 524
391 3300005455 Ga0070663_100002095 Ga0070663_1000020954 524
392 3300005456 Ga0070678_100068119 Ga0070678_1000681191 524
393 3300005459 Ga0068867_100009134 Ga0068867_1000091342 524
394 3300005471 Ga0070698_100008135 Ga0070698_1000081355 524
395 3300005546 Ga0070696_100018879 Ga0070696_1000188792 524
396 3300005548 Ga0070665_100008498 Ga0070665_1000084985 524
397 3300005615 Ga0070702_100042026 Ga0070702_1000420262 524
398 3300005618 Ga0068864_100036797 Ga0068864_1000367972 524
399 3300005842 Ga0068858_100046336 Ga0068858_1000463363 524
400 3300009147 Ga0114129_10001397 Ga0114129_100013979 524
401 3300009147 Ga0114129_10012644 Ga0114129_1001264410 524
402 3300013296 Ga0157374_10179230 Ga0157374_101792301 524
403 3300014325 Ga0163163_10007568 Ga0163163_100075683 524
404 3300014325 Ga0163163_10021438 Ga0163163_100214382 524
405 3300014325 Ga0163163_10146027 Ga0163163_101460273 524
406 3300014968 Ga0157379_10014462 Ga0157379_100144625 524
407 3300014968 Ga0157379_10018624 Ga0157379_100186246 524
408 3300025931 Ga0207644_10007437 Ga0207644_100074373 524
409 3300026067 Ga0207678_10000785 Ga0207678_100007854 524
410 3300026075 Ga0207708_10020421 Ga0207708_100204213 524
411 3300026088 Ga0207641_10000855 Ga0207641_100008554 524
412 3300026089 Ga0207648_10005064 Ga0207648_100050646 524
413 3300026121 Ga0207683_10098091 Ga0207683_100980912 524
414 3300028379 Ga0268266_10009794 Ga0268266_100097944 524
415 3300031456 Ga0307513_10103500 Ga0307513_101035002 524
416 3300041512 Ga0451853_3098222 Ga0451853_3098222_696_2357 524
417 3300044658 Ga0466972_0005806 Ga0466972_0005806_2612_4315 524
418 3300044683 Ga0466965_0002461 Ga0466965_0002461_3791_5494 524
419 3300044693 Ga0466961_0065115 Ga0466961_0065115_52_1704 524
420 3300044765 Ga0466970_0052942 Ga0466970_0052942_268_1971 524
421 3300044901 Ga0466960_0002342 Ga0466960_0002342_1767_3470 524
422 3300046455 Ga0495603_0012348 Ga0495603_0012348_896_2548 524
423 3300046492 Ga0495585_0039114 Ga0495585_0039114_669_2324 524
424 3300046665 Ga0495661_0035179 Ga0495661_0035179_1017_2672 524
425 3300046683 Ga0495658_0035130 Ga0495658_0035130_523_2205 524
426 3300047319 Ga0495674_0044931 Ga0495674_0044931_2038_3705 524
427 3300048905 Ga0496102_0000046 Ga0496102_0000046_86642_88342 524
428 3300048905 Ga0496102_0029801 Ga0496102_0029801_2506_4209 524
429 3300048906 Ga0496103_0000011 Ga0496103_0000011_23052_24752 524
430 3300048907 Ga0496104_0040751 Ga0496104_0040751_2201_3901 524
431 3300048908 Ga0496105_0046616 Ga0496105_0046616_1420_3126 524
432 3300048911 Ga0496108_0015621 Ga0496108_0015621_3592_5292 524
433 3300048919 Ga0496116_0000328 Ga0496116_0000328_48772_50472 524
434 3300048920 Ga0496117_0000109 Ga0496117_0000109_96321_98021 524
435 3300048921 Ga0496118_0000132 Ga0496118_0000132_33143_34843 524
436 3300048922 Ga0496119_0001399 Ga0496119_0001399_26497_28197 524
437 3300048924 Ga0496121_0007631 Ga0496121_0007631_2585_4285 524
438 3300048927 Ga0496124_0032677 Ga0496124_0032677_1834_3534 524
439 3300048929 Ga0496126_0000345 Ga0496126_0000345_46761_48461 524
440 3300049587 Ga0501071_0055272 Ga0501071_0055272_918_2555 524
441 3300050507 nmdc:mga05p37_3241_c1 nmdc:mga05p37_3241_c1_11900_13579 524
442 3300053150 Ga0500603_008820 Ga0500603_008820_89_1762 524
443 3300059423 Ga0590074_000702 Ga0590074_000702_1704_3389 524
444 3300005331 Ga0070670_100045779 Ga0070670_1000457791 525
445 3300005445 Ga0070708_100045096 Ga0070708_1000450963 525
446 3300005834 Ga0068851_10044626 Ga0068851_100446261 525
447 3300006028 Ga0070717_10026431 Ga0070717_100264312 525
448 3300006058 Ga0075432_10011415 Ga0075432_100114152 525
449 3300006175 Ga0070712_100042084 Ga0070712_1000420843 525
450 3300006852 Ga0075433_10066589 Ga0075433_100665893 525
451 3300013308 Ga0157375_10029612 Ga0157375_100296125 525
452 3300014968 Ga0157379_10111505 Ga0157379_101115052 525
453 3300015688 Ga0183367_1003 Ga0183367_1003423 525
454 3300021384 Ga0213876_10002282 Ga0213876_100022825 525
455 3300021384 Ga0213876_10058644 Ga0213876_100586442 525
456 3300025901 Ga0207688_10014132 Ga0207688_100141324 525
457 3300025905 Ga0207685_10005361 Ga0207685_100053612 525
458 3300025907 Ga0207645_10029832 Ga0207645_100298322 525
459 3300025915 Ga0207693_10001547 Ga0207693_100015476 525
460 3300025915 Ga0207693_10119372 Ga0207693_101193722 525
461 3300025918 Ga0207662_10032228 Ga0207662_100322282 525
462 3300025919 Ga0207657_10015512 Ga0207657_100155122 525
463 3300025923 Ga0207681_10062876 Ga0207681_100628761 525
464 3300025928 Ga0207700_10116515 Ga0207700_101165152 525
465 3300025939 Ga0207665_10018547 Ga0207665_100185473 525
466 3300025942 Ga0207689_10012298 Ga0207689_100122984 525
467 3300026095 Ga0207676_10179998 Ga0207676_101799982 525
468 3300026118 Ga0207675_100055493 Ga0207675_1000554931 525
469 3300027907 Ga0207428_10063239 Ga0207428_100632393 525
470 3300028381 Ga0268264_10183701 Ga0268264_101837011 525
471 3300028794 Ga0307515_10014050 Ga0307515_100140501 525
472 3300030521 Ga0307511_10015850 Ga0307511_100158503 525
473 3300031507 Ga0307509_10050248 Ga0307509_100502483 525
474 3300031507 Ga0307509_10103837 Ga0307509_101038371 525
475 3300031616 Ga0307508_10008110 Ga0307508_100081105 525
476 3300031730 Ga0307516_10033431 Ga0307516_100334312 525
477 3300031838 Ga0307518_10016097 Ga0307518_100160975 525
478 3300033179 Ga0307507_10012829 Ga0307507_100128294 525
479 3300033180 Ga0307510_10060675 Ga0307510_100606751 525
480 3300035083 Ga0373926_0004470 Ga0373926_0004470_1442_3100 525
481 3300035089 Ga0373944_0007068 Ga0373944_0007068_507_2165 525
482 3300035116 Ga0373945_0001574 Ga0373945_0001574_4661_6319 525
483 3300035170 Ga0373943_0029801 Ga0373943_0029801_87_1745 525
484 3300035171 Ga0373946_0004588 Ga0373946_0004588_2624_4282 525
485 3300035410 Ga0373924_0018278 Ga0373924_0018278_373_2031 525
486 3300035695 Ga0373927_0004175 Ga0373927_0004175_1002_2660 525
487 3300035725 Ga0373947_0033495 Ga0373947_0033495_132_1790 525
488 3300038742 Ga0400486_21479 Ga0400486_21479_83_1732 525
489 3300039437 Ga0436365_0542570 Ga0436365_0542570_248_1906 525
490 3300039437 Ga0436365_1210809 Ga0436365_1210809_3926_5593 525
491 3300044658 Ga0466972_0007692 Ga0466972_0007692_895_2562 525
492 3300044712 Ga0453684_0122256 Ga0453684_0122256_677_2380 525
493 3300046455 Ga0495603_0026749 Ga0495603_0026749_189_1847 525
494 3300046455 Ga0495603_0056579 Ga0495603_0056579_366_2033 525
495 3300046459 Ga0495629_0039341 Ga0495629_0039341_1002_2660 525
496 3300046461 Ga0495641_0002361 Ga0495641_0002361_3593_5251 525
497 3300046462 Ga0495651_0007217 Ga0495651_0007217_4449_6116 525
498 3300046462 Ga0495651_0096619 Ga0495651_0096619_162_1829 525
499 3300046472 Ga0495580_0029450 Ga0495580_0029450_1882_3540 525
500 3300046473 Ga0495582_0008058 Ga0495582_0008058_2747_4405 525
501 3300046473 Ga0495582_0023960 Ga0495582_0023960_1099_2766 525
502 3300046475 Ga0495639_0000733 Ga0495639_0000733_3219_4877 525
503 3300046476 Ga0495662_0013965 Ga0495662_0013965_2116_3783 525
504 3300046477 Ga0495664_0001037 Ga0495664_0001037_4318_5985 525
505 3300046499 Ga0495594_0027407 Ga0495594_0027407_1022_2680 525
506 3300046499 Ga0495594_0028449 Ga0495594_0028449_114_1781 525
507 3300046517 Ga0495630_0030223 Ga0495630_0030223_291_1958 525
508 3300046517 Ga0495630_0034901 Ga0495630_0034901_1431_3089 525
509 3300046529 Ga0495652_0076320 Ga0495652_0076320_287_1954 525
510 3300046531 Ga0495665_0002021 Ga0495665_0002021_4750_6408 525
511 3300046533 Ga0495640_0013894 Ga0495640_0013894_4346_6004 525
512 3300046535 Ga0495586_0019919 Ga0495586_0019919_66_1724 525
513 3300046536 Ga0495587_0025860 Ga0495587_0025860_126_1793 525
514 3300046559 Ga0495667_0038867 Ga0495667_0038867_17_1675 525
515 3300046642 Ga0495634_0022495 Ga0495634_0022495_1237_2895 525
516 3300046660 Ga0495625_0004664 Ga0495625_0004664_5079_6749 525
517 3300046663 Ga0495635_0001067 Ga0495635_0001067_4396_6063 525
518 3300046663 Ga0495635_0008048 Ga0495635_0008048_2470_4128 525
519 3300046674 Ga0495588_0008979 Ga0495588_0008979_1634_3292 525
520 3300046674 Ga0495588_0037805 Ga0495588_0037805_455_2122 525
521 3300046675 Ga0495657_0001313 Ga0495657_0001313_10383_12050 525
522 3300046680 Ga0495646_0074831 Ga0495646_0074831_200_1867 525
523 3300046683 Ga0495658_0002328 Ga0495658_0002328_4364_6022 525
524 3300046689 Ga0495613_0070184 Ga0495613_0070184_835_2493 525
525 3300046690 Ga0495624_0005587 Ga0495624_0005587_2308_3966 525
526 3300046809 Ga0495600_0012911 Ga0495600_0012911_743_2410 525
527 3300047315 Ga0495581_0003375 Ga0495581_0003375_4313_5980 525
528 3300047317 Ga0495604_0003847 Ga0495604_0003847_8719_10386 525
529 3300047317 Ga0495604_0104871 Ga0495604_0104871_284_1951 525
530 3300047319 Ga0495674_0006495 Ga0495674_0006495_4788_6446 525
531 3300047319 Ga0495674_0115650 Ga0495674_0115650_61_1728 525
532 3300047321 Ga0495676_0022869 Ga0495676_0022869_2689_4356 525
533 3300047322 Ga0495680_0015800 Ga0495680_0015800_2510_4168 525
534 3300047443 Ga0495687_004554 Ga0495687_004554_3846_5513 525
535 3300047470 Ga0495681_0011848 Ga0495681_0011848_112_1782 525
536 3300047673 Ga0495593_0003591 Ga0495593_0003591_3206_4873 525
537 3300047673 Ga0495593_0014442 Ga0495593_0014442_1469_3127 525
538 3300048088 Ga0495602_0021341 Ga0495602_0021341_1191_2858 525
539 3300048907 Ga0496104_0018432 Ga0496104_0018432_1102_2802 525
540 3300048911 Ga0496108_0018664 Ga0496108_0018664_2803_4470 525
541 3300048911 Ga0496108_0019797 Ga0496108_0019797_3711_5411 525
542 3300048912 Ga0496109_0036432 Ga0496109_0036432_944_2644 525
543 3300048913 Ga0496110_0004537 Ga0496110_0004537_317_2029 525
544 3300048913 Ga0496110_0073023 Ga0496110_0073023_41_1741 525
545 3300048917 Ga0496114_0033573 Ga0496114_0033573_2077_3777 525
546 3300050507 nmdc:mga05p37_19768_c1 nmdc:mga05p37_19768_c1_4108_5763 525
547 3300050511 nmdc:mga08y16_184773_c1 nmdc:mga08y16_184773_c1_268_1926 525
548 3300053085 Ga0495619_0008129 Ga0495619_0008129_4965_6623 525
549 3300053090 Ga0500646_0000089 Ga0500646_0000089_9324_11033 525
550 3300053146 Ga0500588_0002793 Ga0500588_0002793_633_2342 525
551 3300060353 Ga0501082_0115399 Ga0501082_0115399_422_2107 525
552 3300005344 Ga0070661_100026200 Ga0070661_1000262004 526
553 3300005355 Ga0070671_100015031 Ga0070671_1000150314 526
554 3300005366 Ga0070659_100010975 Ga0070659_1000109752 526
555 3300005440 Ga0070705_100002591 Ga0070705_1000025914 526
556 3300005468 Ga0070707_100009423 Ga0070707_1000094235 526
557 3300005471 Ga0070698_100060038 Ga0070698_1000600385 526
558 3300005518 Ga0070699_100006322 Ga0070699_1000063226 526
559 3300005518 Ga0070699_100017960 Ga0070699_1000179604 526
560 3300005530 Ga0070679_100086969 Ga0070679_1000869692 526
561 3300005546 Ga0070696_100067887 Ga0070696_1000678872 526
562 3300005564 Ga0070664_100067880 Ga0070664_1000678802 526
563 3300005841 Ga0068863_100003945 Ga0068863_1000039454 526
564 3300005841 Ga0068863_100023726 Ga0068863_1000237264 526
565 3300005937 Ga0081455_10006576 Ga0081455_100065768 526
566 3300005985 Ga0081539_10005582 Ga0081539_1000558210 526
567 3300006178 Ga0075367_10008041 Ga0075367_100080412 526
568 3300006186 Ga0075369_10005130 Ga0075369_100051303 526
569 3300006353 Ga0075370_10044479 Ga0075370_100444791 526
570 3300006844 Ga0075428_100247981 Ga0075428_1002479811 526
571 3300006852 Ga0075433_10007584 Ga0075433_100075844 526
572 3300009094 Ga0111539_10011179 Ga0111539_100111799 526
573 3300009098 Ga0105245_10036528 Ga0105245_100365282 526
574 3300009147 Ga0114129_10006183 Ga0114129_1000618312 526
575 3300009177 Ga0105248_10191886 Ga0105248_101918862 526
576 3300009551 Ga0105238_10136809 Ga0105238_101368092 526
577 3300011119 Ga0105246_10010694 Ga0105246_100106942 526
578 3300013307 Ga0157372_10104916 Ga0157372_101049162 526
579 3300025899 Ga0207642_10017626 Ga0207642_100176262 526
580 3300025908 Ga0207643_10003535 Ga0207643_100035354 526
581 3300025922 Ga0207646_10004171 Ga0207646_100041712 526
582 3300025931 Ga0207644_10002738 Ga0207644_100027389 526
583 3300025937 Ga0207669_10040474 Ga0207669_100404742 526
584 3300025945 Ga0207679_10037788 Ga0207679_100377883 526
585 3300026075 Ga0207708_10006612 Ga0207708_100066125 526
586 3300026075 Ga0207708_10020237 Ga0207708_100202372 526
587 3300026088 Ga0207641_10003504 Ga0207641_100035047 526
588 3300026116 Ga0207674_10029446 Ga0207674_100294464 526
589 3300027907 Ga0207428_10002318 Ga0207428_100023183 526
590 3300028380 Ga0268265_10023176 Ga0268265_100231763 526
591 3300028563 Ga0265319_1020020 Ga0265319_10200202 526
592 3300031995 Ga0307409_100066755 Ga0307409_1000667552 526
593 3300035112 Ga0373932_0016335 Ga0373932_0016335_35_1729 526
594 3300035172 Ga0373955_0030234 Ga0373955_0030234_675_2339 526
595 3300035724 Ga0373933_0011345 Ga0373933_0011345_1073_2737 526
596 3300036401 Ga0373937_0000758 Ga0373937_0000758_20879_22543 526
597 3300037312 Ga0395899_0008636 Ga0395899_0008636_2612_4273 526
598 3300037418 Ga0395900_0002757 Ga0395900_0002757_14357_16018 526
599 3300037471 Ga0395905_0003288 Ga0395905_0003288_3069_4730 526
600 3300037853 Ga0436364_0433954 Ga0436364_0433954_2933_4609 526
601 3300037853 Ga0436364_1303368 Ga0436364_1303368_154_1800 526
602 3300038443 Ga0395901_0001240 Ga0395901_0001240_10506_12167 526
603 3300038741 Ga0400488_22792 Ga0400488_22792_675_2441 526
604 3300039062 Ga0400483_126970 Ga0400483_126970_3443_5128 526
605 3300039062 Ga0400483_164544 Ga0400483_164544_277_1962 526
606 3300042157 Ga0439458_0008770 Ga0439458_0008770_252_1937 526
607 3300045836 Ga0466958_0018228 Ga0466958_0018228_855_2540 526
608 3300046459 Ga0495629_0014218 Ga0495629_0014218_3965_5629 526
609 3300046463 Ga0495653_0083576 Ga0495653_0083576_69_1733 526
610 3300046473 Ga0495582_0028686 Ga0495582_0028686_752_2416 526
611 3300046511 Ga0495608_0019225 Ga0495608_0019225_1135_2799 526
612 3300046517 Ga0495630_0013431 Ga0495630_0013431_2807_4471 526
613 3300046543 Ga0495645_0072139 Ga0495645_0072139_71_1735 526
614 3300046642 Ga0495634_0092707 Ga0495634_0092707_284_1948 526
615 3300046675 Ga0495657_0006378 Ga0495657_0006378_2889_4553 526
616 3300046678 Ga0495599_0015132 Ga0495599_0015132_2495_4159 526
617 3300046680 Ga0495646_0048465 Ga0495646_0048465_641_2305 526
618 3300046690 Ga0495624_0104552 Ga0495624_0104552_28_1692 526
619 3300046809 Ga0495600_0007929 Ga0495600_0007929_1617_3281 526
620 3300047317 Ga0495604_0011912 Ga0495604_0011912_1736_3400 526
621 3300047322 Ga0495680_0021408 Ga0495680_0021408_2495_4159 526
622 3300048088 Ga0495602_0049002 Ga0495602_0049002_1373_3037 526
623 3300048903 Ga0496100_0035465 Ga0496100_0035465_1181_2854 526
624 3300048904 Ga0496101_0001168 Ga0496101_0001168_10863_12536 526
625 3300048905 Ga0496102_0022609 Ga0496102_0022609_131_1816 526
626 3300048906 Ga0496103_0013712 Ga0496103_0013712_1663_3348 526
627 3300048907 Ga0496104_0007997 Ga0496104_0007997_2512_4185 526
628 3300048908 Ga0496105_0085986 Ga0496105_0085986_778_2451 526
629 3300048909 Ga0496106_0050790 Ga0496106_0050790_179_1864 526
630 3300048910 Ga0496107_0009722 Ga0496107_0009722_2555_4228 526
631 3300048912 Ga0496109_0030042 Ga0496109_0030042_1546_3210 526
632 3300048917 Ga0496114_0060739 Ga0496114_0060739_1122_2795 526
633 3300049569 Ga0501032_0083472 Ga0501032_0083472_351_2024 526
634 3300049578 Ga0501042_0035034 Ga0501042_0035034_212_1885 526
635 3300049583 Ga0501067_0006119 Ga0501067_0006119_3829_5526 526
636 3300049584 Ga0501068_0018379 Ga0501068_0018379_1711_3384 526
637 3300049585 Ga0501069_0007943 Ga0501069_0007943_2743_4440 526
638 3300049741 Ga0501079_0069935 Ga0501079_0069935_568_2241 526
639 3300049742 Ga0501080_0050432 Ga0501080_0050432_1650_3323 526
640 3300049824 Ga0501045_0018554 Ga0501045_0018554_519_2192 526
641 3300050490 nmdc:mga03n38_9379_c1 nmdc:mga03n38_9379_c1_1080_2759 526
642 3300050491 nmdc:mga00v17_2906_c1 nmdc:mga00v17_2906_c1_832_2511 526
643 3300050507 nmdc:mga05p37_109354_c1 nmdc:mga05p37_109354_c1_1660_3318 526
644 3300050507 nmdc:mga05p37_232554_c1 nmdc:mga05p37_232554_c1_342_2000 526
645 3300050511 nmdc:mga08y16_43231_c1 nmdc:mga08y16_43231_c1_1558_3216 526
646 3300050516 nmdc:mga0sz30_888_c1 nmdc:mga0sz30_888_c1_3930_5609 526
647 3300050516 nmdc:mga0sz30_888_c1 nmdc:mga0sz30_888_c1_7250_8929 526
648 3300053078 Ga0495612_0000045 Ga0495612_0000045_48239_49924 526
649 3300053078 Ga0495612_0011410 Ga0495612_0011410_1278_2942 526
650 3300054114 Ga0501084_0072999 Ga0501084_0072999_936_2609 526
651 3300003373 JGI25407J50210_10000506 JGI25407J50210_100005061 527
652 3300003373 JGI25407J50210_10005943 JGI25407J50210_100059432 527
653 3300005329 Ga0070683_100122150 Ga0070683_1001221502 527
654 3300005434 Ga0070709_10003538 Ga0070709_100035383 527
655 3300005435 Ga0070714_100001289 Ga0070714_10000128910 527
656 3300005436 Ga0070713_100002106 Ga0070713_1000021061 527
657 3300005437 Ga0070710_10000632 Ga0070710_100006327 527
658 3300005439 Ga0070711_100000406 Ga0070711_1000004067 527
659 3300005439 Ga0070711_100004936 Ga0070711_1000049367 527
660 3300005543 Ga0070672_100015506 Ga0070672_1000155062 527
661 3300005548 Ga0070665_100040944 Ga0070665_1000409443 527
662 3300005614 Ga0068856_100014225 Ga0068856_1000142254 527
663 3300005844 Ga0068862_100019587 Ga0068862_1000195873 527
664 3300005981 Ga0081538_10001053 Ga0081538_1000105314 527
665 3300005981 Ga0081538_10007573 Ga0081538_100075735 527
666 3300005981 Ga0081538_10028282 Ga0081538_100282823 527
667 3300005981 Ga0081538_10048950 Ga0081538_100489502 527
668 3300005981 Ga0081538_10050535 Ga0081538_100505352 527
669 3300006028 Ga0070717_10001937 Ga0070717_100019373 527
670 3300006173 Ga0070716_100001381 Ga0070716_1000013815 527
671 3300006175 Ga0070712_100001990 Ga0070712_1000019907 527
672 3300006844 Ga0075428_100018814 Ga0075428_1000188142 527
673 3300006844 Ga0075428_100051074 Ga0075428_1000510743 527
674 3300006844 Ga0075428_100099806 Ga0075428_1000998063 527
675 3300006846 Ga0075430_100013964 Ga0075430_1000139647 527
676 3300006847 Ga0075431_100131223 Ga0075431_1001312232 527
677 3300006880 Ga0075429_100012045 Ga0075429_1000120453 527
678 3300009147 Ga0114129_10008528 Ga0114129_100085283 527
679 3300009147 Ga0114129_10068328 Ga0114129_100683286 527
680 3300013296 Ga0157374_10014687 Ga0157374_100146876 527
681 3300025898 Ga0207692_10000452 Ga0207692_100004523 527
682 3300025906 Ga0207699_10000483 Ga0207699_1000048316 527
683 3300025907 Ga0207645_10003459 Ga0207645_100034596 527
684 3300025915 Ga0207693_10010139 Ga0207693_100101392 527
685 3300025928 Ga0207700_10000175 Ga0207700_1000017513 527
686 3300025929 Ga0207664_10000254 Ga0207664_1000025442 527
687 3300025929 Ga0207664_10036714 Ga0207664_100367142 527
688 3300025933 Ga0207706_10008035 Ga0207706_100080356 527
689 3300025937 Ga0207669_10013760 Ga0207669_100137603 527
690 3300025938 Ga0207704_10016428 Ga0207704_100164283 527
691 3300025939 Ga0207665_10001164 Ga0207665_100011646 527
692 3300025940 Ga0207691_10013938 Ga0207691_100139383 527
693 3300026075 Ga0207708_10123887 Ga0207708_101238872 527
694 3300026078 Ga0207702_10041502 Ga0207702_100415022 527
695 3300026095 Ga0207676_10076934 Ga0207676_100769341 527
696 3300026118 Ga0207675_100026000 Ga0207675_1000260002 527
697 3300026118 Ga0207675_100033823 Ga0207675_1000338233 527
698 3300026121 Ga0207683_10119508 Ga0207683_101195081 527
699 3300027682 Ga0209971_1003082 Ga0209971_10030822 527
700 3300028379 Ga0268266_10011782 Ga0268266_100117824 527
701 3300028381 Ga0268264_10060150 Ga0268264_100601503 527
702 3300031691 Ga0316579_10000086 Ga0316579_100000865 527
703 3300033179 Ga0307507_10029090 Ga0307507_100290902 527
704 3300033180 Ga0307510_10049577 Ga0307510_100495773 527
705 3300035083 Ga0373926_0021691 Ga0373926_0021691_310_2022 527
706 3300035725 Ga0373947_0040116 Ga0373947_0040116_630_2336 527
707 3300036712 Ga0316584_0001021 Ga0316584_0001021_4308_6140 527
708 3300037312 Ga0395899_0088272 Ga0395899_0088272_41_1711 527
709 3300037418 Ga0395900_0032163 Ga0395900_0032163_3667_5361 527
710 3300037466 Ga0395898_0027247 Ga0395898_0027247_3206_4900 527
711 3300038735 Ga0400485_04221 Ga0400485_04221_22968_24659 527
712 3300038742 Ga0400486_29215 Ga0400486_29215_51450_53141 527
713 3300039437 Ga0436365_0269776 Ga0436365_0269776_685_2376 527
714 3300041411 Ga0439466_0015543 Ga0439466_0015543_252_1949 527
715 3300042002 Ga0439442_001772 Ga0439442_001772_1584_3281 527
716 3300044694 Ga0466963_0023881 Ga0466963_0023881_1787_3478 527
717 3300044765 Ga0466970_0039847 Ga0466970_0039847_474_2177 527
718 3300046459 Ga0495629_0006511 Ga0495629_0006511_2207_3913 527
719 3300046459 Ga0495629_0054628 Ga0495629_0054628_20_1732 527
720 3300046462 Ga0495651_0000950 Ga0495651_0000950_14466_16178 527
721 3300046463 Ga0495653_0019344 Ga0495653_0019344_3056_4768 527
722 3300046500 Ga0495596_0027897 Ga0495596_0027897_432_2147 527
723 3300046514 Ga0495618_0007289 Ga0495618_0007289_3429_5141 527
724 3300046536 Ga0495587_0000345 Ga0495587_0000345_17103_18815 527
725 3300046543 Ga0495645_0015832 Ga0495645_0015832_1192_2904 527
726 3300046678 Ga0495599_0000694 Ga0495599_0000694_11170_12882 527
727 3300047319 Ga0495674_0101419 Ga0495674_0101419_114_1820 527
728 3300047471 Ga0495684_0014181 Ga0495684_0014181_1670_3382 527
729 3300047673 Ga0495593_0010305 Ga0495593_0010305_2288_3994 527
730 3300048904 Ga0496101_0122493 Ga0496101_0122493_137_1834 527
731 3300048905 Ga0496102_0090280 Ga0496102_0090280_988_2694 527
732 3300048907 Ga0496104_0026568 Ga0496104_0026568_3396_5102 527
733 3300048911 Ga0496108_0005691 Ga0496108_0005691_7157_8863 527
734 3300049572 Ga0501036_0050785 Ga0501036_0050785_84_1760 527
735 3300049587 Ga0501071_0064774 Ga0501071_0064774_100_1776 527
736 3300049587 Ga0501071_0099626 Ga0501071_0099626_191_1867 527
737 3300049588 Ga0501072_0011366 Ga0501072_0011366_4453_6129 527
738 3300049588 Ga0501072_0037586 Ga0501072_0037586_493_2169 527
739 3300049590 Ga0501074_0048048 Ga0501074_0048048_925_2601 527
740 3300049590 Ga0501074_0056828 Ga0501074_0056828_282_1955 527
741 3300049591 Ga0501075_0006451 Ga0501075_0006451_2097_3773 527
742 3300049592 Ga0501076_0003785 Ga0501076_0003785_6634_8310 527
743 3300049592 Ga0501076_0046607 Ga0501076_0046607_306_1973 527
744 3300049741 Ga0501079_0047322 Ga0501079_0047322_74_1750 527
745 3300049824 Ga0501045_0005816 Ga0501045_0005816_6583_8259 527
746 3300050507 nmdc:mga05p37_13837_c1 nmdc:mga05p37_13837_c1_4923_6623 527
747 3300050507 nmdc:mga05p37_21425_c1 nmdc:mga05p37_21425_c1_40_1749 527
748 3300050509 nmdc:mga0qj67_21404_c1 nmdc:mga0qj67_21404_c1_1977_3713 527
749 3300050510 nmdc:mga06r32_154516_c1 nmdc:mga06r32_154516_c1_360_2060 527
750 3300054114 Ga0501084_0059362 Ga0501084_0059362_96_1802 527
751 3300060353 Ga0501082_0051802 Ga0501082_0051802_672_2348 527
752 3300005339 Ga0070660_100083828 Ga0070660_1000838281 528
753 3300005438 Ga0070701_10003882 Ga0070701_100038826 528
754 3300005457 Ga0070662_100072803 Ga0070662_1000728032 528
755 3300005544 Ga0070686_100043391 Ga0070686_1000433912 528
756 3300005615 Ga0070702_100015201 Ga0070702_1000152014 528
757 3300005615 Ga0070702_100031922 Ga0070702_1000319222 528
758 3300005617 Ga0068859_100083643 Ga0068859_1000836432 528
759 3300005842 Ga0068858_100062741 Ga0068858_1000627411 528
760 3300005843 Ga0068860_100125205 Ga0068860_1001252052 528
761 3300005985 Ga0081539_10008727 Ga0081539_100087279 528
762 3300006931 Ga0097620_100083646 Ga0097620_1000836462 528
763 3300009098 Ga0105245_10003604 Ga0105245_1000360412 528
764 3300009098 Ga0105245_10014855 Ga0105245_100148551 528
765 3300009148 Ga0105243_10036568 Ga0105243_100365682 528
766 3300009148 Ga0105243_10077905 Ga0105243_100779053 528
767 3300009553 Ga0105249_10041023 Ga0105249_100410233 528
768 3300009553 Ga0105249_10103066 Ga0105249_101030661 528
769 3300013308 Ga0157375_10142663 Ga0157375_101426632 528
770 3300014325 Ga0163163_10065692 Ga0163163_100656923 528
771 3300014745 Ga0157377_10010091 Ga0157377_100100913 528
772 3300017792 Ga0163161_10035175 Ga0163161_100351752 528
773 3300025901 Ga0207688_10013588 Ga0207688_100135881 528
774 3300025908 Ga0207643_10052124 Ga0207643_100521242 528
775 3300025918 Ga0207662_10020897 Ga0207662_100208972 528
776 3300025927 Ga0207687_10076834 Ga0207687_100768342 528
777 3300025933 Ga0207706_10014602 Ga0207706_100146021 528
778 3300025935 Ga0207709_10024884 Ga0207709_100248842 528
779 3300025942 Ga0207689_10077000 Ga0207689_100770003 528
780 3300025944 Ga0207661_10031948 Ga0207661_100319483 528
781 3300025961 Ga0207712_10089524 Ga0207712_100895241 528
782 3300025981 Ga0207640_10095710 Ga0207640_100957101 528
783 3300026035 Ga0207703_10096103 Ga0207703_100961031 528
784 3300026075 Ga0207708_10003064 Ga0207708_100030642 528
785 3300026075 Ga0207708_10023068 Ga0207708_100230683 528
786 3300048912 Ga0496109_0094620 Ga0496109_0094620_377_2098 528
787 3300048914 Ga0496111_0007741 Ga0496111_0007741_5225_6946 528
788 3300048916 Ga0496113_0053244 Ga0496113_0053244_878_2599 528
789 3300049569 Ga0501032_0019527 Ga0501032_0019527_2856_4532 528
790 3300049570 Ga0501033_0019272 Ga0501033_0019272_2248_3924 528
791 3300049572 Ga0501036_0123814 Ga0501036_0123814_461_2137 528
792 3300049578 Ga0501042_0033706 Ga0501042_0033706_1635_3311 528
793 3300049579 Ga0501043_0008879 Ga0501043_0008879_1941_3617 528
794 3300049580 Ga0501046_0003729 Ga0501046_0003729_9723_11399 528
795 3300049581 Ga0501047_0037176 Ga0501047_0037176_1091_2767 528
796 3300049582 Ga0501048_0016916 Ga0501048_0016916_2360_4036 528
797 3300049583 Ga0501067_0036155 Ga0501067_0036155_426_2102 528
798 3300049586 Ga0501070_0005087 Ga0501070_0005087_2854_4530 528
799 3300049589 Ga0501073_0005971 Ga0501073_0005971_2363_4039 528
800 3300049592 Ga0501076_0098255 Ga0501076_0098255_264_1940 528
801 3300049742 Ga0501080_0045989 Ga0501080_0045989_569_2245 528
802 3300049742 Ga0501080_0112681 Ga0501080_0112681_480_2156 528
803 3300049823 Ga0501044_0069444 Ga0501044_0069444_1342_3018 528
804 3300050513 nmdc:mga0rr50_62396_c1 nmdc:mga0rr50_62396_c1_355_2082 528
805 3300053153 Ga0500616_0000116 Ga0500616_0000116_29461_31158 528
806 3300060353 Ga0501082_0021996 Ga0501082_0021996_3585_5261 528
807 3300061734 Ga0530510_0011003 Ga0530510_0011003_1123_2811 528
808 3300006038 Ga0075365_10000949 Ga0075365_100009493 529
809 3300006038 Ga0075365_10022144 Ga0075365_100221443 529
810 3300050491 nmdc:mga00v17_75049_c1 nmdc:mga00v17_75049_c1_81_1799 530
811 3300050496 nmdc:mga07m45_62683_c1 nmdc:mga07m45_62683_c1_240_1958 530
812 3300046683 Ga0495658_0047831 Ga0495658_0047831_223_1896 532
813 3300025919 Ga0207657_10097186 Ga0207657_100971862 533
814 3300001979 JGI24740J21852_10030136 JGI24740J21852_100301361 535
815 3300005336 Ga0070680_100028450 Ga0070680_1000284502 535
816 3300005337 Ga0070682_100006888 Ga0070682_1000068882 535
817 3300005354 Ga0070675_100025862 Ga0070675_1000258623 535
818 3300005364 Ga0070673_100133716 Ga0070673_1001337161 535
819 3300005617 Ga0068859_100016083 Ga0068859_1000160835 535
820 3300005843 Ga0068860_100125179 Ga0068860_1001251792 535
821 3300005844 Ga0068862_100006418 Ga0068862_1000064184 535
822 3300006931 Ga0097620_100016083 Ga0097620_1000160835 535
823 3300009093 Ga0105240_10015116 Ga0105240_100151166 535
824 3300009545 Ga0105237_10017504 Ga0105237_100175045 535
825 3300010375 Ga0105239_10035997 Ga0105239_100359972 535
826 3300013104 Ga0157370_10053348 Ga0157370_100533482 535
827 3300013306 Ga0163162_10000494 Ga0163162_1000049411 535
828 3300014745 Ga0157377_10002124 Ga0157377_100021246 535
829 3300025911 Ga0207654_10025416 Ga0207654_100254162 535
830 3300025912 Ga0207707_10001291 Ga0207707_1000129121 535
831 3300025914 Ga0207671_10093013 Ga0207671_100930132 535
832 3300025923 Ga0207681_10047349 Ga0207681_100473492 535
833 3300025933 Ga0207706_10008590 Ga0207706_100085902 535
834 3300025960 Ga0207651_10033192 Ga0207651_100331922 535
835 3300025972 Ga0207668_10018510 Ga0207668_100185104 535
836 3300026118 Ga0207675_100010338 Ga0207675_1000103384 535
837 3300028380 Ga0268265_10003009 Ga0268265_100030096 535
838 3300028381 Ga0268264_10020902 Ga0268264_100209022 535

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00732

GMC_oxred_N

GMC oxidoreductase

9

305

0.99

PF05199

GMC_oxred_C

GMC oxidoreductase

395

529

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7r36-assembly1.cif.gz_A difference-refined structure of fatty acid photodecarboxylase 2 microsecond following 400-nm laser irradiation of the dark-state determined by sfx 0.9381 1 524
5oc1-assembly1.cif.gz_A crystal structure of aryl-alcohol oxidase from pleurotus eryngii in complex with p-anisic acid 0.9332 5 521
8bxl-assembly3.cif.gz_E patulin synthase from penicillium expansum 0.9322 3 521
3fim-assembly1.cif.gz_B crystal structure of aryl-alcohol-oxidase from pleurotus eryingii 0.9299 5 521
5zu3-assembly2.cif.gz_B effect of mutation (r554k) on fad modification in aspergillus oryzae rib40formate oxidase 0.9249 3 519
ID Description Score Start End Superfamily
af_Q2FV11_9_533_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9867 6 513 3.50.50.60
af_P17444_4_531_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9827 6 517 3.50.50.60
af_Q6UPE0_47_576_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9728 7 517 3.50.50.60
af_Q2FV11_9_533_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9531 6 513 3.50.50.60
af_P17444_4_531_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9514 6 517 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A7Y2DR00-F1-model_v4 Choline dehydrogenase (EC 1.1.99.1) 0.9925 64 531 GO:0008812
GO:0016020
GO:0019285
GO:0050660
AF-H0TAE6-F1-model_v4 Choline dehydrogenase, a flavoprotein alcohol dehydrogenase (EC 1.1.99.1) 0.9906 374 519 GO:0008812
GO:0050660
AF-A0A183AWR9-F1-model_v4 GMC_OxRdtase_N domain-containing protein 0.9868 115 255 GO:0005743
GO:0008812
GO:0050660
AF-A0A6B0CXT1-F1-model_v4 Choline dehydrogenase (EC 1.1.99.1) 0.9858 61 533 GO:0008812
GO:0016020
GO:0019285
GO:0050660
AF-A0A536W501-F1-model_v4 Choline dehydrogenase 0.985 374 519 GO:0016614
GO:0050660

Feature Viewer

pLDDT pTM Quality
92.53 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map