F482987
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 838 | 384 | 819 | 549 |
Family's Representative Sequence
| Representative Sequence | 3300031995|Ga0307409_100066755|Ga0307409_1000667552 |
| Length | 613 |
| Sequence | MAAGRARQYDFVIVGGGSAGCALANRLSADRSNRVLVLEAGRPDYRFDVFIHMPAALAYPIGSRFYDWQYESEPEPFMNGRRIYHARGKVLGGSSSINGMIFQRGNPLDYERWAADSGMETWDYAHCLPYFRRMEDCLAAEPDDPFRGHGGPLGLERGPATNPLFTAFFEATKEAGYPPTHDVNGYRQEGFAKFDRNIRRARRLSAARAYLHPVMKRPNLKVRTRTLVTRIIFEGTRAVGVEIERQGGGTETIRAGEVILAGGAIASPQILQLSGVGNAAELGAVGITPVVDVPGVGEHLQDHLEVYIQHRSTKPVSMQPALAHWRKPWIGFQWLFLRRGPGATNHFEGGGFVRSNDEVRYPNLMFHFLPLSIRYDGSGDKSGHGYQVHVGPMYSDARGSVKIVSTDPRRHPALRFNYLSTDQDRREWVEAIRVARRILGQPALAEFDGGETSPGASVETDEEILAWVARDAETALHPSCTTRMGTDAMSVLDPLTMRVHGVGGLRVVDAGSMPYVTNGNIYAPVMMLAEKAADLILDNTPLAPEPVEFYRHAATRAVSNVTTWRPRSGWGVPDRGRGASGEKGGSVIRAQATGAVAPAGVSQPSWGSTVPTR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 2 | 2565956521 | Vibrio rhizosphaerae DSM 18581 | Isolate | Rhizosphere |
| 3 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 4 | 2599185353 | Staphylococcus sp. NFPP34 | Isolate | Rhizoplane |
| 5 | 2600254943 | Staphylococcus pasteuri NFIX07 | Isolate | Rhizoplane |
| 6 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 7 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 8 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 9 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 10 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 11 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 12 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 13 | 2915358134 | Pseudonocardia pini CAP47R | Isolate | Unclassified |
| 14 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 15 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 16 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 17 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 73 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 75 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 76 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 78 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 79 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 82 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 83 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 84 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 85 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 86 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 87 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 88 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 89 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 90 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 117 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 119 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 120 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 169 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 173 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 174 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 175 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 176 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 177 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 178 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 179 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 180 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 181 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 182 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 183 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 184 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 185 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 186 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 187 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 188 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 189 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 190 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 191 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 192 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 193 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 194 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 195 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 196 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 197 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 198 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 199 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 200 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 201 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 202 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 203 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 204 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 205 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 206 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 207 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 208 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 209 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 210 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 211 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 212 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 213 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 214 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 215 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 216 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 217 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 218 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 219 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 220 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 221 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 222 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 223 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 224 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 225 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 226 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 227 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 228 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 229 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 230 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 231 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 232 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 233 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 234 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 235 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 236 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 237 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 238 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 239 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 240 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 241 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 242 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 243 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 244 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 245 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 246 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 247 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 248 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 249 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 250 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 301 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 303 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 304 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 305 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 306 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 307 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 308 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 309 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 310 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 311 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 312 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 313 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 314 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 315 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 316 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 317 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 318 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 319 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 320 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 321 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 322 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 323 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 356 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 357 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 358 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 366 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 370 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 371 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 372 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 373 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 374 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 375 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 376 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 378 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 380 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 381 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 382 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
| 383 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
| 384 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.85 |
| Metatranscriptomes | 0 |
| Isolates | 2.15 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.15 |
| Nodule | 0 |
| Rhizoplane | 7.88 |
| Rhizosphere | 84.25 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.73 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10030136 | 3300001979 | Bacteria | 1771 |
| 2 | JGI24744J21845_10002908 | 3300002077 | Bacteria | 3501 |
| 3 | JGI25407J50210_10000506 | 3300003373 | Bacteria | 7842 |
| 4 | JGI25407J50210_10005943 | 3300003373 | Bacteria | 3020 |
| 5 | Ga0070683_100122150 | 3300005329 | Bacteria | 2461 |
| 6 | Ga0070690_100004217 | 3300005330 | Bacteria | 7959 |
| 7 | Ga0070690_100048860 | 3300005330 | Bacteria | 2696 |
| 8 | Ga0070690_100061574 | 3300005330 | Bacteria | 2418 |
| 9 | Ga0070670_100045779 | 3300005331 | Bacteria | 3761 |
| 10 | Ga0070680_100028450 | 3300005336 | Bacteria | 4483 |
| 11 | Ga0070682_100006888 | 3300005337 | Bacteria | 6389 |
| 12 | Ga0068868_100002478 | 3300005338 | Bacteria | 12805 |
| 13 | Ga0070660_100083828 | 3300005339 | Bacteria | 2505 |
| 14 | Ga0070689_100014522 | 3300005340 | Bacteria | 5723 |
| 15 | Ga0070691_10004433 | 3300005341 | Bacteria | 6380 |
| 16 | Ga0070661_100026200 | 3300005344 | Bacteria | 4191 |
| 17 | Ga0070675_100025862 | 3300005354 | Bacteria | 4707 |
| 18 | Ga0070675_100028655 | 3300005354 | Bacteria | 4482 |
| 19 | Ga0070671_100000903 | 3300005355 | Bacteria | 21644 |
| 20 | Ga0070671_100015031 | 3300005355 | Bacteria | 6252 |
| 21 | Ga0070674_100004418 | 3300005356 | Bacteria | 8017 |
| 22 | Ga0070674_100027833 | 3300005356 | Bacteria | 3707 |
| 23 | Ga0070673_100133716 | 3300005364 | Unclassified | 2085 |
| 24 | Ga0070688_100018703 | 3300005365 | Bacteria | 4003 |
| 25 | Ga0070688_100031062 | 3300005365 | Bacteria | 3211 |
| 26 | Ga0070659_100010975 | 3300005366 | Bacteria | 6689 |
| 27 | Ga0070709_10003538 | 3300005434 | Bacteria | 8393 |
| 28 | Ga0070709_10008433 | 3300005434 | Bacteria | 5664 |
| 29 | Ga0070709_10059357 | 3300005434 | Bacteria | 2428 |
| 30 | Ga0070714_100000698 | 3300005435 | Bacteria | 23770 |
| 31 | Ga0070714_100001289 | 3300005435 | Bacteria | 18147 |
| 32 | Ga0070714_100002238 | 3300005435 | Bacteria | 14230 |
| 33 | Ga0070714_100004075 | 3300005435 | Bacteria | 10982 |
| 34 | Ga0070714_100084332 | 3300005435 | Bacteria | 2772 |
| 35 | Ga0070713_100002106 | 3300005436 | Bacteria | 12865 |
| 36 | Ga0070713_100121165 | 3300005436 | Bacteria | 2294 |
| 37 | Ga0070710_10000632 | 3300005437 | Bacteria | 16754 |
| 38 | Ga0070701_10003882 | 3300005438 | Bacteria | 5971 |
| 39 | Ga0070711_100000406 | 3300005439 | Bacteria | 22315 |
| 40 | Ga0070711_100004936 | 3300005439 | Bacteria | 7921 |
| 41 | Ga0070705_100002591 | 3300005440 | Bacteria | 9062 |
| 42 | Ga0070700_100017870 | 3300005441 | Bacteria | 4066 |
| 43 | Ga0070708_100003878 | 3300005445 | Bacteria | 11736 |
| 44 | Ga0070708_100045096 | 3300005445 | Bacteria | 3882 |
| 45 | Ga0070663_100002095 | 3300005455 | Bacteria | 11160 |
| 46 | Ga0070678_100003212 | 3300005456 | Bacteria | 9072 |
| 47 | Ga0070678_100068119 | 3300005456 | Bacteria | 2652 |
| 48 | Ga0070662_100072803 | 3300005457 | Bacteria | 2538 |
| 49 | Ga0068867_100009134 | 3300005459 | Bacteria | 6994 |
| 50 | Ga0068867_100009948 | 3300005459 | Bacteria | 6700 |
| 51 | Ga0070706_100000465 | 3300005467 | Bacteria | 48000 |
| 52 | Ga0070706_100047123 | 3300005467 | Bacteria | 3978 |
| 53 | Ga0070707_100001997 | 3300005468 | Bacteria | 19526 |
| 54 | Ga0070707_100002860 | 3300005468 | Bacteria | 16441 |
| 55 | Ga0070707_100009423 | 3300005468 | Bacteria | 9063 |
| 56 | Ga0070707_100019210 | 3300005468 | Bacteria | 6438 |
| 57 | Ga0070707_100020654 | 3300005468 | Bacteria | 6216 |
| 58 | Ga0070698_100000317 | 3300005471 | Bacteria | 49042 |
| 59 | Ga0070698_100008135 | 3300005471 | Bacteria | 11337 |
| 60 | Ga0070698_100050894 | 3300005471 | Bacteria | 4220 |
| 61 | Ga0070698_100059773 | 3300005471 | Bacteria | 3848 |
| 62 | Ga0070698_100060038 | 3300005471 | Bacteria | 3838 |
| 63 | Ga0070699_100006322 | 3300005518 | Bacteria | 10330 |
| 64 | Ga0070699_100017960 | 3300005518 | Bacteria | 6075 |
| 65 | Ga0070679_100086969 | 3300005530 | Bacteria | 3112 |
| 66 | Ga0070697_100055802 | 3300005536 | Bacteria | 3212 |
| 67 | Ga0070697_100089700 | 3300005536 | Bacteria | 2540 |
| 68 | Ga0070672_100015506 | 3300005543 | Bacteria | 5428 |
| 69 | Ga0070686_100043391 | 3300005544 | Bacteria | 2821 |
| 70 | Ga0070686_100057768 | 3300005544 | Bacteria | 2494 |
| 71 | Ga0070696_100018879 | 3300005546 | Bacteria | 4668 |
| 72 | Ga0070696_100067887 | 3300005546 | Bacteria | 2503 |
| 73 | Ga0070665_100008498 | 3300005548 | Bacteria | 10384 |
| 74 | Ga0070665_100040944 | 3300005548 | Bacteria | 4656 |
| 75 | Ga0070704_100060943 | 3300005549 | Bacteria | 2698 |
| 76 | Ga0070664_100067880 | 3300005564 | Bacteria | 3048 |
| 77 | Ga0068854_100003077 | 3300005578 | Bacteria | 10390 |
| 78 | Ga0068856_100014225 | 3300005614 | Bacteria | 7694 |
| 79 | Ga0070702_100015201 | 3300005615 | Bacteria | 3923 |
| 80 | Ga0070702_100031922 | 3300005615 | Bacteria | 2886 |
| 81 | Ga0070702_100042026 | 3300005615 | Bacteria | 2568 |
| 82 | Ga0068852_100024953 | 3300005616 | Bacteria | 4838 |
| 83 | Ga0068859_100016083 | 3300005617 | Bacteria | 7516 |
| 84 | Ga0068859_100083643 | 3300005617 | Bacteria | 3235 |
| 85 | Ga0068864_100036797 | 3300005618 | Bacteria | 4174 |
| 86 | Ga0068866_10004888 | 3300005718 | Bacteria | 5505 |
| 87 | Ga0068861_100030100 | 3300005719 | Bacteria | 3977 |
| 88 | Ga0068851_10044626 | 3300005834 | Bacteria | 2238 |
| 89 | Ga0068863_100003945 | 3300005841 | Bacteria | 14662 |
| 90 | Ga0068863_100023726 | 3300005841 | Bacteria | 5853 |
| 91 | Ga0068858_100005598 | 3300005842 | Bacteria | 12287 |
| 92 | Ga0068858_100046336 | 3300005842 | Bacteria | 4031 |
| 93 | Ga0068858_100062741 | 3300005842 | Bacteria | 3437 |
| 94 | Ga0068858_100176383 | 3300005842 | Bacteria | 2017 |
| 95 | Ga0068860_100019495 | 3300005843 | Bacteria | 6576 |
| 96 | Ga0068860_100125179 | 3300005843 | Bacteria | 2463 |
| 97 | Ga0068860_100125205 | 3300005843 | Bacteria | 2463 |
| 98 | Ga0068862_100006418 | 3300005844 | Bacteria | 9780 |
| 99 | Ga0068862_100019587 | 3300005844 | Bacteria | 5650 |
| 100 | Ga0081455_10006576 | 3300005937 | Bacteria | 12434 |
| 101 | Ga0081455_10028351 | 3300005937 | Bacteria | 5116 |
| 102 | Ga0081538_10001053 | 3300005981 | Bacteria | 29391 |
| 103 | Ga0081538_10007573 | 3300005981 | Bacteria | 9368 |
| 104 | Ga0081538_10028282 | 3300005981 | Bacteria | 3860 |
| 105 | Ga0081538_10048950 | 3300005981 | Bacteria | 2570 |
| 106 | Ga0081538_10050535 | 3300005981 | Bacteria | 2509 |
| 107 | Ga0081540_1000497 | 3300005983 | Bacteria | 38627 |
| 108 | Ga0081540_1001419 | 3300005983 | Bacteria | 20728 |
| 109 | Ga0081540_1023832 | 3300005983 | Bacteria | 3567 |
| 110 | Ga0081540_1054752 | 3300005983 | Bacteria | 1947 |
| 111 | Ga0081539_10004219 | 3300005985 | Bacteria | 16194 |
| 112 | Ga0081539_10004838 | 3300005985 | Bacteria | 14427 |
| 113 | Ga0081539_10005582 | 3300005985 | Bacteria | 12712 |
| 114 | Ga0081539_10008727 | 3300005985 | Bacteria | 8711 |
| 115 | Ga0081539_10016782 | 3300005985 | Bacteria | 5197 |
| 116 | Ga0070717_10001937 | 3300006028 | Bacteria | 14441 |
| 117 | Ga0070717_10005007 | 3300006028 | Bacteria | 9642 |
| 118 | Ga0070717_10026431 | 3300006028 | Bacteria | 4629 |
| 119 | Ga0075365_10000949 | 3300006038 | Bacteria | 12296 |
| 120 | Ga0075365_10022144 | 3300006038 | Bacteria | 3977 |
| 121 | Ga0075432_10011415 | 3300006058 | Bacteria | 3017 |
| 122 | Ga0075432_10016161 | 3300006058 | Bacteria | 2548 |
| 123 | Ga0070716_100001381 | 3300006173 | Bacteria | 10777 |
| 124 | Ga0070712_100001909 | 3300006175 | Bacteria | 12744 |
| 125 | Ga0070712_100001990 | 3300006175 | Bacteria | 12512 |
| 126 | Ga0070712_100042084 | 3300006175 | Bacteria | 3140 |
| 127 | Ga0075367_10008041 | 3300006178 | Bacteria | 5439 |
| 128 | Ga0075369_10005130 | 3300006186 | Bacteria | 4879 |
| 129 | Ga0075370_10044479 | 3300006353 | Bacteria | 2510 |
| 130 | Ga0068871_100017985 | 3300006358 | Bacteria | 5362 |
| 131 | Ga0068871_100021915 | 3300006358 | Bacteria | 4920 |
| 132 | Ga0075428_100018814 | 3300006844 | Bacteria | 7637 |
| 133 | Ga0075428_100051074 | 3300006844 | Bacteria | 4533 |
| 134 | Ga0075428_100063647 | 3300006844 | Bacteria | 4039 |
| 135 | Ga0075428_100073189 | 3300006844 | Bacteria | 3742 |
| 136 | Ga0075428_100099806 | 3300006844 | Bacteria | 3165 |
| 137 | Ga0075428_100247981 | 3300006844 | Bacteria | 1920 |
| 138 | Ga0075430_100013964 | 3300006846 | Bacteria | 6845 |
| 139 | Ga0075431_100131223 | 3300006847 | Bacteria | 2584 |
| 140 | Ga0075433_10007584 | 3300006852 | Bacteria | 8611 |
| 141 | Ga0075433_10066589 | 3300006852 | Bacteria | 3161 |
| 142 | Ga0075434_100015242 | 3300006871 | Bacteria | 7366 |
| 143 | Ga0075429_100012045 | 3300006880 | Bacteria | 7495 |
| 144 | Ga0068865_100000375 | 3300006881 | Bacteria | 24788 |
| 145 | Ga0075436_100004003 | 3300006914 | Bacteria | 10108 |
| 146 | Ga0097620_100016083 | 3300006931 | Bacteria | 7516 |
| 147 | Ga0097620_100083646 | 3300006931 | Bacteria | 3235 |
| 148 | Ga0105240_10015116 | 3300009093 | Bacteria | 10506 |
| 149 | Ga0111539_10007294 | 3300009094 | Bacteria | 14156 |
| 150 | Ga0111539_10011179 | 3300009094 | Bacteria | 11283 |
| 151 | Ga0111539_10024604 | 3300009094 | Bacteria | 7386 |
| 152 | Ga0111539_10035023 | 3300009094 | Bacteria | 6080 |
| 153 | Ga0111539_10125427 | 3300009094 | Bacteria | 3008 |
| 154 | Ga0105245_10001215 | 3300009098 | Bacteria | 23288 |
| 155 | Ga0105245_10003604 | 3300009098 | Bacteria | 13814 |
| 156 | Ga0105245_10014855 | 3300009098 | Bacteria | 6782 |
| 157 | Ga0105245_10036528 | 3300009098 | Bacteria | 4365 |
| 158 | Ga0105245_10065975 | 3300009098 | Bacteria | 3275 |
| 159 | Ga0114129_10001397 | 3300009147 | Bacteria | 32537 |
| 160 | Ga0114129_10004699 | 3300009147 | Bacteria | 19283 |
| 161 | Ga0114129_10006183 | 3300009147 | Bacteria | 16987 |
| 162 | Ga0114129_10008528 | 3300009147 | Bacteria | 14609 |
| 163 | Ga0114129_10012644 | 3300009147 | Bacteria | 12019 |
| 164 | Ga0114129_10066310 | 3300009147 | Bacteria | 5036 |
| 165 | Ga0114129_10068328 | 3300009147 | Bacteria | 4955 |
| 166 | Ga0105243_10001235 | 3300009148 | Bacteria | 23033 |
| 167 | Ga0105243_10007668 | 3300009148 | Bacteria | 8292 |
| 168 | Ga0105243_10036568 | 3300009148 | Bacteria | 3812 |
| 169 | Ga0105243_10077905 | 3300009148 | Bacteria | 2697 |
| 170 | Ga0105241_10019585 | 3300009174 | Bacteria | 4991 |
| 171 | Ga0105242_10001832 | 3300009176 | Bacteria | 16690 |
| 172 | Ga0105248_10068535 | 3300009177 | Bacteria | 3983 |
| 173 | Ga0105248_10191886 | 3300009177 | Bacteria | 2302 |
| 174 | Ga0105237_10017504 | 3300009545 | Bacteria | 7427 |
| 175 | Ga0105238_10136809 | 3300009551 | Bacteria | 2427 |
| 176 | Ga0105249_10002953 | 3300009553 | Bacteria | 14671 |
| 177 | Ga0105249_10041023 | 3300009553 | Bacteria | 4206 |
| 178 | Ga0105249_10100879 | 3300009553 | Bacteria | 2714 |
| 179 | Ga0105249_10103066 | 3300009553 | Bacteria | 2687 |
| 180 | Ga0105239_10009715 | 3300010375 | Bacteria | 10816 |
| 181 | Ga0105239_10035997 | 3300010375 | Bacteria | 5434 |
| 182 | Ga0105246_10010694 | 3300011119 | Bacteria | 5684 |
| 183 | Ga0157370_10053348 | 3300013104 | Bacteria | 3855 |
| 184 | Ga0157374_10014687 | 3300013296 | Bacteria | 6855 |
| 185 | Ga0157374_10127575 | 3300013296 | Bacteria | 2460 |
| 186 | Ga0157374_10179230 | 3300013296 | Bacteria | 2069 |
| 187 | Ga0157378_10001840 | 3300013297 | Bacteria | 19047 |
| 188 | Ga0157378_10008800 | 3300013297 | Bacteria | 8787 |
| 189 | Ga0163162_10000494 | 3300013306 | Bacteria | 36629 |
| 190 | Ga0157372_10075798 | 3300013307 | Bacteria | 3796 |
| 191 | Ga0157372_10104916 | 3300013307 | Bacteria | 3232 |
| 192 | Ga0157375_10008831 | 3300013308 | Bacteria | 8826 |
| 193 | Ga0157375_10029612 | 3300013308 | Bacteria | 5152 |
| 194 | Ga0157375_10142663 | 3300013308 | Bacteria | 2523 |
| 195 | Ga0157375_10175379 | 3300013308 | Bacteria | 2293 |
| 196 | Ga0163163_10007568 | 3300014325 | Bacteria | 9592 |
| 197 | Ga0163163_10021438 | 3300014325 | Bacteria | 6098 |
| 198 | Ga0163163_10065692 | 3300014325 | Bacteria | 3602 |
| 199 | Ga0163163_10074270 | 3300014325 | Bacteria | 3392 |
| 200 | Ga0163163_10146027 | 3300014325 | Bacteria | 2409 |
| 201 | Ga0157377_10002124 | 3300014745 | Bacteria | 8717 |
| 202 | Ga0157377_10010091 | 3300014745 | Bacteria | 4661 |
| 203 | Ga0157379_10006431 | 3300014968 | Bacteria | 10122 |
| 204 | Ga0157379_10008017 | 3300014968 | Bacteria | 9165 |
| 205 | Ga0157379_10014462 | 3300014968 | Bacteria | 6926 |
| 206 | Ga0157379_10018624 | 3300014968 | Bacteria | 6123 |
| 207 | Ga0157379_10111505 | 3300014968 | Bacteria | 2457 |
| 208 | Ga0183367_1003 | 3300015688 | Bacteria | 814276 |
| 209 | Ga0163161_10035175 | 3300017792 | Bacteria | 3585 |
| 210 | Ga0213876_10002282 | 3300021384 | Bacteria | 11313 |
| 211 | Ga0213876_10058644 | 3300021384 | Bacteria | 2032 |
| 212 | Ga0213875_10011690 | 3300021388 | Bacteria | 4359 |
| 213 | Ga0207692_10000452 | 3300025898 | Bacteria | 14540 |
| 214 | Ga0207692_10002895 | 3300025898 | Bacteria | 6647 |
| 215 | Ga0207642_10017626 | 3300025899 | Bacteria | 2721 |
| 216 | Ga0207642_10018821 | 3300025899 | Bacteria | 2660 |
| 217 | Ga0207688_10013588 | 3300025901 | Bacteria | 4426 |
| 218 | Ga0207688_10014132 | 3300025901 | Bacteria | 4343 |
| 219 | Ga0207685_10005361 | 3300025905 | Bacteria | 3378 |
| 220 | Ga0207699_10000483 | 3300025906 | Bacteria | 20176 |
| 221 | Ga0207645_10003459 | 3300025907 | Bacteria | 11981 |
| 222 | Ga0207645_10029832 | 3300025907 | Bacteria | 3515 |
| 223 | Ga0207643_10003535 | 3300025908 | Bacteria | 8410 |
| 224 | Ga0207643_10052124 | 3300025908 | Bacteria | 2323 |
| 225 | Ga0207684_10000514 | 3300025910 | Bacteria | 48078 |
| 226 | Ga0207684_10016825 | 3300025910 | Bacteria | 6278 |
| 227 | Ga0207654_10025416 | 3300025911 | Bacteria | 3195 |
| 228 | Ga0207707_10001291 | 3300025912 | Bacteria | 23352 |
| 229 | Ga0207671_10093013 | 3300025914 | Bacteria | 2274 |
| 230 | Ga0207693_10001043 | 3300025915 | Bacteria | 24769 |
| 231 | Ga0207693_10001547 | 3300025915 | Bacteria | 20327 |
| 232 | Ga0207693_10010139 | 3300025915 | Bacteria | 7654 |
| 233 | Ga0207693_10119372 | 3300025915 | Bacteria | 2071 |
| 234 | Ga0207662_10020897 | 3300025918 | Bacteria | 3737 |
| 235 | Ga0207662_10032228 | 3300025918 | Bacteria | 3049 |
| 236 | Ga0207657_10015512 | 3300025919 | Bacteria | 7379 |
| 237 | Ga0207657_10097186 | 3300025919 | Bacteria | 2449 |
| 238 | Ga0207646_10000129 | 3300025922 | Bacteria | 102411 |
| 239 | Ga0207646_10004171 | 3300025922 | Bacteria | 15853 |
| 240 | Ga0207646_10005395 | 3300025922 | Bacteria | 13449 |
| 241 | Ga0207646_10017861 | 3300025922 | Bacteria | 6625 |
| 242 | Ga0207681_10047349 | 3300025923 | Bacteria | 2896 |
| 243 | Ga0207681_10062876 | 3300025923 | Bacteria | 2558 |
| 244 | Ga0207659_10109988 | 3300025926 | Bacteria | 2093 |
| 245 | Ga0207687_10076834 | 3300025927 | Bacteria | 2400 |
| 246 | Ga0207700_10000175 | 3300025928 | Bacteria | 38523 |
| 247 | Ga0207700_10009976 | 3300025928 | Bacteria | 5966 |
| 248 | Ga0207700_10010122 | 3300025928 | Bacteria | 5930 |
| 249 | Ga0207700_10116515 | 3300025928 | Bacteria | 2159 |
| 250 | Ga0207664_10000254 | 3300025929 | Bacteria | 40157 |
| 251 | Ga0207664_10001718 | 3300025929 | Bacteria | 14423 |
| 252 | Ga0207664_10002051 | 3300025929 | Bacteria | 13269 |
| 253 | Ga0207664_10012653 | 3300025929 | Bacteria | 6036 |
| 254 | Ga0207664_10036714 | 3300025929 | Bacteria | 3787 |
| 255 | Ga0207664_10048060 | 3300025929 | Bacteria | 3354 |
| 256 | Ga0207644_10002738 | 3300025931 | Bacteria | 11352 |
| 257 | Ga0207644_10007437 | 3300025931 | Bacteria | 7141 |
| 258 | Ga0207706_10007704 | 3300025933 | Bacteria | 9942 |
| 259 | Ga0207706_10008035 | 3300025933 | Bacteria | 9737 |
| 260 | Ga0207706_10008590 | 3300025933 | Bacteria | 9410 |
| 261 | Ga0207706_10014602 | 3300025933 | Bacteria | 7113 |
| 262 | Ga0207709_10024884 | 3300025935 | Bacteria | 3424 |
| 263 | Ga0207669_10001964 | 3300025937 | Bacteria | 8718 |
| 264 | Ga0207669_10013429 | 3300025937 | Bacteria | 4067 |
| 265 | Ga0207669_10013760 | 3300025937 | Bacteria | 4033 |
| 266 | Ga0207669_10040474 | 3300025937 | Bacteria | 2704 |
| 267 | Ga0207704_10001568 | 3300025938 | Bacteria | 10248 |
| 268 | Ga0207704_10016428 | 3300025938 | Bacteria | 3804 |
| 269 | Ga0207665_10001164 | 3300025939 | Bacteria | 17674 |
| 270 | Ga0207665_10018547 | 3300025939 | Bacteria | 4570 |
| 271 | Ga0207691_10013938 | 3300025940 | Bacteria | 7670 |
| 272 | Ga0207691_10098945 | 3300025940 | Bacteria | 2605 |
| 273 | Ga0207689_10012298 | 3300025942 | Bacteria | 7324 |
| 274 | Ga0207689_10077000 | 3300025942 | Bacteria | 2742 |
| 275 | Ga0207661_10031948 | 3300025944 | Bacteria | 4073 |
| 276 | Ga0207679_10037788 | 3300025945 | Bacteria | 3435 |
| 277 | Ga0207651_10033192 | 3300025960 | Bacteria | 3326 |
| 278 | Ga0207712_10020248 | 3300025961 | Bacteria | 4355 |
| 279 | Ga0207712_10089524 | 3300025961 | Bacteria | 2263 |
| 280 | Ga0207668_10018510 | 3300025972 | Unclassified | 4386 |
| 281 | Ga0207640_10005102 | 3300025981 | Bacteria | 7139 |
| 282 | Ga0207640_10095710 | 3300025981 | Bacteria | 2068 |
| 283 | Ga0207658_10058603 | 3300025986 | Bacteria | 2866 |
| 284 | Ga0207677_10009676 | 3300026023 | Bacteria | 5429 |
| 285 | Ga0207677_10065235 | 3300026023 | Bacteria | 2540 |
| 286 | Ga0207703_10096103 | 3300026035 | Bacteria | 2501 |
| 287 | Ga0207678_10000785 | 3300026067 | Bacteria | 29030 |
| 288 | Ga0207708_10003064 | 3300026075 | Bacteria | 12311 |
| 289 | Ga0207708_10006612 | 3300026075 | Bacteria | 8580 |
| 290 | Ga0207708_10010618 | 3300026075 | Bacteria | 6838 |
| 291 | Ga0207708_10014167 | 3300026075 | Bacteria | 5961 |
| 292 | Ga0207708_10020237 | 3300026075 | Bacteria | 5018 |
| 293 | Ga0207708_10020421 | 3300026075 | Bacteria | 4997 |
| 294 | Ga0207708_10023068 | 3300026075 | Bacteria | 4701 |
| 295 | Ga0207708_10123887 | 3300026075 | Bacteria | 2016 |
| 296 | Ga0207702_10041502 | 3300026078 | Bacteria | 3859 |
| 297 | Ga0207641_10000855 | 3300026088 | Bacteria | 32290 |
| 298 | Ga0207641_10003504 | 3300026088 | Bacteria | 13892 |
| 299 | Ga0207648_10001438 | 3300026089 | Bacteria | 26210 |
| 300 | Ga0207648_10005064 | 3300026089 | Bacteria | 13362 |
| 301 | Ga0207676_10076934 | 3300026095 | Bacteria | 2698 |
| 302 | Ga0207676_10179998 | 3300026095 | Bacteria | 1850 |
| 303 | Ga0207674_10029446 | 3300026116 | Bacteria | 5780 |
| 304 | Ga0207675_100010338 | 3300026118 | Bacteria | 8746 |
| 305 | Ga0207675_100026000 | 3300026118 | Bacteria | 5448 |
| 306 | Ga0207675_100026454 | 3300026118 | Bacteria | 5401 |
| 307 | Ga0207675_100033823 | 3300026118 | Bacteria | 4763 |
| 308 | Ga0207675_100055493 | 3300026118 | Bacteria | 3696 |
| 309 | Ga0207683_10000829 | 3300026121 | Bacteria | 28292 |
| 310 | Ga0207683_10098091 | 3300026121 | Bacteria | 2614 |
| 311 | Ga0207683_10119508 | 3300026121 | Bacteria | 2365 |
| 312 | Ga0207683_10157822 | 3300026121 | Bacteria | 2049 |
| 313 | Ga0207698_10008461 | 3300026142 | Bacteria | 6511 |
| 314 | Ga0209971_1003082 | 3300027682 | Bacteria | 3979 |
| 315 | Ga0207428_10000479 | 3300027907 | Bacteria | 48258 |
| 316 | Ga0207428_10002318 | 3300027907 | Bacteria | 19059 |
| 317 | Ga0207428_10063239 | 3300027907 | Bacteria | 2924 |
| 318 | Ga0268266_10009794 | 3300028379 | Bacteria | 8430 |
| 319 | Ga0268266_10011782 | 3300028379 | Bacteria | 7582 |
| 320 | Ga0268266_10034951 | 3300028379 | Bacteria | 4275 |
| 321 | Ga0268265_10003009 | 3300028380 | Bacteria | 12311 |
| 322 | Ga0268265_10023176 | 3300028380 | Bacteria | 4373 |
| 323 | Ga0268264_10008529 | 3300028381 | Bacteria | 8519 |
| 324 | Ga0268264_10020902 | 3300028381 | Bacteria | 5347 |
| 325 | Ga0268264_10060150 | 3300028381 | Bacteria | 3184 |
| 326 | Ga0268264_10183701 | 3300028381 | Bacteria | 1901 |
| 327 | Ga0265337_1000333 | 3300028556 | Bacteria | 25123 |
| 328 | Ga0265319_1009164 | 3300028563 | Bacteria | 4244 |
| 329 | Ga0265319_1020020 | 3300028563 | Bacteria | 2488 |
| 330 | Ga0265334_10001755 | 3300028573 | Bacteria | 10365 |
| 331 | Ga0265334_10002151 | 3300028573 | Bacteria | 9278 |
| 332 | Ga0265334_10019876 | 3300028573 | Bacteria | 2756 |
| 333 | Ga0265318_10000251 | 3300028577 | Bacteria | 46650 |
| 334 | Ga0265323_10003405 | 3300028653 | Bacteria | 7030 |
| 335 | Ga0265336_10002602 | 3300028666 | Bacteria | 7363 |
| 336 | Ga0307515_10014050 | 3300028794 | Bacteria | 14895 |
| 337 | Ga0265338_10000457 | 3300028800 | Bacteria | 72848 |
| 338 | Ga0265338_10000956 | 3300028800 | Bacteria | 48667 |
| 339 | Ga0265338_10033814 | 3300028800 | Bacteria | 4954 |
| 340 | Ga0265338_10071040 | 3300028800 | Bacteria | 2981 |
| 341 | Ga0265324_10004705 | 3300029957 | Bacteria | 6058 |
| 342 | Ga0265324_10008566 | 3300029957 | Bacteria | 4058 |
| 343 | Ga0307511_10001274 | 3300030521 | Bacteria | 26705 |
| 344 | Ga0307511_10015850 | 3300030521 | Bacteria | 7285 |
| 345 | Ga0265330_10000873 | 3300031235 | Bacteria | 18828 |
| 346 | Ga0265320_10006834 | 3300031240 | Bacteria | 7148 |
| 347 | Ga0265320_10013270 | 3300031240 | Bacteria | 4745 |
| 348 | Ga0265325_10006532 | 3300031241 | Bacteria | 7073 |
| 349 | Ga0265325_10018232 | 3300031241 | Bacteria | 3892 |
| 350 | Ga0265325_10018618 | 3300031241 | Bacteria | 3851 |
| 351 | Ga0265329_10004447 | 3300031242 | Bacteria | 5824 |
| 352 | Ga0265340_10000078 | 3300031247 | Bacteria | 46872 |
| 353 | Ga0265340_10000733 | 3300031247 | Bacteria | 18632 |
| 354 | Ga0265340_10031769 | 3300031247 | Bacteria | 2639 |
| 355 | Ga0265339_10001224 | 3300031249 | Bacteria | 19295 |
| 356 | Ga0265316_10006833 | 3300031344 | Bacteria | 10841 |
| 357 | Ga0265316_10064553 | 3300031344 | Bacteria | 2836 |
| 358 | Ga0307513_10103500 | 3300031456 | Bacteria | 2863 |
| 359 | Ga0307509_10050248 | 3300031507 | Bacteria | 4465 |
| 360 | Ga0307509_10103837 | 3300031507 | Bacteria | 2869 |
| 361 | Ga0265313_10008095 | 3300031595 | Bacteria | 7037 |
| 362 | Ga0265313_10033973 | 3300031595 | Bacteria | 2585 |
| 363 | Ga0307508_10008110 | 3300031616 | Bacteria | 9738 |
| 364 | Ga0316579_10000086 | 3300031691 | Bacteria | 23939 |
| 365 | Ga0265314_10006206 | 3300031711 | Bacteria | 10615 |
| 366 | Ga0265314_10027558 | 3300031711 | Bacteria | 4253 |
| 367 | Ga0265342_10004595 | 3300031712 | Bacteria | 10772 |
| 368 | Ga0307516_10033431 | 3300031730 | Bacteria | 5174 |
| 369 | Ga0307518_10016097 | 3300031838 | Bacteria | 5356 |
| 370 | Ga0307406_10010429 | 3300031901 | Bacteria | 5239 |
| 371 | Ga0307406_10075309 | 3300031901 | Bacteria | 2226 |
| 372 | Ga0307409_100033750 | 3300031995 | Bacteria | 3728 |
| 373 | Ga0307409_100066755 | 3300031995 | Bacteria | 2838 |
| 374 | Ga0307416_100033472 | 3300032002 | Bacteria | 3896 |
| 375 | Ga0307416_100068330 | 3300032002 | Bacteria | 2936 |
| 376 | Ga0307416_100131868 | 3300032002 | Bacteria | 2251 |
| 377 | Ga0307414_10050944 | 3300032004 | Bacteria | 2871 |
| 378 | Ga0307415_100033745 | 3300032126 | Bacteria | 3324 |
| 379 | Ga0307415_100060467 | 3300032126 | Bacteria | 2618 |
| 380 | Ga0307507_10012829 | 3300033179 | Bacteria | 10281 |
| 381 | Ga0307507_10029090 | 3300033179 | Bacteria | 5868 |
| 382 | Ga0307510_10049577 | 3300033180 | Bacteria | 4464 |
| 383 | Ga0307510_10060675 | 3300033180 | Bacteria | 3888 |
| 384 | Ga0373926_0004470 | 3300035083 | Bacteria | 4586 |
| 385 | Ga0373926_0021691 | 3300035083 | Bacteria | 2224 |
| 386 | Ga0373944_0007068 | 3300035089 | Bacteria | 2999 |
| 387 | Ga0373932_0016335 | 3300035112 | Bacteria | 1894 |
| 388 | Ga0373945_0001574 | 3300035116 | Bacteria | 6987 |
| 389 | Ga0373953_0030098 | 3300035117 | Bacteria | 2103 |
| 390 | Ga0373956_0039452 | 3300035119 | Bacteria | 2093 |
| 391 | Ga0373943_0029801 | 3300035170 | Bacteria | 2579 |
| 392 | Ga0373946_0004588 | 3300035171 | Bacteria | 4950 |
| 393 | Ga0373955_0030234 | 3300035172 | Bacteria | 2825 |
| 394 | Ga0373924_0018278 | 3300035410 | Bacteria | 2698 |
| 395 | Ga0373927_0004175 | 3300035695 | Bacteria | 10152 |
| 396 | Ga0373933_0011345 | 3300035724 | Bacteria | 4908 |
| 397 | Ga0373947_0033495 | 3300035725 | Bacteria | 3033 |
| 398 | Ga0373947_0040116 | 3300035725 | Bacteria | 2788 |
| 399 | Ga0373937_0000758 | 3300036401 | Bacteria | 27855 |
| 400 | Ga0316584_0001021 | 3300036712 | Bacteria | 16185 |
| 401 | Ga0395899_0008636 | 3300037312 | Bacteria | 7838 |
| 402 | Ga0395899_0088272 | 3300037312 | Bacteria | 2250 |
| 403 | Ga0395900_0002757 | 3300037418 | Bacteria | 19197 |
| 404 | Ga0395900_0032163 | 3300037418 | Bacteria | 5394 |
| 405 | Ga0395898_0027247 | 3300037466 | Bacteria | 5739 |
| 406 | Ga0395905_0003288 | 3300037471 | Bacteria | 17363 |
| 407 | Ga0436364_0433954 | 3300037853 | Bacteria | 9412 |
| 408 | Ga0436364_0667900 | 3300037853 | Bacteria | 105608 |
| 409 | Ga0436364_1303368 | 3300037853 | Bacteria | 3783 |
| 410 | Ga0395901_0001240 | 3300038443 | Bacteria | 27243 |
| 411 | Ga0395901_0081927 | 3300038443 | Bacteria | 3371 |
| 412 | Ga0400485_04221 | 3300038735 | Bacteria | 54088 |
| 413 | Ga0400488_22792 | 3300038741 | Bacteria | 6610 |
| 414 | Ga0400486_21479 | 3300038742 | Bacteria | 1828 |
| 415 | Ga0400486_29215 | 3300038742 | Bacteria | 140932 |
| 416 | Ga0400483_126970 | 3300039062 | Bacteria | 6998 |
| 417 | Ga0400483_164544 | 3300039062 | Bacteria | 12959 |
| 418 | Ga0436365_0269776 | 3300039437 | Bacteria | 3610 |
| 419 | Ga0436365_0542570 | 3300039437 | Bacteria | 2423 |
| 420 | Ga0436365_0658475 | 3300039437 | Bacteria | 2033 |
| 421 | Ga0436365_1210809 | 3300039437 | Bacteria | 15025 |
| 422 | Ga0439466_0015543 | 3300041411 | Bacteria | 2764 |
| 423 | Ga0451853_3098222 | 3300041512 | Bacteria | 2406 |
| 424 | Ga0439442_001772 | 3300042002 | Bacteria | 4225 |
| 425 | Ga0439458_0008770 | 3300042157 | Bacteria | 2256 |
| 426 | Ga0466969_0000608 | 3300044656 | Bacteria | 19404 |
| 427 | Ga0466972_0005806 | 3300044658 | Bacteria | 6186 |
| 428 | Ga0466972_0007692 | 3300044658 | Bacteria | 5410 |
| 429 | Ga0466965_0002461 | 3300044683 | Bacteria | 7873 |
| 430 | Ga0466966_0056568 | 3300044684 | Bacteria | 2481 |
| 431 | Ga0466961_0065115 | 3300044693 | Bacteria | 2316 |
| 432 | Ga0466961_0123528 | 3300044693 | Bacteria | 1624 |
| 433 | Ga0466963_0000392 | 3300044694 | Bacteria | 19966 |
| 434 | Ga0466963_0002439 | 3300044694 | Bacteria | 10401 |
| 435 | Ga0466963_0023881 | 3300044694 | Bacteria | 3888 |
| 436 | Ga0466964_0007175 | 3300044706 | Bacteria | 4167 |
| 437 | Ga0453684_0122256 | 3300044712 | Bacteria | 3141 |
| 438 | Ga0466968_0001536 | 3300044735 | Bacteria | 8296 |
| 439 | Ga0466968_0020084 | 3300044735 | Bacteria | 2693 |
| 440 | Ga0466970_0039847 | 3300044765 | Bacteria | 2494 |
| 441 | Ga0466970_0052942 | 3300044765 | Bacteria | 2167 |
| 442 | Ga0466957_0000936 | 3300044842 | Bacteria | 14934 |
| 443 | Ga0466957_0017303 | 3300044842 | Bacteria | 4220 |
| 444 | Ga0466960_0002342 | 3300044901 | Bacteria | 7120 |
| 445 | Ga0466960_0009385 | 3300044901 | Bacteria | 4031 |
| 446 | Ga0466960_0016566 | 3300044901 | Bacteria | 3200 |
| 447 | Ga0466959_0011612 | 3300045049 | Bacteria | 6331 |
| 448 | Ga0466959_0018712 | 3300045049 | Bacteria | 5087 |
| 449 | Ga0466959_0137576 | 3300045049 | Bacteria | 1728 |
| 450 | Ga0466958_0005643 | 3300045836 | Bacteria | 6754 |
| 451 | Ga0466958_0018228 | 3300045836 | Bacteria | 4071 |
| 452 | Ga0466958_0036699 | 3300045836 | Bacteria | 2935 |
| 453 | Ga0466967_0008724 | 3300045976 | Bacteria | 7464 |
| 454 | Ga0466967_0033419 | 3300045976 | Bacteria | 4354 |
| 455 | Ga0466967_0035213 | 3300045976 | Bacteria | 4258 |
| 456 | Ga0466967_0037277 | 3300045976 | Bacteria | 4159 |
| 457 | Ga0466967_0054572 | 3300045976 | Bacteria | 3517 |
| 458 | Ga0466967_0138476 | 3300045976 | Bacteria | 2265 |
| 459 | Ga0495592_0030629 | 3300046454 | Bacteria | 4069 |
| 460 | Ga0495603_0012348 | 3300046455 | Bacteria | 5170 |
| 461 | Ga0495603_0026749 | 3300046455 | Bacteria | 3484 |
| 462 | Ga0495603_0056579 | 3300046455 | Bacteria | 2321 |
| 463 | Ga0495629_0006511 | 3300046459 | Bacteria | 8654 |
| 464 | Ga0495629_0014218 | 3300046459 | Bacteria | 5731 |
| 465 | Ga0495629_0039341 | 3300046459 | Bacteria | 3328 |
| 466 | Ga0495629_0054628 | 3300046459 | Bacteria | 2793 |
| 467 | Ga0495641_0002361 | 3300046461 | Bacteria | 14980 |
| 468 | Ga0495651_0000950 | 3300046462 | Bacteria | 22399 |
| 469 | Ga0495651_0007217 | 3300046462 | Bacteria | 8494 |
| 470 | Ga0495651_0096619 | 3300046462 | Bacteria | 2207 |
| 471 | Ga0495653_0019344 | 3300046463 | Bacteria | 5523 |
| 472 | Ga0495653_0045102 | 3300046463 | Bacteria | 3419 |
| 473 | Ga0495653_0046817 | 3300046463 | Bacteria | 3347 |
| 474 | Ga0495653_0067812 | 3300046463 | Bacteria | 2677 |
| 475 | Ga0495653_0083576 | 3300046463 | Bacteria | 2353 |
| 476 | Ga0495580_0029450 | 3300046472 | Bacteria | 3985 |
| 477 | Ga0495582_0008058 | 3300046473 | Bacteria | 5813 |
| 478 | Ga0495582_0023960 | 3300046473 | Bacteria | 3337 |
| 479 | Ga0495582_0028686 | 3300046473 | Bacteria | 3054 |
| 480 | Ga0495639_0000733 | 3300046475 | Bacteria | 15007 |
| 481 | Ga0495662_0000347 | 3300046476 | Bacteria | 20264 |
| 482 | Ga0495662_0013965 | 3300046476 | Bacteria | 3909 |
| 483 | Ga0495664_0000303 | 3300046477 | Bacteria | 23601 |
| 484 | Ga0495664_0001037 | 3300046477 | Bacteria | 14354 |
| 485 | Ga0495664_0064639 | 3300046477 | Bacteria | 2181 |
| 486 | Ga0495585_0039114 | 3300046492 | Bacteria | 2667 |
| 487 | Ga0495594_0027407 | 3300046499 | Bacteria | 3070 |
| 488 | Ga0495594_0028449 | 3300046499 | Bacteria | 3016 |
| 489 | Ga0495596_0027897 | 3300046500 | Bacteria | 2268 |
| 490 | Ga0495608_0003824 | 3300046511 | Bacteria | 10820 |
| 491 | Ga0495608_0019225 | 3300046511 | Bacteria | 4703 |
| 492 | Ga0495618_0007289 | 3300046514 | Bacteria | 6693 |
| 493 | Ga0495630_0013431 | 3300046517 | Bacteria | 5958 |
| 494 | Ga0495630_0030223 | 3300046517 | Bacteria | 4029 |
| 495 | Ga0495630_0034901 | 3300046517 | Bacteria | 3757 |
| 496 | Ga0495630_0098504 | 3300046517 | Bacteria | 2211 |
| 497 | Ga0495630_0127132 | 3300046517 | Bacteria | 1935 |
| 498 | Ga0495666_0021425 | 3300046526 | Bacteria | 3198 |
| 499 | Ga0495652_0022175 | 3300046529 | Bacteria | 5638 |
| 500 | Ga0495652_0076320 | 3300046529 | Bacteria | 2780 |
| 501 | Ga0495665_0002021 | 3300046531 | Bacteria | 10966 |
| 502 | Ga0495640_0013894 | 3300046533 | Bacteria | 6111 |
| 503 | Ga0495586_0019919 | 3300046535 | Bacteria | 3573 |
| 504 | Ga0495586_0042115 | 3300046535 | Bacteria | 2459 |
| 505 | Ga0495587_0000345 | 3300046536 | Bacteria | 33064 |
| 506 | Ga0495587_0025860 | 3300046536 | Bacteria | 3583 |
| 507 | Ga0495645_0015832 | 3300046543 | Bacteria | 5369 |
| 508 | Ga0495645_0072139 | 3300046543 | Bacteria | 2488 |
| 509 | Ga0495667_0015707 | 3300046559 | Bacteria | 5118 |
| 510 | Ga0495667_0017683 | 3300046559 | Bacteria | 4816 |
| 511 | Ga0495667_0022575 | 3300046559 | Bacteria | 4239 |
| 512 | Ga0495667_0038867 | 3300046559 | Bacteria | 3168 |
| 513 | Ga0495634_0022495 | 3300046642 | Bacteria | 4441 |
| 514 | Ga0495634_0039088 | 3300046642 | Bacteria | 3233 |
| 515 | Ga0495634_0064380 | 3300046642 | Bacteria | 2431 |
| 516 | Ga0495634_0092707 | 3300046642 | Bacteria | 1959 |
| 517 | Ga0495625_0004664 | 3300046660 | Bacteria | 12869 |
| 518 | Ga0495635_0001067 | 3300046663 | Bacteria | 18162 |
| 519 | Ga0495635_0008048 | 3300046663 | Bacteria | 7366 |
| 520 | Ga0495635_0009805 | 3300046663 | Bacteria | 6695 |
| 521 | Ga0495635_0013373 | 3300046663 | Bacteria | 5744 |
| 522 | Ga0495635_0036741 | 3300046663 | Bacteria | 3393 |
| 523 | Ga0495635_0069328 | 3300046663 | Bacteria | 2418 |
| 524 | Ga0495661_0035179 | 3300046665 | Bacteria | 3146 |
| 525 | Ga0495588_0008979 | 3300046674 | Bacteria | 4603 |
| 526 | Ga0495588_0037805 | 3300046674 | Bacteria | 2453 |
| 527 | Ga0495657_0001313 | 3300046675 | Bacteria | 21641 |
| 528 | Ga0495657_0004405 | 3300046675 | Bacteria | 11240 |
| 529 | Ga0495657_0006378 | 3300046675 | Bacteria | 9232 |
| 530 | Ga0495657_0041563 | 3300046675 | Bacteria | 3145 |
| 531 | Ga0495599_0000694 | 3300046678 | Bacteria | 19041 |
| 532 | Ga0495599_0015132 | 3300046678 | Bacteria | 4783 |
| 533 | Ga0495646_0025660 | 3300046680 | Bacteria | 3705 |
| 534 | Ga0495646_0048465 | 3300046680 | Bacteria | 2580 |
| 535 | Ga0495646_0074831 | 3300046680 | Bacteria | 1986 |
| 536 | Ga0495647_0018457 | 3300046681 | Bacteria | 2484 |
| 537 | Ga0495658_0002328 | 3300046683 | Bacteria | 9588 |
| 538 | Ga0495658_0035130 | 3300046683 | Bacteria | 2756 |
| 539 | Ga0495658_0047831 | 3300046683 | Bacteria | 2410 |
| 540 | Ga0495613_0001143 | 3300046689 | Bacteria | 20228 |
| 541 | Ga0495613_0070184 | 3300046689 | Bacteria | 2554 |
| 542 | Ga0495613_0096637 | 3300046689 | Bacteria | 2136 |
| 543 | Ga0495613_0179107 | 3300046689 | Bacteria | 1501 |
| 544 | Ga0495624_0005587 | 3300046690 | Bacteria | 9042 |
| 545 | Ga0495624_0104552 | 3300046690 | Bacteria | 1742 |
| 546 | Ga0495589_0072396 | 3300046794 | Bacteria | 1683 |
| 547 | Ga0495600_0007929 | 3300046809 | Bacteria | 6508 |
| 548 | Ga0495600_0012911 | 3300046809 | Bacteria | 5234 |
| 549 | Ga0495600_0074867 | 3300046809 | Bacteria | 2211 |
| 550 | Ga0495600_0089928 | 3300046809 | Bacteria | 2002 |
| 551 | Ga0495581_0003375 | 3300047315 | Bacteria | 9173 |
| 552 | Ga0495581_0015264 | 3300047315 | Bacteria | 4459 |
| 553 | Ga0495604_0001245 | 3300047317 | Bacteria | 20863 |
| 554 | Ga0495604_0003847 | 3300047317 | Bacteria | 11959 |
| 555 | Ga0495604_0011912 | 3300047317 | Bacteria | 6916 |
| 556 | Ga0495604_0104871 | 3300047317 | Bacteria | 2070 |
| 557 | Ga0495604_0124074 | 3300047317 | Bacteria | 1865 |
| 558 | Ga0495674_0006495 | 3300047319 | Bacteria | 11215 |
| 559 | Ga0495674_0044931 | 3300047319 | Bacteria | 3925 |
| 560 | Ga0495674_0074318 | 3300047319 | Bacteria | 2928 |
| 561 | Ga0495674_0101419 | 3300047319 | Bacteria | 2448 |
| 562 | Ga0495674_0115650 | 3300047319 | Bacteria | 2270 |
| 563 | Ga0495676_0022869 | 3300047321 | Bacteria | 5432 |
| 564 | Ga0495680_0015800 | 3300047322 | Bacteria | 6498 |
| 565 | Ga0495680_0021408 | 3300047322 | Bacteria | 5413 |
| 566 | Ga0495680_0054812 | 3300047322 | Bacteria | 3094 |
| 567 | Ga0495687_004554 | 3300047443 | Bacteria | 9299 |
| 568 | Ga0495681_0011848 | 3300047470 | Bacteria | 5159 |
| 569 | Ga0495684_0014181 | 3300047471 | Bacteria | 6131 |
| 570 | Ga0495684_0017936 | 3300047471 | Bacteria | 5452 |
| 571 | Ga0495686_0128754 | 3300047472 | Bacteria | 1502 |
| 572 | Ga0495593_0003591 | 3300047673 | Bacteria | 9268 |
| 573 | Ga0495593_0010305 | 3300047673 | Bacteria | 5403 |
| 574 | Ga0495593_0014442 | 3300047673 | Bacteria | 4489 |
| 575 | Ga0495593_0049227 | 3300047673 | Bacteria | 2237 |
| 576 | Ga0495602_0021341 | 3300048088 | Bacteria | 6378 |
| 577 | Ga0495602_0049002 | 3300048088 | Bacteria | 3788 |
| 578 | Ga0496100_0000191 | 3300048903 | Bacteria | 34073 |
| 579 | Ga0496100_0035465 | 3300048903 | Bacteria | 3137 |
| 580 | Ga0496101_0001168 | 3300048904 | Bacteria | 15708 |
| 581 | Ga0496101_0005663 | 3300048904 | Bacteria | 7970 |
| 582 | Ga0496101_0050691 | 3300048904 | Bacteria | 2989 |
| 583 | Ga0496101_0122493 | 3300048904 | Bacteria | 1967 |
| 584 | Ga0496102_0000046 | 3300048905 | Bacteria | 184899 |
| 585 | Ga0496102_0005921 | 3300048905 | Bacteria | 10411 |
| 586 | Ga0496102_0022609 | 3300048905 | Bacteria | 5572 |
| 587 | Ga0496102_0029801 | 3300048905 | Bacteria | 4883 |
| 588 | Ga0496102_0044821 | 3300048905 | Bacteria | 4014 |
| 589 | Ga0496102_0090280 | 3300048905 | Bacteria | 2835 |
| 590 | Ga0496102_0201370 | 3300048905 | Bacteria | 1877 |
| 591 | Ga0496103_0000011 | 3300048906 | Bacteria | 304506 |
| 592 | Ga0496103_0013712 | 3300048906 | Bacteria | 4809 |
| 593 | Ga0496104_0007997 | 3300048907 | Bacteria | 9375 |
| 594 | Ga0496104_0008921 | 3300048907 | Bacteria | 8911 |
| 595 | Ga0496104_0015678 | 3300048907 | Bacteria | 6872 |
| 596 | Ga0496104_0017596 | 3300048907 | Bacteria | 6512 |
| 597 | Ga0496104_0018432 | 3300048907 | Bacteria | 6367 |
| 598 | Ga0496104_0026568 | 3300048907 | Bacteria | 5349 |
| 599 | Ga0496104_0040751 | 3300048907 | Bacteria | 4354 |
| 600 | Ga0496104_0092219 | 3300048907 | Bacteria | 2896 |
| 601 | Ga0496105_0003832 | 3300048908 | Bacteria | 11220 |
| 602 | Ga0496105_0046616 | 3300048908 | Bacteria | 3578 |
| 603 | Ga0496105_0085986 | 3300048908 | Bacteria | 2599 |
| 604 | Ga0496106_0004991 | 3300048909 | Bacteria | 9820 |
| 605 | Ga0496106_0050790 | 3300048909 | Bacteria | 3126 |
| 606 | Ga0496106_0118121 | 3300048909 | Bacteria | 2070 |
| 607 | Ga0496107_0009722 | 3300048910 | Bacteria | 6669 |
| 608 | Ga0496107_0049444 | 3300048910 | Bacteria | 3030 |
| 609 | Ga0496108_0005691 | 3300048911 | Bacteria | 10088 |
| 610 | Ga0496108_0009029 | 3300048911 | Bacteria | 8077 |
| 611 | Ga0496108_0015621 | 3300048911 | Bacteria | 6193 |
| 612 | Ga0496108_0018664 | 3300048911 | Bacteria | 5683 |
| 613 | Ga0496108_0019797 | 3300048911 | Bacteria | 5529 |
| 614 | Ga0496108_0121974 | 3300048911 | Bacteria | 2236 |
| 615 | Ga0496108_0197530 | 3300048911 | Bacteria | 1745 |
| 616 | Ga0496108_0211082 | 3300048911 | Bacteria | 1685 |
| 617 | Ga0496109_0008259 | 3300048912 | Bacteria | 8841 |
| 618 | Ga0496109_0010930 | 3300048912 | Bacteria | 7777 |
| 619 | Ga0496109_0030042 | 3300048912 | Bacteria | 4870 |
| 620 | Ga0496109_0036432 | 3300048912 | Bacteria | 4440 |
| 621 | Ga0496109_0085764 | 3300048912 | Bacteria | 2907 |
| 622 | Ga0496109_0094620 | 3300048912 | Bacteria | 2765 |
| 623 | Ga0496110_0004537 | 3300048913 | Bacteria | 10778 |
| 624 | Ga0496110_0016480 | 3300048913 | Bacteria | 6172 |
| 625 | Ga0496110_0023113 | 3300048913 | Bacteria | 5287 |
| 626 | Ga0496110_0065705 | 3300048913 | Bacteria | 3208 |
| 627 | Ga0496110_0073023 | 3300048913 | Bacteria | 3045 |
| 628 | Ga0496110_0244438 | 3300048913 | Bacteria | 1633 |
| 629 | Ga0496111_0007741 | 3300048914 | Bacteria | 7068 |
| 630 | Ga0496111_0086388 | 3300048914 | Bacteria | 2295 |
| 631 | Ga0496112_0000001 | 3300048915 | Bacteria | 1346031 |
| 632 | Ga0496112_0011769 | 3300048915 | Bacteria | 8011 |
| 633 | Ga0496112_0099267 | 3300048915 | Bacteria | 2881 |
| 634 | Ga0496113_0028175 | 3300048916 | Bacteria | 4037 |
| 635 | Ga0496113_0046370 | 3300048916 | Bacteria | 3226 |
| 636 | Ga0496113_0053244 | 3300048916 | Bacteria | 3026 |
| 637 | Ga0496114_0002035 | 3300048917 | Bacteria | 15389 |
| 638 | Ga0496114_0033573 | 3300048917 | Bacteria | 4229 |
| 639 | Ga0496114_0060739 | 3300048917 | Bacteria | 3159 |
| 640 | Ga0496115_0003896 | 3300048918 | Bacteria | 10751 |
| 641 | Ga0496115_0008417 | 3300048918 | Bacteria | 7632 |
| 642 | Ga0496116_0000328 | 3300048919 | Bacteria | 76892 |
| 643 | Ga0496117_0000109 | 3300048920 | Bacteria | 184635 |
| 644 | Ga0496118_0000132 | 3300048921 | Bacteria | 131401 |
| 645 | Ga0496119_0001399 | 3300048922 | Bacteria | 29247 |
| 646 | Ga0496121_0007631 | 3300048924 | Bacteria | 13001 |
| 647 | Ga0496124_0032677 | 3300048927 | Bacteria | 4589 |
| 648 | Ga0496126_0000345 | 3300048929 | Bacteria | 97255 |
| 649 | Ga0501031_0015248 | 3300049568 | Bacteria | 4990 |
| 650 | Ga0501032_0012338 | 3300049569 | Bacteria | 6109 |
| 651 | Ga0501032_0019527 | 3300049569 | Bacteria | 4740 |
| 652 | Ga0501032_0026363 | 3300049569 | Bacteria | 3998 |
| 653 | Ga0501032_0083472 | 3300049569 | Bacteria | 2125 |
| 654 | Ga0501033_0019272 | 3300049570 | Bacteria | 5156 |
| 655 | Ga0501033_0019493 | 3300049570 | Bacteria | 5128 |
| 656 | Ga0501034_0074058 | 3300049571 | Bacteria | 3414 |
| 657 | Ga0501034_0167845 | 3300049571 | Bacteria | 2163 |
| 658 | Ga0501034_0233664 | 3300049571 | Bacteria | 1787 |
| 659 | Ga0501036_0030166 | 3300049572 | Bacteria | 4581 |
| 660 | Ga0501036_0050785 | 3300049572 | Bacteria | 3512 |
| 661 | Ga0501036_0123814 | 3300049572 | Bacteria | 2183 |
| 662 | Ga0501036_0150937 | 3300049572 | Bacteria | 1960 |
| 663 | Ga0501038_0017754 | 3300049574 | Bacteria | 6431 |
| 664 | Ga0501038_0072031 | 3300049574 | Bacteria | 2929 |
| 665 | Ga0501038_0133099 | 3300049574 | Bacteria | 2039 |
| 666 | Ga0501039_0025403 | 3300049575 | Bacteria | 4551 |
| 667 | Ga0501039_0048018 | 3300049575 | Bacteria | 3299 |
| 668 | Ga0501039_0085814 | 3300049575 | Bacteria | 2452 |
| 669 | Ga0501040_0006932 | 3300049576 | Bacteria | 7336 |
| 670 | Ga0501040_0006995 | 3300049576 | Bacteria | 7309 |
| 671 | Ga0501040_0010049 | 3300049576 | Bacteria | 6180 |
| 672 | Ga0501040_0023090 | 3300049576 | Bacteria | 4169 |
| 673 | Ga0501040_0080299 | 3300049576 | Bacteria | 2259 |
| 674 | Ga0501040_0099548 | 3300049576 | Bacteria | 2027 |
| 675 | Ga0501041_0001057 | 3300049577 | Bacteria | 15059 |
| 676 | Ga0501041_0023558 | 3300049577 | Bacteria | 3691 |
| 677 | Ga0501041_0054318 | 3300049577 | Bacteria | 2444 |
| 678 | Ga0501041_0072344 | 3300049577 | Bacteria | 2118 |
| 679 | Ga0501042_0006956 | 3300049578 | Bacteria | 7384 |
| 680 | Ga0501042_0033706 | 3300049578 | Bacteria | 3631 |
| 681 | Ga0501042_0035034 | 3300049578 | Bacteria | 3561 |
| 682 | Ga0501042_0040422 | 3300049578 | Bacteria | 3316 |
| 683 | Ga0501042_0049128 | 3300049578 | Bacteria | 3009 |
| 684 | Ga0501042_0099081 | 3300049578 | Bacteria | 2095 |
| 685 | Ga0501043_0005321 | 3300049579 | Bacteria | 10403 |
| 686 | Ga0501043_0008879 | 3300049579 | Bacteria | 7909 |
| 687 | Ga0501043_0022479 | 3300049579 | Bacteria | 4944 |
| 688 | Ga0501046_0003729 | 3300049580 | Bacteria | 13948 |
| 689 | Ga0501046_0006046 | 3300049580 | Bacteria | 10768 |
| 690 | Ga0501046_0023391 | 3300049580 | Bacteria | 5085 |
| 691 | Ga0501047_0037176 | 3300049581 | Bacteria | 4707 |
| 692 | Ga0501048_0013979 | 3300049582 | Bacteria | 5950 |
| 693 | Ga0501048_0016916 | 3300049582 | Bacteria | 5376 |
| 694 | Ga0501048_0108819 | 3300049582 | Bacteria | 1957 |
| 695 | Ga0501067_0004408 | 3300049583 | Bacteria | 7762 |
| 696 | Ga0501067_0006119 | 3300049583 | Bacteria | 6672 |
| 697 | Ga0501067_0036155 | 3300049583 | Bacteria | 2743 |
| 698 | Ga0501068_0005364 | 3300049584 | Bacteria | 7008 |
| 699 | Ga0501068_0012307 | 3300049584 | Bacteria | 4844 |
| 700 | Ga0501068_0013175 | 3300049584 | Bacteria | 4702 |
| 701 | Ga0501068_0018379 | 3300049584 | Bacteria | 4049 |
| 702 | Ga0501068_0019749 | 3300049584 | Bacteria | 3917 |
| 703 | Ga0501069_0001443 | 3300049585 | Bacteria | 11670 |
| 704 | Ga0501069_0007943 | 3300049585 | Bacteria | 5570 |
| 705 | Ga0501069_0098137 | 3300049585 | Bacteria | 1661 |
| 706 | Ga0501070_0005012 | 3300049586 | Bacteria | 11298 |
| 707 | Ga0501070_0005087 | 3300049586 | Bacteria | 11205 |
| 708 | Ga0501071_0007051 | 3300049587 | Bacteria | 7344 |
| 709 | Ga0501071_0055272 | 3300049587 | Bacteria | 2866 |
| 710 | Ga0501071_0055437 | 3300049587 | Bacteria | 2861 |
| 711 | Ga0501071_0055776 | 3300049587 | Bacteria | 2853 |
| 712 | Ga0501071_0064774 | 3300049587 | Bacteria | 2652 |
| 713 | Ga0501071_0099626 | 3300049587 | Bacteria | 2141 |
| 714 | Ga0501072_0001813 | 3300049588 | Bacteria | 15907 |
| 715 | Ga0501072_0003167 | 3300049588 | Bacteria | 12382 |
| 716 | Ga0501072_0011366 | 3300049588 | Bacteria | 6804 |
| 717 | Ga0501072_0037586 | 3300049588 | Bacteria | 3797 |
| 718 | Ga0501072_0115812 | 3300049588 | Bacteria | 2134 |
| 719 | Ga0501073_0005971 | 3300049589 | Bacteria | 9085 |
| 720 | Ga0501073_0009990 | 3300049589 | Bacteria | 6981 |
| 721 | Ga0501074_0004289 | 3300049590 | Bacteria | 10181 |
| 722 | Ga0501074_0042826 | 3300049590 | Bacteria | 3275 |
| 723 | Ga0501074_0048048 | 3300049590 | Bacteria | 3083 |
| 724 | Ga0501074_0056828 | 3300049590 | Bacteria | 2820 |
| 725 | Ga0501074_0067950 | 3300049590 | Bacteria | 2562 |
| 726 | Ga0501074_0075051 | 3300049590 | Bacteria | 2427 |
| 727 | Ga0501075_0006451 | 3300049591 | Bacteria | 8074 |
| 728 | Ga0501075_0008537 | 3300049591 | Bacteria | 7140 |
| 729 | Ga0501075_0012788 | 3300049591 | Bacteria | 5973 |
| 730 | Ga0501075_0028112 | 3300049591 | Bacteria | 4148 |
| 731 | Ga0501075_0115973 | 3300049591 | Bacteria | 2036 |
| 732 | Ga0501076_0003449 | 3300049592 | Bacteria | 11091 |
| 733 | Ga0501076_0003785 | 3300049592 | Bacteria | 10652 |
| 734 | Ga0501076_0025140 | 3300049592 | Bacteria | 4606 |
| 735 | Ga0501076_0046607 | 3300049592 | Bacteria | 3426 |
| 736 | Ga0501076_0098255 | 3300049592 | Bacteria | 2358 |
| 737 | Ga0501077_0007458 | 3300049593 | Bacteria | 6748 |
| 738 | Ga0501077_0035599 | 3300049593 | Bacteria | 3169 |
| 739 | Ga0501077_0110492 | 3300049593 | Bacteria | 1742 |
| 740 | Ga0501079_0047322 | 3300049741 | Bacteria | 3318 |
| 741 | Ga0501079_0064175 | 3300049741 | Bacteria | 2833 |
| 742 | Ga0501079_0067731 | 3300049741 | Bacteria | 2755 |
| 743 | Ga0501079_0069935 | 3300049741 | Bacteria | 2709 |
| 744 | Ga0501079_0086456 | 3300049741 | Bacteria | 2427 |
| 745 | Ga0501079_0112909 | 3300049741 | Bacteria | 2112 |
| 746 | Ga0501080_0045989 | 3300049742 | Bacteria | 4065 |
| 747 | Ga0501080_0050432 | 3300049742 | Bacteria | 3873 |
| 748 | Ga0501080_0073319 | 3300049742 | Bacteria | 3185 |
| 749 | Ga0501080_0112681 | 3300049742 | Bacteria | 2522 |
| 750 | Ga0501080_0140453 | 3300049742 | Bacteria | 2233 |
| 751 | Ga0501081_0009027 | 3300049743 | Bacteria | 6482 |
| 752 | Ga0501081_0021138 | 3300049743 | Bacteria | 4342 |
| 753 | Ga0501083_0009973 | 3300049744 | Bacteria | 6702 |
| 754 | Ga0501083_0084544 | 3300049744 | Bacteria | 2101 |
| 755 | Ga0501035_0011103 | 3300049822 | Bacteria | 8340 |
| 756 | Ga0501035_0105190 | 3300049822 | Bacteria | 2475 |
| 757 | Ga0501044_0069444 | 3300049823 | Bacteria | 3586 |
| 758 | Ga0501044_0134802 | 3300049823 | Bacteria | 2461 |
| 759 | Ga0501045_0005816 | 3300049824 | Bacteria | 8537 |
| 760 | Ga0501045_0008101 | 3300049824 | Bacteria | 7317 |
| 761 | Ga0501045_0012189 | 3300049824 | Bacteria | 6053 |
| 762 | Ga0501045_0018554 | 3300049824 | Bacteria | 4949 |
| 763 | nmdc:mga03n38_9379_c1 | 3300050490 | Bacteria | 3559 |
| 764 | nmdc:mga00v17_2906_c1 | 3300050491 | Bacteria | 8786 |
| 765 | nmdc:mga00v17_75049_c1 | 3300050491 | Bacteria | 2102 |
| 766 | nmdc:mga07m45_62683_c1 | 3300050496 | Bacteria | 2107 |
| 767 | nmdc:mga05p37_109354_c1 | 3300050507 | Bacteria | 3401 |
| 768 | nmdc:mga05p37_13837_c1 | 3300050507 | Bacteria | 9667 |
| 769 | nmdc:mga05p37_14857_c1 | 3300050507 | Bacteria | 9352 |
| 770 | nmdc:mga05p37_19768_c1 | 3300050507 | Bacteria | 8148 |
| 771 | nmdc:mga05p37_21425_c1 | 3300050507 | Bacteria | 7829 |
| 772 | nmdc:mga05p37_232554_c1 | 3300050507 | Bacteria | 2220 |
| 773 | nmdc:mga05p37_30168_c1 | 3300050507 | Bacteria | 6616 |
| 774 | nmdc:mga05p37_3241_c1 | 3300050507 | Bacteria | 18962 |
| 775 | nmdc:mga0qj67_21147_c1 | 3300050509 | Bacteria | 4990 |
| 776 | nmdc:mga0qj67_21404_c1 | 3300050509 | Bacteria | 4961 |
| 777 | nmdc:mga06r32_154516_c1 | 3300050510 | Bacteria | 2275 |
| 778 | nmdc:mga08y16_103422_c1 | 3300050511 | Bacteria | 2966 |
| 779 | nmdc:mga08y16_184773_c1 | 3300050511 | Bacteria | 2164 |
| 780 | nmdc:mga08y16_19707_c1 | 3300050511 | Bacteria | 7111 |
| 781 | nmdc:mga08y16_31657_c1 | 3300050511 | Bacteria | 5561 |
| 782 | nmdc:mga08y16_43231_c1 | 3300050511 | Bacteria | 4721 |
| 783 | nmdc:mga08y16_5124_c1 | 3300050511 | Bacteria | 13695 |
| 784 | nmdc:mga0n895_16661_c1 | 3300050512 | Bacteria | 6750 |
| 785 | nmdc:mga0n895_24304_c1 | 3300050512 | Bacteria | 5708 |
| 786 | nmdc:mga0rr50_62396_c1 | 3300050513 | Bacteria | 2811 |
| 787 | nmdc:mga0a205_225981_c1 | 3300050515 | Bacteria | 1756 |
| 788 | nmdc:mga0a205_27287_c1 | 3300050515 | Bacteria | 5453 |
| 789 | nmdc:mga0a205_90017_c1 | 3300050515 | Bacteria | 2966 |
| 790 | nmdc:mga0sz30_888_c1 | 3300050516 | Bacteria | 10776 |
| 791 | Ga0495601_0030555 | 3300053077 | Bacteria | 3345 |
| 792 | Ga0495612_0000045 | 3300053078 | Bacteria | 60489 |
| 793 | Ga0495612_0004734 | 3300053078 | Bacteria | 5632 |
| 794 | Ga0495612_0011410 | 3300053078 | Bacteria | 3582 |
| 795 | Ga0495619_0008129 | 3300053085 | Bacteria | 6640 |
| 796 | Ga0495619_0048434 | 3300053085 | Bacteria | 2800 |
| 797 | Ga0500644_0017802 | 3300053088 | Bacteria | 2070 |
| 798 | Ga0500646_0000089 | 3300053090 | Bacteria | 25903 |
| 799 | Ga0500583_0052625 | 3300053092 | Bacteria | 1895 |
| 800 | Ga0500608_060318 | 3300053122 | Bacteria | 1814 |
| 801 | Ga0500588_0002793 | 3300053146 | Bacteria | 3609 |
| 802 | Ga0500603_008820 | 3300053150 | Bacteria | 2248 |
| 803 | Ga0500616_0000116 | 3300053153 | Bacteria | 145790 |
| 804 | Ga0501084_0005964 | 3300054114 | Bacteria | 10029 |
| 805 | Ga0501084_0022217 | 3300054114 | Bacteria | 5294 |
| 806 | Ga0501084_0059362 | 3300054114 | Bacteria | 3202 |
| 807 | Ga0501084_0072999 | 3300054114 | Bacteria | 2873 |
| 808 | Ga0590074_000702 | 3300059423 | Bacteria | 5102 |
| 809 | Ga0501082_0006285 | 3300060353 | Bacteria | 10302 |
| 810 | Ga0501082_0013204 | 3300060353 | Bacteria | 7103 |
| 811 | Ga0501082_0021996 | 3300060353 | Bacteria | 5498 |
| 812 | Ga0501082_0051802 | 3300060353 | Bacteria | 3538 |
| 813 | Ga0501082_0115399 | 3300060353 | Bacteria | 2326 |
| 814 | Ga0501082_0122215 | 3300060353 | Bacteria | 2257 |
| 815 | Ga0466962_0002813 | 3300061719 | Bacteria | 8283 |
| 816 | Ga0530510_0011003 | 3300061734 | Bacteria | 6346 |
| 817 | Ga0530510_0030015 | 3300061734 | Bacteria | 3904 |
| 818 | Ga0530510_0035018 | 3300061734 | Bacteria | 3618 |
| 819 | Ga0530510_0065041 | 3300061734 | Bacteria | 2642 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049580 | Ga0501046_0023391 | Ga0501046_0023391_3681_5072 | 420 |
| 2 | 3300035119 | Ga0373956_0039452 | Ga0373956_0039452_18_1421 | 423 |
| 3 | 3300046454 | Ga0495592_0030629 | Ga0495592_0030629_17_1372 | 423 |
| 4 | 3300046663 | Ga0495635_0069328 | Ga0495635_0069328_1049_2404 | 423 |
| 5 | 3300047317 | Ga0495604_0124074 | Ga0495604_0124074_17_1357 | 423 |
| 6 | 3300050515 | nmdc:mga0a205_225981_c1 | nmdc:mga0a205_225981_c1_33_1442 | 423 |
| 7 | 3300044693 | Ga0466961_0123528 | Ga0466961_0123528_24_1379 | 426 |
| 8 | 3300046809 | Ga0495600_0074867 | Ga0495600_0074867_811_2190 | 431 |
| 9 | 3300053092 | Ga0500583_0052625 | Ga0500583_0052625_444_1868 | 431 |
| 10 | 3300049585 | Ga0501069_0098137 | Ga0501069_0098137_11_1414 | 432 |
| 11 | 3300047472 | Ga0495686_0128754 | Ga0495686_0128754_18_1421 | 435 |
| 12 | 3300044735 | Ga0466968_0020084 | Ga0466968_0020084_21_1445 | 449 |
| 13 | 3300046689 | Ga0495613_0179107 | Ga0495613_0179107_20_1465 | 453 |
| 14 | 3300048910 | Ga0496107_0049444 | Ga0496107_0049444_1507_2985 | 453 |
| 15 | 3300048913 | Ga0496110_0244438 | Ga0496110_0244438_23_1510 | 453 |
| 16 | 3300048911 | Ga0496108_0211082 | Ga0496108_0211082_233_1666 | 454 |
| 17 | 3300049576 | Ga0501040_0080299 | Ga0501040_0080299_735_2228 | 454 |
| 18 | 3300045049 | Ga0466959_0137576 | Ga0466959_0137576_12_1484 | 455 |
| 19 | 3300049576 | Ga0501040_0099548 | Ga0501040_0099548_513_2000 | 455 |
| 20 | 3300050511 | nmdc:mga08y16_5124_c1 | nmdc:mga08y16_5124_c1_14_1426 | 457 |
| 21 | 3300049593 | Ga0501077_0035599 | Ga0501077_0035599_1705_3159 | 460 |
| 22 | 3300046642 | Ga0495634_0064380 | Ga0495634_0064380_855_2393 | 463 |
| 23 | 3300035117 | Ga0373953_0030098 | Ga0373953_0030098_244_1731 | 470 |
| 24 | 3300046463 | Ga0495653_0067812 | Ga0495653_0067812_22_1566 | 470 |
| 25 | 3300049577 | Ga0501041_0054318 | Ga0501041_0054318_13_1542 | 471 |
| 26 | 3300048904 | Ga0496101_0050691 | Ga0496101_0050691_1418_2971 | 473 |
| 27 | 3300048911 | Ga0496108_0197530 | Ga0496108_0197530_177_1712 | 474 |
| 28 | 3300048905 | Ga0496102_0201370 | Ga0496102_0201370_12_1634 | 476 |
| 29 | 3300049742 | Ga0501080_0140453 | Ga0501080_0140453_649_2151 | 476 |
| 30 | 3300046794 | Ga0495589_0072396 | Ga0495589_0072396_39_1559 | 478 |
| 31 | 3300046663 | Ga0495635_0009805 | Ga0495635_0009805_5166_6683 | 479 |
| 32 | 3300048909 | Ga0496106_0118121 | Ga0496106_0118121_25_1548 | 479 |
| 33 | 3300049571 | Ga0501034_0233664 | Ga0501034_0233664_251_1777 | 479 |
| 34 | 3300049590 | Ga0501074_0042826 | Ga0501074_0042826_15_1544 | 480 |
| 35 | 3300049591 | Ga0501075_0115973 | Ga0501075_0115973_509_2011 | 480 |
| 36 | 3300046535 | Ga0495586_0042115 | Ga0495586_0042115_25_1602 | 484 |
| 37 | 3300049584 | Ga0501068_0019749 | Ga0501068_0019749_351_2015 | 485 |
| 38 | 3300047322 | Ga0495680_0054812 | Ga0495680_0054812_1471_3069 | 488 |
| 39 | 3300005468 | Ga0070707_100019210 | Ga0070707_1000192105 | 489 |
| 40 | 3300025922 | Ga0207646_10017861 | Ga0207646_100178614 | 489 |
| 41 | 3300005445 | Ga0070708_100003878 | Ga0070708_1000038789 | 490 |
| 42 | 3300048915 | Ga0496112_0000001 | Ga0496112_0000001_445733_447394 | 494 |
| 43 | 3300005985 | Ga0081539_10004219 | Ga0081539_100042197 | 496 |
| 44 | 3300005435 | Ga0070714_100004075 | Ga0070714_1000040758 | 497 |
| 45 | 3300025928 | Ga0207700_10010122 | Ga0207700_100101223 | 497 |
| 46 | 3300025929 | Ga0207664_10001718 | Ga0207664_100017182 | 497 |
| 47 | 3300028556 | Ga0265337_1000333 | Ga0265337_10003339 | 497 |
| 48 | 3300028563 | Ga0265319_1009164 | Ga0265319_10091642 | 497 |
| 49 | 3300028573 | Ga0265334_10002151 | Ga0265334_100021517 | 497 |
| 50 | 3300028653 | Ga0265323_10003405 | Ga0265323_100034052 | 497 |
| 51 | 3300028666 | Ga0265336_10002602 | Ga0265336_100026025 | 497 |
| 52 | 3300028800 | Ga0265338_10000956 | Ga0265338_1000095618 | 497 |
| 53 | 3300029957 | Ga0265324_10004705 | Ga0265324_100047053 | 497 |
| 54 | 3300029957 | Ga0265324_10008566 | Ga0265324_100085662 | 497 |
| 55 | 3300031240 | Ga0265320_10006834 | Ga0265320_100068344 | 497 |
| 56 | 3300031241 | Ga0265325_10018618 | Ga0265325_100186183 | 497 |
| 57 | 3300031242 | Ga0265329_10004447 | Ga0265329_100044473 | 497 |
| 58 | 3300031247 | Ga0265340_10000733 | Ga0265340_100007333 | 497 |
| 59 | 3300031344 | Ga0265316_10006833 | Ga0265316_100068335 | 497 |
| 60 | 3300031595 | Ga0265313_10008095 | Ga0265313_100080953 | 497 |
| 61 | 3300031711 | Ga0265314_10006206 | Ga0265314_100062063 | 497 |
| 62 | 3300031712 | Ga0265342_10004595 | Ga0265342_100045954 | 497 |
| 63 | 3300046809 | Ga0495600_0089928 | Ga0495600_0089928_368_1966 | 497 |
| 64 | 3300031241 | Ga0265325_10018232 | Ga0265325_100182321 | 498 |
| 65 | 3300038443 | Ga0395901_0081927 | Ga0395901_0081927_24_1601 | 498 |
| 66 | 3300049576 | Ga0501040_0010049 | Ga0501040_0010049_4292_5935 | 498 |
| 67 | 3300049578 | Ga0501042_0040422 | Ga0501042_0040422_1044_2687 | 498 |
| 68 | 3300025922 | Ga0207646_10005395 | Ga0207646_100053958 | 499 |
| 69 | iso_pu_bacteria | 2858950400 | 2858952339 | 499 |
| 70 | 3300005435 | Ga0070714_100000698 | Ga0070714_10000069810 | 500 |
| 71 | 3300005536 | Ga0070697_100055802 | Ga0070697_1000558023 | 500 |
| 72 | 3300005549 | Ga0070704_100060943 | Ga0070704_1000609432 | 500 |
| 73 | 3300005983 | Ga0081540_1023832 | Ga0081540_10238323 | 500 |
| 74 | 3300005985 | Ga0081539_10016782 | Ga0081539_100167823 | 500 |
| 75 | 3300009098 | Ga0105245_10065975 | Ga0105245_100659752 | 500 |
| 76 | 3300025929 | Ga0207664_10002051 | Ga0207664_100020515 | 500 |
| 77 | 3300005467 | Ga0070706_100000465 | Ga0070706_10000046513 | 501 |
| 78 | 3300005468 | Ga0070707_100002860 | Ga0070707_1000028607 | 501 |
| 79 | 3300025910 | Ga0207684_10000514 | Ga0207684_1000051414 | 501 |
| 80 | 3300009147 | Ga0114129_10066310 | Ga0114129_100663105 | 502 |
| 81 | 3300031247 | Ga0265340_10031769 | Ga0265340_100317692 | 502 |
| 82 | 3300048907 | Ga0496104_0092219 | Ga0496104_0092219_75_1805 | 502 |
| 83 | 3300048914 | Ga0496111_0086388 | Ga0496111_0086388_477_2207 | 502 |
| 84 | 3300048915 | Ga0496112_0099267 | Ga0496112_0099267_333_2063 | 502 |
| 85 | 3300048916 | Ga0496113_0028175 | Ga0496113_0028175_2213_3943 | 502 |
| 86 | 3300002077 | JGI24744J21845_10002908 | JGI24744J21845_100029082 | 503 |
| 87 | 3300005338 | Ga0068868_100002478 | Ga0068868_1000024785 | 503 |
| 88 | 3300005341 | Ga0070691_10004433 | Ga0070691_100044336 | 503 |
| 89 | 3300005354 | Ga0070675_100028655 | Ga0070675_1000286552 | 503 |
| 90 | 3300005441 | Ga0070700_100017870 | Ga0070700_1000178702 | 503 |
| 91 | 3300005456 | Ga0070678_100003212 | Ga0070678_1000032126 | 503 |
| 92 | 3300005471 | Ga0070698_100059773 | Ga0070698_1000597733 | 503 |
| 93 | 3300005578 | Ga0068854_100003077 | Ga0068854_1000030773 | 503 |
| 94 | 3300005616 | Ga0068852_100024953 | Ga0068852_1000249532 | 503 |
| 95 | 3300005718 | Ga0068866_10004888 | Ga0068866_100048883 | 503 |
| 96 | 3300005719 | Ga0068861_100030100 | Ga0068861_1000301003 | 503 |
| 97 | 3300005842 | Ga0068858_100005598 | Ga0068858_1000055985 | 503 |
| 98 | 3300005843 | Ga0068860_100019495 | Ga0068860_1000194951 | 503 |
| 99 | 3300006058 | Ga0075432_10016161 | Ga0075432_100161612 | 503 |
| 100 | 3300006175 | Ga0070712_100001909 | Ga0070712_1000019096 | 503 |
| 101 | 3300006358 | Ga0068871_100017985 | Ga0068871_1000179854 | 503 |
| 102 | 3300006871 | Ga0075434_100015242 | Ga0075434_1000152423 | 503 |
| 103 | 3300006881 | Ga0068865_100000375 | Ga0068865_1000003756 | 503 |
| 104 | 3300009094 | Ga0111539_10125427 | Ga0111539_101254273 | 503 |
| 105 | 3300009098 | Ga0105245_10001215 | Ga0105245_1000121517 | 503 |
| 106 | 3300009148 | Ga0105243_10001235 | Ga0105243_1000123522 | 503 |
| 107 | 3300009148 | Ga0105243_10007668 | Ga0105243_100076686 | 503 |
| 108 | 3300009174 | Ga0105241_10019585 | Ga0105241_100195852 | 503 |
| 109 | 3300009176 | Ga0105242_10001832 | Ga0105242_100018328 | 503 |
| 110 | 3300009553 | Ga0105249_10002953 | Ga0105249_100029537 | 503 |
| 111 | 3300009553 | Ga0105249_10100879 | Ga0105249_101008793 | 503 |
| 112 | 3300010375 | Ga0105239_10009715 | Ga0105239_100097154 | 503 |
| 113 | 3300013297 | Ga0157378_10001840 | Ga0157378_1000184013 | 503 |
| 114 | 3300013307 | Ga0157372_10075798 | Ga0157372_100757982 | 503 |
| 115 | 3300013308 | Ga0157375_10008831 | Ga0157375_100088316 | 503 |
| 116 | 3300014325 | Ga0163163_10074270 | Ga0163163_100742702 | 503 |
| 117 | 3300014968 | Ga0157379_10006431 | Ga0157379_100064313 | 503 |
| 118 | 3300025898 | Ga0207692_10002895 | Ga0207692_100028954 | 503 |
| 119 | 3300025915 | Ga0207693_10001043 | Ga0207693_100010436 | 503 |
| 120 | 3300025926 | Ga0207659_10109988 | Ga0207659_101099882 | 503 |
| 121 | 3300025933 | Ga0207706_10007704 | Ga0207706_100077044 | 503 |
| 122 | 3300025937 | Ga0207669_10001964 | Ga0207669_100019646 | 503 |
| 123 | 3300025938 | Ga0207704_10001568 | Ga0207704_100015682 | 503 |
| 124 | 3300025961 | Ga0207712_10020248 | Ga0207712_100202481 | 503 |
| 125 | 3300025981 | Ga0207640_10005102 | Ga0207640_100051026 | 503 |
| 126 | 3300025986 | Ga0207658_10058603 | Ga0207658_100586032 | 503 |
| 127 | 3300026023 | Ga0207677_10009676 | Ga0207677_100096762 | 503 |
| 128 | 3300026075 | Ga0207708_10010618 | Ga0207708_100106186 | 503 |
| 129 | 3300026118 | Ga0207675_100026454 | Ga0207675_1000264544 | 503 |
| 130 | 3300026121 | Ga0207683_10000829 | Ga0207683_1000082929 | 503 |
| 131 | 3300026142 | Ga0207698_10008461 | Ga0207698_100084612 | 503 |
| 132 | 3300027907 | Ga0207428_10000479 | Ga0207428_1000047929 | 503 |
| 133 | 3300028379 | Ga0268266_10034951 | Ga0268266_100349512 | 503 |
| 134 | 3300028381 | Ga0268264_10008529 | Ga0268264_100085294 | 503 |
| 135 | 3300031901 | Ga0307406_10075309 | Ga0307406_100753092 | 503 |
| 136 | 3300032002 | Ga0307416_100131868 | Ga0307416_1001318682 | 503 |
| 137 | 3300032126 | Ga0307415_100060467 | Ga0307415_1000604673 | 503 |
| 138 | 3300048904 | Ga0496101_0005663 | Ga0496101_0005663_5337_7043 | 503 |
| 139 | 3300048905 | Ga0496102_0005921 | Ga0496102_0005921_4426_6132 | 503 |
| 140 | 3300048909 | Ga0496106_0004991 | Ga0496106_0004991_4486_6192 | 503 |
| 141 | 3300048911 | Ga0496108_0121974 | Ga0496108_0121974_44_1738 | 503 |
| 142 | 3300048917 | Ga0496114_0002035 | Ga0496114_0002035_7266_8972 | 503 |
| 143 | 3300048918 | Ga0496115_0003896 | Ga0496115_0003896_4432_6138 | 503 |
| 144 | 3300049571 | Ga0501034_0167845 | Ga0501034_0167845_95_1786 | 503 |
| 145 | 3300049592 | Ga0501076_0025140 | Ga0501076_0025140_2145_3818 | 503 |
| 146 | 3300050507 | nmdc:mga05p37_30168_c1 | nmdc:mga05p37_30168_c1_4515_6167 | 503 |
| 147 | 3300050509 | nmdc:mga0qj67_21147_c1 | nmdc:mga0qj67_21147_c1_1697_3349 | 503 |
| 148 | 3300050511 | nmdc:mga08y16_103422_c1 | nmdc:mga08y16_103422_c1_861_2513 | 503 |
| 149 | 3300050512 | nmdc:mga0n895_16661_c1 | nmdc:mga0n895_16661_c1_1226_2878 | 503 |
| 150 | 3300050515 | nmdc:mga0a205_90017_c1 | nmdc:mga0a205_90017_c1_454_2106 | 503 |
| 151 | 3300021388 | Ga0213875_10011690 | Ga0213875_100116902 | 504 |
| 152 | 3300037853 | Ga0436364_0667900 | Ga0436364_0667900_9589_11253 | 504 |
| 153 | 3300009094 | Ga0111539_10007294 | Ga0111539_1000729414 | 505 |
| 154 | 3300028577 | Ga0265318_10000251 | Ga0265318_1000025128 | 505 |
| 155 | 3300028800 | Ga0265338_10033814 | Ga0265338_100338143 | 505 |
| 156 | 3300031235 | Ga0265330_10000873 | Ga0265330_1000087314 | 505 |
| 157 | 3300031241 | Ga0265325_10006532 | Ga0265325_100065324 | 505 |
| 158 | 3300048907 | Ga0496104_0017596 | Ga0496104_0017596_2489_4210 | 505 |
| 159 | 3300048908 | Ga0496105_0003832 | Ga0496105_0003832_5482_7203 | 505 |
| 160 | 3300048911 | Ga0496108_0009029 | Ga0496108_0009029_3835_5556 | 505 |
| 161 | 3300048912 | Ga0496109_0008259 | Ga0496109_0008259_4618_6339 | 505 |
| 162 | 3300048915 | Ga0496112_0011769 | Ga0496112_0011769_2603_4324 | 505 |
| 163 | 3300006844 | Ga0075428_100073189 | Ga0075428_1000731893 | 506 |
| 164 | 3300009094 | Ga0111539_10035023 | Ga0111539_100350233 | 506 |
| 165 | 3300048913 | Ga0496110_0023113 | Ga0496110_0023113_3122_4843 | 506 |
| 166 | 3300050511 | nmdc:mga08y16_31657_c1 | nmdc:mga08y16_31657_c1_2748_4361 | 506 |
| 167 | 3300053078 | Ga0495612_0004734 | Ga0495612_0004734_1145_2794 | 506 |
| 168 | 3300005330 | Ga0070690_100048860 | Ga0070690_1000488603 | 507 |
| 169 | 3300026075 | Ga0207708_10014167 | Ga0207708_100141672 | 508 |
| 170 | 3300005937 | Ga0081455_10028351 | Ga0081455_100283514 | 509 |
| 171 | 3300028573 | Ga0265334_10001755 | Ga0265334_100017552 | 509 |
| 172 | 3300031249 | Ga0265339_10001224 | Ga0265339_1000122414 | 509 |
| 173 | 3300044694 | Ga0466963_0000392 | Ga0466963_0000392_13561_15195 | 509 |
| 174 | 3300045836 | Ga0466958_0036699 | Ga0466958_0036699_37_1671 | 509 |
| 175 | 3300005983 | Ga0081540_1000497 | Ga0081540_100049732 | 510 |
| 176 | 3300028573 | Ga0265334_10019876 | Ga0265334_100198762 | 510 |
| 177 | 3300028800 | Ga0265338_10071040 | Ga0265338_100710401 | 510 |
| 178 | 3300031240 | Ga0265320_10013270 | Ga0265320_100132702 | 510 |
| 179 | 3300031344 | Ga0265316_10064553 | Ga0265316_100645531 | 510 |
| 180 | 3300031595 | Ga0265313_10033973 | Ga0265313_100339732 | 510 |
| 181 | 3300031711 | Ga0265314_10027558 | Ga0265314_100275581 | 510 |
| 182 | 3300044842 | Ga0466957_0000936 | Ga0466957_0000936_8039_9673 | 510 |
| 183 | 3300046517 | Ga0495630_0127132 | Ga0495630_0127132_233_1903 | 511 |
| 184 | 3300005536 | Ga0070697_100089700 | Ga0070697_1000897002 | 512 |
| 185 | 3300039437 | Ga0436365_0658475 | Ga0436365_0658475_41_1714 | 513 |
| 186 | iso_pu_bacteria | 8055066027 | 8055069796 | 513 |
| 187 | 3300049569 | Ga0501032_0012338 | Ga0501032_0012338_363_2042 | 514 |
| 188 | 3300049574 | Ga0501038_0017754 | Ga0501038_0017754_1416_3095 | 514 |
| 189 | 3300049575 | Ga0501039_0025403 | Ga0501039_0025403_2772_4451 | 514 |
| 190 | 3300049577 | Ga0501041_0001057 | Ga0501041_0001057_1363_3042 | 514 |
| 191 | 3300049578 | Ga0501042_0099081 | Ga0501042_0099081_73_1752 | 514 |
| 192 | 3300049579 | Ga0501043_0022479 | Ga0501043_0022479_1034_2713 | 514 |
| 193 | 3300049584 | Ga0501068_0013175 | Ga0501068_0013175_2135_3814 | 514 |
| 194 | 3300049587 | Ga0501071_0007051 | Ga0501071_0007051_88_1767 | 514 |
| 195 | 3300049588 | Ga0501072_0003167 | Ga0501072_0003167_6897_8576 | 514 |
| 196 | 3300049590 | Ga0501074_0004289 | Ga0501074_0004289_542_2221 | 514 |
| 197 | 3300049591 | Ga0501075_0012788 | Ga0501075_0012788_3431_5110 | 514 |
| 198 | 3300049593 | Ga0501077_0007458 | Ga0501077_0007458_4960_6639 | 514 |
| 199 | 3300049742 | Ga0501080_0073319 | Ga0501080_0073319_1366_3045 | 514 |
| 200 | 3300049744 | Ga0501083_0084544 | Ga0501083_0084544_231_1916 | 514 |
| 201 | 3300049824 | Ga0501045_0012189 | Ga0501045_0012189_2952_4631 | 514 |
| 202 | 3300054114 | Ga0501084_0005964 | Ga0501084_0005964_5310_6989 | 514 |
| 203 | 3300060353 | Ga0501082_0013204 | Ga0501082_0013204_948_2627 | 514 |
| 204 | 3300005365 | Ga0070688_100018703 | Ga0070688_1000187033 | 515 |
| 205 | 3300005436 | Ga0070713_100121165 | Ga0070713_1001211652 | 515 |
| 206 | 3300005983 | Ga0081540_1001419 | Ga0081540_100141918 | 515 |
| 207 | 3300006028 | Ga0070717_10005007 | Ga0070717_100050076 | 515 |
| 208 | 3300025928 | Ga0207700_10009976 | Ga0207700_100099766 | 515 |
| 209 | 3300049570 | Ga0501033_0019493 | Ga0501033_0019493_2896_4566 | 515 |
| 210 | 3300049576 | Ga0501040_0006995 | Ga0501040_0006995_2352_4022 | 515 |
| 211 | 3300049579 | Ga0501043_0005321 | Ga0501043_0005321_1935_3605 | 515 |
| 212 | 3300049584 | Ga0501068_0005364 | Ga0501068_0005364_2102_3772 | 515 |
| 213 | 3300049585 | Ga0501069_0001443 | Ga0501069_0001443_1965_3635 | 515 |
| 214 | 3300049586 | Ga0501070_0005012 | Ga0501070_0005012_8855_10525 | 515 |
| 215 | 3300049591 | Ga0501075_0028112 | Ga0501075_0028112_1935_3605 | 515 |
| 216 | 3300049744 | Ga0501083_0009973 | Ga0501083_0009973_1813_3483 | 515 |
| 217 | 3300049823 | Ga0501044_0134802 | Ga0501044_0134802_712_2382 | 515 |
| 218 | iso_pu_bacteria | 8055172936 | 8055180705 | 515 |
| 219 | 3300005468 | Ga0070707_100020654 | Ga0070707_1000206542 | 516 |
| 220 | 3300005471 | Ga0070698_100050894 | Ga0070698_1000508943 | 516 |
| 221 | 3300005842 | Ga0068858_100176383 | Ga0068858_1001763831 | 516 |
| 222 | 3300006844 | Ga0075428_100063647 | Ga0075428_1000636473 | 516 |
| 223 | 3300009094 | Ga0111539_10024604 | Ga0111539_100246045 | 516 |
| 224 | 3300009147 | Ga0114129_10004699 | Ga0114129_1000469912 | 516 |
| 225 | 3300013308 | Ga0157375_10175379 | Ga0157375_101753792 | 516 |
| 226 | 3300025929 | Ga0207664_10012653 | Ga0207664_100126537 | 516 |
| 227 | 3300031901 | Ga0307406_10010429 | Ga0307406_100104294 | 516 |
| 228 | 3300032004 | Ga0307414_10050944 | Ga0307414_100509442 | 516 |
| 229 | 3300045976 | Ga0466967_0138476 | Ga0466967_0138476_235_1854 | 516 |
| 230 | 3300046463 | Ga0495653_0045102 | Ga0495653_0045102_637_2256 | 516 |
| 231 | 3300046477 | Ga0495664_0064639 | Ga0495664_0064639_72_1691 | 516 |
| 232 | 3300046517 | Ga0495630_0098504 | Ga0495630_0098504_288_1907 | 516 |
| 233 | 3300046559 | Ga0495667_0017683 | Ga0495667_0017683_2468_4087 | 516 |
| 234 | 3300046663 | Ga0495635_0013373 | Ga0495635_0013373_1052_2671 | 516 |
| 235 | 3300046675 | Ga0495657_0004405 | Ga0495657_0004405_393_2012 | 516 |
| 236 | 3300046681 | Ga0495647_0018457 | Ga0495647_0018457_746_2365 | 516 |
| 237 | 3300046689 | Ga0495613_0096637 | Ga0495613_0096637_465_2084 | 516 |
| 238 | 3300047319 | Ga0495674_0074318 | Ga0495674_0074318_537_2156 | 516 |
| 239 | 3300047471 | Ga0495684_0017936 | Ga0495684_0017936_510_2129 | 516 |
| 240 | 3300048907 | Ga0496104_0015678 | Ga0496104_0015678_891_2510 | 516 |
| 241 | 3300048912 | Ga0496109_0010930 | Ga0496109_0010930_400_2019 | 516 |
| 242 | 3300048918 | Ga0496115_0008417 | Ga0496115_0008417_2162_3781 | 516 |
| 243 | 3300049569 | Ga0501032_0026363 | Ga0501032_0026363_394_2064 | 516 |
| 244 | 3300049571 | Ga0501034_0074058 | Ga0501034_0074058_696_2366 | 516 |
| 245 | 3300049572 | Ga0501036_0030166 | Ga0501036_0030166_2102_3772 | 516 |
| 246 | 3300049574 | Ga0501038_0133099 | Ga0501038_0133099_156_1766 | 516 |
| 247 | 3300049576 | Ga0501040_0023090 | Ga0501040_0023090_461_2071 | 516 |
| 248 | 3300049578 | Ga0501042_0049128 | Ga0501042_0049128_1190_2800 | 516 |
| 249 | 3300049587 | Ga0501071_0055437 | Ga0501071_0055437_847_2457 | 516 |
| 250 | 3300049589 | Ga0501073_0009990 | Ga0501073_0009990_2075_3745 | 516 |
| 251 | 3300049590 | Ga0501074_0075051 | Ga0501074_0075051_599_2269 | 516 |
| 252 | 3300049741 | Ga0501079_0064175 | Ga0501079_0064175_1059_2669 | 516 |
| 253 | 3300049741 | Ga0501079_0067731 | Ga0501079_0067731_828_2438 | 516 |
| 254 | 3300049743 | Ga0501081_0021138 | Ga0501081_0021138_737_2407 | 516 |
| 255 | 3300049822 | Ga0501035_0011103 | Ga0501035_0011103_1962_3632 | 516 |
| 256 | 3300050507 | nmdc:mga05p37_14857_c1 | nmdc:mga05p37_14857_c1_2044_3708 | 516 |
| 257 | 3300050511 | nmdc:mga08y16_19707_c1 | nmdc:mga08y16_19707_c1_4354_6018 | 516 |
| 258 | 3300050515 | nmdc:mga0a205_27287_c1 | nmdc:mga0a205_27287_c1_3496_5160 | 516 |
| 259 | 3300053077 | Ga0495601_0030555 | Ga0495601_0030555_1556_3175 | 516 |
| 260 | 3300053085 | Ga0495619_0048434 | Ga0495619_0048434_410_2029 | 516 |
| 261 | 3300060353 | Ga0501082_0122215 | Ga0501082_0122215_74_1684 | 516 |
| 262 | 3300061734 | Ga0530510_0030015 | Ga0530510_0030015_1315_2925 | 516 |
| 263 | 3300061734 | Ga0530510_0065041 | Ga0530510_0065041_488_2098 | 516 |
| 264 | iso_pu_bacteria | 2558860280 | 2559431391 | 516 |
| 265 | 3300005330 | Ga0070690_100061574 | Ga0070690_1000615742 | 517 |
| 266 | 3300005434 | Ga0070709_10059357 | Ga0070709_100593571 | 517 |
| 267 | 3300005435 | Ga0070714_100084332 | Ga0070714_1000843322 | 517 |
| 268 | 3300005467 | Ga0070706_100047123 | Ga0070706_1000471233 | 517 |
| 269 | 3300005471 | Ga0070698_100000317 | Ga0070698_10000031753 | 517 |
| 270 | 3300005983 | Ga0081540_1054752 | Ga0081540_10547522 | 517 |
| 271 | 3300006358 | Ga0068871_100021915 | Ga0068871_1000219152 | 517 |
| 272 | 3300006914 | Ga0075436_100004003 | Ga0075436_10000400310 | 517 |
| 273 | 3300013296 | Ga0157374_10127575 | Ga0157374_101275752 | 517 |
| 274 | 3300025910 | Ga0207684_10016825 | Ga0207684_100168251 | 517 |
| 275 | 3300026023 | Ga0207677_10065235 | Ga0207677_100652354 | 517 |
| 276 | 3300026121 | Ga0207683_10157822 | Ga0207683_101578222 | 517 |
| 277 | 3300031995 | Ga0307409_100033750 | Ga0307409_1000337503 | 517 |
| 278 | 3300046559 | Ga0495667_0015707 | Ga0495667_0015707_1287_2978 | 517 |
| 279 | 3300046642 | Ga0495634_0039088 | Ga0495634_0039088_105_1799 | 517 |
| 280 | 3300046675 | Ga0495657_0041563 | Ga0495657_0041563_908_2599 | 517 |
| 281 | 3300048912 | Ga0496109_0085764 | Ga0496109_0085764_292_1989 | 517 |
| 282 | 3300049577 | Ga0501041_0072344 | Ga0501041_0072344_82_1782 | 517 |
| 283 | 3300049587 | Ga0501071_0055776 | Ga0501071_0055776_190_1890 | 517 |
| 284 | 3300049741 | Ga0501079_0112909 | Ga0501079_0112909_82_1782 | 517 |
| 285 | 3300050512 | nmdc:mga0n895_24304_c1 | nmdc:mga0n895_24304_c1_1957_3654 | 517 |
| 286 | 3300005434 | Ga0070709_10008433 | Ga0070709_100084332 | 518 |
| 287 | 3300031247 | Ga0265340_10000078 | Ga0265340_100000781 | 518 |
| 288 | 3300049572 | Ga0501036_0150937 | Ga0501036_0150937_31_1731 | 518 |
| 289 | 3300049575 | Ga0501039_0085814 | Ga0501039_0085814_546_2222 | 518 |
| 290 | 3300049583 | Ga0501067_0004408 | Ga0501067_0004408_5980_7728 | 518 |
| 291 | 3300049584 | Ga0501068_0012307 | Ga0501068_0012307_2995_4743 | 518 |
| 292 | 3300049593 | Ga0501077_0110492 | Ga0501077_0110492_29_1705 | 518 |
| 293 | 3300049741 | Ga0501079_0086456 | Ga0501079_0086456_71_1747 | 518 |
| 294 | 3300005435 | Ga0070714_100002238 | Ga0070714_10000223811 | 519 |
| 295 | 3300025929 | Ga0207664_10048060 | Ga0207664_100480602 | 519 |
| 296 | 3300032002 | Ga0307416_100033472 | Ga0307416_1000334722 | 519 |
| 297 | 3300032002 | Ga0307416_100068330 | Ga0307416_1000683301 | 519 |
| 298 | 3300032126 | Ga0307415_100033745 | Ga0307415_1000337452 | 519 |
| 299 | 3300045049 | Ga0466959_0011612 | Ga0466959_0011612_2178_3812 | 519 |
| 300 | iso_pu_bacteria | 2884693830 | 2884695748 | 519 |
| 301 | iso_pu_bacteria | 2895427314 | 2895438810 | 519 |
| 302 | iso_pu_bacteria | 2895442618 | 2895445540 | 519 |
| 303 | 3300005468 | Ga0070707_100001997 | Ga0070707_1000019978 | 520 |
| 304 | 3300005985 | Ga0081539_10004838 | Ga0081539_100048389 | 520 |
| 305 | 3300025922 | Ga0207646_10000129 | Ga0207646_1000012953 | 520 |
| 306 | 3300044694 | Ga0466963_0002439 | Ga0466963_0002439_8206_9840 | 520 |
| 307 | 3300044706 | Ga0466964_0007175 | Ga0466964_0007175_1462_3096 | 520 |
| 308 | 3300044842 | Ga0466957_0017303 | Ga0466957_0017303_486_2120 | 520 |
| 309 | 3300044901 | Ga0466960_0009385 | Ga0466960_0009385_1911_3545 | 520 |
| 310 | 3300045976 | Ga0466967_0008724 | Ga0466967_0008724_5269_6903 | 520 |
| 311 | 3300045976 | Ga0466967_0035213 | Ga0466967_0035213_953_2587 | 520 |
| 312 | 3300045976 | Ga0466967_0054572 | Ga0466967_0054572_491_2122 | 520 |
| 313 | 3300061719 | Ga0466962_0002813 | Ga0466962_0002813_5741_7378 | 520 |
| 314 | iso_pu_bacteria | 2599185353 | 2600200095 | 520 |
| 315 | iso_pu_bacteria | 2600254943 | 2600401272 | 520 |
| 316 | 3300030521 | Ga0307511_10001274 | Ga0307511_100012745 | 521 |
| 317 | 3300044656 | Ga0466969_0000608 | Ga0466969_0000608_12102_13739 | 521 |
| 318 | 3300044684 | Ga0466966_0056568 | Ga0466966_0056568_56_1693 | 521 |
| 319 | 3300044735 | Ga0466968_0001536 | Ga0466968_0001536_2199_3836 | 521 |
| 320 | 3300045049 | Ga0466959_0018712 | Ga0466959_0018712_1080_2717 | 521 |
| 321 | 3300045836 | Ga0466958_0005643 | Ga0466958_0005643_1607_3244 | 521 |
| 322 | 3300045976 | Ga0466967_0033419 | Ga0466967_0033419_2670_4307 | 521 |
| 323 | 3300045976 | Ga0466967_0037277 | Ga0466967_0037277_232_1869 | 521 |
| 324 | 3300048903 | Ga0496100_0000191 | Ga0496100_0000191_8717_10417 | 521 |
| 325 | 3300049568 | Ga0501031_0015248 | Ga0501031_0015248_3172_4821 | 521 |
| 326 | 3300049574 | Ga0501038_0072031 | Ga0501038_0072031_390_2039 | 521 |
| 327 | 3300049575 | Ga0501039_0048018 | Ga0501039_0048018_53_1702 | 521 |
| 328 | 3300049576 | Ga0501040_0006932 | Ga0501040_0006932_4810_6459 | 521 |
| 329 | 3300049577 | Ga0501041_0023558 | Ga0501041_0023558_1863_3512 | 521 |
| 330 | 3300049578 | Ga0501042_0006956 | Ga0501042_0006956_4429_6078 | 521 |
| 331 | 3300049580 | Ga0501046_0006046 | Ga0501046_0006046_5280_6929 | 521 |
| 332 | 3300049582 | Ga0501048_0013979 | Ga0501048_0013979_1244_2893 | 521 |
| 333 | 3300049588 | Ga0501072_0001813 | Ga0501072_0001813_2423_4072 | 521 |
| 334 | 3300049590 | Ga0501074_0067950 | Ga0501074_0067950_795_2444 | 521 |
| 335 | 3300049591 | Ga0501075_0008537 | Ga0501075_0008537_1923_3572 | 521 |
| 336 | 3300049592 | Ga0501076_0003449 | Ga0501076_0003449_1956_3605 | 521 |
| 337 | 3300049743 | Ga0501081_0009027 | Ga0501081_0009027_3899_5548 | 521 |
| 338 | 3300049822 | Ga0501035_0105190 | Ga0501035_0105190_81_1730 | 521 |
| 339 | 3300049824 | Ga0501045_0008101 | Ga0501045_0008101_3709_5358 | 521 |
| 340 | 3300054114 | Ga0501084_0022217 | Ga0501084_0022217_632_2281 | 521 |
| 341 | 3300060353 | Ga0501082_0006285 | Ga0501082_0006285_1736_3385 | 521 |
| 342 | 3300061734 | Ga0530510_0035018 | Ga0530510_0035018_691_2340 | 521 |
| 343 | iso_pu_bacteria | 2675903059 | 2676479758 | 521 |
| 344 | iso_pu_bacteria | 2915358134 | 2915359072 | 521 |
| 345 | iso_pu_bacteria | 8054472261 | 8054474043 | 521 |
| 346 | 3300048913 | Ga0496110_0065705 | Ga0496110_0065705_719_2371 | 522 |
| 347 | 3300049582 | Ga0501048_0108819 | Ga0501048_0108819_88_1737 | 522 |
| 348 | 3300049588 | Ga0501072_0115812 | Ga0501072_0115812_73_1719 | 522 |
| 349 | iso_pu_bacteria | 8003314358 | 8003317089 | 522 |
| 350 | 3300005330 | Ga0070690_100004217 | Ga0070690_1000042173 | 523 |
| 351 | 3300005340 | Ga0070689_100014522 | Ga0070689_1000145222 | 523 |
| 352 | 3300005356 | Ga0070674_100004418 | Ga0070674_1000044185 | 523 |
| 353 | 3300005365 | Ga0070688_100031062 | Ga0070688_1000310623 | 523 |
| 354 | 3300005459 | Ga0068867_100009948 | Ga0068867_1000099482 | 523 |
| 355 | 3300005544 | Ga0070686_100057768 | Ga0070686_1000577682 | 523 |
| 356 | 3300009177 | Ga0105248_10068535 | Ga0105248_100685352 | 523 |
| 357 | 3300013297 | Ga0157378_10008800 | Ga0157378_100088002 | 523 |
| 358 | 3300014968 | Ga0157379_10008017 | Ga0157379_100080174 | 523 |
| 359 | 3300025899 | Ga0207642_10018821 | Ga0207642_100188212 | 523 |
| 360 | 3300025937 | Ga0207669_10013429 | Ga0207669_100134293 | 523 |
| 361 | 3300025940 | Ga0207691_10098945 | Ga0207691_100989452 | 523 |
| 362 | 3300026089 | Ga0207648_10001438 | Ga0207648_1000143817 | 523 |
| 363 | 3300028800 | Ga0265338_10000457 | Ga0265338_1000045772 | 523 |
| 364 | 3300044901 | Ga0466960_0016566 | Ga0466960_0016566_907_2679 | 523 |
| 365 | 3300046463 | Ga0495653_0046817 | Ga0495653_0046817_462_2114 | 523 |
| 366 | 3300046476 | Ga0495662_0000347 | Ga0495662_0000347_3912_5564 | 523 |
| 367 | 3300046477 | Ga0495664_0000303 | Ga0495664_0000303_17910_19562 | 523 |
| 368 | 3300046511 | Ga0495608_0003824 | Ga0495608_0003824_2516_4168 | 523 |
| 369 | 3300046526 | Ga0495666_0021425 | Ga0495666_0021425_30_1682 | 523 |
| 370 | 3300046529 | Ga0495652_0022175 | Ga0495652_0022175_1921_3573 | 523 |
| 371 | 3300046559 | Ga0495667_0022575 | Ga0495667_0022575_1884_3536 | 523 |
| 372 | 3300046663 | Ga0495635_0036741 | Ga0495635_0036741_462_2114 | 523 |
| 373 | 3300046680 | Ga0495646_0025660 | Ga0495646_0025660_1377_3029 | 523 |
| 374 | 3300046689 | Ga0495613_0001143 | Ga0495613_0001143_832_2484 | 523 |
| 375 | 3300047315 | Ga0495581_0015264 | Ga0495581_0015264_13_1665 | 523 |
| 376 | 3300047317 | Ga0495604_0001245 | Ga0495604_0001245_12052_13704 | 523 |
| 377 | 3300047673 | Ga0495593_0049227 | Ga0495593_0049227_55_1707 | 523 |
| 378 | 3300048905 | Ga0496102_0044821 | Ga0496102_0044821_865_2514 | 523 |
| 379 | 3300048907 | Ga0496104_0008921 | Ga0496104_0008921_1865_3514 | 523 |
| 380 | 3300048913 | Ga0496110_0016480 | Ga0496110_0016480_2626_4275 | 523 |
| 381 | 3300048916 | Ga0496113_0046370 | Ga0496113_0046370_1499_3199 | 523 |
| 382 | 3300053088 | Ga0500644_0017802 | Ga0500644_0017802_309_1994 | 523 |
| 383 | 3300053122 | Ga0500608_060318 | Ga0500608_060318_98_1753 | 523 |
| 384 | iso_pu_bacteria | 2565956521 | 2566036260 | 523 |
| 385 | iso_pu_bacteria | 2582581314 | 2585312144 | 523 |
| 386 | iso_pu_bacteria | 2616644814 | 2616693834 | 523 |
| 387 | iso_pu_bacteria | 2867428634 | 2867438005 | 523 |
| 388 | iso_pu_bacteria | 2995463766 | 2995464033 | 523 |
| 389 | 3300005355 | Ga0070671_100000903 | Ga0070671_10000090310 | 524 |
| 390 | 3300005356 | Ga0070674_100027833 | Ga0070674_1000278333 | 524 |
| 391 | 3300005455 | Ga0070663_100002095 | Ga0070663_1000020954 | 524 |
| 392 | 3300005456 | Ga0070678_100068119 | Ga0070678_1000681191 | 524 |
| 393 | 3300005459 | Ga0068867_100009134 | Ga0068867_1000091342 | 524 |
| 394 | 3300005471 | Ga0070698_100008135 | Ga0070698_1000081355 | 524 |
| 395 | 3300005546 | Ga0070696_100018879 | Ga0070696_1000188792 | 524 |
| 396 | 3300005548 | Ga0070665_100008498 | Ga0070665_1000084985 | 524 |
| 397 | 3300005615 | Ga0070702_100042026 | Ga0070702_1000420262 | 524 |
| 398 | 3300005618 | Ga0068864_100036797 | Ga0068864_1000367972 | 524 |
| 399 | 3300005842 | Ga0068858_100046336 | Ga0068858_1000463363 | 524 |
| 400 | 3300009147 | Ga0114129_10001397 | Ga0114129_100013979 | 524 |
| 401 | 3300009147 | Ga0114129_10012644 | Ga0114129_1001264410 | 524 |
| 402 | 3300013296 | Ga0157374_10179230 | Ga0157374_101792301 | 524 |
| 403 | 3300014325 | Ga0163163_10007568 | Ga0163163_100075683 | 524 |
| 404 | 3300014325 | Ga0163163_10021438 | Ga0163163_100214382 | 524 |
| 405 | 3300014325 | Ga0163163_10146027 | Ga0163163_101460273 | 524 |
| 406 | 3300014968 | Ga0157379_10014462 | Ga0157379_100144625 | 524 |
| 407 | 3300014968 | Ga0157379_10018624 | Ga0157379_100186246 | 524 |
| 408 | 3300025931 | Ga0207644_10007437 | Ga0207644_100074373 | 524 |
| 409 | 3300026067 | Ga0207678_10000785 | Ga0207678_100007854 | 524 |
| 410 | 3300026075 | Ga0207708_10020421 | Ga0207708_100204213 | 524 |
| 411 | 3300026088 | Ga0207641_10000855 | Ga0207641_100008554 | 524 |
| 412 | 3300026089 | Ga0207648_10005064 | Ga0207648_100050646 | 524 |
| 413 | 3300026121 | Ga0207683_10098091 | Ga0207683_100980912 | 524 |
| 414 | 3300028379 | Ga0268266_10009794 | Ga0268266_100097944 | 524 |
| 415 | 3300031456 | Ga0307513_10103500 | Ga0307513_101035002 | 524 |
| 416 | 3300041512 | Ga0451853_3098222 | Ga0451853_3098222_696_2357 | 524 |
| 417 | 3300044658 | Ga0466972_0005806 | Ga0466972_0005806_2612_4315 | 524 |
| 418 | 3300044683 | Ga0466965_0002461 | Ga0466965_0002461_3791_5494 | 524 |
| 419 | 3300044693 | Ga0466961_0065115 | Ga0466961_0065115_52_1704 | 524 |
| 420 | 3300044765 | Ga0466970_0052942 | Ga0466970_0052942_268_1971 | 524 |
| 421 | 3300044901 | Ga0466960_0002342 | Ga0466960_0002342_1767_3470 | 524 |
| 422 | 3300046455 | Ga0495603_0012348 | Ga0495603_0012348_896_2548 | 524 |
| 423 | 3300046492 | Ga0495585_0039114 | Ga0495585_0039114_669_2324 | 524 |
| 424 | 3300046665 | Ga0495661_0035179 | Ga0495661_0035179_1017_2672 | 524 |
| 425 | 3300046683 | Ga0495658_0035130 | Ga0495658_0035130_523_2205 | 524 |
| 426 | 3300047319 | Ga0495674_0044931 | Ga0495674_0044931_2038_3705 | 524 |
| 427 | 3300048905 | Ga0496102_0000046 | Ga0496102_0000046_86642_88342 | 524 |
| 428 | 3300048905 | Ga0496102_0029801 | Ga0496102_0029801_2506_4209 | 524 |
| 429 | 3300048906 | Ga0496103_0000011 | Ga0496103_0000011_23052_24752 | 524 |
| 430 | 3300048907 | Ga0496104_0040751 | Ga0496104_0040751_2201_3901 | 524 |
| 431 | 3300048908 | Ga0496105_0046616 | Ga0496105_0046616_1420_3126 | 524 |
| 432 | 3300048911 | Ga0496108_0015621 | Ga0496108_0015621_3592_5292 | 524 |
| 433 | 3300048919 | Ga0496116_0000328 | Ga0496116_0000328_48772_50472 | 524 |
| 434 | 3300048920 | Ga0496117_0000109 | Ga0496117_0000109_96321_98021 | 524 |
| 435 | 3300048921 | Ga0496118_0000132 | Ga0496118_0000132_33143_34843 | 524 |
| 436 | 3300048922 | Ga0496119_0001399 | Ga0496119_0001399_26497_28197 | 524 |
| 437 | 3300048924 | Ga0496121_0007631 | Ga0496121_0007631_2585_4285 | 524 |
| 438 | 3300048927 | Ga0496124_0032677 | Ga0496124_0032677_1834_3534 | 524 |
| 439 | 3300048929 | Ga0496126_0000345 | Ga0496126_0000345_46761_48461 | 524 |
| 440 | 3300049587 | Ga0501071_0055272 | Ga0501071_0055272_918_2555 | 524 |
| 441 | 3300050507 | nmdc:mga05p37_3241_c1 | nmdc:mga05p37_3241_c1_11900_13579 | 524 |
| 442 | 3300053150 | Ga0500603_008820 | Ga0500603_008820_89_1762 | 524 |
| 443 | 3300059423 | Ga0590074_000702 | Ga0590074_000702_1704_3389 | 524 |
| 444 | 3300005331 | Ga0070670_100045779 | Ga0070670_1000457791 | 525 |
| 445 | 3300005445 | Ga0070708_100045096 | Ga0070708_1000450963 | 525 |
| 446 | 3300005834 | Ga0068851_10044626 | Ga0068851_100446261 | 525 |
| 447 | 3300006028 | Ga0070717_10026431 | Ga0070717_100264312 | 525 |
| 448 | 3300006058 | Ga0075432_10011415 | Ga0075432_100114152 | 525 |
| 449 | 3300006175 | Ga0070712_100042084 | Ga0070712_1000420843 | 525 |
| 450 | 3300006852 | Ga0075433_10066589 | Ga0075433_100665893 | 525 |
| 451 | 3300013308 | Ga0157375_10029612 | Ga0157375_100296125 | 525 |
| 452 | 3300014968 | Ga0157379_10111505 | Ga0157379_101115052 | 525 |
| 453 | 3300015688 | Ga0183367_1003 | Ga0183367_1003423 | 525 |
| 454 | 3300021384 | Ga0213876_10002282 | Ga0213876_100022825 | 525 |
| 455 | 3300021384 | Ga0213876_10058644 | Ga0213876_100586442 | 525 |
| 456 | 3300025901 | Ga0207688_10014132 | Ga0207688_100141324 | 525 |
| 457 | 3300025905 | Ga0207685_10005361 | Ga0207685_100053612 | 525 |
| 458 | 3300025907 | Ga0207645_10029832 | Ga0207645_100298322 | 525 |
| 459 | 3300025915 | Ga0207693_10001547 | Ga0207693_100015476 | 525 |
| 460 | 3300025915 | Ga0207693_10119372 | Ga0207693_101193722 | 525 |
| 461 | 3300025918 | Ga0207662_10032228 | Ga0207662_100322282 | 525 |
| 462 | 3300025919 | Ga0207657_10015512 | Ga0207657_100155122 | 525 |
| 463 | 3300025923 | Ga0207681_10062876 | Ga0207681_100628761 | 525 |
| 464 | 3300025928 | Ga0207700_10116515 | Ga0207700_101165152 | 525 |
| 465 | 3300025939 | Ga0207665_10018547 | Ga0207665_100185473 | 525 |
| 466 | 3300025942 | Ga0207689_10012298 | Ga0207689_100122984 | 525 |
| 467 | 3300026095 | Ga0207676_10179998 | Ga0207676_101799982 | 525 |
| 468 | 3300026118 | Ga0207675_100055493 | Ga0207675_1000554931 | 525 |
| 469 | 3300027907 | Ga0207428_10063239 | Ga0207428_100632393 | 525 |
| 470 | 3300028381 | Ga0268264_10183701 | Ga0268264_101837011 | 525 |
| 471 | 3300028794 | Ga0307515_10014050 | Ga0307515_100140501 | 525 |
| 472 | 3300030521 | Ga0307511_10015850 | Ga0307511_100158503 | 525 |
| 473 | 3300031507 | Ga0307509_10050248 | Ga0307509_100502483 | 525 |
| 474 | 3300031507 | Ga0307509_10103837 | Ga0307509_101038371 | 525 |
| 475 | 3300031616 | Ga0307508_10008110 | Ga0307508_100081105 | 525 |
| 476 | 3300031730 | Ga0307516_10033431 | Ga0307516_100334312 | 525 |
| 477 | 3300031838 | Ga0307518_10016097 | Ga0307518_100160975 | 525 |
| 478 | 3300033179 | Ga0307507_10012829 | Ga0307507_100128294 | 525 |
| 479 | 3300033180 | Ga0307510_10060675 | Ga0307510_100606751 | 525 |
| 480 | 3300035083 | Ga0373926_0004470 | Ga0373926_0004470_1442_3100 | 525 |
| 481 | 3300035089 | Ga0373944_0007068 | Ga0373944_0007068_507_2165 | 525 |
| 482 | 3300035116 | Ga0373945_0001574 | Ga0373945_0001574_4661_6319 | 525 |
| 483 | 3300035170 | Ga0373943_0029801 | Ga0373943_0029801_87_1745 | 525 |
| 484 | 3300035171 | Ga0373946_0004588 | Ga0373946_0004588_2624_4282 | 525 |
| 485 | 3300035410 | Ga0373924_0018278 | Ga0373924_0018278_373_2031 | 525 |
| 486 | 3300035695 | Ga0373927_0004175 | Ga0373927_0004175_1002_2660 | 525 |
| 487 | 3300035725 | Ga0373947_0033495 | Ga0373947_0033495_132_1790 | 525 |
| 488 | 3300038742 | Ga0400486_21479 | Ga0400486_21479_83_1732 | 525 |
| 489 | 3300039437 | Ga0436365_0542570 | Ga0436365_0542570_248_1906 | 525 |
| 490 | 3300039437 | Ga0436365_1210809 | Ga0436365_1210809_3926_5593 | 525 |
| 491 | 3300044658 | Ga0466972_0007692 | Ga0466972_0007692_895_2562 | 525 |
| 492 | 3300044712 | Ga0453684_0122256 | Ga0453684_0122256_677_2380 | 525 |
| 493 | 3300046455 | Ga0495603_0026749 | Ga0495603_0026749_189_1847 | 525 |
| 494 | 3300046455 | Ga0495603_0056579 | Ga0495603_0056579_366_2033 | 525 |
| 495 | 3300046459 | Ga0495629_0039341 | Ga0495629_0039341_1002_2660 | 525 |
| 496 | 3300046461 | Ga0495641_0002361 | Ga0495641_0002361_3593_5251 | 525 |
| 497 | 3300046462 | Ga0495651_0007217 | Ga0495651_0007217_4449_6116 | 525 |
| 498 | 3300046462 | Ga0495651_0096619 | Ga0495651_0096619_162_1829 | 525 |
| 499 | 3300046472 | Ga0495580_0029450 | Ga0495580_0029450_1882_3540 | 525 |
| 500 | 3300046473 | Ga0495582_0008058 | Ga0495582_0008058_2747_4405 | 525 |
| 501 | 3300046473 | Ga0495582_0023960 | Ga0495582_0023960_1099_2766 | 525 |
| 502 | 3300046475 | Ga0495639_0000733 | Ga0495639_0000733_3219_4877 | 525 |
| 503 | 3300046476 | Ga0495662_0013965 | Ga0495662_0013965_2116_3783 | 525 |
| 504 | 3300046477 | Ga0495664_0001037 | Ga0495664_0001037_4318_5985 | 525 |
| 505 | 3300046499 | Ga0495594_0027407 | Ga0495594_0027407_1022_2680 | 525 |
| 506 | 3300046499 | Ga0495594_0028449 | Ga0495594_0028449_114_1781 | 525 |
| 507 | 3300046517 | Ga0495630_0030223 | Ga0495630_0030223_291_1958 | 525 |
| 508 | 3300046517 | Ga0495630_0034901 | Ga0495630_0034901_1431_3089 | 525 |
| 509 | 3300046529 | Ga0495652_0076320 | Ga0495652_0076320_287_1954 | 525 |
| 510 | 3300046531 | Ga0495665_0002021 | Ga0495665_0002021_4750_6408 | 525 |
| 511 | 3300046533 | Ga0495640_0013894 | Ga0495640_0013894_4346_6004 | 525 |
| 512 | 3300046535 | Ga0495586_0019919 | Ga0495586_0019919_66_1724 | 525 |
| 513 | 3300046536 | Ga0495587_0025860 | Ga0495587_0025860_126_1793 | 525 |
| 514 | 3300046559 | Ga0495667_0038867 | Ga0495667_0038867_17_1675 | 525 |
| 515 | 3300046642 | Ga0495634_0022495 | Ga0495634_0022495_1237_2895 | 525 |
| 516 | 3300046660 | Ga0495625_0004664 | Ga0495625_0004664_5079_6749 | 525 |
| 517 | 3300046663 | Ga0495635_0001067 | Ga0495635_0001067_4396_6063 | 525 |
| 518 | 3300046663 | Ga0495635_0008048 | Ga0495635_0008048_2470_4128 | 525 |
| 519 | 3300046674 | Ga0495588_0008979 | Ga0495588_0008979_1634_3292 | 525 |
| 520 | 3300046674 | Ga0495588_0037805 | Ga0495588_0037805_455_2122 | 525 |
| 521 | 3300046675 | Ga0495657_0001313 | Ga0495657_0001313_10383_12050 | 525 |
| 522 | 3300046680 | Ga0495646_0074831 | Ga0495646_0074831_200_1867 | 525 |
| 523 | 3300046683 | Ga0495658_0002328 | Ga0495658_0002328_4364_6022 | 525 |
| 524 | 3300046689 | Ga0495613_0070184 | Ga0495613_0070184_835_2493 | 525 |
| 525 | 3300046690 | Ga0495624_0005587 | Ga0495624_0005587_2308_3966 | 525 |
| 526 | 3300046809 | Ga0495600_0012911 | Ga0495600_0012911_743_2410 | 525 |
| 527 | 3300047315 | Ga0495581_0003375 | Ga0495581_0003375_4313_5980 | 525 |
| 528 | 3300047317 | Ga0495604_0003847 | Ga0495604_0003847_8719_10386 | 525 |
| 529 | 3300047317 | Ga0495604_0104871 | Ga0495604_0104871_284_1951 | 525 |
| 530 | 3300047319 | Ga0495674_0006495 | Ga0495674_0006495_4788_6446 | 525 |
| 531 | 3300047319 | Ga0495674_0115650 | Ga0495674_0115650_61_1728 | 525 |
| 532 | 3300047321 | Ga0495676_0022869 | Ga0495676_0022869_2689_4356 | 525 |
| 533 | 3300047322 | Ga0495680_0015800 | Ga0495680_0015800_2510_4168 | 525 |
| 534 | 3300047443 | Ga0495687_004554 | Ga0495687_004554_3846_5513 | 525 |
| 535 | 3300047470 | Ga0495681_0011848 | Ga0495681_0011848_112_1782 | 525 |
| 536 | 3300047673 | Ga0495593_0003591 | Ga0495593_0003591_3206_4873 | 525 |
| 537 | 3300047673 | Ga0495593_0014442 | Ga0495593_0014442_1469_3127 | 525 |
| 538 | 3300048088 | Ga0495602_0021341 | Ga0495602_0021341_1191_2858 | 525 |
| 539 | 3300048907 | Ga0496104_0018432 | Ga0496104_0018432_1102_2802 | 525 |
| 540 | 3300048911 | Ga0496108_0018664 | Ga0496108_0018664_2803_4470 | 525 |
| 541 | 3300048911 | Ga0496108_0019797 | Ga0496108_0019797_3711_5411 | 525 |
| 542 | 3300048912 | Ga0496109_0036432 | Ga0496109_0036432_944_2644 | 525 |
| 543 | 3300048913 | Ga0496110_0004537 | Ga0496110_0004537_317_2029 | 525 |
| 544 | 3300048913 | Ga0496110_0073023 | Ga0496110_0073023_41_1741 | 525 |
| 545 | 3300048917 | Ga0496114_0033573 | Ga0496114_0033573_2077_3777 | 525 |
| 546 | 3300050507 | nmdc:mga05p37_19768_c1 | nmdc:mga05p37_19768_c1_4108_5763 | 525 |
| 547 | 3300050511 | nmdc:mga08y16_184773_c1 | nmdc:mga08y16_184773_c1_268_1926 | 525 |
| 548 | 3300053085 | Ga0495619_0008129 | Ga0495619_0008129_4965_6623 | 525 |
| 549 | 3300053090 | Ga0500646_0000089 | Ga0500646_0000089_9324_11033 | 525 |
| 550 | 3300053146 | Ga0500588_0002793 | Ga0500588_0002793_633_2342 | 525 |
| 551 | 3300060353 | Ga0501082_0115399 | Ga0501082_0115399_422_2107 | 525 |
| 552 | 3300005344 | Ga0070661_100026200 | Ga0070661_1000262004 | 526 |
| 553 | 3300005355 | Ga0070671_100015031 | Ga0070671_1000150314 | 526 |
| 554 | 3300005366 | Ga0070659_100010975 | Ga0070659_1000109752 | 526 |
| 555 | 3300005440 | Ga0070705_100002591 | Ga0070705_1000025914 | 526 |
| 556 | 3300005468 | Ga0070707_100009423 | Ga0070707_1000094235 | 526 |
| 557 | 3300005471 | Ga0070698_100060038 | Ga0070698_1000600385 | 526 |
| 558 | 3300005518 | Ga0070699_100006322 | Ga0070699_1000063226 | 526 |
| 559 | 3300005518 | Ga0070699_100017960 | Ga0070699_1000179604 | 526 |
| 560 | 3300005530 | Ga0070679_100086969 | Ga0070679_1000869692 | 526 |
| 561 | 3300005546 | Ga0070696_100067887 | Ga0070696_1000678872 | 526 |
| 562 | 3300005564 | Ga0070664_100067880 | Ga0070664_1000678802 | 526 |
| 563 | 3300005841 | Ga0068863_100003945 | Ga0068863_1000039454 | 526 |
| 564 | 3300005841 | Ga0068863_100023726 | Ga0068863_1000237264 | 526 |
| 565 | 3300005937 | Ga0081455_10006576 | Ga0081455_100065768 | 526 |
| 566 | 3300005985 | Ga0081539_10005582 | Ga0081539_1000558210 | 526 |
| 567 | 3300006178 | Ga0075367_10008041 | Ga0075367_100080412 | 526 |
| 568 | 3300006186 | Ga0075369_10005130 | Ga0075369_100051303 | 526 |
| 569 | 3300006353 | Ga0075370_10044479 | Ga0075370_100444791 | 526 |
| 570 | 3300006844 | Ga0075428_100247981 | Ga0075428_1002479811 | 526 |
| 571 | 3300006852 | Ga0075433_10007584 | Ga0075433_100075844 | 526 |
| 572 | 3300009094 | Ga0111539_10011179 | Ga0111539_100111799 | 526 |
| 573 | 3300009098 | Ga0105245_10036528 | Ga0105245_100365282 | 526 |
| 574 | 3300009147 | Ga0114129_10006183 | Ga0114129_1000618312 | 526 |
| 575 | 3300009177 | Ga0105248_10191886 | Ga0105248_101918862 | 526 |
| 576 | 3300009551 | Ga0105238_10136809 | Ga0105238_101368092 | 526 |
| 577 | 3300011119 | Ga0105246_10010694 | Ga0105246_100106942 | 526 |
| 578 | 3300013307 | Ga0157372_10104916 | Ga0157372_101049162 | 526 |
| 579 | 3300025899 | Ga0207642_10017626 | Ga0207642_100176262 | 526 |
| 580 | 3300025908 | Ga0207643_10003535 | Ga0207643_100035354 | 526 |
| 581 | 3300025922 | Ga0207646_10004171 | Ga0207646_100041712 | 526 |
| 582 | 3300025931 | Ga0207644_10002738 | Ga0207644_100027389 | 526 |
| 583 | 3300025937 | Ga0207669_10040474 | Ga0207669_100404742 | 526 |
| 584 | 3300025945 | Ga0207679_10037788 | Ga0207679_100377883 | 526 |
| 585 | 3300026075 | Ga0207708_10006612 | Ga0207708_100066125 | 526 |
| 586 | 3300026075 | Ga0207708_10020237 | Ga0207708_100202372 | 526 |
| 587 | 3300026088 | Ga0207641_10003504 | Ga0207641_100035047 | 526 |
| 588 | 3300026116 | Ga0207674_10029446 | Ga0207674_100294464 | 526 |
| 589 | 3300027907 | Ga0207428_10002318 | Ga0207428_100023183 | 526 |
| 590 | 3300028380 | Ga0268265_10023176 | Ga0268265_100231763 | 526 |
| 591 | 3300028563 | Ga0265319_1020020 | Ga0265319_10200202 | 526 |
| 592 | 3300031995 | Ga0307409_100066755 | Ga0307409_1000667552 | 526 |
| 593 | 3300035112 | Ga0373932_0016335 | Ga0373932_0016335_35_1729 | 526 |
| 594 | 3300035172 | Ga0373955_0030234 | Ga0373955_0030234_675_2339 | 526 |
| 595 | 3300035724 | Ga0373933_0011345 | Ga0373933_0011345_1073_2737 | 526 |
| 596 | 3300036401 | Ga0373937_0000758 | Ga0373937_0000758_20879_22543 | 526 |
| 597 | 3300037312 | Ga0395899_0008636 | Ga0395899_0008636_2612_4273 | 526 |
| 598 | 3300037418 | Ga0395900_0002757 | Ga0395900_0002757_14357_16018 | 526 |
| 599 | 3300037471 | Ga0395905_0003288 | Ga0395905_0003288_3069_4730 | 526 |
| 600 | 3300037853 | Ga0436364_0433954 | Ga0436364_0433954_2933_4609 | 526 |
| 601 | 3300037853 | Ga0436364_1303368 | Ga0436364_1303368_154_1800 | 526 |
| 602 | 3300038443 | Ga0395901_0001240 | Ga0395901_0001240_10506_12167 | 526 |
| 603 | 3300038741 | Ga0400488_22792 | Ga0400488_22792_675_2441 | 526 |
| 604 | 3300039062 | Ga0400483_126970 | Ga0400483_126970_3443_5128 | 526 |
| 605 | 3300039062 | Ga0400483_164544 | Ga0400483_164544_277_1962 | 526 |
| 606 | 3300042157 | Ga0439458_0008770 | Ga0439458_0008770_252_1937 | 526 |
| 607 | 3300045836 | Ga0466958_0018228 | Ga0466958_0018228_855_2540 | 526 |
| 608 | 3300046459 | Ga0495629_0014218 | Ga0495629_0014218_3965_5629 | 526 |
| 609 | 3300046463 | Ga0495653_0083576 | Ga0495653_0083576_69_1733 | 526 |
| 610 | 3300046473 | Ga0495582_0028686 | Ga0495582_0028686_752_2416 | 526 |
| 611 | 3300046511 | Ga0495608_0019225 | Ga0495608_0019225_1135_2799 | 526 |
| 612 | 3300046517 | Ga0495630_0013431 | Ga0495630_0013431_2807_4471 | 526 |
| 613 | 3300046543 | Ga0495645_0072139 | Ga0495645_0072139_71_1735 | 526 |
| 614 | 3300046642 | Ga0495634_0092707 | Ga0495634_0092707_284_1948 | 526 |
| 615 | 3300046675 | Ga0495657_0006378 | Ga0495657_0006378_2889_4553 | 526 |
| 616 | 3300046678 | Ga0495599_0015132 | Ga0495599_0015132_2495_4159 | 526 |
| 617 | 3300046680 | Ga0495646_0048465 | Ga0495646_0048465_641_2305 | 526 |
| 618 | 3300046690 | Ga0495624_0104552 | Ga0495624_0104552_28_1692 | 526 |
| 619 | 3300046809 | Ga0495600_0007929 | Ga0495600_0007929_1617_3281 | 526 |
| 620 | 3300047317 | Ga0495604_0011912 | Ga0495604_0011912_1736_3400 | 526 |
| 621 | 3300047322 | Ga0495680_0021408 | Ga0495680_0021408_2495_4159 | 526 |
| 622 | 3300048088 | Ga0495602_0049002 | Ga0495602_0049002_1373_3037 | 526 |
| 623 | 3300048903 | Ga0496100_0035465 | Ga0496100_0035465_1181_2854 | 526 |
| 624 | 3300048904 | Ga0496101_0001168 | Ga0496101_0001168_10863_12536 | 526 |
| 625 | 3300048905 | Ga0496102_0022609 | Ga0496102_0022609_131_1816 | 526 |
| 626 | 3300048906 | Ga0496103_0013712 | Ga0496103_0013712_1663_3348 | 526 |
| 627 | 3300048907 | Ga0496104_0007997 | Ga0496104_0007997_2512_4185 | 526 |
| 628 | 3300048908 | Ga0496105_0085986 | Ga0496105_0085986_778_2451 | 526 |
| 629 | 3300048909 | Ga0496106_0050790 | Ga0496106_0050790_179_1864 | 526 |
| 630 | 3300048910 | Ga0496107_0009722 | Ga0496107_0009722_2555_4228 | 526 |
| 631 | 3300048912 | Ga0496109_0030042 | Ga0496109_0030042_1546_3210 | 526 |
| 632 | 3300048917 | Ga0496114_0060739 | Ga0496114_0060739_1122_2795 | 526 |
| 633 | 3300049569 | Ga0501032_0083472 | Ga0501032_0083472_351_2024 | 526 |
| 634 | 3300049578 | Ga0501042_0035034 | Ga0501042_0035034_212_1885 | 526 |
| 635 | 3300049583 | Ga0501067_0006119 | Ga0501067_0006119_3829_5526 | 526 |
| 636 | 3300049584 | Ga0501068_0018379 | Ga0501068_0018379_1711_3384 | 526 |
| 637 | 3300049585 | Ga0501069_0007943 | Ga0501069_0007943_2743_4440 | 526 |
| 638 | 3300049741 | Ga0501079_0069935 | Ga0501079_0069935_568_2241 | 526 |
| 639 | 3300049742 | Ga0501080_0050432 | Ga0501080_0050432_1650_3323 | 526 |
| 640 | 3300049824 | Ga0501045_0018554 | Ga0501045_0018554_519_2192 | 526 |
| 641 | 3300050490 | nmdc:mga03n38_9379_c1 | nmdc:mga03n38_9379_c1_1080_2759 | 526 |
| 642 | 3300050491 | nmdc:mga00v17_2906_c1 | nmdc:mga00v17_2906_c1_832_2511 | 526 |
| 643 | 3300050507 | nmdc:mga05p37_109354_c1 | nmdc:mga05p37_109354_c1_1660_3318 | 526 |
| 644 | 3300050507 | nmdc:mga05p37_232554_c1 | nmdc:mga05p37_232554_c1_342_2000 | 526 |
| 645 | 3300050511 | nmdc:mga08y16_43231_c1 | nmdc:mga08y16_43231_c1_1558_3216 | 526 |
| 646 | 3300050516 | nmdc:mga0sz30_888_c1 | nmdc:mga0sz30_888_c1_3930_5609 | 526 |
| 647 | 3300050516 | nmdc:mga0sz30_888_c1 | nmdc:mga0sz30_888_c1_7250_8929 | 526 |
| 648 | 3300053078 | Ga0495612_0000045 | Ga0495612_0000045_48239_49924 | 526 |
| 649 | 3300053078 | Ga0495612_0011410 | Ga0495612_0011410_1278_2942 | 526 |
| 650 | 3300054114 | Ga0501084_0072999 | Ga0501084_0072999_936_2609 | 526 |
| 651 | 3300003373 | JGI25407J50210_10000506 | JGI25407J50210_100005061 | 527 |
| 652 | 3300003373 | JGI25407J50210_10005943 | JGI25407J50210_100059432 | 527 |
| 653 | 3300005329 | Ga0070683_100122150 | Ga0070683_1001221502 | 527 |
| 654 | 3300005434 | Ga0070709_10003538 | Ga0070709_100035383 | 527 |
| 655 | 3300005435 | Ga0070714_100001289 | Ga0070714_10000128910 | 527 |
| 656 | 3300005436 | Ga0070713_100002106 | Ga0070713_1000021061 | 527 |
| 657 | 3300005437 | Ga0070710_10000632 | Ga0070710_100006327 | 527 |
| 658 | 3300005439 | Ga0070711_100000406 | Ga0070711_1000004067 | 527 |
| 659 | 3300005439 | Ga0070711_100004936 | Ga0070711_1000049367 | 527 |
| 660 | 3300005543 | Ga0070672_100015506 | Ga0070672_1000155062 | 527 |
| 661 | 3300005548 | Ga0070665_100040944 | Ga0070665_1000409443 | 527 |
| 662 | 3300005614 | Ga0068856_100014225 | Ga0068856_1000142254 | 527 |
| 663 | 3300005844 | Ga0068862_100019587 | Ga0068862_1000195873 | 527 |
| 664 | 3300005981 | Ga0081538_10001053 | Ga0081538_1000105314 | 527 |
| 665 | 3300005981 | Ga0081538_10007573 | Ga0081538_100075735 | 527 |
| 666 | 3300005981 | Ga0081538_10028282 | Ga0081538_100282823 | 527 |
| 667 | 3300005981 | Ga0081538_10048950 | Ga0081538_100489502 | 527 |
| 668 | 3300005981 | Ga0081538_10050535 | Ga0081538_100505352 | 527 |
| 669 | 3300006028 | Ga0070717_10001937 | Ga0070717_100019373 | 527 |
| 670 | 3300006173 | Ga0070716_100001381 | Ga0070716_1000013815 | 527 |
| 671 | 3300006175 | Ga0070712_100001990 | Ga0070712_1000019907 | 527 |
| 672 | 3300006844 | Ga0075428_100018814 | Ga0075428_1000188142 | 527 |
| 673 | 3300006844 | Ga0075428_100051074 | Ga0075428_1000510743 | 527 |
| 674 | 3300006844 | Ga0075428_100099806 | Ga0075428_1000998063 | 527 |
| 675 | 3300006846 | Ga0075430_100013964 | Ga0075430_1000139647 | 527 |
| 676 | 3300006847 | Ga0075431_100131223 | Ga0075431_1001312232 | 527 |
| 677 | 3300006880 | Ga0075429_100012045 | Ga0075429_1000120453 | 527 |
| 678 | 3300009147 | Ga0114129_10008528 | Ga0114129_100085283 | 527 |
| 679 | 3300009147 | Ga0114129_10068328 | Ga0114129_100683286 | 527 |
| 680 | 3300013296 | Ga0157374_10014687 | Ga0157374_100146876 | 527 |
| 681 | 3300025898 | Ga0207692_10000452 | Ga0207692_100004523 | 527 |
| 682 | 3300025906 | Ga0207699_10000483 | Ga0207699_1000048316 | 527 |
| 683 | 3300025907 | Ga0207645_10003459 | Ga0207645_100034596 | 527 |
| 684 | 3300025915 | Ga0207693_10010139 | Ga0207693_100101392 | 527 |
| 685 | 3300025928 | Ga0207700_10000175 | Ga0207700_1000017513 | 527 |
| 686 | 3300025929 | Ga0207664_10000254 | Ga0207664_1000025442 | 527 |
| 687 | 3300025929 | Ga0207664_10036714 | Ga0207664_100367142 | 527 |
| 688 | 3300025933 | Ga0207706_10008035 | Ga0207706_100080356 | 527 |
| 689 | 3300025937 | Ga0207669_10013760 | Ga0207669_100137603 | 527 |
| 690 | 3300025938 | Ga0207704_10016428 | Ga0207704_100164283 | 527 |
| 691 | 3300025939 | Ga0207665_10001164 | Ga0207665_100011646 | 527 |
| 692 | 3300025940 | Ga0207691_10013938 | Ga0207691_100139383 | 527 |
| 693 | 3300026075 | Ga0207708_10123887 | Ga0207708_101238872 | 527 |
| 694 | 3300026078 | Ga0207702_10041502 | Ga0207702_100415022 | 527 |
| 695 | 3300026095 | Ga0207676_10076934 | Ga0207676_100769341 | 527 |
| 696 | 3300026118 | Ga0207675_100026000 | Ga0207675_1000260002 | 527 |
| 697 | 3300026118 | Ga0207675_100033823 | Ga0207675_1000338233 | 527 |
| 698 | 3300026121 | Ga0207683_10119508 | Ga0207683_101195081 | 527 |
| 699 | 3300027682 | Ga0209971_1003082 | Ga0209971_10030822 | 527 |
| 700 | 3300028379 | Ga0268266_10011782 | Ga0268266_100117824 | 527 |
| 701 | 3300028381 | Ga0268264_10060150 | Ga0268264_100601503 | 527 |
| 702 | 3300031691 | Ga0316579_10000086 | Ga0316579_100000865 | 527 |
| 703 | 3300033179 | Ga0307507_10029090 | Ga0307507_100290902 | 527 |
| 704 | 3300033180 | Ga0307510_10049577 | Ga0307510_100495773 | 527 |
| 705 | 3300035083 | Ga0373926_0021691 | Ga0373926_0021691_310_2022 | 527 |
| 706 | 3300035725 | Ga0373947_0040116 | Ga0373947_0040116_630_2336 | 527 |
| 707 | 3300036712 | Ga0316584_0001021 | Ga0316584_0001021_4308_6140 | 527 |
| 708 | 3300037312 | Ga0395899_0088272 | Ga0395899_0088272_41_1711 | 527 |
| 709 | 3300037418 | Ga0395900_0032163 | Ga0395900_0032163_3667_5361 | 527 |
| 710 | 3300037466 | Ga0395898_0027247 | Ga0395898_0027247_3206_4900 | 527 |
| 711 | 3300038735 | Ga0400485_04221 | Ga0400485_04221_22968_24659 | 527 |
| 712 | 3300038742 | Ga0400486_29215 | Ga0400486_29215_51450_53141 | 527 |
| 713 | 3300039437 | Ga0436365_0269776 | Ga0436365_0269776_685_2376 | 527 |
| 714 | 3300041411 | Ga0439466_0015543 | Ga0439466_0015543_252_1949 | 527 |
| 715 | 3300042002 | Ga0439442_001772 | Ga0439442_001772_1584_3281 | 527 |
| 716 | 3300044694 | Ga0466963_0023881 | Ga0466963_0023881_1787_3478 | 527 |
| 717 | 3300044765 | Ga0466970_0039847 | Ga0466970_0039847_474_2177 | 527 |
| 718 | 3300046459 | Ga0495629_0006511 | Ga0495629_0006511_2207_3913 | 527 |
| 719 | 3300046459 | Ga0495629_0054628 | Ga0495629_0054628_20_1732 | 527 |
| 720 | 3300046462 | Ga0495651_0000950 | Ga0495651_0000950_14466_16178 | 527 |
| 721 | 3300046463 | Ga0495653_0019344 | Ga0495653_0019344_3056_4768 | 527 |
| 722 | 3300046500 | Ga0495596_0027897 | Ga0495596_0027897_432_2147 | 527 |
| 723 | 3300046514 | Ga0495618_0007289 | Ga0495618_0007289_3429_5141 | 527 |
| 724 | 3300046536 | Ga0495587_0000345 | Ga0495587_0000345_17103_18815 | 527 |
| 725 | 3300046543 | Ga0495645_0015832 | Ga0495645_0015832_1192_2904 | 527 |
| 726 | 3300046678 | Ga0495599_0000694 | Ga0495599_0000694_11170_12882 | 527 |
| 727 | 3300047319 | Ga0495674_0101419 | Ga0495674_0101419_114_1820 | 527 |
| 728 | 3300047471 | Ga0495684_0014181 | Ga0495684_0014181_1670_3382 | 527 |
| 729 | 3300047673 | Ga0495593_0010305 | Ga0495593_0010305_2288_3994 | 527 |
| 730 | 3300048904 | Ga0496101_0122493 | Ga0496101_0122493_137_1834 | 527 |
| 731 | 3300048905 | Ga0496102_0090280 | Ga0496102_0090280_988_2694 | 527 |
| 732 | 3300048907 | Ga0496104_0026568 | Ga0496104_0026568_3396_5102 | 527 |
| 733 | 3300048911 | Ga0496108_0005691 | Ga0496108_0005691_7157_8863 | 527 |
| 734 | 3300049572 | Ga0501036_0050785 | Ga0501036_0050785_84_1760 | 527 |
| 735 | 3300049587 | Ga0501071_0064774 | Ga0501071_0064774_100_1776 | 527 |
| 736 | 3300049587 | Ga0501071_0099626 | Ga0501071_0099626_191_1867 | 527 |
| 737 | 3300049588 | Ga0501072_0011366 | Ga0501072_0011366_4453_6129 | 527 |
| 738 | 3300049588 | Ga0501072_0037586 | Ga0501072_0037586_493_2169 | 527 |
| 739 | 3300049590 | Ga0501074_0048048 | Ga0501074_0048048_925_2601 | 527 |
| 740 | 3300049590 | Ga0501074_0056828 | Ga0501074_0056828_282_1955 | 527 |
| 741 | 3300049591 | Ga0501075_0006451 | Ga0501075_0006451_2097_3773 | 527 |
| 742 | 3300049592 | Ga0501076_0003785 | Ga0501076_0003785_6634_8310 | 527 |
| 743 | 3300049592 | Ga0501076_0046607 | Ga0501076_0046607_306_1973 | 527 |
| 744 | 3300049741 | Ga0501079_0047322 | Ga0501079_0047322_74_1750 | 527 |
| 745 | 3300049824 | Ga0501045_0005816 | Ga0501045_0005816_6583_8259 | 527 |
| 746 | 3300050507 | nmdc:mga05p37_13837_c1 | nmdc:mga05p37_13837_c1_4923_6623 | 527 |
| 747 | 3300050507 | nmdc:mga05p37_21425_c1 | nmdc:mga05p37_21425_c1_40_1749 | 527 |
| 748 | 3300050509 | nmdc:mga0qj67_21404_c1 | nmdc:mga0qj67_21404_c1_1977_3713 | 527 |
| 749 | 3300050510 | nmdc:mga06r32_154516_c1 | nmdc:mga06r32_154516_c1_360_2060 | 527 |
| 750 | 3300054114 | Ga0501084_0059362 | Ga0501084_0059362_96_1802 | 527 |
| 751 | 3300060353 | Ga0501082_0051802 | Ga0501082_0051802_672_2348 | 527 |
| 752 | 3300005339 | Ga0070660_100083828 | Ga0070660_1000838281 | 528 |
| 753 | 3300005438 | Ga0070701_10003882 | Ga0070701_100038826 | 528 |
| 754 | 3300005457 | Ga0070662_100072803 | Ga0070662_1000728032 | 528 |
| 755 | 3300005544 | Ga0070686_100043391 | Ga0070686_1000433912 | 528 |
| 756 | 3300005615 | Ga0070702_100015201 | Ga0070702_1000152014 | 528 |
| 757 | 3300005615 | Ga0070702_100031922 | Ga0070702_1000319222 | 528 |
| 758 | 3300005617 | Ga0068859_100083643 | Ga0068859_1000836432 | 528 |
| 759 | 3300005842 | Ga0068858_100062741 | Ga0068858_1000627411 | 528 |
| 760 | 3300005843 | Ga0068860_100125205 | Ga0068860_1001252052 | 528 |
| 761 | 3300005985 | Ga0081539_10008727 | Ga0081539_100087279 | 528 |
| 762 | 3300006931 | Ga0097620_100083646 | Ga0097620_1000836462 | 528 |
| 763 | 3300009098 | Ga0105245_10003604 | Ga0105245_1000360412 | 528 |
| 764 | 3300009098 | Ga0105245_10014855 | Ga0105245_100148551 | 528 |
| 765 | 3300009148 | Ga0105243_10036568 | Ga0105243_100365682 | 528 |
| 766 | 3300009148 | Ga0105243_10077905 | Ga0105243_100779053 | 528 |
| 767 | 3300009553 | Ga0105249_10041023 | Ga0105249_100410233 | 528 |
| 768 | 3300009553 | Ga0105249_10103066 | Ga0105249_101030661 | 528 |
| 769 | 3300013308 | Ga0157375_10142663 | Ga0157375_101426632 | 528 |
| 770 | 3300014325 | Ga0163163_10065692 | Ga0163163_100656923 | 528 |
| 771 | 3300014745 | Ga0157377_10010091 | Ga0157377_100100913 | 528 |
| 772 | 3300017792 | Ga0163161_10035175 | Ga0163161_100351752 | 528 |
| 773 | 3300025901 | Ga0207688_10013588 | Ga0207688_100135881 | 528 |
| 774 | 3300025908 | Ga0207643_10052124 | Ga0207643_100521242 | 528 |
| 775 | 3300025918 | Ga0207662_10020897 | Ga0207662_100208972 | 528 |
| 776 | 3300025927 | Ga0207687_10076834 | Ga0207687_100768342 | 528 |
| 777 | 3300025933 | Ga0207706_10014602 | Ga0207706_100146021 | 528 |
| 778 | 3300025935 | Ga0207709_10024884 | Ga0207709_100248842 | 528 |
| 779 | 3300025942 | Ga0207689_10077000 | Ga0207689_100770003 | 528 |
| 780 | 3300025944 | Ga0207661_10031948 | Ga0207661_100319483 | 528 |
| 781 | 3300025961 | Ga0207712_10089524 | Ga0207712_100895241 | 528 |
| 782 | 3300025981 | Ga0207640_10095710 | Ga0207640_100957101 | 528 |
| 783 | 3300026035 | Ga0207703_10096103 | Ga0207703_100961031 | 528 |
| 784 | 3300026075 | Ga0207708_10003064 | Ga0207708_100030642 | 528 |
| 785 | 3300026075 | Ga0207708_10023068 | Ga0207708_100230683 | 528 |
| 786 | 3300048912 | Ga0496109_0094620 | Ga0496109_0094620_377_2098 | 528 |
| 787 | 3300048914 | Ga0496111_0007741 | Ga0496111_0007741_5225_6946 | 528 |
| 788 | 3300048916 | Ga0496113_0053244 | Ga0496113_0053244_878_2599 | 528 |
| 789 | 3300049569 | Ga0501032_0019527 | Ga0501032_0019527_2856_4532 | 528 |
| 790 | 3300049570 | Ga0501033_0019272 | Ga0501033_0019272_2248_3924 | 528 |
| 791 | 3300049572 | Ga0501036_0123814 | Ga0501036_0123814_461_2137 | 528 |
| 792 | 3300049578 | Ga0501042_0033706 | Ga0501042_0033706_1635_3311 | 528 |
| 793 | 3300049579 | Ga0501043_0008879 | Ga0501043_0008879_1941_3617 | 528 |
| 794 | 3300049580 | Ga0501046_0003729 | Ga0501046_0003729_9723_11399 | 528 |
| 795 | 3300049581 | Ga0501047_0037176 | Ga0501047_0037176_1091_2767 | 528 |
| 796 | 3300049582 | Ga0501048_0016916 | Ga0501048_0016916_2360_4036 | 528 |
| 797 | 3300049583 | Ga0501067_0036155 | Ga0501067_0036155_426_2102 | 528 |
| 798 | 3300049586 | Ga0501070_0005087 | Ga0501070_0005087_2854_4530 | 528 |
| 799 | 3300049589 | Ga0501073_0005971 | Ga0501073_0005971_2363_4039 | 528 |
| 800 | 3300049592 | Ga0501076_0098255 | Ga0501076_0098255_264_1940 | 528 |
| 801 | 3300049742 | Ga0501080_0045989 | Ga0501080_0045989_569_2245 | 528 |
| 802 | 3300049742 | Ga0501080_0112681 | Ga0501080_0112681_480_2156 | 528 |
| 803 | 3300049823 | Ga0501044_0069444 | Ga0501044_0069444_1342_3018 | 528 |
| 804 | 3300050513 | nmdc:mga0rr50_62396_c1 | nmdc:mga0rr50_62396_c1_355_2082 | 528 |
| 805 | 3300053153 | Ga0500616_0000116 | Ga0500616_0000116_29461_31158 | 528 |
| 806 | 3300060353 | Ga0501082_0021996 | Ga0501082_0021996_3585_5261 | 528 |
| 807 | 3300061734 | Ga0530510_0011003 | Ga0530510_0011003_1123_2811 | 528 |
| 808 | 3300006038 | Ga0075365_10000949 | Ga0075365_100009493 | 529 |
| 809 | 3300006038 | Ga0075365_10022144 | Ga0075365_100221443 | 529 |
| 810 | 3300050491 | nmdc:mga00v17_75049_c1 | nmdc:mga00v17_75049_c1_81_1799 | 530 |
| 811 | 3300050496 | nmdc:mga07m45_62683_c1 | nmdc:mga07m45_62683_c1_240_1958 | 530 |
| 812 | 3300046683 | Ga0495658_0047831 | Ga0495658_0047831_223_1896 | 532 |
| 813 | 3300025919 | Ga0207657_10097186 | Ga0207657_100971862 | 533 |
| 814 | 3300001979 | JGI24740J21852_10030136 | JGI24740J21852_100301361 | 535 |
| 815 | 3300005336 | Ga0070680_100028450 | Ga0070680_1000284502 | 535 |
| 816 | 3300005337 | Ga0070682_100006888 | Ga0070682_1000068882 | 535 |
| 817 | 3300005354 | Ga0070675_100025862 | Ga0070675_1000258623 | 535 |
| 818 | 3300005364 | Ga0070673_100133716 | Ga0070673_1001337161 | 535 |
| 819 | 3300005617 | Ga0068859_100016083 | Ga0068859_1000160835 | 535 |
| 820 | 3300005843 | Ga0068860_100125179 | Ga0068860_1001251792 | 535 |
| 821 | 3300005844 | Ga0068862_100006418 | Ga0068862_1000064184 | 535 |
| 822 | 3300006931 | Ga0097620_100016083 | Ga0097620_1000160835 | 535 |
| 823 | 3300009093 | Ga0105240_10015116 | Ga0105240_100151166 | 535 |
| 824 | 3300009545 | Ga0105237_10017504 | Ga0105237_100175045 | 535 |
| 825 | 3300010375 | Ga0105239_10035997 | Ga0105239_100359972 | 535 |
| 826 | 3300013104 | Ga0157370_10053348 | Ga0157370_100533482 | 535 |
| 827 | 3300013306 | Ga0163162_10000494 | Ga0163162_1000049411 | 535 |
| 828 | 3300014745 | Ga0157377_10002124 | Ga0157377_100021246 | 535 |
| 829 | 3300025911 | Ga0207654_10025416 | Ga0207654_100254162 | 535 |
| 830 | 3300025912 | Ga0207707_10001291 | Ga0207707_1000129121 | 535 |
| 831 | 3300025914 | Ga0207671_10093013 | Ga0207671_100930132 | 535 |
| 832 | 3300025923 | Ga0207681_10047349 | Ga0207681_100473492 | 535 |
| 833 | 3300025933 | Ga0207706_10008590 | Ga0207706_100085902 | 535 |
| 834 | 3300025960 | Ga0207651_10033192 | Ga0207651_100331922 | 535 |
| 835 | 3300025972 | Ga0207668_10018510 | Ga0207668_100185104 | 535 |
| 836 | 3300026118 | Ga0207675_100010338 | Ga0207675_1000103384 | 535 |
| 837 | 3300028380 | Ga0268265_10003009 | Ga0268265_100030096 | 535 |
| 838 | 3300028381 | Ga0268264_10020902 | Ga0268264_100209022 | 535 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7r36-assembly1.cif.gz_A | difference-refined structure of fatty acid photodecarboxylase 2 microsecond following 400-nm laser irradiation of the dark-state determined by sfx | 0.9381 | 1 | 524 |
| 5oc1-assembly1.cif.gz_A | crystal structure of aryl-alcohol oxidase from pleurotus eryngii in complex with p-anisic acid | 0.9332 | 5 | 521 |
| 8bxl-assembly3.cif.gz_E | patulin synthase from penicillium expansum | 0.9322 | 3 | 521 |
| 3fim-assembly1.cif.gz_B | crystal structure of aryl-alcohol-oxidase from pleurotus eryingii | 0.9299 | 5 | 521 |
| 5zu3-assembly2.cif.gz_B | effect of mutation (r554k) on fad modification in aspergillus oryzae rib40formate oxidase | 0.9249 | 3 | 519 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FV11_9_533_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9867 | 6 | 513 | 3.50.50.60 |
| af_P17444_4_531_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9827 | 6 | 517 | 3.50.50.60 |
| af_Q6UPE0_47_576_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9728 | 7 | 517 | 3.50.50.60 |
| af_Q2FV11_9_533_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9531 | 6 | 513 | 3.50.50.60 |
| af_P17444_4_531_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9514 | 6 | 517 | 3.50.50.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y2DR00-F1-model_v4 | Choline dehydrogenase (EC 1.1.99.1) | 0.9925 | 64 | 531 |
GO:0008812
GO:0016020 GO:0019285 GO:0050660 |
| AF-H0TAE6-F1-model_v4 | Choline dehydrogenase, a flavoprotein alcohol dehydrogenase (EC 1.1.99.1) | 0.9906 | 374 | 519 |
GO:0008812
GO:0050660 |
| AF-A0A183AWR9-F1-model_v4 | GMC_OxRdtase_N domain-containing protein | 0.9868 | 115 | 255 |
GO:0005743
GO:0008812 GO:0050660 |
| AF-A0A6B0CXT1-F1-model_v4 | Choline dehydrogenase (EC 1.1.99.1) | 0.9858 | 61 | 533 |
GO:0008812
GO:0016020 GO:0019285 GO:0050660 |
| AF-A0A536W501-F1-model_v4 | Choline dehydrogenase | 0.985 | 374 | 519 |
GO:0016614
GO:0050660 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar