F482808

General Info

Members Datasets Scaffolds Average Seq Length
834 383 808 218

Family's Representative Sequence

Representative Sequence 3300046691|Ga0495670_0021536|Ga0495670_0021536_203_862
Length 212
Sequence MAQAPETHDDALHRRGLMFILSSPSGAGKTTISRKLLEHDGRIGMSVSVTTRPPRPGEVDGKDYIFKSQAQFDQMVEDGHFLEWAHVFGHSYGTPKAQIKAFLFDIDWQGTQQLYQKAETDVVRVFLLPPSLDELRRRLTSRGTDSAEVIAGRMARAQAEISHWDGYDYVVVNDDIDVCFDKVVQILAAERLSRARQTGLIGFVRELTRPEA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
3 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
4 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
5 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
6 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
7 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
8 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
9 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
10 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
11 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
12 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
13 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
14 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
15 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
16 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
17 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
18 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
19 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
20 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
21 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
22 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
23 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
24 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
25 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
26 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
27 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
28 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
29 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
30 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
31 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
32 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
33 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
34 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
35 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
36 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
37 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
38 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
39 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
40 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
41 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
42 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
43 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
44 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
45 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
46 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
47 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
48 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
49 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
50 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
51 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
52 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
53 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
54 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
55 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
56 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
57 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
58 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
59 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
60 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
61 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
62 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
63 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
64 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
65 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
66 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
67 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
68 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
69 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
70 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
71 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
72 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
73 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
74 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
75 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
76 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
77 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
78 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
79 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
80 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
81 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
82 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
83 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
84 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
85 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
86 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
87 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
88 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
89 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
90 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
91 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
92 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
93 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
94 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
95 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
96 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
97 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
98 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
99 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
101 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
102 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
104 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
105 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
106 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
107 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
108 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
109 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
111 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
112 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
113 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
114 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
115 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
116 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
117 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
118 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
119 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
120 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
121 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
122 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
123 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
124 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
125 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
126 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
127 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
128 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
129 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
130 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
131 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
132 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
133 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
134 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
135 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
136 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
137 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
139 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
140 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
142 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
143 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
147 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
149 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
203 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
207 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
208 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
209 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
210 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
211 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
212 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
213 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
214 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
215 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
216 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
217 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
218 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
219 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
220 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
221 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
222 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
223 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
224 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
225 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
226 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
227 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
228 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
229 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
230 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
231 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
232 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
233 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
234 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
235 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
236 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
237 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
238 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
239 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
240 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
241 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
242 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
243 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
244 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
245 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
246 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
247 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
248 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
249 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
250 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
251 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
252 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
253 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
254 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
255 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
256 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
257 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
258 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
259 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
260 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
261 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
262 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
263 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
264 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
265 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
266 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
267 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
268 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
269 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
270 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
271 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
272 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
273 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
274 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
275 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
276 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
277 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
278 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
279 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
280 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
281 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
282 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
283 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
284 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
285 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
286 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
287 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
288 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
289 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
290 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
291 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
292 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
293 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
294 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
295 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
296 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
297 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
298 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
299 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
300 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
301 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
302 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
303 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
304 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
305 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
306 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
307 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
308 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
309 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
310 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
311 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
312 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
313 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
314 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
315 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
316 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
317 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
318 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
319 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
328 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
329 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
330 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
331 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
332 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
333 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
334 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
335 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
336 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
337 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
338 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
339 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
340 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
341 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
342 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
343 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
344 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
345 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
346 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
348 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
349 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
350 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
351 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
352 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
353 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
354 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
355 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
356 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
357 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
358 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
359 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
360 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
361 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
362 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
363 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
364 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
365 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
366 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
367 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
368 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
369 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
370 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
371 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
372 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
373 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
374 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
375 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
376 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
377 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
378 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
379 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
380 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
381 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
382 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
383 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.76
Metatranscriptomes 0.12
Isolates 3.12

Biome Distribution

Category Percentage (%)
Aerial Root 0.6
Bulb 0
Endosphere 10.79
Nodule 0.12
Rhizoplane 3.84
Rhizosphere 73.02
Stem 0
Stem Tuber 0
Unclassified 11.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3660702 2162886007 Bacteria 11509
2 JGI24736J21556_1000235 3300001904 Bacteria 10063
3 JGI24741J21665_1000124 3300001915 Bacteria 20973
4 JGI24752J21851_1000586 3300001976 Bacteria 4846
5 JGI24740J21852_10003311 3300001979 Bacteria 7098
6 JGI24740J21852_10028989 3300001979 Bacteria 1823
7 JGI24740J21852_10058057 3300001979 Bacteria 1078
8 JGI24739J22299_10001891 3300001989 Bacteria 8000
9 JGI24737J22298_10003492 3300001990 Bacteria 5545
10 JGI24737J22298_10006196 3300001990 Bacteria 4096
11 JGI24737J22298_10040310 3300001990 Bacteria 1434
12 JGI24737J22298_10084090 3300001990 Bacteria 946
13 JGI24743J22301_10012544 3300001991 Bacteria 1543
14 JGI24735J21928_10000699 3300002067 Bacteria 11907
15 JGI24735J21928_10009713 3300002067 Bacteria 3082
16 JGI24735J21928_10009810 3300002067 Bacteria 3066
17 JGI24735J21928_10012405 3300002067 Bacteria 2693
18 JGI24735J21928_10012704 3300002067 Bacteria 2659
19 JGI24735J21928_10027489 3300002067 Bacteria 1705
20 JGI24735J21928_10054782 3300002067 Bacteria 1149
21 JGI24738J21930_10002736 3300002075 Bacteria 4536
22 JGI24738J21930_10004755 3300002075 Bacteria 3302
23 JGI24738J21930_10015195 3300002075 Bacteria 1642
24 JGI24738J21930_10020901 3300002075 Bacteria 1360
25 JGI24749J21850_1000352 3300002076 Bacteria 6855
26 JGI24744J21845_10000115 3300002077 Bacteria 10973
27 JGI24035J26624_1003524 3300002126 Bacteria 1476
28 JGI24751J29686_10000208 3300002459 Bacteria 25368
29 JGI25150J39212_1003534 3300002774 Bacteria 3648
30 JGI25151J46595_10037612 3300003187 Bacteria 1813
31 JGI25165J46597_1000534 3300003214 Bacteria 35395
32 JGI25153J46596_10000186 3300003215 Bacteria 60427
33 rootL2_10042168 3300003322 Bacteria 1995
34 Ga0055542_1003000 3300003762 Bacteria 4916
35 Ga0055526_1012603 3300003771 Bacteria 3669
36 Ga0055536_1016085 3300003781 Bacteria 2521
37 Ga0055530_10000064 3300003791 Bacteria 94475
38 Ga0055530_10037267 3300003791 Bacteria 1218
39 Ga0055540_1000768 3300003792 Bacteria 21808
40 Ga0055540_1002060 3300003792 Bacteria 11094
41 Ga0055531_10000073 3300003794 Bacteria 109510
42 Ga0065165_1056282 3300005262 Bacteria 1094
43 Ga0065704_10000192 3300005289 Bacteria 216848
44 Ga0065704_10000914 3300005289 Bacteria 11453
45 Ga0065704_10003296 3300005289 Bacteria 4388
46 Ga0065704_10070989 3300005289 Bacteria 13960
47 Ga0065704_10077790 3300005289 Bacteria 4619
48 Ga0065707_10084356 3300005295 Bacteria 7311
49 Ga0065707_10086371 3300005295 Bacteria 5505
50 Ga0070658_10001154 3300005327 Bacteria 22529
51 Ga0070658_10012339 3300005327 Bacteria 6861
52 Ga0070676_10000448 3300005328 Bacteria 19663
53 Ga0070683_100276977 3300005329 Bacteria 1596
54 Ga0070683_100532952 3300005329 Bacteria 1122
55 Ga0070670_100000024 3300005331 Bacteria 189811
56 Ga0070670_100003502 3300005331 Bacteria 13049
57 Ga0070670_100035441 3300005331 Bacteria 4295
58 Ga0068869_100002661 3300005334 Bacteria 10794
59 Ga0070666_10000111 3300005335 Bacteria 56117
60 Ga0070666_10001747 3300005335 Bacteria 13257
61 Ga0070666_10051148 3300005335 Bacteria 2781
62 Ga0070666_10062591 3300005335 Bacteria 2521
63 Ga0070666_10098313 3300005335 Bacteria 2015
64 Ga0070666_10456715 3300005335 Bacteria 923
65 Ga0068868_100000910 3300005338 Bacteria 20102
66 Ga0070660_100009320 3300005339 Bacteria 6897
67 Ga0070660_100058583 3300005339 Bacteria 2986
68 Ga0070660_100135929 3300005339 Bacteria 1970
69 Ga0070660_100149113 3300005339 Bacteria 1880
70 Ga0070660_100166856 3300005339 Bacteria 1777
71 Ga0070661_100008203 3300005344 Bacteria 7203
72 Ga0070661_100261922 3300005344 Bacteria 1337
73 Ga0070668_100000027 3300005347 Bacteria 89913
74 Ga0070668_100000041 3300005347 Bacteria 78742
75 Ga0070668_100008132 3300005347 Bacteria 7792
76 Ga0070668_100024451 3300005347 Bacteria 4578
77 Ga0070668_100027686 3300005347 Bacteria 4303
78 Ga0070668_100084870 3300005347 Bacteria 2488
79 Ga0070668_100135504 3300005347 Bacteria 1980
80 Ga0070669_100000012 3300005353 Bacteria 211302
81 Ga0070669_100000047 3300005353 Bacteria 118892
82 Ga0070669_100005445 3300005353 Bacteria 9185
83 Ga0070669_100010694 3300005353 Bacteria 6514
84 Ga0070669_100054887 3300005353 Bacteria 2919
85 Ga0070669_100218101 3300005353 Bacteria 1508
86 Ga0070675_100071809 3300005354 Bacteria 2873
87 Ga0070671_100000019 3300005355 Bacteria 132341
88 Ga0070671_100000517 3300005355 Bacteria 27085
89 Ga0070671_100002891 3300005355 Bacteria 13371
90 Ga0070671_100003218 3300005355 Bacteria 12731
91 Ga0070671_100023173 3300005355 Bacteria 5077
92 Ga0070671_100057465 3300005355 Bacteria 3238
93 Ga0070674_100019915 3300005356 Bacteria 4274
94 Ga0070673_100000020 3300005364 Bacteria 102632
95 Ga0070659_100140337 3300005366 Bacteria 1967
96 Ga0070659_100233254 3300005366 Bacteria 1521
97 Ga0070659_100287872 3300005366 Bacteria 1368
98 Ga0070667_100000017 3300005367 Bacteria 230531
99 Ga0070667_100000058 3300005367 Bacteria 148071
100 Ga0070667_100000143 3300005367 Bacteria 90358
101 Ga0070667_100005804 3300005367 Bacteria 10302
102 Ga0070667_100012087 3300005367 Bacteria 7148
103 Ga0070667_100016472 3300005367 Bacteria 6117
104 Ga0070667_100113572 3300005367 Bacteria 2351
105 Ga0070705_100004405 3300005440 Bacteria 6859
106 Ga0070708_100912558 3300005445 Bacteria 825
107 Ga0070663_100001418 3300005455 Bacteria 13103
108 Ga0070678_100005895 3300005456 Bacteria 7126
109 Ga0070662_100032068 3300005457 Bacteria 3691
110 Ga0070662_100394559 3300005457 Bacteria 1141
111 Ga0068867_100000155 3300005459 Bacteria 43934
112 Ga0070685_10016519 3300005466 Bacteria 3934
113 Ga0070685_10505431 3300005466 Bacteria 856
114 Ga0068853_100070689 3300005539 Bacteria 3038
115 Ga0068853_100086514 3300005539 Bacteria 2749
116 Ga0068853_100089633 3300005539 Bacteria 2702
117 Ga0068853_100265068 3300005539 Bacteria 1580
118 Ga0068853_100315074 3300005539 Bacteria 1449
119 Ga0070665_100001012 3300005548 Bacteria 35432
120 Ga0070665_100010368 3300005548 Bacteria 9429
121 Ga0068855_100002050 3300005563 Bacteria 24977
122 Ga0068855_100121831 3300005563 Bacteria 2985
123 Ga0068855_100629612 3300005563 Bacteria 1154
124 Ga0070664_100014905 3300005564 Bacteria 6342
125 Ga0070664_100490854 3300005564 Bacteria 1131
126 Ga0068857_100013486 3300005577 Bacteria 7119
127 Ga0068857_100059205 3300005577 Bacteria 3402
128 Ga0068857_100108610 3300005577 Bacteria 2493
129 Ga0068857_100121731 3300005577 Bacteria 2350
130 Ga0068857_100309780 3300005577 Bacteria 1456
131 Ga0068854_100002936 3300005578 Bacteria 10575
132 Ga0068854_100268072 3300005578 Bacteria 1370
133 Ga0068854_100340174 3300005578 Bacteria 1225
134 Ga0068856_100008231 3300005614 Bacteria 10165
135 Ga0068856_100019646 3300005614 Bacteria 6557
136 Ga0070702_100041902 3300005615 Bacteria 2571
137 Ga0068852_100010016 3300005616 Bacteria 7052
138 Ga0068852_100483302 3300005616 Bacteria 1231
139 Ga0068852_100491236 3300005616 Bacteria 1221
140 Ga0068852_100493014 3300005616 Bacteria 1219
141 Ga0068859_100038244 3300005617 Bacteria 4814
142 Ga0068859_100062917 3300005617 Bacteria 3741
143 Ga0068859_100092658 3300005617 Bacteria 3073
144 Ga0068859_100190175 3300005617 Bacteria 2137
145 Ga0068859_100588416 3300005617 Bacteria 1206
146 Ga0068864_100000036 3300005618 Bacteria 189811
147 Ga0068864_100000475 3300005618 Bacteria 34778
148 Ga0068864_100004795 3300005618 Bacteria 11081
149 Ga0068864_100159134 3300005618 Bacteria 2052
150 Ga0068861_100002169 3300005719 Bacteria 12735
151 Ga0068861_100005201 3300005719 Bacteria 8770
152 Ga0068861_100021348 3300005719 Bacteria 4654
153 Ga0068851_10013802 3300005834 Bacteria 3825
154 Ga0068851_10077709 3300005834 Bacteria 1728
155 Ga0068851_10160609 3300005834 Bacteria 1234
156 Ga0068863_100000031 3300005841 Bacteria 175602
157 Ga0068863_100001489 3300005841 Bacteria 23203
158 Ga0068863_100002193 3300005841 Bacteria 19382
159 Ga0068863_100005824 3300005841 Bacteria 12076
160 Ga0068863_100007418 3300005841 Bacteria 10732
161 Ga0068863_100031052 3300005841 Bacteria 5102
162 Ga0068858_100000103 3300005842 Bacteria 88754
163 Ga0068858_100021883 3300005842 Bacteria 5971
164 Ga0068858_100204130 3300005842 Bacteria 1870
165 Ga0068860_100000056 3300005843 Bacteria 202751
166 Ga0068860_100000181 3300005843 Bacteria 101627
167 Ga0068860_100022971 3300005843 Bacteria 6031
168 Ga0068860_100031058 3300005843 Bacteria 5136
169 Ga0068860_100031678 3300005843 Bacteria 5083
170 Ga0068860_100078368 3300005843 Bacteria 3142
171 Ga0068860_100324700 3300005843 Bacteria 1511
172 Ga0068862_100000033 3300005844 Bacteria 176515
173 Ga0068862_100000187 3300005844 Bacteria 68303
174 Ga0068862_100000884 3300005844 Bacteria 29162
175 Ga0068862_100005927 3300005844 Bacteria 10176
176 Ga0068862_100030592 3300005844 Bacteria 4538
177 Ga0068862_100128025 3300005844 Bacteria 2243
178 Ga0068862_100235818 3300005844 Bacteria 1661
179 Ga0081539_10016956 3300005985 Bacteria 5158
180 Ga0075368_10001355 3300006042 Bacteria 7790
181 Ga0075364_10166195 3300006051 Bacteria 1491
182 Ga0075367_10001026 3300006178 Bacteria 11507
183 Ga0075366_10034983 3300006195 Bacteria 2961
184 Ga0075366_10117135 3300006195 Bacteria 1604
185 Ga0097621_100005590 3300006237 Bacteria 8863
186 Ga0075370_10002503 3300006353 Bacteria 8532
187 Ga0068865_100000272 3300006881 Bacteria 28389
188 Ga0097620_100038244 3300006931 Bacteria 4814
189 Ga0097620_100062917 3300006931 Bacteria 3741
190 Ga0097620_100092661 3300006931 Bacteria 3073
191 Ga0097620_100190181 3300006931 Bacteria 2137
192 Ga0097620_100588387 3300006931 Bacteria 1206
193 Ga0099826_10138471 3300006948 Bacteria 1410
194 Ga0105251_10004489 3300009011 Bacteria 9471
195 Ga0105251_10015704 3300009011 Bacteria 4126
196 Ga0105251_10032668 3300009011 Bacteria 2591
197 Ga0105251_10035471 3300009011 Bacteria 2461
198 Ga0105250_10032780 3300009092 Bacteria 2086
199 Ga0105250_10075779 3300009092 Bacteria 1361
200 Ga0105240_10012649 3300009093 Bacteria 11636
201 Ga0105240_10020042 3300009093 Bacteria 8928
202 Ga0105240_10574747 3300009093 Bacteria 1244
203 Ga0105245_10002130 3300009098 Bacteria 17920
204 Ga0105247_10004441 3300009101 Bacteria 8942
205 Ga0105247_10117922 3300009101 Bacteria 1716
206 Ga0105247_10118724 3300009101 Bacteria 1711
207 Ga0114129_10282114 3300009147 Bacteria 2219
208 Ga0105243_10000711 3300009148 Bacteria 32092
209 Ga0105243_10222341 3300009148 Bacteria 1670
210 Ga0105243_10654438 3300009148 Bacteria 1019
211 Ga0105241_10000807 3300009174 Bacteria 23818
212 Ga0105242_10000320 3300009176 Bacteria 38566
213 Ga0105248_10000091 3300009177 Bacteria 101191
214 Ga0105248_10002773 3300009177 Bacteria 19480
215 Ga0105248_10014281 3300009177 Bacteria 8743
216 Ga0105248_10018898 3300009177 Bacteria 7619
217 Ga0105248_10033589 3300009177 Bacteria 5732
218 Ga0105248_10070358 3300009177 Bacteria 3929
219 Ga0105248_10227998 3300009177 Bacteria 2097
220 Ga0105248_10365850 3300009177 Bacteria 1624
221 Ga0105237_10008796 3300009545 Bacteria 10890
222 Ga0105237_10075759 3300009545 Bacteria 3355
223 Ga0105238_10501816 3300009551 Bacteria 1214
224 Ga0105249_10000553 3300009553 Bacteria 34593
225 Ga0105249_10001384 3300009553 Bacteria 21229
226 Ga0105249_10093615 3300009553 Bacteria 2815
227 Ga0105249_10414876 3300009553 Bacteria 1379
228 Ga0105148_100060 3300009978 Bacteria 17151
229 Ga0105239_10142551 3300010375 Bacteria 2671
230 Ga0105239_10165940 3300010375 Bacteria 2469
231 Ga0105239_10808157 3300010375 Bacteria 1074
232 Ga0105246_10004775 3300011119 Bacteria 8251
233 Ga0157326_1000067 3300012513 Bacteria 10095
234 Ga0157373_10015080 3300013100 Bacteria 5653
235 Ga0157373_10097352 3300013100 Bacteria 2071
236 Ga0157371_10710594 3300013102 Bacteria 753
237 Ga0157370_10000145 3300013104 Bacteria 86693
238 Ga0157370_10013194 3300013104 Bacteria 8521
239 Ga0157370_10704392 3300013104 Bacteria 922
240 Ga0157369_10018860 3300013105 Bacteria 7729
241 Ga0157369_10648922 3300013105 Bacteria 1088
242 Ga0157369_10957018 3300013105 Bacteria 877
243 Ga0157374_10005414 3300013296 Bacteria 10723
244 Ga0157374_10136449 3300013296 Bacteria 2379
245 Ga0157378_10011140 3300013297 Bacteria 7870
246 Ga0163162_10053526 3300013306 Bacteria 4057
247 Ga0163162_10124375 3300013306 Bacteria 2685
248 Ga0163162_10658904 3300013306 Bacteria 1170
249 Ga0157372_10029740 3300013307 Bacteria 5969
250 Ga0157372_10065951 3300013307 Bacteria 4067
251 Ga0157372_10146982 3300013307 Bacteria 2718
252 Ga0157372_10202471 3300013307 Bacteria 2300
253 Ga0157372_10681462 3300013307 Bacteria 1196
254 Ga0157380_10008171 3300014326 Bacteria 7456
255 Ga0157380_10370279 3300014326 Bacteria 1348
256 Ga0157380_10545439 3300014326 Bacteria 1136
257 Ga0157377_10013528 3300014745 Bacteria 4131
258 Ga0157379_10001174 3300014968 Bacteria 21344
259 Ga0157376_10000395 3300014969 Bacteria 28347
260 Ga0183363_1005 3300015690 Bacteria 403020
261 Ga0163161_10038021 3300017792 Bacteria 3450
262 Ga0163161_10057942 3300017792 Bacteria 2815
263 Ga0163161_10153985 3300017792 Bacteria 1749
264 Ga0163161_10364892 3300017792 Bacteria 1151
265 Ga0213874_10064662 3300021377 Bacteria 1154
266 Ga0213876_10200643 3300021384 Bacteria 1060
267 Ga0209147_100881 3300025229 Bacteria 13827
268 Ga0207427_100878 3300025231 Bacteria 13165
269 Ga0207425_1000049 3300025245 Bacteria 180735
270 Ga0209148_1000318 3300025254 Bacteria 67692
271 Ga0209148_1015931 3300025254 Bacteria 1303
272 Ga0209129_1003718 3300025258 Bacteria 6459
273 Ga0209233_1000181 3300025261 Bacteria 138699
274 Ga0209565_1001004 3300025263 Bacteria 14505
275 Ga0209455_1000942 3300025272 Bacteria 14894
276 Ga0209676_1015713 3300025292 Bacteria 2772
277 Ga0209025_1000068 3300025294 Bacteria 294129
278 Ga0209564_1004346 3300025295 Bacteria 8727
279 Ga0209758_1000019 3300025297 Bacteria 743682
280 Ga0209758_1026569 3300025297 Bacteria 2501
281 Ga0209050_1000001 3300025298 Bacteria 3563507
282 Ga0209050_1000010 3300025298 Bacteria 980454
283 Ga0209050_1000108 3300025298 Bacteria 222534
284 Ga0209050_1029301 3300025298 Bacteria 1764
285 Ga0209051_1005046 3300025303 Bacteria 7858
286 Ga0209257_1000027 3300025304 Bacteria 703541
287 Ga0209257_1035415 3300025304 Bacteria 1545
288 Ga0207697_10000003 3300025315 Bacteria 90538
289 Ga0207656_10084618 3300025321 Bacteria 1431
290 Ga0207656_10088066 3300025321 Bacteria 1405
291 Ga0207656_10104901 3300025321 Bacteria 1300
292 Ga0207713_1019134 3300025735 Bacteria 3363
293 Ga0207713_1020886 3300025735 Bacteria 3155
294 Ga0207710_10006744 3300025900 Bacteria 4894
295 Ga0207710_10012555 3300025900 Bacteria 3564
296 Ga0207710_10019525 3300025900 Bacteria 2891
297 Ga0207710_10310503 3300025900 Bacteria 798
298 Ga0207688_10107208 3300025901 Bacteria 1619
299 Ga0207688_10362667 3300025901 Bacteria 894
300 Ga0207680_10000142 3300025903 Bacteria 34278
301 Ga0207680_10000890 3300025903 Bacteria 14105
302 Ga0207680_10015221 3300025903 Bacteria 4010
303 Ga0207680_10024379 3300025903 Bacteria 3320
304 Ga0207680_10084501 3300025903 Bacteria 2003
305 Ga0207647_10000611 3300025904 Bacteria 27863
306 Ga0207647_10003792 3300025904 Bacteria 11296
307 Ga0207647_10004427 3300025904 Bacteria 10414
308 Ga0207647_10022600 3300025904 Bacteria 4174
309 Ga0207647_10029211 3300025904 Bacteria 3570
310 Ga0207647_10220582 3300025904 Bacteria 1093
311 Ga0207645_10011226 3300025907 Bacteria 6126
312 Ga0207705_10001161 3300025909 Bacteria 21450
313 Ga0207705_10003807 3300025909 Bacteria 11473
314 Ga0207705_10055811 3300025909 Bacteria 2848
315 Ga0207705_10593060 3300025909 Bacteria 862
316 Ga0207654_10098004 3300025911 Bacteria 1801
317 Ga0207695_10011414 3300025913 Bacteria 10767
318 Ga0207695_10058839 3300025913 Bacteria 3988
319 Ga0207695_10346807 3300025913 Bacteria 1372
320 Ga0207671_10021473 3300025914 Bacteria 4897
321 Ga0207671_10042931 3300025914 Bacteria 3345
322 Ga0207671_10141452 3300025914 Bacteria 1854
323 Ga0207657_10002758 3300025919 Bacteria 18916
324 Ga0207657_10005094 3300025919 Bacteria 13770
325 Ga0207657_10030799 3300025919 Bacteria 4864
326 Ga0207657_10041026 3300025919 Bacteria 4095
327 Ga0207657_10154561 3300025919 Bacteria 1866
328 Ga0207649_10234990 3300025920 Bacteria 1313
329 Ga0207652_10718415 3300025921 Bacteria 891
330 Ga0207681_10000004 3300025923 Bacteria 559005
331 Ga0207681_10000014 3300025923 Bacteria 353422
332 Ga0207681_10002077 3300025923 Bacteria 12831
333 Ga0207681_10002575 3300025923 Bacteria 11500
334 Ga0207681_10021367 3300025923 Bacteria 4113
335 Ga0207681_10046229 3300025923 Bacteria 2927
336 Ga0207681_10146955 3300025923 Bacteria 1762
337 Ga0207681_10191208 3300025923 Bacteria 1566
338 Ga0207694_10034311 3300025924 Bacteria 3890
339 Ga0207650_10000015 3300025925 Bacteria 369173
340 Ga0207650_10003369 3300025925 Bacteria 10999
341 Ga0207650_10005182 3300025925 Bacteria 8892
342 Ga0207659_10052745 3300025926 Bacteria 2899
343 Ga0207687_10001173 3300025927 Bacteria 17895
344 Ga0207644_10000031 3300025931 Bacteria 134402
345 Ga0207644_10000066 3300025931 Bacteria 76450
346 Ga0207644_10000293 3300025931 Bacteria 32998
347 Ga0207644_10007460 3300025931 Bacteria 7131
348 Ga0207644_10055644 3300025931 Bacteria 2852
349 Ga0207644_10117952 3300025931 Bacteria 2016
350 Ga0207690_10057882 3300025932 Bacteria 2620
351 Ga0207690_10124879 3300025932 Bacteria 1875
352 Ga0207706_10015901 3300025933 Bacteria 6801
353 Ga0207706_10022403 3300025933 Bacteria 5670
354 Ga0207706_10117259 3300025933 Bacteria 2342
355 Ga0207686_10000181 3300025934 Bacteria 48566
356 Ga0207709_10000750 3300025935 Bacteria 25694
357 Ga0207669_10009649 3300025937 Bacteria 4612
358 Ga0207704_10000048 3300025938 Bacteria 83529
359 Ga0207691_10065054 3300025940 Bacteria 3302
360 Ga0207711_10002409 3300025941 Bacteria 16703
361 Ga0207711_10008194 3300025941 Bacteria 8748
362 Ga0207711_10012761 3300025941 Bacteria 6979
363 Ga0207711_10027237 3300025941 Bacteria 4801
364 Ga0207689_10000378 3300025942 Bacteria 41915
365 Ga0207661_10217487 3300025944 Bacteria 1687
366 Ga0207679_10158754 3300025945 Bacteria 1849
367 Ga0207667_10001267 3300025949 Bacteria 31686
368 Ga0207667_10070214 3300025949 Bacteria 3646
369 Ga0207667_10225965 3300025949 Bacteria 1917
370 Ga0207651_10000001 3300025960 Bacteria 516823
371 Ga0207712_10000048 3300025961 Bacteria 160050
372 Ga0207712_10018680 3300025961 Bacteria 4518
373 Ga0207712_10029096 3300025961 Bacteria 3702
374 Ga0207712_10058448 3300025961 Bacteria 2725
375 Ga0207712_10068285 3300025961 Bacteria 2546
376 Ga0207712_10383132 3300025961 Bacteria 1177
377 Ga0207668_10000012 3300025972 Bacteria 182541
378 Ga0207668_10000038 3300025972 Bacteria 112486
379 Ga0207668_10000135 3300025972 Bacteria 50909
380 Ga0207668_10003241 3300025972 Bacteria 9540
381 Ga0207668_10004934 3300025972 Bacteria 7846
382 Ga0207668_10069823 3300025972 Bacteria 2503
383 Ga0207668_10095405 3300025972 Bacteria 2195
384 Ga0207668_10150777 3300025972 Bacteria 1799
385 Ga0207640_10000167 3300025981 Bacteria 47729
386 Ga0207640_10014319 3300025981 Bacteria 4563
387 Ga0207640_10305753 3300025981 Bacteria 1260
388 Ga0207640_10400395 3300025981 Bacteria 1118
389 Ga0207640_10511012 3300025981 Bacteria 1002
390 Ga0207658_10000011 3300025986 Bacteria 239620
391 Ga0207658_10000037 3300025986 Bacteria 148087
392 Ga0207658_10000164 3300025986 Bacteria 70677
393 Ga0207658_10003835 3300025986 Bacteria 10588
394 Ga0207658_10004090 3300025986 Bacteria 10173
395 Ga0207658_10010872 3300025986 Bacteria 6194
396 Ga0207658_10397755 3300025986 Bacteria 1210
397 Ga0207677_10000711 3300026023 Bacteria 19645
398 Ga0207703_10000538 3300026035 Bacteria 38989
399 Ga0207703_10015775 3300026035 Bacteria 5892
400 Ga0207639_10000138 3300026041 Bacteria 54326
401 Ga0207639_10001072 3300026041 Bacteria 18552
402 Ga0207639_10068669 3300026041 Bacteria 2762
403 Ga0207639_10700124 3300026041 Bacteria 940
404 Ga0207678_10005374 3300026067 Bacteria 11474
405 Ga0207678_10006691 3300026067 Bacteria 10221
406 Ga0207678_10251559 3300026067 Bacteria 1513
407 Ga0207702_10048203 3300026078 Bacteria 3592
408 Ga0207702_10252641 3300026078 Bacteria 1656
409 Ga0207702_10256064 3300026078 Bacteria 1646
410 Ga0207641_10000050 3300026088 Bacteria 175954
411 Ga0207641_10000228 3300026088 Bacteria 72357
412 Ga0207641_10000755 3300026088 Bacteria 34850
413 Ga0207641_10006924 3300026088 Bacteria 9488
414 Ga0207641_10008467 3300026088 Bacteria 8502
415 Ga0207648_10000494 3300026089 Bacteria 43933
416 Ga0207676_10000021 3300026095 Bacteria 296572
417 Ga0207676_10003587 3300026095 Bacteria 10968
418 Ga0207676_10004090 3300026095 Bacteria 10289
419 Ga0207674_10007528 3300026116 Bacteria 12691
420 Ga0207674_10035934 3300026116 Bacteria 5167
421 Ga0207674_10064320 3300026116 Bacteria 3700
422 Ga0207674_10275701 3300026116 Bacteria 1630
423 Ga0207674_10341218 3300026116 Bacteria 1448
424 Ga0207675_100000071 3300026118 Bacteria 77575
425 Ga0207675_100003319 3300026118 Bacteria 15755
426 Ga0207675_100006708 3300026118 Bacteria 10884
427 Ga0207675_100059135 3300026118 Bacteria 3577
428 Ga0207683_10061493 3300026121 Bacteria 3305
429 Ga0207683_10530257 3300026121 Bacteria 1088
430 Ga0207698_10001828 3300026142 Bacteria 12444
431 Ga0207698_10352718 3300026142 Bacteria 1390
432 Ga0207698_10354531 3300026142 Bacteria 1387
433 Ga0207698_10434633 3300026142 Bacteria 1263
434 Ga0207698_10474974 3300026142 Bacteria 1212
435 Ga0209813_10000036 3300027866 Bacteria 58545
436 Ga0268266_10000471 3300028379 Bacteria 58314
437 Ga0268266_10019776 3300028379 Bacteria 5738
438 Ga0268266_10133519 3300028379 Bacteria 2222
439 Ga0268265_10000013 3300028380 Bacteria 341536
440 Ga0268265_10000209 3300028380 Bacteria 68317
441 Ga0268265_10000525 3300028380 Bacteria 39061
442 Ga0268265_10004259 3300028380 Bacteria 9991
443 Ga0268265_10014040 3300028380 Bacteria 5456
444 Ga0268265_11121799 3300028380 Bacteria 781
445 Ga0268264_10000089 3300028381 Bacteria 234760
446 Ga0268264_10000144 3300028381 Bacteria 168841
447 Ga0268264_10000483 3300028381 Bacteria 52975
448 Ga0268264_10004593 3300028381 Bacteria 11734
449 Ga0268264_10019865 3300028381 Bacteria 5489
450 Ga0268264_10064820 3300028381 Bacteria 3076
451 Ga0268264_10143375 3300028381 Bacteria 2133
452 Ga0268264_10321702 3300028381 Bacteria 1463
453 Ga0307513_10213019 3300031456 Bacteria 1761
454 Ga0307408_100074061 3300031548 Bacteria 2525
455 Ga0307408_100427460 3300031548 Bacteria 1144
456 Ga0307508_10049043 3300031616 Bacteria 3761
457 Ga0307405_10263720 3300031731 Bacteria 1288
458 Ga0307405_10407112 3300031731 Bacteria 1066
459 Ga0307413_10120074 3300031824 Bacteria 1779
460 Ga0307413_10187326 3300031824 Bacteria 1482
461 Ga0307412_10004187 3300031911 Bacteria 8043
462 Ga0307412_10048912 3300031911 Bacteria 2783
463 Ga0307412_10089691 3300031911 Bacteria 2147
464 Ga0307412_10463036 3300031911 Bacteria 1047
465 Ga0307409_100462886 3300031995 Bacteria 1226
466 Ga0307416_100064488 3300032002 Bacteria 3005
467 Ga0307416_100064534 3300032002 Bacteria 3004
468 Ga0307416_100229611 3300032002 Bacteria 1788
469 Ga0307414_10039012 3300032004 Bacteria 3195
470 Ga0307414_10050186 3300032004 Bacteria 2889
471 Ga0307414_10078461 3300032004 Bacteria 2407
472 Ga0307414_10178988 3300032004 Bacteria 1703
473 Ga0307414_10461251 3300032004 Bacteria 1117
474 Ga0307414_10686004 3300032004 Bacteria 926
475 Ga0307411_10076149 3300032005 Bacteria 2293
476 Ga0307411_10259352 3300032005 Bacteria 1372
477 Ga0307411_10621453 3300032005 Bacteria 931
478 Ga0307510_10131028 3300033180 Bacteria 2181
479 Ga0373923_0113816 3300035111 Bacteria 1204
480 Ga0373923_0130921 3300035111 Bacteria 1127
481 Ga0395899_0008722 3300037312 Bacteria 7805
482 Ga0395900_0036311 3300037418 Bacteria 5080
483 Ga0395900_0295708 3300037418 Bacteria 1607
484 Ga0395898_0667244 3300037466 Bacteria 982
485 Ga0395905_0021782 3300037471 Bacteria 6062
486 Ga0395905_0104285 3300037471 Bacteria 2662
487 Ga0395905_0237379 3300037471 Bacteria 1704
488 Ga0395905_0477343 3300037471 Bacteria 1146
489 Ga0395905_0592646 3300037471 Bacteria 1010
490 Ga0395905_0842566 3300037471 Bacteria 820
491 Ga0436364_0154840 3300037853 Bacteria 188668
492 Ga0395901_0101619 3300038443 Bacteria 3017
493 Ga0395901_0387218 3300038443 Bacteria 1438
494 Ga0237819_01638 3300038705 Bacteria 5514
495 Ga0436365_0864664 3300039437 Bacteria 1940
496 Ga0436363_1390116 3300039450 Bacteria 1581
497 Ga0439461_0000062 3300041410 Bacteria 13562
498 Ga0439461_0062145 3300041410 Bacteria 850
499 Ga0439465_0002490 3300041413 Bacteria 6015
500 Ga0439465_0002807 3300041413 Bacteria 5706
501 Ga0451807_0610978 3300041486 Bacteria 1510
502 Ga0451807_2451244 3300041486 Bacteria 937
503 Ga0451853_2895476 3300041512 Bacteria 895
504 Ga0439431_0000213 3300041997 Bacteria 11584
505 Ga0439431_0011636 3300041997 Bacteria 2012
506 Ga0439442_002121 3300042002 Bacteria 3899
507 Ga0439445_0001827 3300042004 Bacteria 4687
508 Ga0439445_0072984 3300042004 Bacteria 951
509 Ga0439448_0006066 3300042005 Bacteria 3465
510 Ga0439448_0017764 3300042005 Bacteria 2174
511 Ga0439448_0039712 3300042005 Bacteria 1518
512 Ga0439432_001352 3300042006 Bacteria 9275
513 Ga0439450_054815 3300042008 Bacteria 954
514 Ga0439452_012615 3300042010 Bacteria 2397
515 Ga0439455_0000548 3300042012 Bacteria 5312
516 Ga0439455_0010465 3300042012 Bacteria 2040
517 Ga0439457_023261 3300042014 Bacteria 1371
518 Ga0439462_0000410 3300042015 Bacteria 8305
519 Ga0439462_0051755 3300042015 Bacteria 1104
520 Ga0450922_009002 3300042124 Bacteria 946
521 Ga0439446_0091979 3300042156 Bacteria 950
522 Ga0439458_0002779 3300042157 Bacteria 4212
523 Ga0439458_0004556 3300042157 Bacteria 3174
524 Ga0439458_0005357 3300042157 Bacteria 2884
525 Ga0439434_0000698 3300042435 Bacteria 9679
526 Ga0439434_0028901 3300042435 Bacteria 1680
527 Ga0451577_0335570 3300042876 Bacteria 1371
528 Ga0466972_0013569 3300044658 Bacteria 4089
529 Ga0466973_0178351 3300044659 Bacteria 1623
530 Ga0466965_0158371 3300044683 Bacteria 1186
531 Ga0466966_0217357 3300044684 Bacteria 1154
532 Ga0466961_0030993 3300044693 Bacteria 3437
533 Ga0466963_0006035 3300044694 Bacteria 7140
534 Ga0466964_0009242 3300044706 Bacteria 3708
535 Ga0466964_0049201 3300044706 Bacteria 1725
536 Ga0453684_0146010 3300044712 Bacteria 2818
537 Ga0466970_0048935 3300044765 Bacteria 2254
538 Ga0466957_0351838 3300044842 Bacteria 999
539 Ga0466960_0132825 3300044901 Bacteria 1315
540 Ga0466959_0183124 3300045049 Bacteria 1464
541 Ga0466958_0015445 3300045836 Bacteria 4375
542 Ga0466967_0649818 3300045976 Bacteria 1043
543 Ga0495627_000036 3300046453 Bacteria 205589
544 Ga0495627_000090 3300046453 Bacteria 109622
545 Ga0495627_000287 3300046453 Bacteria 50673
546 Ga0495638_0012358 3300046460 Bacteria 5855
547 Ga0495638_0016175 3300046460 Bacteria 5000
548 Ga0495650_0000684 3300046471 Bacteria 43971
549 Ga0495650_0001816 3300046471 Bacteria 19170
550 Ga0495650_0028746 3300046471 Bacteria 2545
551 Ga0495596_0000601 3300046500 Bacteria 22617
552 Ga0495607_0013398 3300046501 Bacteria 5375
553 Ga0495583_0000252 3300046506 Bacteria 88617
554 Ga0495583_0073090 3300046506 Bacteria 1504
555 Ga0495606_0026435 3300046507 Bacteria 4138
556 Ga0495610_0000015 3300046512 Bacteria 391489
557 Ga0495610_0000079 3300046512 Bacteria 115816
558 Ga0495610_0001801 3300046512 Bacteria 18656
559 Ga0495610_0028580 3300046512 Bacteria 2947
560 Ga0495616_0000010 3300046513 Bacteria 224378
561 Ga0495620_0013186 3300046515 Bacteria 4240
562 Ga0495631_0069054 3300046518 Bacteria 1528
563 Ga0495632_0000095 3300046519 Bacteria 89499
564 Ga0495632_0000668 3300046519 Bacteria 31348
565 Ga0495632_0001502 3300046519 Bacteria 19288
566 Ga0495632_0090126 3300046519 Bacteria 1455
567 Ga0495637_0003691 3300046520 Bacteria 8085
568 Ga0495637_0047079 3300046520 Bacteria 1822
569 Ga0495643_0000038 3300046522 Bacteria 236010
570 Ga0495643_0000217 3300046522 Bacteria 88279
571 Ga0495643_0012289 3300046522 Bacteria 5170
572 Ga0495643_0086614 3300046522 Bacteria 1622
573 Ga0495648_0000018 3300046524 Bacteria 282490
574 Ga0495648_0005139 3300046524 Bacteria 10954
575 Ga0495663_0000028 3300046525 Bacteria 89526
576 Ga0495609_0001277 3300046538 Bacteria 17177
577 Ga0495609_0007581 3300046538 Bacteria 5396
578 Ga0495622_0012565 3300046557 Bacteria 3923
579 Ga0495633_0000340 3300046558 Bacteria 52440
580 Ga0495633_0003319 3300046558 Bacteria 10807
581 Ga0495633_0004974 3300046558 Bacteria 8294
582 Ga0495633_0108375 3300046558 Bacteria 1288
583 Ga0495633_0142170 3300046558 Bacteria 1109
584 Ga0495668_0008492 3300046616 Bacteria 6400
585 Ga0495668_0074488 3300046616 Bacteria 1864
586 Ga0495625_0006657 3300046660 Bacteria 10249
587 Ga0495625_0014445 3300046660 Bacteria 6302
588 Ga0495625_0057803 3300046660 Bacteria 2757
589 Ga0495661_0024460 3300046665 Bacteria 3909
590 Ga0495661_0048707 3300046665 Bacteria 2574
591 Ga0495669_0241249 3300046684 Bacteria 867
592 Ga0495670_0021536 3300046691 Bacteria 3180
593 Ga0495670_0315271 3300046691 Bacteria 839
594 Ga0495671_0000011 3300046692 Bacteria 365582
595 Ga0495671_0000027 3300046692 Bacteria 236011
596 Ga0495672_0055076 3300047320 Bacteria 2322
597 Ga0495673_0000013 3300047469 Bacteria 612902
598 Ga0495673_0086819 3300047469 Bacteria 1285
599 Ga0495681_0000048 3300047470 Bacteria 110216
600 Ga0495681_0000077 3300047470 Bacteria 87471
601 Ga0495681_0029019 3300047470 Bacteria 2837
602 Ga0495686_0000469 3300047472 Bacteria 60229
603 Ga0495686_0015005 3300047472 Bacteria 5309
604 Ga0495686_0035001 3300047472 Bacteria 3231
605 Ga0495686_0045796 3300047472 Bacteria 2767
606 Ga0495686_0347710 3300047472 Bacteria 807
607 Ga0495615_0091122 3300048090 Bacteria 849
608 Ga0496100_0063797 3300048903 Bacteria 2435
609 Ga0496101_0035108 3300048904 Bacteria 3545
610 Ga0496101_0641956 3300048904 Bacteria 839
611 Ga0496102_0000267 3300048905 Bacteria 66761
612 Ga0496102_0033928 3300048905 Bacteria 4589
613 Ga0496102_0180466 3300048905 Bacteria 1989
614 Ga0496102_0234679 3300048905 Bacteria 1729
615 Ga0496103_0000139 3300048906 Bacteria 75158
616 Ga0496103_0442886 3300048906 Bacteria 833
617 Ga0496104_0001996 3300048907 Bacteria 17709
618 Ga0496105_0000099 3300048908 Bacteria 59095
619 Ga0496106_0522487 3300048909 Bacteria 953
620 Ga0496107_0020816 3300048910 Bacteria 4636
621 Ga0496107_0660656 3300048910 Bacteria 770
622 Ga0496108_0001779 3300048911 Bacteria 17174
623 Ga0496109_0006311 3300048912 Bacteria 9982
624 Ga0496109_0197981 3300048912 Bacteria 1889
625 Ga0496110_0188045 3300048913 Bacteria 1875
626 Ga0496110_0205913 3300048913 Bacteria 1788
627 Ga0496110_0525296 3300048913 Bacteria 1076
628 Ga0496111_0025926 3300048914 Bacteria 4137
629 Ga0496111_0090959 3300048914 Bacteria 2236
630 Ga0496111_0192483 3300048914 Bacteria 1516
631 Ga0496112_0018899 3300048915 Bacteria 6493
632 Ga0496112_0445998 3300048915 Bacteria 1232
633 Ga0496113_0004509 3300048916 Bacteria 8576
634 Ga0496113_0058450 3300048916 Bacteria 2901
635 Ga0496115_0019907 3300048918 Bacteria 5170
636 Ga0496115_0236213 3300048918 Bacteria 1507
637 Ga0496116_0019293 3300048919 Bacteria 5223
638 Ga0496116_0026853 3300048919 Bacteria 4200
639 Ga0496116_0058256 3300048919 Bacteria 2520
640 Ga0496116_0072004 3300048919 Bacteria 2186
641 Ga0496117_0008650 3300048920 Bacteria 9634
642 Ga0496117_0017167 3300048920 Bacteria 6058
643 Ga0496117_0020177 3300048920 Bacteria 5443
644 Ga0496117_0166070 3300048920 Bacteria 1287
645 Ga0496118_0000606 3300048921 Bacteria 59016
646 Ga0496118_0009747 3300048921 Bacteria 9635
647 Ga0496118_0015390 3300048921 Bacteria 7082
648 Ga0496118_0023847 3300048921 Bacteria 5301
649 Ga0496118_0032113 3300048921 Bacteria 4335
650 Ga0496118_0244241 3300048921 Bacteria 1025
651 Ga0496119_0004210 3300048922 Bacteria 14446
652 Ga0496119_0043741 3300048922 Bacteria 2827
653 Ga0496119_0058202 3300048922 Bacteria 2330
654 Ga0496119_0298168 3300048922 Bacteria 796
655 Ga0496120_0003080 3300048923 Bacteria 15717
656 Ga0496120_0163353 3300048923 Bacteria 1108
657 Ga0496120_0299918 3300048923 Bacteria 736
658 Ga0496121_0000349 3300048924 Bacteria 96428
659 Ga0496121_0006573 3300048924 Bacteria 14350
660 Ga0496121_0009274 3300048924 Bacteria 11352
661 Ga0496121_0013822 3300048924 Bacteria 8640
662 Ga0496121_0023584 3300048924 Bacteria 5918
663 Ga0496121_0138727 3300048924 Bacteria 1807
664 Ga0496121_0153284 3300048924 Bacteria 1693
665 Ga0496122_0000579 3300048925 Bacteria 75073
666 Ga0496122_0003895 3300048925 Bacteria 19129
667 Ga0496122_0005423 3300048925 Bacteria 15204
668 Ga0496122_0007148 3300048925 Bacteria 12516
669 Ga0496122_0009664 3300048925 Bacteria 10094
670 Ga0496122_0059250 3300048925 Bacteria 2827
671 Ga0496122_0141734 3300048925 Bacteria 1502
672 Ga0496122_0166595 3300048925 Bacteria 1335
673 Ga0496122_0219377 3300048925 Bacteria 1093
674 Ga0496123_0000286 3300048926 Bacteria 98752
675 Ga0496123_0001402 3300048926 Bacteria 33737
676 Ga0496123_0002745 3300048926 Bacteria 21046
677 Ga0496123_0002794 3300048926 Bacteria 20744
678 Ga0496123_0056695 3300048926 Bacteria 2557
679 Ga0496123_0101824 3300048926 Bacteria 1669
680 Ga0496123_0106295 3300048926 Bacteria 1617
681 Ga0496123_0120378 3300048926 Bacteria 1478
682 Ga0496123_0147013 3300048926 Bacteria 1278
683 Ga0496124_0001132 3300048927 Bacteria 41905
684 Ga0496124_0001730 3300048927 Bacteria 30704
685 Ga0496124_0008888 3300048927 Bacteria 10420
686 Ga0496124_0049847 3300048927 Bacteria 3570
687 Ga0496124_0050093 3300048927 Bacteria 3560
688 Ga0496124_0067144 3300048927 Bacteria 2985
689 Ga0496124_0132955 3300048927 Bacteria 1974
690 Ga0496124_0258622 3300048927 Bacteria 1283
691 Ga0496124_0269944 3300048927 Bacteria 1246
692 Ga0496124_0278223 3300048927 Bacteria 1221
693 Ga0496124_0344554 3300048927 Bacteria 1056
694 Ga0496124_0348664 3300048927 Bacteria 1048
695 Ga0496125_0004923 3300048928 Bacteria 15118
696 Ga0496125_0012034 3300048928 Bacteria 8613
697 Ga0496125_0012127 3300048928 Bacteria 8574
698 Ga0496125_0016696 3300048928 Bacteria 7039
699 Ga0496125_0018428 3300048928 Bacteria 6630
700 Ga0496125_0021250 3300048928 Bacteria 6061
701 Ga0496125_0038148 3300048928 Bacteria 4164
702 Ga0496125_0060040 3300048928 Bacteria 3059
703 Ga0496125_0079290 3300048928 Bacteria 2520
704 Ga0496125_0107609 3300048928 Bacteria 2031
705 Ga0496125_0283364 3300048928 Bacteria 1025
706 Ga0496125_0392570 3300048928 Bacteria 814
707 Ga0496126_0000619 3300048929 Bacteria 66827
708 Ga0496126_0027985 3300048929 Bacteria 5375
709 Ga0496126_0066961 3300048929 Bacteria 3210
710 Ga0496126_0115084 3300048929 Bacteria 2339
711 Ga0496126_0232662 3300048929 Bacteria 1543
712 Ga0496126_0459179 3300048929 Bacteria 1024
713 Ga0496126_0633079 3300048929 Bacteria 839
714 Ga0501292_000004 3300049515 Bacteria 159565
715 Ga0501294_000758 3300049517 Bacteria 3568
716 Ga0501300_000066 3300049523 Bacteria 15100
717 Ga0501314_001800 3300049530 Bacteria 1592
718 Ga0501032_0085757 3300049569 Bacteria 2093
719 Ga0501034_0016790 3300049571 Bacteria 7506
720 Ga0501034_0204545 3300049571 Bacteria 1931
721 Ga0501037_0745985 3300049573 Bacteria 649
722 Ga0501038_0298223 3300049574 Bacteria 1265
723 Ga0501043_0130029 3300049579 Bacteria 1973
724 Ga0501043_0195947 3300049579 Bacteria 1569
725 Ga0501046_0428815 3300049580 Bacteria 953
726 Ga0501047_0000644 3300049581 Bacteria 36698
727 Ga0501048_0134900 3300049582 Bacteria 1744
728 Ga0501202_014100 3300049652 Bacteria 1527
729 Ga0501222_000505 3300049662 Bacteria 5796
730 Ga0501223_000042 3300049663 Bacteria 44258
731 Ga0501223_000211 3300049663 Bacteria 14909
732 Ga0501223_001716 3300049663 Bacteria 5000
733 Ga0501224_000008 3300049664 Bacteria 111708
734 Ga0501224_009310 3300049664 Bacteria 1436
735 Ga0501227_014569 3300049665 Bacteria 1746
736 Ga0501233_008110 3300049668 Bacteria 2017
737 Ga0501235_000139 3300049669 Bacteria 12177
738 Ga0501249_000549 3300049679 Bacteria 9020
739 Ga0501257_003748 3300049686 Bacteria 3284
740 Ga0501259_000801 3300049688 Bacteria 5144
741 Ga0501261_000010 3300049690 Bacteria 49364
742 Ga0501225_0000073 3300049705 Bacteria 33154
743 Ga0501225_0000520 3300049705 Bacteria 12018
744 Ga0501225_0003808 3300049705 Bacteria 4533
745 Ga0501225_0022874 3300049705 Bacteria 1725
746 Ga0501234_000985 3300049707 Bacteria 4509
747 Ga0501245_000603 3300049708 Bacteria 4418
748 Ga0501245_008999 3300049708 Bacteria 1429
749 Ga0501241_005459 3300049758 Bacteria 2368
750 Ga0501279_000005 3300049775 Bacteria 153858
751 Ga0501280_000038 3300049776 Bacteria 38694
752 Ga0501282_000165 3300049778 Bacteria 8009
753 Ga0501044_0049651 3300049823 Bacteria 4331
754 Ga0501044_0892156 3300049823 Bacteria 764
755 Ga0501226_000042 3300049853 Bacteria 59224
756 nmdc:mga00v17_29710_c1 3300050491 Bacteria 3209
757 nmdc:mga0k408_188043_c1 3300050493 Bacteria 1232
758 nmdc:mga0k408_51881_c1 3300050493 Bacteria 2376
759 nmdc:mga06z11_111_c1 3300050494 Bacteria 33603
760 nmdc:mga04h51_100_c1 3300050495 Bacteria 25673
761 nmdc:mga07m45_1083_c1 3300050496 Bacteria 12127
762 nmdc:mga07m45_82575_c1 3300050496 Bacteria 1835
763 nmdc:mga05p37_228596_c1 3300050507 Bacteria 2242
764 Ga0495619_0327712 3300053085 Bacteria 1060
765 Ga0500643_000539 3300053087 Bacteria 26512
766 Ga0500643_002149 3300053087 Bacteria 10433
767 Ga0500643_004524 3300053087 Bacteria 6250
768 Ga0500643_010045 3300053087 Bacteria 3559
769 Ga0500643_021485 3300053087 Bacteria 2091
770 Ga0500643_045312 3300053087 Bacteria 1274
771 Ga0500643_068092 3300053087 Bacteria 990
772 Ga0500644_0028883 3300053088 Bacteria 1739
773 Ga0500647_0029989 3300053091 Bacteria 2581
774 Ga0500651_0002188 3300053093 Bacteria 10235
775 Ga0500641_0001555 3300053096 Bacteria 8178
776 Ga0500641_0012360 3300053096 Bacteria 3116
777 Ga0500650_0191460 3300053098 Bacteria 934
778 Ga0500556_0000074 3300053104 Bacteria 98799
779 Ga0500557_017166 3300053105 Bacteria 1993
780 Ga0500562_005307 3300053108 Bacteria 3236
781 Ga0500562_073645 3300053108 Bacteria 922
782 Ga0500594_0062933 3300053118 Bacteria 1074
783 Ga0500595_005345 3300053119 Bacteria 5617
784 Ga0500618_005557 3300053125 Bacteria 3815
785 Ga0500618_022875 3300053125 Bacteria 1516
786 Ga0500642_0000002 3300053130 Bacteria 795093
787 Ga0500642_0001441 3300053130 Bacteria 6825
788 Ga0500652_092939 3300053131 Bacteria 1260
789 Ga0500655_000061 3300053133 Bacteria 29562
790 Ga0500559_0001442 3300053136 Bacteria 13495
791 Ga0500573_0000015 3300053140 Bacteria 192264
792 Ga0500573_0264954 3300053140 Bacteria 878
793 Ga0500616_0003051 3300053153 Bacteria 13180
794 Ga0500622_0000901 3300053156 Bacteria 25291
795 Ga0500622_0003437 3300053156 Bacteria 10591
796 Ga0500622_0016726 3300053156 Bacteria 3916
797 Ga0500624_000085 3300053157 Bacteria 47798
798 Ga0500624_000125 3300053157 Bacteria 34426
799 Ga0500627_0002237 3300053158 Bacteria 5671
800 Ga0500636_0013174 3300053177 Bacteria 4851
801 Ga0500636_0077521 3300053177 Bacteria 1920
802 Ga0500637_0000023 3300053178 Bacteria 61044
803 Ga0500570_000268 3300053724 Bacteria 17871
804 Ga0500645_003833 3300053730 Bacteria 5966
805 Ga0500645_004874 3300053730 Bacteria 5055
806 Ga0500661_000138 3300055283 Bacteria 12382
807 Ga0466962_0001351 3300061719 Bacteria 11344
808 Ga0466962_0046360 3300061719 Bacteria 2077

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048904 Ga0496101_0641956 Ga0496101_0641956_10_561 183
2 iso_pu_bacteria 2928526807 2928528758 198
3 iso_pu_bacteria 2928968154 2928970312 198
4 3300046616 Ga0495668_0074488 Ga0495668_0074488_35_643 202
5 3300049573 Ga0501037_0745985 Ga0501037_0745985_31_639 202
6 3300053087 Ga0500643_068092 Ga0500643_068092_26_634 202
7 3300015690 Ga0183363_1005 Ga0183363_1005276 203
8 3300049708 Ga0501245_008999 Ga0501245_008999_582_1199 203
9 3300005335 Ga0070666_10456715 Ga0070666_104567152 205
10 iso_pu_bacteria 2643221541 2643730699 206
11 iso_pu_bacteria 2643221605 2644040835 206
12 iso_pu_bacteria 2643221606 2644044647 206
13 iso_pu_bacteria 2643221671 2644391428 206
14 3300031616 Ga0307508_10049043 Ga0307508_100490435 208
15 3300035111 Ga0373923_0113816 Ga0373923_0113816_170_796 208
16 3300053087 Ga0500643_021485 Ga0500643_021485_938_1576 208
17 3300005617 Ga0068859_100190175 Ga0068859_1001901753 209
18 3300006931 Ga0097620_100190181 Ga0097620_1001901812 209
19 3300009177 Ga0105248_10014281 Ga0105248_100142815 209
20 3300025941 Ga0207711_10008194 Ga0207711_100081945 209
21 3300033180 Ga0307510_10131028 Ga0307510_101310282 209
22 3300048928 Ga0496125_0021250 Ga0496125_0021250_1462_2094 209
23 3300049515 Ga0501292_000004 Ga0501292_000004_138868_139500 209
24 3300049517 Ga0501294_000758 Ga0501294_000758_81_713 209
25 3300049523 Ga0501300_000066 Ga0501300_000066_13289_13921 209
26 3300049652 Ga0501202_014100 Ga0501202_014100_287_919 209
27 3300049662 Ga0501222_000505 Ga0501222_000505_4854_5486 209
28 3300049663 Ga0501223_001716 Ga0501223_001716_274_906 209
29 3300049664 Ga0501224_009310 Ga0501224_009310_382_1014 209
30 3300049665 Ga0501227_014569 Ga0501227_014569_572_1204 209
31 3300049669 Ga0501235_000139 Ga0501235_000139_10798_11430 209
32 3300049686 Ga0501257_003748 Ga0501257_003748_291_923 209
33 3300049688 Ga0501259_000801 Ga0501259_000801_767_1399 209
34 3300049690 Ga0501261_000010 Ga0501261_000010_9111_9743 209
35 3300049708 Ga0501245_000603 Ga0501245_000603_785_1417 209
36 3300049775 Ga0501279_000005 Ga0501279_000005_39116_39748 209
37 3300049776 Ga0501280_000038 Ga0501280_000038_3365_3997 209
38 3300049778 Ga0501282_000165 Ga0501282_000165_2537_3169 209
39 3300053087 Ga0500643_004524 Ga0500643_004524_607_1239 209
40 3300053730 Ga0500645_004874 Ga0500645_004874_661_1293 209
41 3300001979 JGI24740J21852_10028989 JGI24740J21852_100289892 210
42 3300001979 JGI24740J21852_10058057 JGI24740J21852_100580572 210
43 3300001990 JGI24737J22298_10003492 JGI24737J22298_100034926 210
44 3300001990 JGI24737J22298_10040310 JGI24737J22298_100403102 210
45 3300001990 JGI24737J22298_10084090 JGI24737J22298_100840902 210
46 3300001991 JGI24743J22301_10012544 JGI24743J22301_100125441 210
47 3300002067 JGI24735J21928_10009713 JGI24735J21928_100097133 210
48 3300002067 JGI24735J21928_10009810 JGI24735J21928_100098102 210
49 3300002067 JGI24735J21928_10012405 JGI24735J21928_100124054 210
50 3300002067 JGI24735J21928_10012704 JGI24735J21928_100127041 210
51 3300002067 JGI24735J21928_10027489 JGI24735J21928_100274893 210
52 3300002067 JGI24735J21928_10054782 JGI24735J21928_100547822 210
53 3300002075 JGI24738J21930_10002736 JGI24738J21930_100027366 210
54 3300002075 JGI24738J21930_10004755 JGI24738J21930_100047553 210
55 3300002075 JGI24738J21930_10015195 JGI24738J21930_100151952 210
56 3300002076 JGI24749J21850_1000352 JGI24749J21850_10003526 210
57 3300002077 JGI24744J21845_10000115 JGI24744J21845_100001157 210
58 3300002459 JGI24751J29686_10000208 JGI24751J29686_100002088 210
59 3300003214 JGI25165J46597_1000534 JGI25165J46597_100053417 210
60 3300003762 Ga0055542_1003000 Ga0055542_10030003 210
61 3300005295 Ga0065707_10086371 Ga0065707_100863716 210
62 3300005327 Ga0070658_10001154 Ga0070658_1000115425 210
63 3300005327 Ga0070658_10012339 Ga0070658_100123394 210
64 3300005328 Ga0070676_10000448 Ga0070676_100004483 210
65 3300005331 Ga0070670_100000024 Ga0070670_10000002456 210
66 3300005331 Ga0070670_100003502 Ga0070670_10000350214 210
67 3300005334 Ga0068869_100002661 Ga0068869_10000266112 210
68 3300005338 Ga0068868_100000910 Ga0068868_1000009104 210
69 3300005339 Ga0070660_100009320 Ga0070660_1000093206 210
70 3300005339 Ga0070660_100058583 Ga0070660_1000585832 210
71 3300005339 Ga0070660_100135929 Ga0070660_1001359293 210
72 3300005339 Ga0070660_100149113 Ga0070660_1001491132 210
73 3300005344 Ga0070661_100261922 Ga0070661_1002619222 210
74 3300005347 Ga0070668_100000027 Ga0070668_10000002773 210
75 3300005347 Ga0070668_100027686 Ga0070668_1000276864 210
76 3300005353 Ga0070669_100000047 Ga0070669_10000004762 210
77 3300005353 Ga0070669_100054887 Ga0070669_1000548872 210
78 3300005354 Ga0070675_100071809 Ga0070675_1000718094 210
79 3300005355 Ga0070671_100000517 Ga0070671_10000051722 210
80 3300005355 Ga0070671_100023173 Ga0070671_1000231733 210
81 3300005355 Ga0070671_100057465 Ga0070671_1000574652 210
82 3300005356 Ga0070674_100019915 Ga0070674_1000199156 210
83 3300005364 Ga0070673_100000020 Ga0070673_10000002074 210
84 3300005366 Ga0070659_100233254 Ga0070659_1002332542 210
85 3300005366 Ga0070659_100287872 Ga0070659_1002878722 210
86 3300005367 Ga0070667_100000017 Ga0070667_100000017170 210
87 3300005367 Ga0070667_100005804 Ga0070667_1000058047 210
88 3300005445 Ga0070708_100912558 Ga0070708_1009125581 210
89 3300005455 Ga0070663_100001418 Ga0070663_10000141814 210
90 3300005456 Ga0070678_100005895 Ga0070678_1000058952 210
91 3300005457 Ga0070662_100032068 Ga0070662_1000320684 210
92 3300005457 Ga0070662_100394559 Ga0070662_1003945592 210
93 3300005459 Ga0068867_100000155 Ga0068867_10000015528 210
94 3300005466 Ga0070685_10505431 Ga0070685_105054311 210
95 3300005539 Ga0068853_100070689 Ga0068853_1000706893 210
96 3300005539 Ga0068853_100086514 Ga0068853_1000865143 210
97 3300005539 Ga0068853_100089633 Ga0068853_1000896334 210
98 3300005539 Ga0068853_100315074 Ga0068853_1003150742 210
99 3300005563 Ga0068855_100002050 Ga0068855_10000205010 210
100 3300005563 Ga0068855_100121831 Ga0068855_1001218312 210
101 3300005564 Ga0070664_100490854 Ga0070664_1004908542 210
102 3300005577 Ga0068857_100108610 Ga0068857_1001086102 210
103 3300005577 Ga0068857_100121731 Ga0068857_1001217312 210
104 3300005578 Ga0068854_100002936 Ga0068854_10000293614 210
105 3300005578 Ga0068854_100268072 Ga0068854_1002680722 210
106 3300005614 Ga0068856_100019646 Ga0068856_1000196463 210
107 3300005616 Ga0068852_100010016 Ga0068852_1000100166 210
108 3300005616 Ga0068852_100483302 Ga0068852_1004833021 210
109 3300005616 Ga0068852_100493014 Ga0068852_1004930142 210
110 3300005617 Ga0068859_100038244 Ga0068859_1000382442 210
111 3300005617 Ga0068859_100092658 Ga0068859_1000926584 210
112 3300005617 Ga0068859_100588416 Ga0068859_1005884161 210
113 3300005618 Ga0068864_100000036 Ga0068864_10000003657 210
114 3300005618 Ga0068864_100004795 Ga0068864_1000047956 210
115 3300005719 Ga0068861_100005201 Ga0068861_1000052011 210
116 3300005719 Ga0068861_100021348 Ga0068861_1000213483 210
117 3300005834 Ga0068851_10160609 Ga0068851_101606092 210
118 3300005841 Ga0068863_100002193 Ga0068863_10000219313 210
119 3300005842 Ga0068858_100000103 Ga0068858_10000010317 210
120 3300005843 Ga0068860_100000056 Ga0068860_10000005674 210
121 3300005844 Ga0068862_100000033 Ga0068862_10000003347 210
122 3300005844 Ga0068862_100030592 Ga0068862_1000305923 210
123 3300006195 Ga0075366_10034983 Ga0075366_100349832 210
124 3300006237 Ga0097621_100005590 Ga0097621_1000055905 210
125 3300006881 Ga0068865_100000272 Ga0068865_1000002725 210
126 3300006931 Ga0097620_100038244 Ga0097620_1000382442 210
127 3300006931 Ga0097620_100092661 Ga0097620_1000926614 210
128 3300006931 Ga0097620_100588387 Ga0097620_1005883871 210
129 3300009093 Ga0105240_10012649 Ga0105240_1001264915 210
130 3300009098 Ga0105245_10002130 Ga0105245_100021303 210
131 3300009148 Ga0105243_10000711 Ga0105243_1000071123 210
132 3300009148 Ga0105243_10222341 Ga0105243_102223411 210
133 3300009176 Ga0105242_10000320 Ga0105242_1000032036 210
134 3300009177 Ga0105248_10000091 Ga0105248_1000009157 210
135 3300009551 Ga0105238_10501816 Ga0105238_105018162 210
136 3300009553 Ga0105249_10414876 Ga0105249_104148762 210
137 3300010375 Ga0105239_10142551 Ga0105239_101425514 210
138 3300010375 Ga0105239_10165940 Ga0105239_101659402 210
139 3300011119 Ga0105246_10004775 Ga0105246_100047755 210
140 3300012513 Ga0157326_1000067 Ga0157326_10000677 210
141 3300013100 Ga0157373_10015080 Ga0157373_100150808 210
142 3300013104 Ga0157370_10000145 Ga0157370_100001455 210
143 3300013105 Ga0157369_10018860 Ga0157369_100188605 210
144 3300013296 Ga0157374_10005414 Ga0157374_100054148 210
145 3300013296 Ga0157374_10136449 Ga0157374_101364494 210
146 3300013297 Ga0157378_10011140 Ga0157378_100111408 210
147 3300013306 Ga0163162_10124375 Ga0163162_101243752 210
148 3300013307 Ga0157372_10029740 Ga0157372_100297406 210
149 3300013307 Ga0157372_10065951 Ga0157372_100659513 210
150 3300013307 Ga0157372_10146982 Ga0157372_101469823 210
151 3300013307 Ga0157372_10202471 Ga0157372_102024712 210
152 3300013307 Ga0157372_10681462 Ga0157372_106814622 210
153 3300014326 Ga0157380_10008171 Ga0157380_100081717 210
154 3300014745 Ga0157377_10013528 Ga0157377_100135284 210
155 3300014969 Ga0157376_10000395 Ga0157376_1000039514 210
156 3300017792 Ga0163161_10364892 Ga0163161_103648922 210
157 3300025231 Ga0207427_100878 Ga0207427_1008789 210
158 3300025254 Ga0209148_1000318 Ga0209148_100031850 210
159 3300025254 Ga0209148_1015931 Ga0209148_10159312 210
160 3300025261 Ga0209233_1000181 Ga0209233_100018131 210
161 3300025272 Ga0209455_1000942 Ga0209455_10009427 210
162 3300025321 Ga0207656_10084618 Ga0207656_100846182 210
163 3300025901 Ga0207688_10107208 Ga0207688_101072082 210
164 3300025901 Ga0207688_10362667 Ga0207688_103626671 210
165 3300025903 Ga0207680_10015221 Ga0207680_100152213 210
166 3300025904 Ga0207647_10000611 Ga0207647_1000061130 210
167 3300025904 Ga0207647_10003792 Ga0207647_1000379210 210
168 3300025904 Ga0207647_10022600 Ga0207647_100226005 210
169 3300025904 Ga0207647_10029211 Ga0207647_100292113 210
170 3300025904 Ga0207647_10220582 Ga0207647_102205822 210
171 3300025907 Ga0207645_10011226 Ga0207645_100112266 210
172 3300025909 Ga0207705_10001161 Ga0207705_100011613 210
173 3300025909 Ga0207705_10003807 Ga0207705_1000380711 210
174 3300025909 Ga0207705_10055811 Ga0207705_100558111 210
175 3300025909 Ga0207705_10593060 Ga0207705_105930602 210
176 3300025913 Ga0207695_10011414 Ga0207695_1001141415 210
177 3300025919 Ga0207657_10002758 Ga0207657_1000275822 210
178 3300025919 Ga0207657_10030799 Ga0207657_100307992 210
179 3300025919 Ga0207657_10041026 Ga0207657_100410264 210
180 3300025919 Ga0207657_10154561 Ga0207657_101545613 210
181 3300025920 Ga0207649_10234990 Ga0207649_102349902 210
182 3300025923 Ga0207681_10000014 Ga0207681_10000014144 210
183 3300025923 Ga0207681_10046229 Ga0207681_100462292 210
184 3300025925 Ga0207650_10000015 Ga0207650_10000015158 210
185 3300025925 Ga0207650_10003369 Ga0207650_100033694 210
186 3300025926 Ga0207659_10052745 Ga0207659_100527455 210
187 3300025927 Ga0207687_10001173 Ga0207687_1000117321 210
188 3300025931 Ga0207644_10000066 Ga0207644_1000006646 210
189 3300025931 Ga0207644_10055644 Ga0207644_100556444 210
190 3300025932 Ga0207690_10057882 Ga0207690_100578822 210
191 3300025932 Ga0207690_10124879 Ga0207690_101248793 210
192 3300025933 Ga0207706_10022403 Ga0207706_100224037 210
193 3300025933 Ga0207706_10117259 Ga0207706_101172594 210
194 3300025934 Ga0207686_10000181 Ga0207686_1000018119 210
195 3300025935 Ga0207709_10000750 Ga0207709_1000075023 210
196 3300025937 Ga0207669_10009649 Ga0207669_100096494 210
197 3300025938 Ga0207704_10000048 Ga0207704_1000004852 210
198 3300025940 Ga0207691_10065054 Ga0207691_100650546 210
199 3300025941 Ga0207711_10002409 Ga0207711_100024097 210
200 3300025942 Ga0207689_10000378 Ga0207689_1000037836 210
201 3300025949 Ga0207667_10001267 Ga0207667_1000126717 210
202 3300025949 Ga0207667_10070214 Ga0207667_100702143 210
203 3300025949 Ga0207667_10225965 Ga0207667_102259652 210
204 3300025960 Ga0207651_10000001 Ga0207651_1000000171 210
205 3300025961 Ga0207712_10029096 Ga0207712_100290965 210
206 3300025961 Ga0207712_10383132 Ga0207712_103831323 210
207 3300025972 Ga0207668_10000012 Ga0207668_1000001272 210
208 3300025972 Ga0207668_10095405 Ga0207668_100954052 210
209 3300025981 Ga0207640_10000167 Ga0207640_1000016713 210
210 3300025981 Ga0207640_10014319 Ga0207640_100143193 210
211 3300025981 Ga0207640_10400395 Ga0207640_104003951 210
212 3300025986 Ga0207658_10000011 Ga0207658_1000001173 210
213 3300025986 Ga0207658_10004090 Ga0207658_100040907 210
214 3300026023 Ga0207677_10000711 Ga0207677_100007114 210
215 3300026035 Ga0207703_10000538 Ga0207703_1000053825 210
216 3300026041 Ga0207639_10068669 Ga0207639_100686694 210
217 3300026041 Ga0207639_10700124 Ga0207639_107001242 210
218 3300026067 Ga0207678_10006691 Ga0207678_100066914 210
219 3300026067 Ga0207678_10251559 Ga0207678_102515592 210
220 3300026078 Ga0207702_10048203 Ga0207702_100482033 210
221 3300026078 Ga0207702_10256064 Ga0207702_102560642 210
222 3300026088 Ga0207641_10000228 Ga0207641_1000022834 210
223 3300026089 Ga0207648_10000494 Ga0207648_1000049423 210
224 3300026095 Ga0207676_10000021 Ga0207676_10000021244 210
225 3300026095 Ga0207676_10003587 Ga0207676_1000358711 210
226 3300026116 Ga0207674_10064320 Ga0207674_100643204 210
227 3300026116 Ga0207674_10341218 Ga0207674_103412182 210
228 3300026118 Ga0207675_100006708 Ga0207675_1000067086 210
229 3300026118 Ga0207675_100059135 Ga0207675_1000591353 210
230 3300026121 Ga0207683_10061493 Ga0207683_100614932 210
231 3300026142 Ga0207698_10001828 Ga0207698_100018285 210
232 3300026142 Ga0207698_10354531 Ga0207698_103545312 210
233 3300026142 Ga0207698_10434633 Ga0207698_104346331 210
234 3300028380 Ga0268265_10000013 Ga0268265_10000013216 210
235 3300028380 Ga0268265_10004259 Ga0268265_1000425911 210
236 3300028381 Ga0268264_10000089 Ga0268264_10000089177 210
237 3300032002 Ga0307416_100229611 Ga0307416_1002296113 210
238 3300032004 Ga0307414_10686004 Ga0307414_106860042 210
239 3300037312 Ga0395899_0008722 Ga0395899_0008722_4970_5614 210
240 3300037418 Ga0395900_0036311 Ga0395900_0036311_3264_3908 210
241 3300037418 Ga0395900_0295708 Ga0395900_0295708_64_708 210
242 3300037466 Ga0395898_0667244 Ga0395898_0667244_219_863 210
243 3300037471 Ga0395905_0021782 Ga0395905_0021782_1522_2166 210
244 3300037471 Ga0395905_0237379 Ga0395905_0237379_437_1081 210
245 3300037471 Ga0395905_0477343 Ga0395905_0477343_258_902 210
246 3300037471 Ga0395905_0592646 Ga0395905_0592646_195_839 210
247 3300037471 Ga0395905_0842566 Ga0395905_0842566_40_684 210
248 3300042005 Ga0439448_0006066 Ga0439448_0006066_566_1210 210
249 3300042005 Ga0439448_0017764 Ga0439448_0017764_766_1410 210
250 3300042005 Ga0439448_0039712 Ga0439448_0039712_25_669 210
251 3300042008 Ga0439450_054815 Ga0439450_054815_112_756 210
252 3300042012 Ga0439455_0000548 Ga0439455_0000548_2859_3503 210
253 3300042012 Ga0439455_0010465 Ga0439455_0010465_1333_1977 210
254 3300042157 Ga0439458_0002779 Ga0439458_0002779_3334_3978 210
255 3300042157 Ga0439458_0004556 Ga0439458_0004556_490_1134 210
256 3300042157 Ga0439458_0005357 Ga0439458_0005357_1675_2319 210
257 3300044658 Ga0466972_0013569 Ga0466972_0013569_548_1192 210
258 3300044659 Ga0466973_0178351 Ga0466973_0178351_104_745 210
259 3300044683 Ga0466965_0158371 Ga0466965_0158371_153_797 210
260 3300044684 Ga0466966_0217357 Ga0466966_0217357_391_1035 210
261 3300044693 Ga0466961_0030993 Ga0466961_0030993_1044_1688 210
262 3300044694 Ga0466963_0006035 Ga0466963_0006035_5279_5923 210
263 3300044706 Ga0466964_0009242 Ga0466964_0009242_2515_3159 210
264 3300044706 Ga0466964_0049201 Ga0466964_0049201_938_1582 210
265 3300044765 Ga0466970_0048935 Ga0466970_0048935_925_1569 210
266 3300044842 Ga0466957_0351838 Ga0466957_0351838_74_718 210
267 3300044901 Ga0466960_0132825 Ga0466960_0132825_398_1042 210
268 3300045049 Ga0466959_0183124 Ga0466959_0183124_340_984 210
269 3300045836 Ga0466958_0015445 Ga0466958_0015445_2474_3118 210
270 3300045976 Ga0466967_0649818 Ga0466967_0649818_124_768 210
271 3300046460 Ga0495638_0016175 Ga0495638_0016175_2308_2967 210
272 3300046691 Ga0495670_0021536 Ga0495670_0021536_203_862 210
273 3300048921 Ga0496118_0015390 Ga0496118_0015390_6014_6658 210
274 3300048923 Ga0496120_0163353 Ga0496120_0163353_375_1019 210
275 3300048923 Ga0496120_0299918 Ga0496120_0299918_16_660 210
276 3300048924 Ga0496121_0023584 Ga0496121_0023584_2629_3273 210
277 3300048924 Ga0496121_0153284 Ga0496121_0153284_447_1091 210
278 3300048925 Ga0496122_0007148 Ga0496122_0007148_4544_5188 210
279 3300048926 Ga0496123_0056695 Ga0496123_0056695_622_1266 210
280 3300048927 Ga0496124_0067144 Ga0496124_0067144_572_1216 210
281 3300048927 Ga0496124_0258622 Ga0496124_0258622_311_955 210
282 3300048928 Ga0496125_0012127 Ga0496125_0012127_3009_3653 210
283 3300048929 Ga0496126_0115084 Ga0496126_0115084_315_959 210
284 3300049569 Ga0501032_0085757 Ga0501032_0085757_1392_2033 210
285 3300049571 Ga0501034_0204545 Ga0501034_0204545_975_1616 210
286 3300049579 Ga0501043_0195947 Ga0501043_0195947_98_739 210
287 3300049580 Ga0501046_0428815 Ga0501046_0428815_258_899 210
288 3300049581 Ga0501047_0000644 Ga0501047_0000644_24014_24655 210
289 3300049582 Ga0501048_0134900 Ga0501048_0134900_1027_1668 210
290 3300050493 nmdc:mga0k408_51881_c1 nmdc:mga0k408_51881_c1_1698_2342 210
291 3300053091 Ga0500647_0029989 Ga0500647_0029989_1275_1913 210
292 3300061719 Ga0466962_0001351 Ga0466962_0001351_2809_3453 210
293 3300061719 Ga0466962_0046360 Ga0466962_0046360_353_994 210
294 iso_pu_bacteria 2990265787 2990266488 210
295 iso_pu_bacteria 2993693658 2993695714 210
296 3300005335 Ga0070666_10051148 Ga0070666_100511484 211
297 3300005367 Ga0070667_100000143 Ga0070667_10000014322 211
298 3300005841 Ga0068863_100001489 Ga0068863_1000014899 211
299 3300005843 Ga0068860_100000181 Ga0068860_10000018133 211
300 3300025903 Ga0207680_10024379 Ga0207680_100243794 211
301 3300025986 Ga0207658_10000164 Ga0207658_1000016466 211
302 3300026088 Ga0207641_10000755 Ga0207641_1000075518 211
303 3300028381 Ga0268264_10000144 Ga0268264_1000014498 211
304 3300031911 Ga0307412_10463036 Ga0307412_104630362 211
305 3300032004 Ga0307414_10039012 Ga0307414_100390123 211
306 3300032004 Ga0307414_10078461 Ga0307414_100784613 211
307 3300032005 Ga0307411_10076149 Ga0307411_100761491 211
308 3300042124 Ga0450922_009002 Ga0450922_009002_43_684 211
309 3300049530 Ga0501314_001800 Ga0501314_001800_319_960 211
310 3300049571 Ga0501034_0016790 Ga0501034_0016790_6193_6834 211
311 3300049663 Ga0501223_000211 Ga0501223_000211_3834_4475 211
312 3300049664 Ga0501224_000008 Ga0501224_000008_48832_49473 211
313 3300049668 Ga0501233_008110 Ga0501233_008110_22_663 211
314 3300049705 Ga0501225_0000073 Ga0501225_0000073_23637_24278 211
315 3300049707 Ga0501234_000985 Ga0501234_000985_3666_4307 211
316 3300049853 Ga0501226_000042 Ga0501226_000042_42495_43136 211
317 3300053153 Ga0500616_0003051 Ga0500616_0003051_3698_4342 211
318 3300053157 Ga0500624_000085 Ga0500624_000085_17479_18120 211
319 3300053178 Ga0500637_0000023 Ga0500637_0000023_12052_12693 211
320 iso_pu_bacteria 2928027323 2928028566 211
321 iso_pu_bacteria 2984555340 2984555857 211
322 iso_pu_bacteria 2984564862 2984566034 211
323 iso_pu_bacteria 2993356040 2993357045 211
324 3300005329 Ga0070683_100276977 Ga0070683_1002769772 212
325 3300005616 Ga0068852_100491236 Ga0068852_1004912362 212
326 3300006195 Ga0075366_10117135 Ga0075366_101171352 212
327 3300009093 Ga0105240_10574747 Ga0105240_105747471 212
328 3300013104 Ga0157370_10704392 Ga0157370_107043921 212
329 3300025913 Ga0207695_10346807 Ga0207695_103468072 212
330 3300025944 Ga0207661_10217487 Ga0207661_102174872 212
331 3300026142 Ga0207698_10474974 Ga0207698_104749742 212
332 3300031911 Ga0307412_10048912 Ga0307412_100489123 212
333 3300042876 Ga0451577_0335570 Ga0451577_0335570_628_1266 212
334 3300044712 Ga0453684_0146010 Ga0453684_0146010_642_1280 212
335 3300046506 Ga0495583_0073090 Ga0495583_0073090_156_839 212
336 3300046538 Ga0495609_0007581 Ga0495609_0007581_260_943 212
337 3300046684 Ga0495669_0241249 Ga0495669_0241249_46_729 212
338 3300048925 Ga0496122_0000579 Ga0496122_0000579_54469_55113 212
339 3300048926 Ga0496123_0001402 Ga0496123_0001402_24779_25423 212
340 3300048927 Ga0496124_0278223 Ga0496124_0278223_361_1005 212
341 3300048928 Ga0496125_0107609 Ga0496125_0107609_785_1432 212
342 3300049679 Ga0501249_000549 Ga0501249_000549_4165_4821 212
343 3300049823 Ga0501044_0892156 Ga0501044_0892156_87_746 212
344 3300050493 nmdc:mga0k408_188043_c1 nmdc:mga0k408_188043_c1_278_958 212
345 3300053093 Ga0500651_0002188 Ga0500651_0002188_3290_3973 212
346 3300053096 Ga0500641_0012360 Ga0500641_0012360_105_788 212
347 3300053125 Ga0500618_005557 Ga0500618_005557_483_1166 212
348 3300053130 Ga0500642_0001441 Ga0500642_0001441_3489_4172 212
349 3300053131 Ga0500652_092939 Ga0500652_092939_60_743 212
350 3300053133 Ga0500655_000061 Ga0500655_000061_7183_7866 212
351 3300053156 Ga0500622_0003437 Ga0500622_0003437_3756_4439 212
352 3300053177 Ga0500636_0077521 Ga0500636_0077521_862_1545 212
353 3300053724 Ga0500570_000268 Ga0500570_000268_6439_7122 212
354 iso_pu_bacteria 2582581305 2585263904 212
355 iso_pu_bacteria 2599185359 2600225765 212
356 iso_pu_bacteria 2808606401 2809064830 212
357 iso_pu_bacteria 2808606404 2809080797 212
358 iso_pu_bacteria 2808606405 2809085162 212
359 iso_pu_bacteria 2818991466 2819716433 212
360 iso_pu_bacteria 2879163058 2879165296 212
361 iso_pu_bacteria 2880518877 2880521862 212
362 iso_pu_bacteria 2919709256 2919711333 212
363 iso_pu_bacteria 8057101203 8057101944 212
364 3300002774 JGI25150J39212_1003534 JGI25150J39212_10035342 213
365 3300003187 JGI25151J46595_10037612 JGI25151J46595_100376122 213
366 3300003215 JGI25153J46596_10000186 JGI25153J46596_1000018659 213
367 3300003322 rootL2_10042168 rootL2_100421681 213
368 3300003771 Ga0055526_1012603 Ga0055526_10126034 213
369 3300003781 Ga0055536_1016085 Ga0055536_10160854 213
370 3300003791 Ga0055530_10000064 Ga0055530_1000006435 213
371 3300003791 Ga0055530_10037267 Ga0055530_100372672 213
372 3300003792 Ga0055540_1000768 Ga0055540_100076823 213
373 3300003792 Ga0055540_1002060 Ga0055540_100206014 213
374 3300003794 Ga0055531_10000073 Ga0055531_1000007335 213
375 3300005262 Ga0065165_1056282 Ga0065165_10562821 213
376 3300005347 Ga0070668_100024451 Ga0070668_1000244516 213
377 3300005617 Ga0068859_100062917 Ga0068859_1000629172 213
378 3300005841 Ga0068863_100031052 Ga0068863_1000310525 213
379 3300005843 Ga0068860_100031058 Ga0068860_1000310584 213
380 3300005843 Ga0068860_100324700 Ga0068860_1003247002 213
381 3300005844 Ga0068862_100000187 Ga0068862_10000018723 213
382 3300005844 Ga0068862_100128025 Ga0068862_1001280253 213
383 3300006931 Ga0097620_100062917 Ga0097620_1000629172 213
384 3300006948 Ga0099826_10138471 Ga0099826_101384711 213
385 3300009101 Ga0105247_10118724 Ga0105247_101187242 213
386 3300009177 Ga0105248_10002773 Ga0105248_100027737 213
387 3300009177 Ga0105248_10227998 Ga0105248_102279983 213
388 3300009553 Ga0105249_10001384 Ga0105249_1000138422 213
389 3300025245 Ga0207425_1000049 Ga0207425_100004930 213
390 3300025258 Ga0209129_1003718 Ga0209129_10037188 213
391 3300025263 Ga0209565_1001004 Ga0209565_10010046 213
392 3300025292 Ga0209676_1015713 Ga0209676_10157133 213
393 3300025294 Ga0209025_1000068 Ga0209025_10000682 213
394 3300025295 Ga0209564_1004346 Ga0209564_10043468 213
395 3300025297 Ga0209758_1000019 Ga0209758_1000019616 213
396 3300025297 Ga0209758_1026569 Ga0209758_10265693 213
397 3300025298 Ga0209050_1000001 Ga0209050_10000011828 213
398 3300025298 Ga0209050_1000010 Ga0209050_1000010855 213
399 3300025298 Ga0209050_1000108 Ga0209050_1000108116 213
400 3300025298 Ga0209050_1029301 Ga0209050_10293014 213
401 3300025303 Ga0209051_1005046 Ga0209051_10050467 213
402 3300025304 Ga0209257_1000027 Ga0209257_1000027497 213
403 3300025304 Ga0209257_1035415 Ga0209257_10354153 213
404 3300025900 Ga0207710_10012555 Ga0207710_100125552 213
405 3300025923 Ga0207681_10021367 Ga0207681_100213675 213
406 3300025941 Ga0207711_10012761 Ga0207711_100127613 213
407 3300025961 Ga0207712_10000048 Ga0207712_10000048129 213
408 3300025972 Ga0207668_10003241 Ga0207668_100032413 213
409 3300026118 Ga0207675_100000071 Ga0207675_10000007136 213
410 3300028380 Ga0268265_10000209 Ga0268265_1000020923 213
411 3300028380 Ga0268265_11121799 Ga0268265_111217991 213
412 3300028381 Ga0268264_10004593 Ga0268264_1000459310 213
413 3300028381 Ga0268264_10321702 Ga0268264_103217022 213
414 3300031456 Ga0307513_10213019 Ga0307513_102130192 213
415 3300032004 Ga0307414_10461251 Ga0307414_104612512 213
416 3300038705 Ga0237819_01638 Ga0237819_01638_1763_2413 213
417 3300041410 Ga0439461_0000062 Ga0439461_0000062_8292_8942 213
418 3300041410 Ga0439461_0062145 Ga0439461_0062145_28_678 213
419 3300041413 Ga0439465_0002490 Ga0439465_0002490_4422_5072 213
420 3300041413 Ga0439465_0002807 Ga0439465_0002807_762_1412 213
421 3300041486 Ga0451807_0610978 Ga0451807_0610978_105_755 213
422 3300041997 Ga0439431_0000213 Ga0439431_0000213_3934_4584 213
423 3300041997 Ga0439431_0011636 Ga0439431_0011636_831_1481 213
424 3300042002 Ga0439442_002121 Ga0439442_002121_2453_3103 213
425 3300042004 Ga0439445_0001827 Ga0439445_0001827_3222_3872 213
426 3300042004 Ga0439445_0072984 Ga0439445_0072984_220_870 213
427 3300042006 Ga0439432_001352 Ga0439432_001352_4192_4842 213
428 3300042010 Ga0439452_012615 Ga0439452_012615_486_1136 213
429 3300042014 Ga0439457_023261 Ga0439457_023261_416_1066 213
430 3300042015 Ga0439462_0000410 Ga0439462_0000410_3115_3765 213
431 3300042015 Ga0439462_0051755 Ga0439462_0051755_54_704 213
432 3300042156 Ga0439446_0091979 Ga0439446_0091979_261_911 213
433 3300042435 Ga0439434_0000698 Ga0439434_0000698_4514_5164 213
434 3300042435 Ga0439434_0028901 Ga0439434_0028901_958_1608 213
435 3300047472 Ga0495686_0015005 Ga0495686_0015005_4371_5021 213
436 3300047472 Ga0495686_0347710 Ga0495686_0347710_35_685 213
437 3300048905 Ga0496102_0234679 Ga0496102_0234679_754_1404 213
438 3300048918 Ga0496115_0019907 Ga0496115_0019907_3672_4322 213
439 3300048920 Ga0496117_0017167 Ga0496117_0017167_4830_5480 213
440 3300048921 Ga0496118_0000606 Ga0496118_0000606_7342_7992 213
441 3300048926 Ga0496123_0101824 Ga0496123_0101824_55_705 213
442 3300048926 Ga0496123_0147013 Ga0496123_0147013_420_1070 213
443 3300048927 Ga0496124_0132955 Ga0496124_0132955_228_878 213
444 3300053096 Ga0500641_0001555 Ga0500641_0001555_637_1287 213
445 3300053108 Ga0500562_073645 Ga0500562_073645_114_764 213
446 3300053118 Ga0500594_0062933 Ga0500594_0062933_73_714 213
447 3300053119 Ga0500595_005345 Ga0500595_005345_3136_3789 213
448 3300053140 Ga0500573_0264954 Ga0500573_0264954_89_739 213
449 3300005563 Ga0068855_100629612 Ga0068855_1006296122 214
450 3300005577 Ga0068857_100309780 Ga0068857_1003097803 214
451 3300005834 Ga0068851_10013802 Ga0068851_100138024 214
452 3300013105 Ga0157369_10648922 Ga0157369_106489222 214
453 3300025321 Ga0207656_10104901 Ga0207656_101049012 214
454 3300026041 Ga0207639_10001072 Ga0207639_1000107220 214
455 3300026116 Ga0207674_10275701 Ga0207674_102757012 214
456 3300035111 Ga0373923_0130921 Ga0373923_0130921_264_914 214
457 3300046460 Ga0495638_0012358 Ga0495638_0012358_612_1280 214
458 3300046501 Ga0495607_0013398 Ga0495607_0013398_4119_4769 214
459 3300053087 Ga0500643_010045 Ga0500643_010045_1671_2324 214
460 3300021377 Ga0213874_10064662 Ga0213874_100646621 215
461 3300021384 Ga0213876_10200643 Ga0213876_102006432 215
462 3300026121 Ga0207683_10530257 Ga0207683_105302572 215
463 3300039437 Ga0436365_0864664 Ga0436365_0864664_380_1036 215
464 3300039450 Ga0436363_1390116 Ga0436363_1390116_676_1329 215
465 3300053085 Ga0495619_0327712 Ga0495619_0327712_384_1043 215
466 3300053140 Ga0500573_0000015 Ga0500573_0000015_149286_149954 215
467 3300001904 JGI24736J21556_1000235 JGI24736J21556_10002356 216
468 3300001915 JGI24741J21665_1000124 JGI24741J21665_10001249 216
469 3300001976 JGI24752J21851_1000586 JGI24752J21851_10005865 216
470 3300001979 JGI24740J21852_10003311 JGI24740J21852_100033119 216
471 3300001989 JGI24739J22299_10001891 JGI24739J22299_100018913 216
472 3300001990 JGI24737J22298_10006196 JGI24737J22298_100061964 216
473 3300002067 JGI24735J21928_10000699 JGI24735J21928_100006998 216
474 3300002075 JGI24738J21930_10020901 JGI24738J21930_100209012 216
475 3300002126 JGI24035J26624_1003524 JGI24035J26624_10035242 216
476 3300005289 Ga0065704_10000914 Ga0065704_100009141 216
477 3300005329 Ga0070683_100532952 Ga0070683_1005329522 216
478 3300005335 Ga0070666_10000111 Ga0070666_1000011133 216
479 3300005335 Ga0070666_10001747 Ga0070666_100017474 216
480 3300005339 Ga0070660_100166856 Ga0070660_1001668562 216
481 3300005344 Ga0070661_100008203 Ga0070661_1000082032 216
482 3300005347 Ga0070668_100000041 Ga0070668_10000004149 216
483 3300005347 Ga0070668_100084870 Ga0070668_1000848703 216
484 3300005353 Ga0070669_100000012 Ga0070669_10000001253 216
485 3300005353 Ga0070669_100005445 Ga0070669_10000544513 216
486 3300005353 Ga0070669_100218101 Ga0070669_1002181012 216
487 3300005355 Ga0070671_100000019 Ga0070671_10000001953 216
488 3300005366 Ga0070659_100140337 Ga0070659_1001403373 216
489 3300005367 Ga0070667_100000058 Ga0070667_100000058119 216
490 3300005367 Ga0070667_100113572 Ga0070667_1001135721 216
491 3300005440 Ga0070705_100004405 Ga0070705_1000044059 216
492 3300005466 Ga0070685_10016519 Ga0070685_100165192 216
493 3300005539 Ga0068853_100265068 Ga0068853_1002650683 216
494 3300005564 Ga0070664_100014905 Ga0070664_1000149052 216
495 3300005577 Ga0068857_100013486 Ga0068857_1000134862 216
496 3300005577 Ga0068857_100059205 Ga0068857_1000592053 216
497 3300005578 Ga0068854_100340174 Ga0068854_1003401742 216
498 3300005614 Ga0068856_100008231 Ga0068856_1000082316 216
499 3300005615 Ga0070702_100041902 Ga0070702_1000419023 216
500 3300005618 Ga0068864_100000475 Ga0068864_10000047520 216
501 3300005618 Ga0068864_100159134 Ga0068864_1001591343 216
502 3300005719 Ga0068861_100002169 Ga0068861_10000216911 216
503 3300005834 Ga0068851_10077709 Ga0068851_100777092 216
504 3300005841 Ga0068863_100000031 Ga0068863_100000031119 216
505 3300005841 Ga0068863_100005824 Ga0068863_10000582415 216
506 3300005842 Ga0068858_100021883 Ga0068858_1000218837 216
507 3300005843 Ga0068860_100022971 Ga0068860_1000229717 216
508 3300005843 Ga0068860_100031678 Ga0068860_1000316786 216
509 3300005844 Ga0068862_100000884 Ga0068862_10000088416 216
510 3300005985 Ga0081539_10016956 Ga0081539_100169567 216
511 3300006042 Ga0075368_10001355 Ga0075368_100013559 216
512 3300006178 Ga0075367_10001026 Ga0075367_1000102612 216
513 3300009011 Ga0105251_10015704 Ga0105251_100157046 216
514 3300009011 Ga0105251_10032668 Ga0105251_100326683 216
515 3300009092 Ga0105250_10075779 Ga0105250_100757791 216
516 3300009101 Ga0105247_10004441 Ga0105247_100044416 216
517 3300009147 Ga0114129_10282114 Ga0114129_102821141 216
518 3300009174 Ga0105241_10000807 Ga0105241_1000080712 216
519 3300009177 Ga0105248_10365850 Ga0105248_103658503 216
520 3300009545 Ga0105237_10008796 Ga0105237_100087966 216
521 3300009553 Ga0105249_10000553 Ga0105249_100005536 216
522 3300009978 Ga0105148_100060 Ga0105148_1000605 216
523 3300010375 Ga0105239_10808157 Ga0105239_108081571 216
524 3300013100 Ga0157373_10097352 Ga0157373_100973522 216
525 3300013102 Ga0157371_10710594 Ga0157371_107105941 216
526 3300013104 Ga0157370_10013194 Ga0157370_1001319410 216
527 3300013105 Ga0157369_10957018 Ga0157369_109570182 216
528 3300013306 Ga0163162_10658904 Ga0163162_106589042 216
529 3300014326 Ga0157380_10370279 Ga0157380_103702792 216
530 3300014968 Ga0157379_10001174 Ga0157379_1000117412 216
531 3300017792 Ga0163161_10038021 Ga0163161_100380213 216
532 3300017792 Ga0163161_10153985 Ga0163161_101539851 216
533 3300025229 Ga0209147_100881 Ga0209147_10088110 216
534 3300025315 Ga0207697_10000003 Ga0207697_1000000395 216
535 3300025321 Ga0207656_10088066 Ga0207656_100880661 216
536 3300025900 Ga0207710_10006744 Ga0207710_100067445 216
537 3300025903 Ga0207680_10000142 Ga0207680_1000014243 216
538 3300025903 Ga0207680_10000890 Ga0207680_1000089017 216
539 3300025904 Ga0207647_10004427 Ga0207647_100044278 216
540 3300025911 Ga0207654_10098004 Ga0207654_100980042 216
541 3300025914 Ga0207671_10021473 Ga0207671_100214736 216
542 3300025914 Ga0207671_10141452 Ga0207671_101414523 216
543 3300025919 Ga0207657_10005094 Ga0207657_100050943 216
544 3300025923 Ga0207681_10000004 Ga0207681_10000004518 216
545 3300025923 Ga0207681_10146955 Ga0207681_101469552 216
546 3300025923 Ga0207681_10191208 Ga0207681_101912082 216
547 3300025924 Ga0207694_10034311 Ga0207694_100343112 216
548 3300025925 Ga0207650_10005182 Ga0207650_100051827 216
549 3300025931 Ga0207644_10000031 Ga0207644_1000003154 216
550 3300025931 Ga0207644_10117952 Ga0207644_101179521 216
551 3300025933 Ga0207706_10015901 Ga0207706_100159017 216
552 3300025945 Ga0207679_10158754 Ga0207679_101587543 216
553 3300025961 Ga0207712_10018680 Ga0207712_100186806 216
554 3300025961 Ga0207712_10068285 Ga0207712_100682852 216
555 3300025972 Ga0207668_10000038 Ga0207668_1000003836 216
556 3300025972 Ga0207668_10000135 Ga0207668_1000013552 216
557 3300025972 Ga0207668_10069823 Ga0207668_100698231 216
558 3300025981 Ga0207640_10305753 Ga0207640_103057532 216
559 3300025981 Ga0207640_10511012 Ga0207640_105110122 216
560 3300025986 Ga0207658_10000037 Ga0207658_10000037119 216
561 3300025986 Ga0207658_10003835 Ga0207658_100038358 216
562 3300025986 Ga0207658_10397755 Ga0207658_103977552 216
563 3300026035 Ga0207703_10015775 Ga0207703_100157756 216
564 3300026041 Ga0207639_10000138 Ga0207639_1000013844 216
565 3300026067 Ga0207678_10005374 Ga0207678_100053743 216
566 3300026078 Ga0207702_10252641 Ga0207702_102526412 216
567 3300026088 Ga0207641_10000050 Ga0207641_1000005012 216
568 3300026088 Ga0207641_10006924 Ga0207641_1000692412 216
569 3300026095 Ga0207676_10004090 Ga0207676_1000409014 216
570 3300026116 Ga0207674_10007528 Ga0207674_1000752811 216
571 3300026116 Ga0207674_10035934 Ga0207674_100359348 216
572 3300026118 Ga0207675_100003319 Ga0207675_10000331912 216
573 3300026142 Ga0207698_10352718 Ga0207698_103527182 216
574 3300027866 Ga0209813_10000036 Ga0209813_100000367 216
575 3300028379 Ga0268266_10133519 Ga0268266_101335192 216
576 3300028380 Ga0268265_10000525 Ga0268265_1000052529 216
577 3300028381 Ga0268264_10000483 Ga0268264_1000048312 216
578 3300028381 Ga0268264_10143375 Ga0268264_101433753 216
579 3300031548 Ga0307408_100074061 Ga0307408_1000740612 216
580 3300031548 Ga0307408_100427460 Ga0307408_1004274601 216
581 3300031731 Ga0307405_10263720 Ga0307405_102637201 216
582 3300031731 Ga0307405_10407112 Ga0307405_104071122 216
583 3300031824 Ga0307413_10120074 Ga0307413_101200742 216
584 3300031824 Ga0307413_10187326 Ga0307413_101873262 216
585 3300031911 Ga0307412_10004187 Ga0307412_100041875 216
586 3300031911 Ga0307412_10089691 Ga0307412_100896913 216
587 3300031995 Ga0307409_100462886 Ga0307409_1004628862 216
588 3300032002 Ga0307416_100064488 Ga0307416_1000644883 216
589 3300032002 Ga0307416_100064534 Ga0307416_1000645342 216
590 3300032004 Ga0307414_10050186 Ga0307414_100501862 216
591 3300032004 Ga0307414_10178988 Ga0307414_101789883 216
592 3300032005 Ga0307411_10259352 Ga0307411_102593522 216
593 3300032005 Ga0307411_10621453 Ga0307411_106214532 216
594 3300041486 Ga0451807_2451244 Ga0451807_2451244_227_883 216
595 3300046453 Ga0495627_000036 Ga0495627_000036_145972_146637 216
596 3300046453 Ga0495627_000287 Ga0495627_000287_31488_32153 216
597 3300046471 Ga0495650_0001816 Ga0495650_0001816_3494_4162 216
598 3300046506 Ga0495583_0000252 Ga0495583_0000252_18923_19591 216
599 3300046512 Ga0495610_0000079 Ga0495610_0000079_96618_97283 216
600 3300046512 Ga0495610_0028580 Ga0495610_0028580_1586_2251 216
601 3300046518 Ga0495631_0069054 Ga0495631_0069054_145_810 216
602 3300046519 Ga0495632_0000095 Ga0495632_0000095_66522_67187 216
603 3300046519 Ga0495632_0000668 Ga0495632_0000668_12695_13363 216
604 3300046520 Ga0495637_0003691 Ga0495637_0003691_5679_6344 216
605 3300046520 Ga0495637_0047079 Ga0495637_0047079_209_874 216
606 3300046522 Ga0495643_0000038 Ga0495643_0000038_212927_213592 216
607 3300046524 Ga0495648_0000018 Ga0495648_0000018_275400_276068 216
608 3300046524 Ga0495648_0005139 Ga0495648_0005139_2490_3155 216
609 3300046525 Ga0495663_0000028 Ga0495663_0000028_66522_67187 216
610 3300046558 Ga0495633_0000340 Ga0495633_0000340_48010_48675 216
611 3300046558 Ga0495633_0003319 Ga0495633_0003319_9266_9931 216
612 3300046558 Ga0495633_0004974 Ga0495633_0004974_5908_6576 216
613 3300046558 Ga0495633_0108375 Ga0495633_0108375_563_1225 216
614 3300046558 Ga0495633_0142170 Ga0495633_0142170_149_814 216
615 3300046660 Ga0495625_0057803 Ga0495625_0057803_2065_2730 216
616 3300046665 Ga0495661_0024460 Ga0495661_0024460_199_864 216
617 3300046692 Ga0495671_0000011 Ga0495671_0000011_68996_69664 216
618 3300046692 Ga0495671_0000027 Ga0495671_0000027_22420_23085 216
619 3300047320 Ga0495672_0055076 Ga0495672_0055076_118_783 216
620 3300047469 Ga0495673_0000013 Ga0495673_0000013_337060_337728 216
621 3300047469 Ga0495673_0086819 Ga0495673_0086819_136_801 216
622 3300047470 Ga0495681_0000077 Ga0495681_0000077_81755_82420 216
623 3300047470 Ga0495681_0029019 Ga0495681_0029019_1956_2621 216
624 3300047472 Ga0495686_0035001 Ga0495686_0035001_1630_2295 216
625 3300047472 Ga0495686_0045796 Ga0495686_0045796_505_1170 216
626 3300048905 Ga0496102_0033928 Ga0496102_0033928_2720_3379 216
627 3300048905 Ga0496102_0180466 Ga0496102_0180466_146_811 216
628 3300048906 Ga0496103_0442886 Ga0496103_0442886_150_809 216
629 3300048909 Ga0496106_0522487 Ga0496106_0522487_202_861 216
630 3300048910 Ga0496107_0660656 Ga0496107_0660656_94_753 216
631 3300048911 Ga0496108_0001779 Ga0496108_0001779_15966_16631 216
632 3300048912 Ga0496109_0006311 Ga0496109_0006311_6290_6955 216
633 3300048912 Ga0496109_0197981 Ga0496109_0197981_1073_1738 216
634 3300048913 Ga0496110_0188045 Ga0496110_0188045_721_1386 216
635 3300048913 Ga0496110_0205913 Ga0496110_0205913_38_703 216
636 3300048913 Ga0496110_0525296 Ga0496110_0525296_248_913 216
637 3300048914 Ga0496111_0025926 Ga0496111_0025926_2951_3616 216
638 3300048914 Ga0496111_0090959 Ga0496111_0090959_68_733 216
639 3300048915 Ga0496112_0445998 Ga0496112_0445998_370_1035 216
640 3300048916 Ga0496113_0058450 Ga0496113_0058450_1136_1801 216
641 3300048919 Ga0496116_0019293 Ga0496116_0019293_2359_3024 216
642 3300048919 Ga0496116_0058256 Ga0496116_0058256_874_1539 216
643 3300048920 Ga0496117_0020177 Ga0496117_0020177_2948_3613 216
644 3300048921 Ga0496118_0244241 Ga0496118_0244241_271_936 216
645 3300048922 Ga0496119_0058202 Ga0496119_0058202_126_791 216
646 3300048922 Ga0496119_0298168 Ga0496119_0298168_69_752 216
647 3300048924 Ga0496121_0000349 Ga0496121_0000349_5650_6315 216
648 3300048924 Ga0496121_0138727 Ga0496121_0138727_1050_1715 216
649 3300048925 Ga0496122_0059250 Ga0496122_0059250_641_1306 216
650 3300048925 Ga0496122_0141734 Ga0496122_0141734_31_696 216
651 3300048925 Ga0496122_0166595 Ga0496122_0166595_368_1054 216
652 3300048926 Ga0496123_0106295 Ga0496123_0106295_519_1205 216
653 3300048926 Ga0496123_0120378 Ga0496123_0120378_724_1389 216
654 3300048927 Ga0496124_0001132 Ga0496124_0001132_18846_19529 216
655 3300048927 Ga0496124_0008888 Ga0496124_0008888_5058_5741 216
656 3300048927 Ga0496124_0049847 Ga0496124_0049847_1727_2413 216
657 3300048927 Ga0496124_0050093 Ga0496124_0050093_2587_3252 216
658 3300048927 Ga0496124_0269944 Ga0496124_0269944_395_1060 216
659 3300048927 Ga0496124_0344554 Ga0496124_0344554_57_722 216
660 3300048927 Ga0496124_0348664 Ga0496124_0348664_38_703 216
661 3300048928 Ga0496125_0016696 Ga0496125_0016696_436_1101 216
662 3300048928 Ga0496125_0018428 Ga0496125_0018428_2617_3282 216
663 3300048928 Ga0496125_0038148 Ga0496125_0038148_41_706 216
664 3300048928 Ga0496125_0060040 Ga0496125_0060040_2032_2697 216
665 3300048929 Ga0496126_0027985 Ga0496126_0027985_2163_2828 216
666 3300048929 Ga0496126_0633079 Ga0496126_0633079_19_684 216
667 3300049574 Ga0501038_0298223 Ga0501038_0298223_43_705 216
668 3300049663 Ga0501223_000042 Ga0501223_000042_35404_36069 216
669 3300049705 Ga0501225_0000520 Ga0501225_0000520_3573_4238 216
670 3300049705 Ga0501225_0003808 Ga0501225_0003808_3813_4478 216
671 3300049705 Ga0501225_0022874 Ga0501225_0022874_426_1091 216
672 3300050494 nmdc:mga06z11_111_c1 nmdc:mga06z11_111_c1_10332_10997 216
673 3300050495 nmdc:mga04h51_100_c1 nmdc:mga04h51_100_c1_22607_23272 216
674 3300050507 nmdc:mga05p37_228596_c1 nmdc:mga05p37_228596_c1_1550_2215 216
675 3300053087 Ga0500643_000539 Ga0500643_000539_16563_17231 216
676 3300053087 Ga0500643_002149 Ga0500643_002149_3596_4258 216
677 3300053108 Ga0500562_005307 Ga0500562_005307_2426_3091 216
678 3300053125 Ga0500618_022875 Ga0500618_022875_142_804 216
679 3300053136 Ga0500559_0001442 Ga0500559_0001442_3447_4115 216
680 3300053157 Ga0500624_000125 Ga0500624_000125_23236_23898 216
681 3300053177 Ga0500636_0013174 Ga0500636_0013174_3007_3669 216
682 3300055283 Ga0500661_000138 Ga0500661_000138_8873_9541 216
683 3300006353 Ga0075370_10002503 Ga0075370_1000250312 217
684 3300025921 Ga0207652_10718415 Ga0207652_107184151 217
685 3300037471 Ga0395905_0104285 Ga0395905_0104285_1067_1747 217
686 3300037853 Ga0436364_0154840 Ga0436364_0154840_48580_49248 217
687 3300038443 Ga0395901_0101619 Ga0395901_0101619_747_1427 217
688 3300038443 Ga0395901_0387218 Ga0395901_0387218_150_830 217
689 3300048929 Ga0496126_0232662 Ga0496126_0232662_89_754 217
690 3300050496 nmdc:mga07m45_1083_c1 nmdc:mga07m45_1083_c1_6968_7627 217
691 3300050496 nmdc:mga07m45_82575_c1 nmdc:mga07m45_82575_c1_470_1129 217
692 3300053156 Ga0500622_0000901 Ga0500622_0000901_24364_25023 217
693 iso_pu_bacteria 8054302542 8054306873 217
694 3300005289 Ga0065704_10003296 Ga0065704_100032963 218
695 3300005289 Ga0065704_10077790 Ga0065704_100777906 218
696 3300005331 Ga0070670_100035441 Ga0070670_1000354414 218
697 3300005335 Ga0070666_10098313 Ga0070666_100983132 218
698 3300005347 Ga0070668_100135504 Ga0070668_1001355042 218
699 3300005355 Ga0070671_100002891 Ga0070671_1000028918 218
700 3300005367 Ga0070667_100016472 Ga0070667_1000164726 218
701 3300005548 Ga0070665_100001012 Ga0070665_1000010124 218
702 3300005841 Ga0068863_100007418 Ga0068863_10000741813 218
703 3300005842 Ga0068858_100204130 Ga0068858_1002041303 218
704 3300005844 Ga0068862_100005927 Ga0068862_1000059275 218
705 3300009011 Ga0105251_10004489 Ga0105251_100044895 218
706 3300009093 Ga0105240_10020042 Ga0105240_100200426 218
707 3300009101 Ga0105247_10117922 Ga0105247_101179222 218
708 3300009148 Ga0105243_10654438 Ga0105243_106544381 218
709 3300009177 Ga0105248_10018898 Ga0105248_100188984 218
710 3300009177 Ga0105248_10070358 Ga0105248_100703585 218
711 3300009545 Ga0105237_10075759 Ga0105237_100757592 218
712 3300025735 Ga0207713_1020886 Ga0207713_10208863 218
713 3300025900 Ga0207710_10019525 Ga0207710_100195254 218
714 3300025900 Ga0207710_10310503 Ga0207710_103105031 218
715 3300025903 Ga0207680_10084501 Ga0207680_100845012 218
716 3300025913 Ga0207695_10058839 Ga0207695_100588393 218
717 3300025914 Ga0207671_10042931 Ga0207671_100429312 218
718 3300025923 Ga0207681_10002575 Ga0207681_1000257511 218
719 3300025931 Ga0207644_10000293 Ga0207644_1000029327 218
720 3300025972 Ga0207668_10150777 Ga0207668_101507772 218
721 3300025986 Ga0207658_10010872 Ga0207658_100108722 218
722 3300026088 Ga0207641_10008467 Ga0207641_1000846712 218
723 3300028379 Ga0268266_10000471 Ga0268266_1000047117 218
724 3300028380 Ga0268265_10014040 Ga0268265_100140406 218
725 3300028381 Ga0268264_10019865 Ga0268264_100198658 218
726 3300046660 Ga0495625_0006657 Ga0495625_0006657_1565_2233 218
727 3300047472 Ga0495686_0000469 Ga0495686_0000469_42544_43230 218
728 3300048919 Ga0496116_0026853 Ga0496116_0026853_2029_2697 218
729 3300048920 Ga0496117_0166070 Ga0496117_0166070_30_761 218
730 3300048921 Ga0496118_0023847 Ga0496118_0023847_974_1642 218
731 3300048921 Ga0496118_0032113 Ga0496118_0032113_492_1223 218
732 3300048922 Ga0496119_0043741 Ga0496119_0043741_1690_2376 218
733 3300048924 Ga0496121_0006573 Ga0496121_0006573_4070_4750 218
734 3300048924 Ga0496121_0009274 Ga0496121_0009274_6996_7664 218
735 3300048925 Ga0496122_0219377 Ga0496122_0219377_412_1080 218
736 3300048928 Ga0496125_0012034 Ga0496125_0012034_7016_7684 218
737 3300048928 Ga0496125_0283364 Ga0496125_0283364_249_935 218
738 3300048929 Ga0496126_0459179 Ga0496126_0459179_340_1008 218
739 3300049579 Ga0501043_0130029 Ga0501043_0130029_436_1122 218
740 3300049758 Ga0501241_005459 Ga0501241_005459_711_1379 218
741 3300049823 Ga0501044_0049651 Ga0501044_0049651_596_1282 218
742 3300053087 Ga0500643_045312 Ga0500643_045312_522_1190 218
743 3300053098 Ga0500650_0191460 Ga0500650_0191460_82_750 218
744 3300053104 Ga0500556_0000074 Ga0500556_0000074_79786_80454 218
745 3300053105 Ga0500557_017166 Ga0500557_017166_102_770 218
746 3300053130 Ga0500642_0000002 Ga0500642_0000002_514210_514878 218
747 3300053730 Ga0500645_003833 Ga0500645_003833_1464_2132 218
748 iso_pu_bacteria 2512564014 2512644061 218
749 iso_pu_bacteria 2775507255 2778123851 218
750 3300005289 Ga0065704_10070989 Ga0065704_1007098915 219
751 3300005295 Ga0065707_10084356 Ga0065707_100843568 219
752 3300005335 Ga0070666_10062591 Ga0070666_100625914 219
753 3300005347 Ga0070668_100008132 Ga0070668_1000081326 219
754 3300005353 Ga0070669_100010694 Ga0070669_1000106944 219
755 3300005355 Ga0070671_100003218 Ga0070671_10000321815 219
756 3300005367 Ga0070667_100012087 Ga0070667_1000120875 219
757 3300005548 Ga0070665_100010368 Ga0070665_1000103685 219
758 3300005843 Ga0068860_100078368 Ga0068860_1000783686 219
759 3300005844 Ga0068862_100235818 Ga0068862_1002358181 219
760 3300009011 Ga0105251_10035471 Ga0105251_100354712 219
761 3300009092 Ga0105250_10032780 Ga0105250_100327803 219
762 3300009177 Ga0105248_10033589 Ga0105248_100335897 219
763 3300009553 Ga0105249_10093615 Ga0105249_100936152 219
764 3300013306 Ga0163162_10053526 Ga0163162_100535264 219
765 3300014326 Ga0157380_10545439 Ga0157380_105454392 219
766 3300025735 Ga0207713_1019134 Ga0207713_10191342 219
767 3300025923 Ga0207681_10002077 Ga0207681_1000207710 219
768 3300025931 Ga0207644_10007460 Ga0207644_100074605 219
769 3300025941 Ga0207711_10027237 Ga0207711_100272373 219
770 3300025961 Ga0207712_10058448 Ga0207712_100584483 219
771 3300025972 Ga0207668_10004934 Ga0207668_100049346 219
772 3300028379 Ga0268266_10019776 Ga0268266_100197768 219
773 3300028381 Ga0268264_10064820 Ga0268264_100648206 219
774 3300046471 Ga0495650_0028746 Ga0495650_0028746_809_1507 219
775 3300046513 Ga0495616_0000010 Ga0495616_0000010_173971_174669 219
776 3300046616 Ga0495668_0008492 Ga0495668_0008492_1856_2554 219
777 3300048903 Ga0496100_0063797 Ga0496100_0063797_1483_2154 219
778 3300048904 Ga0496101_0035108 Ga0496101_0035108_1392_2063 219
779 3300048905 Ga0496102_0000267 Ga0496102_0000267_4337_5008 219
780 3300048906 Ga0496103_0000139 Ga0496103_0000139_33090_33761 219
781 3300048907 Ga0496104_0001996 Ga0496104_0001996_12727_13398 219
782 3300048908 Ga0496105_0000099 Ga0496105_0000099_31679_32350 219
783 3300048910 Ga0496107_0020816 Ga0496107_0020816_1848_2519 219
784 3300048914 Ga0496111_0192483 Ga0496111_0192483_115_786 219
785 3300048915 Ga0496112_0018899 Ga0496112_0018899_4330_5001 219
786 3300048916 Ga0496113_0004509 Ga0496113_0004509_3898_4569 219
787 3300048918 Ga0496115_0236213 Ga0496115_0236213_23_694 219
788 3300048919 Ga0496116_0072004 Ga0496116_0072004_22_693 219
789 3300048920 Ga0496117_0008650 Ga0496117_0008650_4224_4895 219
790 3300048921 Ga0496118_0009747 Ga0496118_0009747_4225_4896 219
791 3300048922 Ga0496119_0004210 Ga0496119_0004210_4350_5021 219
792 3300048923 Ga0496120_0003080 Ga0496120_0003080_11881_12552 219
793 3300048924 Ga0496121_0013822 Ga0496121_0013822_4349_5020 219
794 3300048925 Ga0496122_0005423 Ga0496122_0005423_4349_5020 219
795 3300048926 Ga0496123_0002794 Ga0496123_0002794_3166_3837 219
796 3300048927 Ga0496124_0001730 Ga0496124_0001730_4308_4979 219
797 3300048928 Ga0496125_0004923 Ga0496125_0004923_3042_3713 219
798 3300048929 Ga0496126_0000619 Ga0496126_0000619_4349_5020 219
799 3300053158 Ga0500627_0002237 Ga0500627_0002237_750_1448 219
800 3300006051 Ga0075364_10166195 Ga0075364_101661951 220
801 3300017792 Ga0163161_10057942 Ga0163161_100579424 220
802 3300046557 Ga0495622_0012565 Ga0495622_0012565_814_1491 220
803 3300050491 nmdc:mga00v17_29710_c1 nmdc:mga00v17_29710_c1_603_1277 220
804 3300005289 Ga0065704_10000192 Ga0065704_10000192119 221
805 3300041512 Ga0451853_2895476 Ga0451853_2895476_146_841 221
806 3300046453 Ga0495627_000090 Ga0495627_000090_36306_36971 221
807 3300046471 Ga0495650_0000684 Ga0495650_0000684_35729_36394 221
808 3300046500 Ga0495596_0000601 Ga0495596_0000601_15011_15676 221
809 3300046507 Ga0495606_0026435 Ga0495606_0026435_3132_3797 221
810 3300046512 Ga0495610_0000015 Ga0495610_0000015_90123_90788 221
811 3300046512 Ga0495610_0001801 Ga0495610_0001801_9978_10643 221
812 3300046515 Ga0495620_0013186 Ga0495620_0013186_551_1216 221
813 3300046519 Ga0495632_0001502 Ga0495632_0001502_8834_9499 221
814 3300046519 Ga0495632_0090126 Ga0495632_0090126_772_1437 221
815 3300046522 Ga0495643_0000217 Ga0495643_0000217_51281_51946 221
816 3300046522 Ga0495643_0012289 Ga0495643_0012289_2086_2751 221
817 3300046522 Ga0495643_0086614 Ga0495643_0086614_564_1229 221
818 3300046538 Ga0495609_0001277 Ga0495609_0001277_11560_12225 221
819 3300046660 Ga0495625_0014445 Ga0495625_0014445_1228_1893 221
820 3300046665 Ga0495661_0048707 Ga0495661_0048707_776_1441 221
821 3300046691 Ga0495670_0315271 Ga0495670_0315271_35_700 221
822 3300047470 Ga0495681_0000048 Ga0495681_0000048_36296_36961 221
823 3300048090 Ga0495615_0091122 Ga0495615_0091122_70_735 221
824 3300048925 Ga0496122_0003895 Ga0496122_0003895_6916_7596 221
825 3300048925 Ga0496122_0009664 Ga0496122_0009664_109_774 221
826 3300048926 Ga0496123_0000286 Ga0496123_0000286_62931_63611 221
827 3300048926 Ga0496123_0002745 Ga0496123_0002745_20235_20900 221
828 3300048928 Ga0496125_0079290 Ga0496125_0079290_393_1094 221
829 3300048928 Ga0496125_0392570 Ga0496125_0392570_46_726 221
830 3300048929 Ga0496126_0066961 Ga0496126_0066961_756_1436 221
831 3300053088 Ga0500644_0028883 Ga0500644_0028883_589_1269 221
832 3300053156 Ga0500622_0016726 Ga0500622_0016726_2831_3511 221
833 iso_pu_bacteria 2510917021 2511129570 222
834 2162886007 SwRhRL2b_contig_3660702 SwRhRL2b_0207.00001360 223

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00625

Guanylate_kin

Guanylate kinase

15

190

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7yki-assembly1.cif.gz_A crystal structure of magi2 pdz0-gk domain in complex with phospho-sapap1 gbr3 peptide 0.9666 50 100
7luy-assembly1.cif.gz_F crystal structure of guanylate kinase from bartonella henselae str. houston-1 0.9397 18 223
7luy-assembly1.cif.gz_F crystal structure of guanylate kinase from bartonella henselae str. houston-1 0.9302 18 223
7luy-assembly2.cif.gz_E crystal structure of guanylate kinase from bartonella henselae str. houston-1 0.9282 18 223
7luy-assembly2.cif.gz_E crystal structure of guanylate kinase from bartonella henselae str. houston-1 0.9194 18 223
ID Description Score Start End Superfamily
af_Q94JM2_119_167_3.30.63.10 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.9999 51 99 3.30.63.10
af_Q2QPW1_160_210_3.30.63.10 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.9916 51 99 3.30.63.10
3tr0A02 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.9823 51 110 3.30.63.10
af_Q94JM2_119_167_3.30.63.10 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.98 51 99 3.30.63.10
3tr0A02 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.9663 51 110 3.30.63.10
ID Description Score Start End GO Terms
AF-A0A1U9Z321-F1-model_v4 Guanylate kinase (EC 2.7.4.8) (GMP kinase) 0.9639 15 219 GO:0004385
GO:0005524
GO:0005829
AF-A0A0Q8Q189-F1-model_v4 Guanylate kinase (EC 2.7.4.8) (GMP kinase) 0.9635 11 223 GO:0004385
GO:0005524
GO:0005829
AF-A0A0Q8Q189-F1-model_v4 Guanylate kinase (EC 2.7.4.8) (GMP kinase) 0.9591 11 223 GO:0004385
GO:0005524
GO:0005829
AF-A0A7V8A964-F1-model_v4 Guanylate kinase 0.9578 18 143 GO:0004385
GO:0005829
AF-A0A6I4TDJ5-F1-model_v4 Guanylate kinase (EC 2.7.4.8) (GMP kinase) 0.9542 7 219 GO:0004385
GO:0005524
GO:0005829

Feature Viewer

pLDDT pTM Quality
84.44 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map