F482732

General Info

Members Datasets Scaffolds Average Seq Length
832 419 772 157

Family's Representative Sequence

Representative Sequence 3300049573|Ga0501037_0125713|Ga0501037_0125713_190_744
Length 184
Sequence MREPLAFAFRHGSGRIRIVPPSTPTETAMKGDAKVIEFLNKVLYNELTAINQYFLHYRMFKDWGYQELAEHEYKESIEEMKHADHLIERILFLDGLPNLQHLGKLRIGENVLECIQGDLDLELVAAKDLRAAIAHAEGIADYVSRDLFKNILHDEEEHIDWLETQQSLVKDIGAERYLQNKMGD

Samples

Sample ID Description Type Environment
1 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
2 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
3 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
4 2565956521 Vibrio rhizosphaerae DSM 18581 Isolate Rhizosphere
5 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
6 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
7 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
8 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
9 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
10 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
11 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
12 2734482264 Dyella sp. AD052 Isolate Unclassified
13 2738543009 Luteibacter sp. OK325 Isolate Unclassified
14 2739367700 Dyella sp. YR388 Isolate Unclassified
15 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
16 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
17 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
18 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
19 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
20 2818991457 Xanthomonas translucens 569 Isolate Unclassified
21 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
22 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
23 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
24 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
25 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
26 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
27 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
28 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
29 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
30 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
31 2884411467 Dyella sp. AD56 Isolate Rhizosphere
32 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
33 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
34 2919085039 Luteibacter sp. 1214 Isolate Unclassified
35 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
36 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
37 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
38 2919404418 Luteibacter sp. 3190 Isolate Unclassified
39 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
40 2928963466 Dyella japonica 1073 Isolate Unclassified
41 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
42 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
43 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
44 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
45 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
46 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
47 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
48 2941471342 Luteibacter sp. 621 Isolate Unclassified
49 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
50 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
51 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
52 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
53 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
54 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
55 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
56 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
57 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
58 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
59 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
60 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
61 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
62 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
63 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
64 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
65 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
66 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
67 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
68 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
69 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
70 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
71 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
72 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
73 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
74 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
75 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
76 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
77 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
78 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
79 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
80 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
81 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
82 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
83 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
84 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
85 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
86 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
87 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
88 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
89 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
90 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
91 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
92 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
93 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
94 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
95 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
96 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
97 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
98 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
99 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
100 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
101 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
102 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
103 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
104 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
105 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
106 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
107 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
108 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
109 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
110 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
111 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
112 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
113 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
114 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
115 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
116 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
117 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
118 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
119 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
120 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
121 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
122 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
123 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
124 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
125 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
126 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
127 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
128 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
129 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
130 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
131 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
132 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
133 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
134 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
135 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
136 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
137 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
138 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
139 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
140 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
141 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
142 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
143 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
144 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
145 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
146 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
147 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
148 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
149 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
150 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
151 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
152 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
153 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
154 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
155 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
156 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
157 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
158 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
159 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
160 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
161 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
162 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
163 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
164 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
165 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
166 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
167 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
168 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
169 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
170 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
171 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
172 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
173 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
174 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
175 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
176 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
177 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
178 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
179 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
180 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
181 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
182 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
183 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
184 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
188 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
190 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
191 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
192 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
193 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
194 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
197 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
198 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
199 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
200 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
201 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
202 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
203 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
204 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
205 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
206 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
207 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
208 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
245 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
249 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
250 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
252 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
253 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
254 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
255 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
256 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
257 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
258 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
259 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
260 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
261 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
262 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
263 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
264 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
265 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
266 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
267 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
268 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
269 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
270 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
271 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
272 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
273 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
274 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
275 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
276 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
277 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
278 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
279 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
280 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
281 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
282 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
283 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
284 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
285 3300044536 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E Metagenome Unclassified
286 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
287 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
288 3300044661 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E Metagenome Unclassified
289 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
290 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
291 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
292 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
293 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
294 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
295 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
296 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
297 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
298 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
299 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
300 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
301 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
302 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
303 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
304 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
305 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
306 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
307 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
308 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
309 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
310 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
311 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
312 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
313 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
314 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
315 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
316 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
317 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
318 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
319 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
320 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
321 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
322 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
323 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
324 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
325 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
326 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
327 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
328 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
329 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
330 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
331 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
332 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
333 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
334 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
335 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
336 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
337 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
338 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
339 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
340 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
341 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
342 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
343 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
344 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
345 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
346 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
347 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
348 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
349 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
350 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
351 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
352 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
353 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
354 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
355 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
356 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
357 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
358 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
359 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
360 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
361 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
362 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
363 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
364 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
365 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
366 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
371 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
374 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
375 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
376 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
377 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
378 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
379 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
380 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
381 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
382 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
383 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
384 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
385 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
386 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
387 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
388 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
389 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
390 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
391 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
392 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
393 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
394 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
395 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
396 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
397 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
398 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
399 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
400 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
401 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
402 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
403 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
404 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
405 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
406 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
407 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
408 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
409 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
410 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
411 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
412 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
413 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
414 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
415 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
416 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
417 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
418 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
419 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.26
Metatranscriptomes 2.52
Isolates 7.21

Biome Distribution

Category Percentage (%)
Aerial Root 0.12
Bulb 0
Endosphere 16.23
Nodule 0.12
Rhizoplane 2.16
Rhizosphere 66.95
Stem 0
Stem Tuber 0
Unclassified 14.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1006931 3300001904 Bacteria 1908
2 JGI24740J21852_10006437 3300001979 Bacteria 4864
3 JGI24740J21852_10046037 3300001979 Bacteria 1283
4 JGI24739J22299_10005117 3300001989 Bacteria 4994
5 JGI24737J22298_10003429 3300001990 Bacteria 5605
6 JGI24737J22298_10007318 3300001990 Bacteria 3732
7 JGI24737J22298_10042862 3300001990 Bacteria 1386
8 JGI24735J21928_10004506 3300002067 Bacteria 4685
9 JGI24735J21928_10007432 3300002067 Bacteria 3574
10 JGI24735J21928_10034707 3300002067 Bacteria 1486
11 JGI24738J21930_10000134 3300002075 Bacteria 18117
12 JGI24738J21930_10065776 3300002075 Bacteria 747
13 JGI25156J39149_1006761 3300002705 Bacteria 3092
14 JGI25156J39149_1022847 3300002705 Bacteria 1055
15 JGI25162J39368_1000115 3300002737 Bacteria 88006
16 JGI25162J39368_1000402 3300002737 Bacteria 35934
17 JGI25162J39368_1003198 3300002737 Bacteria 5089
18 JGI25162J39368_1004010 3300002737 Bacteria 3716
19 JGI25162J39368_1009221 3300002737 Bacteria 1340
20 JGI25154J39366_1006347 3300002738 Bacteria 1745
21 JGI25157J39369_1000132 3300002741 Bacteria 62647
22 JGI25157J39369_1000313 3300002741 Bacteria 35036
23 JGI25157J39369_1000344 3300002741 Bacteria 32837
24 JGI25157J39369_1000452 3300002741 Bacteria 26160
25 JGI25157J39369_1000453 3300002741 Bacteria 26066
26 JGI25157J39369_1003094 3300002741 Bacteria 3589
27 JGI25163J39215_1000758 3300002771 Bacteria 8028
28 JGI25164J39214_1000090 3300002772 Bacteria 90565
29 JGI25164J39214_1000117 3300002772 Bacteria 76695
30 JGI25164J39214_1000522 3300002772 Bacteria 18167
31 JGI25164J39214_1001570 3300002772 Bacteria 4926
32 JGI25165J46597_1000194 3300003214 Bacteria 91012
33 JGI25165J46597_1000235 3300003214 Bacteria 76684
34 JGI25165J46597_1002775 3300003214 Bacteria 5089
35 rootH2_10001214 3300003320 Bacteria 12480
36 Ga0006562J51391_1003311 3300003578 Bacteria 6730
37 Ga0006562J51391_1026967 3300003578 Bacteria 18790
38 Ga0006562J51391_1026969 3300003578 Bacteria 12990
39 Ga0055538_1002959 3300003751 Bacteria 2292
40 Ga0055533_1001362 3300003756 Bacteria 6544
41 Ga0055533_1001537 3300003756 Bacteria 6014
42 Ga0055533_1007754 3300003756 Bacteria 1424
43 Ga0055525_1000082 3300003759 Bacteria 159396
44 Ga0055527_1000176 3300003760 Bacteria 43621
45 Ga0055527_1000179 3300003760 Bacteria 42841
46 Ga0055527_1005250 3300003760 Bacteria 1701
47 Ga0055535_1000106 3300003761 Bacteria 90565
48 Ga0055535_1000373 3300003761 Bacteria 42794
49 Ga0055535_1000405 3300003761 Bacteria 40615
50 Ga0055535_1000487 3300003761 Bacteria 35749
51 Ga0055535_1001357 3300003761 Bacteria 12869
52 Ga0055535_1001457 3300003761 Bacteria 11944
53 Ga0055535_1001699 3300003761 Bacteria 10025
54 Ga0055542_1000150 3300003762 Bacteria 88006
55 Ga0055542_1000245 3300003762 Bacteria 62120
56 Ga0055542_1000394 3300003762 Bacteria 43618
57 Ga0055542_1000429 3300003762 Bacteria 40523
58 Ga0055542_1000431 3300003762 Bacteria 40271
59 Ga0055542_1000734 3300003762 Bacteria 25435
60 Ga0055529_1000168 3300003763 Bacteria 90565
61 Ga0055529_1000178 3300003763 Bacteria 86969
62 Ga0055529_1000314 3300003763 Bacteria 55435
63 Ga0055529_1000420 3300003763 Bacteria 43618
64 Ga0055529_1000428 3300003763 Bacteria 42837
65 Ga0055536_1000766 3300003781 Bacteria 21387
66 Ga0055536_1000908 3300003781 Bacteria 19136
67 Ga0055530_10002816 3300003791 Bacteria 10690
68 Ga0055540_1020526 3300003792 Bacteria 1744
69 Ga0055540_1032434 3300003792 Bacteria 1192
70 Ga0055531_10005486 3300003794 Bacteria 7420
71 Ga0058692_1000004 3300003856 Bacteria 431119
72 Ga0065165_1001600 3300005262 Bacteria 23230
73 Ga0065704_10041565 3300005289 Bacteria 939
74 Ga0065704_10395925 3300005289 Bacteria 757
75 Ga0070658_10002151 3300005327 Bacteria 16517
76 Ga0070658_10153551 3300005327 Bacteria 1929
77 Ga0070683_100587141 3300005329 Bacteria 1066
78 Ga0070666_10000001 3300005335 Bacteria 543080
79 Ga0070680_100214885 3300005336 Bacteria 1623
80 Ga0070682_100001661 3300005337 Bacteria 12376
81 Ga0070682_100012513 3300005337 Bacteria 4867
82 Ga0070682_100074554 3300005337 Bacteria 2179
83 Ga0070682_100202603 3300005337 Bacteria 1401
84 Ga0070660_100115019 3300005339 Bacteria 2144
85 Ga0070660_100165679 3300005339 Bacteria 1783
86 Ga0070689_100004904 3300005340 Bacteria 9077
87 Ga0070661_100012331 3300005344 Bacteria 5980
88 Ga0070661_100020178 3300005344 Bacteria 4751
89 Ga0070661_100021242 3300005344 Bacteria 4634
90 Ga0070661_100075635 3300005344 Bacteria 2481
91 Ga0070692_10008876 3300005345 Bacteria 4504
92 Ga0070692_10247756 3300005345 Bacteria 1065
93 Ga0070668_100008631 3300005347 Bacteria 7568
94 Ga0070669_100381917 3300005353 Bacteria 1149
95 Ga0070688_100114170 3300005365 Bacteria 1800
96 Ga0070659_100001906 3300005366 Bacteria 14915
97 Ga0070659_100002475 3300005366 Bacteria 13114
98 Ga0070667_100006964 3300005367 Bacteria 9393
99 Ga0070714_100000749 3300005435 Bacteria 22993
100 Ga0070714_100001553 3300005435 Bacteria 16723
101 Ga0070714_100007691 3300005435 Bacteria 8393
102 Ga0070713_100000602 3300005436 Bacteria 22854
103 Ga0070713_100278234 3300005436 Bacteria 1534
104 Ga0070713_100344861 3300005436 Bacteria 1381
105 Ga0070710_10032588 3300005437 Bacteria 2824
106 Ga0070711_100807841 3300005439 Bacteria 796
107 Ga0070711_101507507 3300005439 Bacteria 587
108 Ga0070705_100525476 3300005440 Bacteria 903
109 Ga0070694_100985686 3300005444 Bacteria 699
110 Ga0070663_100018335 3300005455 Bacteria 4587
111 Ga0070663_100081346 3300005455 Bacteria 2381
112 Ga0070663_100321872 3300005455 Bacteria 1244
113 Ga0070663_100406035 3300005455 Bacteria 1115
114 Ga0070663_100539021 3300005455 Bacteria 974
115 Ga0070678_100011516 3300005456 Bacteria 5463
116 Ga0070662_100022988 3300005457 Bacteria 4277
117 Ga0070681_10003017 3300005458 Bacteria 15620
118 Ga0070681_10010816 3300005458 Bacteria 9019
119 Ga0070681_10286291 3300005458 Bacteria 1558
120 Ga0070681_11303941 3300005458 Bacteria 649
121 Ga0070706_101223212 3300005467 Bacteria 690
122 Ga0070679_100027315 3300005530 Bacteria 5617
123 Ga0070679_100279657 3300005530 Bacteria 1622
124 Ga0070679_101640567 3300005530 Bacteria 591
125 Ga0070684_100561902 3300005535 Bacteria 1059
126 Ga0068853_100006253 3300005539 Bacteria 9438
127 Ga0068853_100169361 3300005539 Bacteria 1975
128 Ga0068853_100258383 3300005539 Bacteria 1600
129 Ga0070696_100015645 3300005546 Bacteria 5097
130 Ga0070696_100113397 3300005546 Bacteria 1954
131 Ga0070696_100359714 3300005546 Bacteria 1129
132 Ga0070696_100644576 3300005546 Bacteria 858
133 Ga0070693_100043943 3300005547 Bacteria 2526
134 Ga0070693_100113977 3300005547 Bacteria 1667
135 Ga0070665_100017480 3300005548 Bacteria 7202
136 Ga0070665_100174034 3300005548 Bacteria 2153
137 Ga0068855_100165702 3300005563 Bacteria 2505
138 Ga0068855_100178419 3300005563 Bacteria 2402
139 Ga0068855_100679439 3300005563 Bacteria 1103
140 Ga0070664_100457627 3300005564 Bacteria 1172
141 Ga0068857_100007224 3300005577 Bacteria 9565
142 Ga0068857_100083154 3300005577 Bacteria 2859
143 Ga0068857_100278611 3300005577 Bacteria 1538
144 Ga0068857_100675440 3300005577 Bacteria 980
145 Ga0068854_100000026 3300005578 Bacteria 118880
146 Ga0068854_100033812 3300005578 Bacteria 3566
147 Ga0068854_100074560 3300005578 Bacteria 2489
148 Ga0068854_100131868 3300005578 Bacteria 1909
149 Ga0068856_100000132 3300005614 Bacteria 75819
150 Ga0068856_100000138 3300005614 Bacteria 73748
151 Ga0068856_100156438 3300005614 Bacteria 2289
152 Ga0068852_100059059 3300005616 Bacteria 3325
153 Ga0068851_10063461 3300005834 Bacteria 1897
154 Ga0068858_100076429 3300005842 Bacteria 3109
155 Ga0068858_100334273 3300005842 Bacteria 1449
156 Ga0068860_100040218 3300005843 Bacteria 4470
157 Ga0068860_100093958 3300005843 Bacteria 2859
158 Ga0068862_100191160 3300005844 Bacteria 1842
159 Ga0081540_1001656 3300005983 Bacteria 18948
160 Ga0081539_10013089 3300005985 Bacteria 6289
161 Ga0070717_10194523 3300006028 Bacteria 1773
162 Ga0070717_10373156 3300006028 Bacteria 1278
163 Ga0075364_10000769 3300006051 Bacteria 16847
164 Ga0075364_10027694 3300006051 Bacteria 3622
165 Ga0075364_10726542 3300006051 Bacteria 677
166 Ga0070715_10668246 3300006163 Bacteria 617
167 Ga0070712_100215883 3300006175 Bacteria 1515
168 Ga0070712_100346463 3300006175 Bacteria 1215
169 Ga0075369_10027448 3300006186 Bacteria 2380
170 Ga0075370_10003280 3300006353 Bacteria 7677
171 Ga0068871_101432345 3300006358 Bacteria 652
172 Ga0075428_100014713 3300006844 Bacteria 8690
173 Ga0075430_100194747 3300006846 Bacteria 1684
174 Ga0075431_100020748 3300006847 Bacteria 6714
175 Ga0075434_100618681 3300006871 Bacteria 1102
176 Ga0075429_100535692 3300006880 Bacteria 1026
177 Ga0099795_10008350 3300007788 Bacteria 2947
178 Ga0099795_10054573 3300007788 Bacteria 1466
179 Ga0105244_10057268 3300009036 Bacteria 1970
180 Ga0105244_10082339 3300009036 Bacteria 1591
181 Ga0105244_10130145 3300009036 Bacteria 1215
182 Ga0105240_10001223 3300009093 Bacteria 44659
183 Ga0105240_10007527 3300009093 Bacteria 15797
184 Ga0105240_10224484 3300009093 Bacteria 2186
185 Ga0105240_10250368 3300009093 Bacteria 2049
186 Ga0105240_10832982 3300009093 Bacteria 997
187 Ga0105240_11944773 3300009093 Bacteria 612
188 Ga0105247_10004311 3300009101 Bacteria 9094
189 Ga0114129_10007316 3300009147 Bacteria 15716
190 Ga0114129_11363296 3300009147 Bacteria 876
191 Ga0105243_10025020 3300009148 Bacteria 4559
192 Ga0105243_11510667 3300009148 Bacteria 696
193 Ga0105241_10131103 3300009174 Bacteria 2030
194 Ga0105241_10620480 3300009174 Bacteria 979
195 Ga0105237_10000079 3300009545 Bacteria 127925
196 Ga0105237_10000387 3300009545 Bacteria 62716
197 Ga0105237_10075974 3300009545 Bacteria 3350
198 Ga0105237_10081547 3300009545 Bacteria 3226
199 Ga0105237_11092360 3300009545 Bacteria 804
200 Ga0105238_10000729 3300009551 Bacteria 34322
201 Ga0105238_10001523 3300009551 Bacteria 23225
202 Ga0105238_10015059 3300009551 Bacteria 7833
203 Ga0105238_10016831 3300009551 Bacteria 7415
204 Ga0105238_10097882 3300009551 Bacteria 2918
205 Ga0105238_10532286 3300009551 Bacteria 1178
206 Ga0105249_10986325 3300009553 Bacteria 911
207 Ga0099796_10033943 3300010159 Bacteria 1682
208 Ga0105239_10000830 3300010375 Bacteria 43916
209 Ga0105239_10001310 3300010375 Bacteria 33536
210 Ga0105239_10038489 3300010375 Bacteria 5241
211 Ga0157314_1001498 3300012500 Bacteria 1670
212 Ga0157347_1000485 3300012502 Bacteria 2613
213 Ga0157339_1003353 3300012505 Bacteria 1150
214 Ga0157373_10000971 3300013100 Bacteria 22248
215 Ga0157373_10048421 3300013100 Bacteria 3030
216 Ga0157373_10067819 3300013100 Bacteria 2522
217 Ga0157371_10011477 3300013102 Bacteria 6817
218 Ga0157371_10060109 3300013102 Bacteria 2694
219 Ga0157370_10012805 3300013104 Bacteria 8672
220 Ga0157370_10013410 3300013104 Bacteria 8443
221 Ga0157370_10014299 3300013104 Bacteria 8123
222 Ga0157370_10027685 3300013104 Bacteria 5588
223 Ga0157370_10036447 3300013104 Bacteria 4772
224 Ga0157370_10115258 3300013104 Bacteria 2510
225 Ga0157370_10128414 3300013104 Bacteria 2366
226 Ga0157370_10290784 3300013104 Bacteria 1509
227 Ga0157370_10799651 3300013104 Bacteria 858
228 Ga0157369_10006739 3300013105 Bacteria 13255
229 Ga0157369_10044986 3300013105 Bacteria 4803
230 Ga0157369_10095621 3300013105 Bacteria 3169
231 Ga0157369_10292162 3300013105 Bacteria 1697
232 Ga0157369_10332336 3300013105 Bacteria 1579
233 Ga0157369_10526319 3300013105 Bacteria 1223
234 Ga0163162_10002846 3300013306 Bacteria 16475
235 Ga0163162_10196314 3300013306 Bacteria 2147
236 Ga0163162_10376773 3300013306 Bacteria 1552
237 Ga0157372_10006610 3300013307 Bacteria 12337
238 Ga0157372_10040415 3300013307 Bacteria 5152
239 Ga0157372_10099833 3300013307 Bacteria 3312
240 Ga0157372_10419630 3300013307 Bacteria 1559
241 Ga0157372_10879822 3300013307 Bacteria 1040
242 Ga0157375_10204716 3300013308 Bacteria 2130
243 Ga0163163_11295194 3300014325 Bacteria 791
244 Ga0157380_10323470 3300014326 Bacteria 1431
245 Ga0182008_10004786 3300014497 Bacteria 7827
246 Ga0182008_10029428 3300014497 Bacteria 2775
247 Ga0182008_10041003 3300014497 Bacteria 2310
248 Ga0182008_10047630 3300014497 Bacteria 2130
249 Ga0157376_10510136 3300014969 Bacteria 1183
250 Ga0182006_1000041 3300015261 Bacteria 203413
251 Ga0182006_1000133 3300015261 Bacteria 80418
252 Ga0182006_1017810 3300015261 Bacteria 3012
253 Ga0182006_1070115 3300015261 Bacteria 1302
254 Ga0182007_10022205 3300015262 Bacteria 2243
255 Ga0182007_10029244 3300015262 Bacteria 1887
256 Ga0182007_10085253 3300015262 Bacteria 1038
257 Ga0182007_10360031 3300015262 Bacteria 548
258 Ga0182005_1000257 3300015265 Bacteria 33567
259 Ga0182005_1000685 3300015265 Bacteria 15850
260 Ga0182005_1017371 3300015265 Bacteria 1992
261 Ga0183369_1004 3300015685 Bacteria 539301
262 Ga0183368_1002 3300015687 Bacteria 1865598
263 Ga0163161_10002121 3300017792 Bacteria 14346
264 Ga0163161_10089970 3300017792 Bacteria 2271
265 Ga0197907_10549321 3300020069 Bacteria 1266
266 Ga0206356_10106703 3300020070 Bacteria 602
267 Ga0206349_1019390 3300020075 Bacteria 761
268 Ga0206352_10038571 3300020078 Bacteria 850
269 Ga0206350_11086872 3300020080 Bacteria 1328
270 Ga0206354_10250520 3300020081 Bacteria 1343
271 Ga0206354_11158424 3300020081 Bacteria 1308
272 Ga0206353_12018004 3300020082 Bacteria 1402
273 Ga0213872_10084492 3300021361 Bacteria 1423
274 Ga0224712_10054345 3300022467 Bacteria 1571
275 Ga0224712_10240571 3300022467 Bacteria 834
276 Ga0209435_105809 3300025206 Bacteria 1382
277 Ga0209435_127180 3300025206 Bacteria 526
278 Ga0209760_100626 3300025207 Bacteria 6014
279 Ga0209784_100053 3300025224 Bacteria 182075
280 Ga0209566_103166 3300025225 Bacteria 2640
281 Ga0209566_106075 3300025225 Bacteria 1454
282 Ga0209674_100014 3300025226 Bacteria 704989
283 Ga0209674_100197 3300025226 Bacteria 62877
284 Ga0209674_100524 3300025226 Bacteria 15556
285 Ga0209674_100550 3300025226 Bacteria 14925
286 Ga0209674_101609 3300025226 Bacteria 5670
287 Ga0209672_100004 3300025228 Bacteria 1467504
288 Ga0209672_100008 3300025228 Bacteria 946876
289 Ga0209672_100089 3300025228 Bacteria 120658
290 Ga0209672_100826 3300025228 Bacteria 14489
291 Ga0209672_100831 3300025228 Bacteria 14391
292 Ga0209672_107708 3300025228 Bacteria 1638
293 Ga0209563_100097 3300025230 Bacteria 159453
294 Ga0207427_100051 3300025231 Bacteria 218792
295 Ga0207427_100061 3300025231 Bacteria 182815
296 Ga0207427_100177 3300025231 Bacteria 69113
297 Ga0207427_102367 3300025231 Bacteria 5143
298 Ga0207427_102424 3300025231 Bacteria 5047
299 Ga0209437_100037 3300025233 Bacteria 459730
300 Ga0209437_100152 3300025233 Bacteria 154551
301 Ga0209437_100643 3300025233 Bacteria 20413
302 Ga0209437_100682 3300025233 Bacteria 18176
303 Ga0209437_102395 3300025233 Bacteria 3639
304 Ga0209258_100003 3300025242 Bacteria 1467504
305 Ga0209258_100004 3300025242 Bacteria 1376422
306 Ga0209258_100008 3300025242 Bacteria 1009355
307 Ga0209258_100090 3300025242 Bacteria 232619
308 Ga0209258_100101 3300025242 Bacteria 210252
309 Ga0209258_100138 3300025242 Bacteria 167495
310 Ga0209258_100479 3300025242 Bacteria 42065
311 Ga0209258_101864 3300025242 Bacteria 6364
312 Ga0209646_1000605 3300025246 Bacteria 14339
313 Ga0209646_1000808 3300025246 Bacteria 10638
314 Ga0209646_1004736 3300025246 Bacteria 2453
315 Ga0209026_1000064 3300025250 Bacteria 211303
316 Ga0209026_1000104 3300025250 Bacteria 152614
317 Ga0209026_1000143 3300025250 Bacteria 113602
318 Ga0209026_1000294 3300025250 Bacteria 55402
319 Ga0209026_1000384 3300025250 Bacteria 40186
320 Ga0209026_1002853 3300025250 Bacteria 6099
321 Ga0209026_1012227 3300025250 Bacteria 1506
322 Ga0209677_103854 3300025253 Bacteria 4610
323 Ga0209148_1000001 3300025254 Bacteria 2545271
324 Ga0209148_1000002 3300025254 Bacteria 2399500
325 Ga0209148_1000016 3300025254 Bacteria 804369
326 Ga0209148_1000041 3300025254 Bacteria 469323
327 Ga0209148_1000065 3300025254 Bacteria 344489
328 Ga0209148_1000079 3300025254 Bacteria 288992
329 Ga0209148_1002008 3300025254 Bacteria 7971
330 Ga0209759_1000165 3300025256 Bacteria 113117
331 Ga0209759_1000220 3300025256 Bacteria 87504
332 Ga0209759_1000449 3300025256 Bacteria 47711
333 Ga0209759_1009733 3300025256 Bacteria 2882
334 Ga0209759_1013162 3300025256 Bacteria 2251
335 Ga0209129_1001756 3300025258 Bacteria 11615
336 Ga0209129_1006594 3300025258 Bacteria 3699
337 Ga0209233_1000002 3300025261 Bacteria 2501366
338 Ga0209233_1000099 3300025261 Bacteria 293995
339 Ga0209233_1000237 3300025261 Bacteria 92427
340 Ga0209233_1000554 3300025261 Bacteria 20406
341 Ga0209233_1029613 3300025261 Bacteria 1299
342 Ga0209233_1054791 3300025261 Bacteria 794
343 Ga0209455_1000004 3300025272 Bacteria 1467504
344 Ga0209455_1000007 3300025272 Bacteria 1157983
345 Ga0209455_1000016 3300025272 Bacteria 753097
346 Ga0209455_1000079 3300025272 Bacteria 268778
347 Ga0209455_1000257 3300025272 Bacteria 62293
348 Ga0209455_1002079 3300025272 Bacteria 8026
349 Ga0209130_1003681 3300025284 Bacteria 6327
350 Ga0209676_1000018 3300025292 Bacteria 631385
351 Ga0209676_1000592 3300025292 Bacteria 54132
352 Ga0209676_1000601 3300025292 Bacteria 53177
353 Ga0209758_1000840 3300025297 Bacteria 42856
354 Ga0209758_1032829 3300025297 Bacteria 2099
355 Ga0209050_1003212 3300025298 Bacteria 12364
356 Ga0209256_1002286 3300025299 Bacteria 16163
357 Ga0209256_1008385 3300025299 Bacteria 4809
358 Ga0207426_1040207 3300025302 Bacteria 1459
359 Ga0209051_1009702 3300025303 Bacteria 4935
360 Ga0209051_1026529 3300025303 Bacteria 2332
361 Ga0209257_1000035 3300025304 Bacteria 631463
362 Ga0209257_1000594 3300025304 Bacteria 60372
363 Ga0207655_1094533 3300025728 Bacteria 1044
364 Ga0207692_10051943 3300025898 Bacteria 2080
365 Ga0207710_10010942 3300025900 Bacteria 3822
366 Ga0207680_10000003 3300025903 Bacteria 925264
367 Ga0207647_10000002 3300025904 Bacteria 400771
368 Ga0207647_10003953 3300025904 Bacteria 11063
369 Ga0207647_10004147 3300025904 Bacteria 10748
370 Ga0207647_10011946 3300025904 Bacteria 6063
371 Ga0207699_10604990 3300025906 Bacteria 798
372 Ga0207705_10001085 3300025909 Bacteria 22127
373 Ga0207705_10042118 3300025909 Bacteria 3278
374 Ga0207705_11298696 3300025909 Bacteria 556
375 Ga0207684_10413903 3300025910 Bacteria 1158
376 Ga0207654_10135853 3300025911 Bacteria 1562
377 Ga0207707_10002356 3300025912 Bacteria 17021
378 Ga0207707_10003266 3300025912 Bacteria 14408
379 Ga0207707_10012489 3300025912 Bacteria 7384
380 Ga0207695_10000291 3300025913 Bacteria 124555
381 Ga0207695_10004892 3300025913 Bacteria 18056
382 Ga0207695_10006861 3300025913 Bacteria 14660
383 Ga0207695_10075964 3300025913 Bacteria 3417
384 Ga0207695_10201598 3300025913 Bacteria 1904
385 Ga0207671_10000009 3300025914 Bacteria 724862
386 Ga0207671_10041576 3300025914 Bacteria 3402
387 Ga0207671_10235645 3300025914 Bacteria 1437
388 Ga0207671_10764392 3300025914 Bacteria 767
389 Ga0207693_10070023 3300025915 Bacteria 2745
390 Ga0207693_10123816 3300025915 Bacteria 2031
391 Ga0207660_11172860 3300025917 Bacteria 625
392 Ga0207657_10030170 3300025919 Bacteria 4926
393 Ga0207649_10011998 3300025920 Bacteria 4793
394 Ga0207649_10016528 3300025920 Bacteria 4165
395 Ga0207649_10498207 3300025920 Bacteria 926
396 Ga0207652_10075881 3300025921 Bacteria 2930
397 Ga0207694_10000336 3300025924 Bacteria 44443
398 Ga0207694_10006052 3300025924 Bacteria 9256
399 Ga0207694_10021419 3300025924 Bacteria 4899
400 Ga0207694_10093538 3300025924 Bacteria 2375
401 Ga0207694_10169233 3300025924 Bacteria 1769
402 Ga0207694_10220975 3300025924 Bacteria 1545
403 Ga0207700_10002997 3300025928 Bacteria 9735
404 Ga0207700_10052810 3300025928 Bacteria 3041
405 Ga0207700_10424411 3300025928 Bacteria 1168
406 Ga0207664_10000499 3300025929 Bacteria 27964
407 Ga0207664_10000670 3300025929 Bacteria 23513
408 Ga0207690_10000499 3300025932 Bacteria 25369
409 Ga0207690_10001115 3300025932 Bacteria 17127
410 Ga0207690_10009857 3300025932 Bacteria 5673
411 Ga0207690_10031552 3300025932 Bacteria 3392
412 Ga0207690_10074232 3300025932 Bacteria 2355
413 Ga0207690_10085128 3300025932 Bacteria 2218
414 Ga0207709_10001882 3300025935 Bacteria 13876
415 Ga0207709_10895144 3300025935 Bacteria 721
416 Ga0207670_10000619 3300025936 Bacteria 19127
417 Ga0207679_10372579 3300025945 Bacteria 1250
418 Ga0207667_10000077 3300025949 Bacteria 166095
419 Ga0207667_10000491 3300025949 Bacteria 52271
420 Ga0207667_10002460 3300025949 Bacteria 23159
421 Ga0207667_10383328 3300025949 Bacteria 1432
422 Ga0207667_11033226 3300025949 Bacteria 808
423 Ga0207712_10146852 3300025961 Bacteria 1816
424 Ga0207668_10003459 3300025972 Bacteria 9267
425 Ga0207640_10000380 3300025981 Bacteria 28559
426 Ga0207640_10015746 3300025981 Bacteria 4383
427 Ga0207640_10076772 3300025981 Bacteria 2269
428 Ga0207640_10110266 3300025981 Bacteria 1949
429 Ga0207640_11028750 3300025981 Bacteria 726
430 Ga0207658_10239807 3300025986 Bacteria 1535
431 Ga0207703_10256521 3300026035 Bacteria 1579
432 Ga0207703_10291324 3300026035 Bacteria 1486
433 Ga0207639_10008859 3300026041 Bacteria 6920
434 Ga0207639_10310241 3300026041 Bacteria 1397
435 Ga0207678_10088693 3300026067 Bacteria 2643
436 Ga0207678_10168201 3300026067 Bacteria 1872
437 Ga0207678_10314280 3300026067 Bacteria 1347
438 Ga0207678_10399825 3300026067 Bacteria 1189
439 Ga0207702_10000299 3300026078 Bacteria 57201
440 Ga0207702_10000740 3300026078 Bacteria 34919
441 Ga0207702_10681524 3300026078 Bacteria 1012
442 Ga0207674_10000128 3300026116 Bacteria 88789
443 Ga0207674_10040597 3300026116 Bacteria 4819
444 Ga0207674_10330008 3300026116 Bacteria 1475
445 Ga0207674_11455515 3300026116 Bacteria 654
446 Ga0207683_10014874 3300026121 Bacteria 6627
447 Ga0207698_10245269 3300026142 Bacteria 1635
448 Ga0209371_1000018 3300027312 Bacteria 614700
449 Ga0268266_10000011 3300028379 Bacteria 757403
450 Ga0268266_10056320 3300028379 Bacteria 3382
451 Ga0268265_10127875 3300028380 Bacteria 2106
452 Ga0268264_10032087 3300028381 Bacteria 4310
453 Ga0268264_10327205 3300028381 Bacteria 1451
454 Ga0268256_1000016 3300030500 Bacteria 614700
455 Ga0316176_1088322 3300030732 Bacteria 887
456 Ga0265760_10066329 3300031090 Bacteria 1103
457 Ga0265332_10271152 3300031238 Bacteria 701
458 Ga0307408_100086899 3300031548 Bacteria 2351
459 Ga0307405_10023448 3300031731 Bacteria 3507
460 Ga0307405_10171222 3300031731 Bacteria 1549
461 Ga0307406_10030241 3300031901 Bacteria 3287
462 Ga0307407_10179616 3300031903 Bacteria 1402
463 Ga0307412_10006273 3300031911 Bacteria 6712
464 Ga0307412_10030790 3300031911 Bacteria 3383
465 Ga0307409_100023226 3300031995 Bacteria 4292
466 Ga0307416_100037916 3300032002 Bacteria 3713
467 Ga0307414_10424305 3300032004 Bacteria 1160
468 Ga0307510_10025234 3300033180 Bacteria 6859
469 Ga0373933_0120026 3300035724 Bacteria 1646
470 Ga0373947_0131280 3300035725 Bacteria 1599
471 Ga0373937_0225514 3300036401 Bacteria 1764
472 Ga0373925_0185546 3300037068 Bacteria 1649
473 Ga0395899_0000313 3300037312 Bacteria 62233
474 Ga0395899_0008130 3300037312 Bacteria 8081
475 Ga0395899_0041326 3300037312 Bacteria 3445
476 Ga0395900_0000011 3300037418 Bacteria 421926
477 Ga0395900_0003994 3300037418 Bacteria 15756
478 Ga0395900_0032143 3300037418 Bacteria 5394
479 Ga0395900_0092654 3300037418 Bacteria 3104
480 Ga0395898_0000013 3300037466 Bacteria 458788
481 Ga0395898_0000058 3300037466 Bacteria 277701
482 Ga0395898_0004893 3300037466 Bacteria 14544
483 Ga0395898_0008343 3300037466 Bacteria 10951
484 Ga0395898_0554457 3300037466 Bacteria 1091
485 Ga0395905_0033957 3300037471 Bacteria 4791
486 Ga0395905_0034566 3300037471 Bacteria 4747
487 Ga0395901_0000201 3300038443 Bacteria 74798
488 Ga0395901_0002392 3300038443 Bacteria 19071
489 Ga0395901_0014897 3300038443 Bacteria 7901
490 Ga0395901_0151570 3300038443 Bacteria 2436
491 Ga0395901_0306831 3300038443 Bacteria 1644
492 Ga0395901_0375264 3300038443 Bacteria 1464
493 Ga0400483_003006 3300039062 Bacteria 1850
494 Ga0436361_0026274 3300039447 Bacteria 2897
495 Ga0436361_0188259 3300039447 Bacteria 21708
496 Ga0436361_1172006 3300039447 Bacteria 945
497 Ga0439436_0000004 3300041404 Bacteria 175137
498 Ga0439465_0004169 3300041413 Bacteria 4703
499 Ga0451791_0751358 3300041451 Bacteria 1179
500 Ga0451793_1473683 3300041452 Bacteria 2126
501 Ga0451797_1106049 3300041453 Bacteria 2527
502 Ga0451807_0503423 3300041486 Bacteria 2384
503 Ga0451837_0804861 3300041494 Bacteria 618
504 Ga0451851_1268479 3300041507 Bacteria 616
505 Ga0439437_004154 3300042000 Bacteria 1577
506 Ga0439432_011961 3300042006 Bacteria 2982
507 Ga0439455_0028996 3300042012 Bacteria 1366
508 Ga0439459_0002347 3300042438 Bacteria 2907
509 Ga0450901_000990 3300042533 Bacteria 3301
510 Ga0466988_0161536 3300044536 Bacteria 1299
511 Ga0466969_0000832 3300044656 Bacteria 16785
512 Ga0466969_0029592 3300044656 Bacteria 2795
513 Ga0466969_0031920 3300044656 Bacteria 2679
514 Ga0466969_0066660 3300044656 Bacteria 1737
515 Ga0466972_0020423 3300044658 Bacteria 3309
516 Ga0466975_0306164 3300044661 Bacteria 1019
517 Ga0466977_0304176 3300044666 Bacteria 964
518 Ga0466982_0000001 3300044672 Bacteria 514662
519 Ga0466982_0000938 3300044672 Bacteria 9779
520 Ga0466965_0012502 3300044683 Bacteria 3994
521 Ga0466965_0022464 3300044683 Bacteria 3040
522 Ga0466965_0365194 3300044683 Bacteria 793
523 Ga0466966_0004925 3300044684 Bacteria 8781
524 Ga0466966_0008456 3300044684 Bacteria 6813
525 Ga0466966_0021893 3300044684 Bacteria 4197
526 Ga0466966_0024360 3300044684 Bacteria 3959
527 Ga0466961_0001123 3300044693 Bacteria 16415
528 Ga0466961_0002879 3300044693 Bacteria 10672
529 Ga0466961_0010515 3300044693 Bacteria 5904
530 Ga0466961_0023027 3300044693 Bacteria 4006
531 Ga0466961_0063988 3300044693 Bacteria 2337
532 Ga0466961_0172987 3300044693 Bacteria 1343
533 Ga0466963_0319947 3300044694 Bacteria 1092
534 Ga0466964_0001080 3300044706 Bacteria 9130
535 Ga0453684_0041068 3300044712 Bacteria 6264
536 Ga0466971_0000358 3300044719 Bacteria 17447
537 Ga0466971_0024916 3300044719 Bacteria 2671
538 Ga0466971_0105482 3300044719 Bacteria 1298
539 Ga0466968_0000061 3300044735 Bacteria 31791
540 Ga0466968_0019270 3300044735 Bacteria 2746
541 Ga0466968_0105991 3300044735 Bacteria 1259
542 Ga0466970_0003545 3300044765 Bacteria 7602
543 Ga0466970_0028277 3300044765 Bacteria 2944
544 Ga0466970_0105801 3300044765 Bacteria 1534
545 Ga0466970_0167399 3300044765 Bacteria 1217
546 Ga0466957_0001515 3300044842 Bacteria 12203
547 Ga0466957_0003488 3300044842 Bacteria 8639
548 Ga0466957_0014896 3300044842 Bacteria 4535
549 Ga0466957_0694545 3300044842 Bacteria 718
550 Ga0466960_0001294 3300044901 Bacteria 9082
551 Ga0466959_0000072 3300045049 Bacteria 66935
552 Ga0466959_0047563 3300045049 Bacteria 3155
553 Ga0466959_0057445 3300045049 Bacteria 2836
554 Ga0466959_0118449 3300045049 Bacteria 1884
555 Ga0466959_0181321 3300045049 Bacteria 1472
556 Ga0466959_0736677 3300045049 Bacteria 660
557 Ga0451576_0316807 3300045051 Bacteria 1632
558 Ga0466958_0016010 3300045836 Bacteria 4311
559 Ga0466958_0053133 3300045836 Bacteria 2457
560 Ga0466958_0071222 3300045836 Bacteria 2129
561 Ga0466958_0102175 3300045836 Bacteria 1783
562 Ga0466958_0147809 3300045836 Bacteria 1481
563 Ga0466967_0042580 3300045976 Bacteria 3925
564 Ga0466967_0329202 3300045976 Bacteria 1475
565 Ga0495617_000085 3300046452 Bacteria 67837
566 Ga0495617_000550 3300046452 Bacteria 19362
567 Ga0495627_101812 3300046453 Bacteria 819
568 Ga0495638_0000236 3300046460 Bacteria 75732
569 Ga0495638_0000290 3300046460 Bacteria 66116
570 Ga0495638_0000754 3300046460 Bacteria 34482
571 Ga0495638_0001087 3300046460 Bacteria 26471
572 Ga0495641_0459239 3300046461 Bacteria 580
573 Ga0495650_0000191 3300046471 Bacteria 132016
574 Ga0495650_0000210 3300046471 Bacteria 125249
575 Ga0495650_0007083 3300046471 Bacteria 6810
576 Ga0495650_0016818 3300046471 Bacteria 3686
577 Ga0495580_1002082 3300046472 Bacteria 532
578 Ga0495605_0108397 3300046474 Bacteria 1270
579 Ga0495584_0001936 3300046491 Bacteria 11904
580 Ga0495585_0005239 3300046492 Bacteria 8215
581 Ga0495585_0045531 3300046492 Bacteria 2448
582 Ga0495607_0000006 3300046501 Bacteria 281664
583 Ga0495607_0000131 3300046501 Bacteria 80259
584 Ga0495607_0054911 3300046501 Bacteria 2294
585 Ga0495606_0000016 3300046507 Bacteria 284865
586 Ga0495606_0001253 3300046507 Bacteria 35422
587 Ga0495606_0001443 3300046507 Bacteria 31874
588 Ga0495606_0005058 3300046507 Bacteria 12831
589 Ga0495606_0031226 3300046507 Bacteria 3707
590 Ga0495606_0262916 3300046507 Bacteria 951
591 Ga0495610_0002949 3300046512 Bacteria 13726
592 Ga0495610_0089717 3300046512 Bacteria 1395
593 Ga0495616_0000401 3300046513 Bacteria 33353
594 Ga0495616_0015631 3300046513 Bacteria 4216
595 Ga0495620_0000365 3300046515 Bacteria 31131
596 Ga0495620_0131360 3300046515 Bacteria 982
597 Ga0495631_0009431 3300046518 Bacteria 4878
598 Ga0495631_0020021 3300046518 Bacteria 3131
599 Ga0495632_0000531 3300046519 Bacteria 36042
600 Ga0495632_0007769 3300046519 Bacteria 6686
601 Ga0495637_0006532 3300046520 Bacteria 5842
602 Ga0495643_0037770 3300046522 Bacteria 2647
603 Ga0495648_0000878 3300046524 Bacteria 31691
604 Ga0495648_0031592 3300046524 Bacteria 3484
605 Ga0495609_0004007 3300046538 Bacteria 8223
606 Ga0495622_0013844 3300046557 Bacteria 3742
607 Ga0495633_0002208 3300046558 Bacteria 13932
608 Ga0495668_0004627 3300046616 Bacteria 9669
609 Ga0495611_0000002 3300046648 Bacteria 705677
610 Ga0495611_0006414 3300046648 Bacteria 5013
611 Ga0495625_0000002 3300046660 Bacteria 813323
612 Ga0495625_0013448 3300046660 Bacteria 6578
613 Ga0495625_0024105 3300046660 Bacteria 4637
614 Ga0495625_0429785 3300046660 Bacteria 819
615 Ga0495661_0046789 3300046665 Bacteria 2639
616 Ga0495661_0142491 3300046665 Bacteria 1302
617 Ga0495670_0000227 3300046691 Bacteria 25531
618 Ga0495670_0002779 3300046691 Bacteria 8651
619 Ga0495670_0125706 3300046691 Bacteria 1334
620 Ga0495671_0002392 3300046692 Bacteria 11895
621 Ga0495649_0000450 3300046694 Bacteria 35527
622 Ga0495649_0003337 3300046694 Bacteria 10892
623 Ga0495589_0000190 3300046794 Bacteria 54374
624 Ga0495660_0000437 3300046810 Bacteria 34919
625 Ga0495660_0000447 3300046810 Bacteria 34412
626 Ga0495676_0294856 3300047321 Bacteria 1095
627 Ga0495683_0000679 3300047323 Bacteria 25118
628 Ga0495679_000003 3300047446 Bacteria 787868
629 Ga0495673_0000004 3300047469 Bacteria 1354526
630 Ga0495673_0000062 3300047469 Bacteria 226461
631 Ga0495673_0014368 3300047469 Bacteria 4119
632 Ga0495681_0098538 3300047470 Bacteria 1281
633 Ga0495686_0000426 3300047472 Bacteria 66285
634 Ga0495686_0001228 3300047472 Bacteria 29296
635 Ga0495686_0028923 3300047472 Bacteria 3607
636 Ga0496100_0034642 3300048903 Bacteria 3170
637 Ga0496101_0000807 3300048904 Bacteria 18486
638 Ga0496102_0417674 3300048905 Bacteria 1260
639 Ga0496104_0090411 3300048907 Bacteria 2925
640 Ga0496105_0002876 3300048908 Bacteria 12611
641 Ga0496106_0000168 3300048909 Bacteria 47597
642 Ga0496106_0119136 3300048909 Bacteria 2062
643 Ga0496107_0260702 3300048910 Bacteria 1290
644 Ga0496113_0006282 3300048916 Bacteria 7514
645 Ga0496114_0575194 3300048917 Bacteria 994
646 Ga0496115_0000095 3300048918 Bacteria 82835
647 Ga0496115_0002018 3300048918 Bacteria 14510
648 Ga0496115_0029277 3300048918 Bacteria 4324
649 Ga0496115_0291179 3300048918 Bacteria 1339
650 Ga0496116_0001905 3300048919 Bacteria 22494
651 Ga0496116_0117442 3300048919 Bacteria 1548
652 Ga0496117_0015396 3300048920 Bacteria 6522
653 Ga0496117_0054835 3300048920 Bacteria 2789
654 Ga0496117_0105616 3300048920 Bacteria 1770
655 Ga0496118_0002160 3300048921 Bacteria 27394
656 Ga0496118_0003450 3300048921 Bacteria 19899
657 Ga0496118_0008228 3300048921 Bacteria 10822
658 Ga0496118_0050850 3300048921 Bacteria 3175
659 Ga0496119_0000966 3300048922 Bacteria 36886
660 Ga0496119_0008465 3300048922 Bacteria 9030
661 Ga0496119_0026020 3300048922 Bacteria 4069
662 Ga0496120_0000409 3300048923 Bacteria 68984
663 Ga0496120_0001143 3300048923 Bacteria 34091
664 Ga0496121_0000116 3300048924 Bacteria 177260
665 Ga0496121_0004519 3300048924 Bacteria 18628
666 Ga0496121_0005025 3300048924 Bacteria 17293
667 Ga0496121_0005906 3300048924 Bacteria 15493
668 Ga0496121_0009013 3300048924 Bacteria 11564
669 Ga0496121_0024979 3300048924 Bacteria 5691
670 Ga0496121_0034038 3300048924 Bacteria 4594
671 Ga0496121_0059838 3300048924 Bacteria 3138
672 Ga0496121_0510861 3300048924 Bacteria 760
673 Ga0496122_0026416 3300048925 Bacteria 5006
674 Ga0496122_0097560 3300048925 Bacteria 1977
675 Ga0496122_0374085 3300048925 Bacteria 734
676 Ga0496123_0021108 3300048926 Bacteria 5072
677 Ga0496123_0021504 3300048926 Bacteria 5011
678 Ga0496123_0023563 3300048926 Bacteria 4708
679 Ga0496124_0006663 3300048927 Bacteria 12525
680 Ga0496124_0013344 3300048927 Bacteria 8028
681 Ga0496124_0071614 3300048927 Bacteria 2872
682 Ga0496125_0000088 3300048928 Bacteria 214942
683 Ga0496125_0085003 3300048928 Bacteria 2399
684 Ga0496125_0150581 3300048928 Bacteria 1599
685 Ga0496125_0340036 3300048928 Bacteria 901
686 Ga0496126_0006276 3300048929 Bacteria 13272
687 Ga0496126_0010165 3300048929 Bacteria 9906
688 Ga0496126_0049430 3300048929 Bacteria 3839
689 Ga0496126_0068718 3300048929 Bacteria 3162
690 Ga0496126_0596706 3300048929 Bacteria 870
691 Ga0496126_0768188 3300048929 Bacteria 742
692 Ga0495678_000019 3300049459 Bacteria 269723
693 Ga0495678_026942 3300049459 Bacteria 2445
694 Ga0495682_0001620 3300049460 Bacteria 11602
695 Ga0495682_0009177 3300049460 Bacteria 3871
696 Ga0501031_0094212 3300049568 Bacteria 1954
697 Ga0501032_0103960 3300049569 Bacteria 1881
698 Ga0501033_0005277 3300049570 Bacteria 10253
699 Ga0501033_0009344 3300049570 Bacteria 7549
700 Ga0501033_0021541 3300049570 Bacteria 4862
701 Ga0501034_0023334 3300049571 Bacteria 6305
702 Ga0501034_0045115 3300049571 Bacteria 4455
703 Ga0501034_0045969 3300049571 Bacteria 4411
704 Ga0501034_0046998 3300049571 Bacteria 4360
705 Ga0501036_0113556 3300049572 Bacteria 2289
706 Ga0501036_0119167 3300049572 Bacteria 2229
707 Ga0501037_0017102 3300049573 Bacteria 5337
708 Ga0501037_0105161 3300049573 Bacteria 2034
709 Ga0501037_0125713 3300049573 Bacteria 1841
710 Ga0501038_0025505 3300049574 Bacteria 5268
711 Ga0501039_0053215 3300049575 Bacteria 3132
712 Ga0501040_0236655 3300049576 Bacteria 1301
713 Ga0501042_0067633 3300049578 Bacteria 2554
714 Ga0501043_0019693 3300049579 Bacteria 5299
715 Ga0501043_0036109 3300049579 Bacteria 3887
716 Ga0501043_0049136 3300049579 Bacteria 3316
717 Ga0501043_0051472 3300049579 Bacteria 3236
718 Ga0501046_0015963 3300049580 Bacteria 6298
719 Ga0501047_0013749 3300049581 Bacteria 7686
720 Ga0501047_0060398 3300049581 Bacteria 3658
721 Ga0501047_1149526 3300049581 Bacteria 590
722 Ga0501048_0090878 3300049582 Bacteria 2153
723 Ga0501048_0599385 3300049582 Bacteria 791
724 Ga0501067_0198405 3300049583 Bacteria 1118
725 Ga0501070_0050469 3300049586 Bacteria 3454
726 Ga0501070_0223882 3300049586 Bacteria 1542
727 Ga0501073_0043570 3300049589 Bacteria 3165
728 Ga0501077_0757601 3300049593 Bacteria 624
729 Ga0501235_133586 3300049669 Bacteria 630
730 Ga0501079_0129119 3300049741 Bacteria 1967
731 Ga0501080_0032186 3300049742 Bacteria 4889
732 Ga0501083_0244603 3300049744 Bacteria 1168
733 Ga0501035_0013687 3300049822 Bacteria 7485
734 Ga0501035_0024637 3300049822 Bacteria 5517
735 Ga0501035_0037095 3300049822 Bacteria 4415
736 Ga0501035_0275331 3300049822 Bacteria 1423
737 Ga0501035_0333309 3300049822 Bacteria 1273
738 Ga0501044_0017049 3300049823 Bacteria 7794
739 Ga0501044_0050029 3300049823 Bacteria 4314
740 Ga0501044_0068761 3300049823 Bacteria 3607
741 Ga0501044_0140755 3300049823 Bacteria 2401
742 Ga0501044_0530805 3300049823 Bacteria 1076
743 nmdc:mga00v17_25_c1 3300050491 Bacteria 101679
744 nmdc:mga0k408_434685_c1 3300050493 Bacteria 780
745 nmdc:mga07m45_4934_c1 3300050496 Bacteria 6574
746 nmdc:mga05p37_8922_c1 3300050507 Bacteria 11851
747 nmdc:mga09592_485568_c1 3300050508 Bacteria 1064
748 nmdc:mga0qj67_1232157_c1 3300050509 Bacteria 581
749 nmdc:mga0qj67_179968_c1 3300050509 Bacteria 1717
750 nmdc:mga06r32_18031_c1 3300050510 Bacteria 6455
751 nmdc:mga0n895_57402_c1 3300050512 Bacteria 3837
752 nmdc:mga0sz30_11202_c1 3300050516 Bacteria 3455
753 Ga0500643_000101 3300053087 Bacteria 88318
754 Ga0500646_0018922 3300053090 Bacteria 1818
755 Ga0500555_000584 3300053103 Bacteria 14374
756 Ga0500607_000007 3300053121 Bacteria 134097
757 Ga0500559_0001214 3300053136 Bacteria 15283
758 Ga0500604_0080094 3300053151 Bacteria 1054
759 Ga0500633_0054274 3300053160 Bacteria 1392
760 Ga0500637_0016186 3300053178 Bacteria 3971
761 Ga0500645_014997 3300053730 Bacteria 2462
762 Ga0500645_040269 3300053730 Bacteria 1382
763 Ga0587080_068454 3300059503 Bacteria 706
764 Ga0587090_031824 3300059510 Bacteria 886
765 Ga0587069_105280 3300059642 Bacteria 581
766 Ga0587076_034795 3300059645 Bacteria 912
767 Ga0587076_158354 3300059645 Bacteria 555
768 Ga0587078_037146 3300059646 Bacteria 677
769 Ga0587111_0200159 3300060346 Bacteria 566
770 Ga0501082_0923000 3300060353 Bacteria 764
771 Ga0466962_0015079 3300061719 Bacteria 3726
772 Ga0530510_0537885 3300061734 Bacteria 887

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2537561836 2538833447 152
2 iso_pu_bacteria 2547132130 2547499947 152
3 iso_pu_bacteria 2547132130 2547503136 152
4 iso_pu_bacteria 2576861471 2578456664 152
5 iso_pu_bacteria 2643221562 2643831800 152
6 iso_pu_bacteria 2643221577 2643896008 152
7 iso_pu_bacteria 2643221685 2644478215 152
8 iso_pu_bacteria 2739367700 2739733231 152
9 iso_pu_bacteria 2747842428 2747949056 152
10 iso_pu_bacteria 2747842501 2748017401 152
11 iso_pu_bacteria 2765235840 2765580821 152
12 iso_pu_bacteria 2816332141 2816518189 152
13 iso_pu_bacteria 2818991457 2819662224 152
14 iso_pu_bacteria 2842391507 2842395147 152
15 iso_pu_bacteria 2842757796 2842760961 152
16 iso_pu_bacteria 2852649853 2852651867 152
17 iso_pu_bacteria 2852684882 2852688075 152
18 iso_pu_bacteria 2857442823 2857444900 152
19 iso_pu_bacteria 2874220319 2874223467 152
20 iso_pu_bacteria 2884411467 2884415673 152
21 iso_pu_bacteria 2895395659 2895395845 152
22 iso_pu_bacteria 2919089067 2919092229 152
23 iso_pu_bacteria 2919130084 2919132865 152
24 iso_pu_bacteria 2919134579 2919136720 152
25 iso_pu_bacteria 2928496128 2928497149 152
26 iso_pu_bacteria 2928963466 2928966964 152
27 iso_pu_bacteria 2929195423 2929199498 152
28 iso_pu_bacteria 2931380184 2931383121 152
29 iso_pu_bacteria 2937610967 2937614052 152
30 iso_pu_bacteria 2939589442 2939590103 152
31 iso_pu_bacteria 2939611941 2939613818 152
32 iso_pu_bacteria 2939622612 2939623724 152
33 iso_pu_bacteria 2939626828 2939630817 152
34 iso_pu_bacteria 2941475908 2941478504 152
35 iso_pu_bacteria 2961047084 2961050231 152
36 iso_pu_bacteria 2961064222 2961064622 152
37 iso_pu_bacteria 2974307012 2974307295 152
38 iso_pu_bacteria 2977247770 2977248041 152
39 iso_pu_bacteria 2984514374 2984517504 152
40 iso_pu_bacteria 2987605356 2987606541 152
41 iso_pu_bacteria 8021622325 8021622777 152
42 iso_pu_bacteria 8021626552 8021626651 152
43 iso_pu_bacteria 8021648035 8021651667 152
44 iso_pu_bacteria 2526164512 2526210851 154
45 iso_pu_bacteria 2565956521 2566037991 154
46 3300031903 Ga0307407_10179616 Ga0307407_101796162 155
47 3300037312 Ga0395899_0008130 Ga0395899_0008130_6321_6788 155
48 3300037312 Ga0395899_0041326 Ga0395899_0041326_2504_2971 155
49 3300037418 Ga0395900_0003994 Ga0395900_0003994_1599_2066 155
50 3300037418 Ga0395900_0032143 Ga0395900_0032143_712_1179 155
51 3300037418 Ga0395900_0092654 Ga0395900_0092654_1915_2382 155
52 3300037466 Ga0395898_0004893 Ga0395898_0004893_12925_13392 155
53 3300037466 Ga0395898_0554457 Ga0395898_0554457_517_984 155
54 3300037471 Ga0395905_0033957 Ga0395905_0033957_4220_4687 155
55 3300038443 Ga0395901_0002392 Ga0395901_0002392_4501_4968 155
56 3300038443 Ga0395901_0306831 Ga0395901_0306831_455_922 155
57 iso_pu_bacteria 2593339238 2595448887 155
58 iso_pu_bacteria 2593339239 2595450582 155
59 iso_pu_bacteria 2718218334 2721025497 155
60 iso_pu_bacteria 2734482264 2735834530 155
61 iso_pu_bacteria 2738543009 2739225981 155
62 iso_pu_bacteria 2818991440 2819564802 155
63 iso_pu_bacteria 2828305725 2828309461 155
64 iso_pu_bacteria 2842914999 2842915719 155
65 iso_pu_bacteria 2842918807 2842920949 155
66 iso_pu_bacteria 2884338543 2884338841 155
67 iso_pu_bacteria 2904463128 2904465678 155
68 iso_pu_bacteria 2919085039 2919086466 155
69 iso_pu_bacteria 2919404418 2919407494 155
70 iso_pu_bacteria 2941471342 2941472028 155
71 iso_pu_bacteria 2953994433 2953996219 155
72 3300001979 JGI24740J21852_10006437 JGI24740J21852_100064376 156
73 3300001989 JGI24739J22299_10005117 JGI24739J22299_100051175 156
74 3300001990 JGI24737J22298_10003429 JGI24737J22298_100034297 156
75 3300001990 JGI24737J22298_10007318 JGI24737J22298_100073186 156
76 3300001990 JGI24737J22298_10042862 JGI24737J22298_100428622 156
77 3300002067 JGI24735J21928_10004506 JGI24735J21928_100045064 156
78 3300002067 JGI24735J21928_10007432 JGI24735J21928_100074324 156
79 3300002075 JGI24738J21930_10065776 JGI24738J21930_100657761 156
80 3300002705 JGI25156J39149_1006761 JGI25156J39149_10067612 156
81 3300002705 JGI25156J39149_1022847 JGI25156J39149_10228472 156
82 3300002737 JGI25162J39368_1000115 JGI25162J39368_100011542 156
83 3300002737 JGI25162J39368_1000402 JGI25162J39368_100040218 156
84 3300002737 JGI25162J39368_1003198 JGI25162J39368_10031986 156
85 3300002737 JGI25162J39368_1004010 JGI25162J39368_10040106 156
86 3300002738 JGI25154J39366_1006347 JGI25154J39366_10063472 156
87 3300002741 JGI25157J39369_1000132 JGI25157J39369_100013212 156
88 3300002741 JGI25157J39369_1000313 JGI25157J39369_10003134 156
89 3300002741 JGI25157J39369_1000344 JGI25157J39369_100034410 156
90 3300002741 JGI25157J39369_1000452 JGI25157J39369_100045212 156
91 3300002741 JGI25157J39369_1000453 JGI25157J39369_10004537 156
92 3300002741 JGI25157J39369_1003094 JGI25157J39369_10030942 156
93 3300002771 JGI25163J39215_1000758 JGI25163J39215_10007581 156
94 3300002772 JGI25164J39214_1000090 JGI25164J39214_100009034 156
95 3300002772 JGI25164J39214_1000117 JGI25164J39214_100011751 156
96 3300002772 JGI25164J39214_1000522 JGI25164J39214_10005224 156
97 3300002772 JGI25164J39214_1001570 JGI25164J39214_10015704 156
98 3300003214 JGI25165J46597_1000194 JGI25165J46597_100019447 156
99 3300003214 JGI25165J46597_1000235 JGI25165J46597_100023550 156
100 3300003214 JGI25165J46597_1002775 JGI25165J46597_10027756 156
101 3300003320 rootH2_10001214 rootH2_100012148 156
102 3300003578 Ga0006562J51391_1003311 Ga0006562J51391_10033113 156
103 3300003751 Ga0055538_1002959 Ga0055538_10029593 156
104 3300003756 Ga0055533_1001362 Ga0055533_10013624 156
105 3300003756 Ga0055533_1001537 Ga0055533_10015375 156
106 3300003756 Ga0055533_1007754 Ga0055533_10077542 156
107 3300003759 Ga0055525_1000082 Ga0055525_1000082107 156
108 3300003760 Ga0055527_1000176 Ga0055527_100017616 156
109 3300003760 Ga0055527_1000179 Ga0055527_100017916 156
110 3300003760 Ga0055527_1005250 Ga0055527_10052502 156
111 3300003761 Ga0055535_1000106 Ga0055535_100010634 156
112 3300003761 Ga0055535_1000373 Ga0055535_100037316 156
113 3300003761 Ga0055535_1000405 Ga0055535_100040512 156
114 3300003761 Ga0055535_1000487 Ga0055535_10004874 156
115 3300003761 Ga0055535_1001357 Ga0055535_100135712 156
116 3300003761 Ga0055535_1001457 Ga0055535_10014572 156
117 3300003761 Ga0055535_1001699 Ga0055535_10016992 156
118 3300003762 Ga0055542_1000150 Ga0055542_100015042 156
119 3300003762 Ga0055542_1000245 Ga0055542_100024530 156
120 3300003762 Ga0055542_1000394 Ga0055542_100039430 156
121 3300003762 Ga0055542_1000429 Ga0055542_100042914 156
122 3300003762 Ga0055542_1000431 Ga0055542_100043111 156
123 3300003762 Ga0055542_1000734 Ga0055542_100073413 156
124 3300003763 Ga0055529_1000168 Ga0055529_100016847 156
125 3300003763 Ga0055529_1000178 Ga0055529_100017835 156
126 3300003763 Ga0055529_1000314 Ga0055529_100031429 156
127 3300003763 Ga0055529_1000420 Ga0055529_100042030 156
128 3300003763 Ga0055529_1000428 Ga0055529_100042831 156
129 3300003781 Ga0055536_1000766 Ga0055536_100076617 156
130 3300003781 Ga0055536_1000908 Ga0055536_100090816 156
131 3300003791 Ga0055530_10002816 Ga0055530_100028161 156
132 3300003792 Ga0055540_1020526 Ga0055540_10205264 156
133 3300003794 Ga0055531_10005486 Ga0055531_100054865 156
134 3300003856 Ga0058692_1000004 Ga0058692_1000004123 156
135 3300005289 Ga0065704_10041565 Ga0065704_100415652 156
136 3300005327 Ga0070658_10153551 Ga0070658_101535515 156
137 3300005329 Ga0070683_100587141 Ga0070683_1005871412 156
138 3300005336 Ga0070680_100214885 Ga0070680_1002148852 156
139 3300005337 Ga0070682_100001661 Ga0070682_1000016618 156
140 3300005337 Ga0070682_100012513 Ga0070682_1000125132 156
141 3300005337 Ga0070682_100074554 Ga0070682_1000745543 156
142 3300005337 Ga0070682_100202603 Ga0070682_1002026033 156
143 3300005339 Ga0070660_100115019 Ga0070660_1001150192 156
144 3300005339 Ga0070660_100165679 Ga0070660_1001656792 156
145 3300005340 Ga0070689_100004904 Ga0070689_1000049045 156
146 3300005344 Ga0070661_100021242 Ga0070661_1000212424 156
147 3300005344 Ga0070661_100075635 Ga0070661_1000756352 156
148 3300005345 Ga0070692_10008876 Ga0070692_100088768 156
149 3300005345 Ga0070692_10247756 Ga0070692_102477562 156
150 3300005347 Ga0070668_100008631 Ga0070668_1000086315 156
151 3300005353 Ga0070669_100381917 Ga0070669_1003819172 156
152 3300005365 Ga0070688_100114170 Ga0070688_1001141703 156
153 3300005366 Ga0070659_100001906 Ga0070659_10000190616 156
154 3300005366 Ga0070659_100002475 Ga0070659_1000024757 156
155 3300005435 Ga0070714_100000749 Ga0070714_10000074912 156
156 3300005435 Ga0070714_100001553 Ga0070714_1000015536 156
157 3300005435 Ga0070714_100007691 Ga0070714_1000076916 156
158 3300005436 Ga0070713_100000602 Ga0070713_1000006023 156
159 3300005437 Ga0070710_10032588 Ga0070710_100325884 156
160 3300005439 Ga0070711_100807841 Ga0070711_1008078411 156
161 3300005444 Ga0070694_100985686 Ga0070694_1009856861 156
162 3300005455 Ga0070663_100018335 Ga0070663_1000183356 156
163 3300005455 Ga0070663_100081346 Ga0070663_1000813463 156
164 3300005455 Ga0070663_100406035 Ga0070663_1004060352 156
165 3300005455 Ga0070663_100539021 Ga0070663_1005390212 156
166 3300005456 Ga0070678_100011516 Ga0070678_1000115163 156
167 3300005457 Ga0070662_100022988 Ga0070662_1000229887 156
168 3300005458 Ga0070681_10003017 Ga0070681_100030178 156
169 3300005458 Ga0070681_10010816 Ga0070681_100108162 156
170 3300005458 Ga0070681_10286291 Ga0070681_102862912 156
171 3300005458 Ga0070681_11303941 Ga0070681_113039411 156
172 3300005530 Ga0070679_100027315 Ga0070679_1000273153 156
173 3300005530 Ga0070679_100279657 Ga0070679_1002796572 156
174 3300005530 Ga0070679_101640567 Ga0070679_1016405671 156
175 3300005535 Ga0070684_100561902 Ga0070684_1005619023 156
176 3300005539 Ga0068853_100006253 Ga0068853_10000625310 156
177 3300005539 Ga0068853_100169361 Ga0068853_1001693611 156
178 3300005539 Ga0068853_100258383 Ga0068853_1002583831 156
179 3300005546 Ga0070696_100015645 Ga0070696_1000156456 156
180 3300005546 Ga0070696_100113397 Ga0070696_1001133972 156
181 3300005546 Ga0070696_100359714 Ga0070696_1003597142 156
182 3300005547 Ga0070693_100043943 Ga0070693_1000439433 156
183 3300005547 Ga0070693_100113977 Ga0070693_1001139772 156
184 3300005548 Ga0070665_100017480 Ga0070665_1000174803 156
185 3300005563 Ga0068855_100165702 Ga0068855_1001657024 156
186 3300005563 Ga0068855_100178419 Ga0068855_1001784192 156
187 3300005563 Ga0068855_100679439 Ga0068855_1006794391 156
188 3300005564 Ga0070664_100457627 Ga0070664_1004576271 156
189 3300005577 Ga0068857_100007224 Ga0068857_1000072248 156
190 3300005577 Ga0068857_100083154 Ga0068857_1000831545 156
191 3300005577 Ga0068857_100278611 Ga0068857_1002786113 156
192 3300005578 Ga0068854_100000026 Ga0068854_100000026102 156
193 3300005578 Ga0068854_100033812 Ga0068854_1000338126 156
194 3300005578 Ga0068854_100074560 Ga0068854_1000745603 156
195 3300005578 Ga0068854_100131868 Ga0068854_1001318683 156
196 3300005614 Ga0068856_100000132 Ga0068856_10000013235 156
197 3300005614 Ga0068856_100000138 Ga0068856_10000013846 156
198 3300005614 Ga0068856_100156438 Ga0068856_1001564385 156
199 3300005616 Ga0068852_100059059 Ga0068852_1000590593 156
200 3300005834 Ga0068851_10063461 Ga0068851_100634613 156
201 3300005842 Ga0068858_100076429 Ga0068858_1000764291 156
202 3300005843 Ga0068860_100093958 Ga0068860_1000939583 156
203 3300005983 Ga0081540_1001656 Ga0081540_100165612 156
204 3300005985 Ga0081539_10013089 Ga0081539_100130893 156
205 3300006051 Ga0075364_10000769 Ga0075364_1000076914 156
206 3300006051 Ga0075364_10027694 Ga0075364_100276944 156
207 3300006051 Ga0075364_10726542 Ga0075364_107265421 156
208 3300006175 Ga0070712_100346463 Ga0070712_1003464632 156
209 3300006186 Ga0075369_10027448 Ga0075369_100274484 156
210 3300009036 Ga0105244_10057268 Ga0105244_100572684 156
211 3300009036 Ga0105244_10082339 Ga0105244_100823391 156
212 3300009093 Ga0105240_10001223 Ga0105240_1000122314 156
213 3300009093 Ga0105240_10007527 Ga0105240_1000752712 156
214 3300009093 Ga0105240_10224484 Ga0105240_102244843 156
215 3300009093 Ga0105240_10250368 Ga0105240_102503682 156
216 3300009093 Ga0105240_10832982 Ga0105240_108329822 156
217 3300009148 Ga0105243_10025020 Ga0105243_100250208 156
218 3300009174 Ga0105241_10131103 Ga0105241_101311033 156
219 3300009174 Ga0105241_10620480 Ga0105241_106204802 156
220 3300009545 Ga0105237_10000079 Ga0105237_100000794 156
221 3300009545 Ga0105237_10000387 Ga0105237_1000038724 156
222 3300009545 Ga0105237_10081547 Ga0105237_100815477 156
223 3300009545 Ga0105237_11092360 Ga0105237_110923601 156
224 3300009551 Ga0105238_10001523 Ga0105238_1000152313 156
225 3300009551 Ga0105238_10015059 Ga0105238_100150592 156
226 3300009551 Ga0105238_10097882 Ga0105238_100978821 156
227 3300009551 Ga0105238_10532286 Ga0105238_105322863 156
228 3300009553 Ga0105249_10986325 Ga0105249_109863252 156
229 3300010375 Ga0105239_10000830 Ga0105239_1000083016 156
230 3300010375 Ga0105239_10038489 Ga0105239_100384895 156
231 3300012500 Ga0157314_1001498 Ga0157314_10014984 156
232 3300012502 Ga0157347_1000485 Ga0157347_10004855 156
233 3300012505 Ga0157339_1003353 Ga0157339_10033531 156
234 3300013100 Ga0157373_10000971 Ga0157373_1000097111 156
235 3300013100 Ga0157373_10048421 Ga0157373_100484213 156
236 3300013100 Ga0157373_10067819 Ga0157373_100678194 156
237 3300013102 Ga0157371_10011477 Ga0157371_100114777 156
238 3300013102 Ga0157371_10060109 Ga0157371_100601095 156
239 3300013104 Ga0157370_10012805 Ga0157370_100128057 156
240 3300013104 Ga0157370_10013410 Ga0157370_100134108 156
241 3300013104 Ga0157370_10027685 Ga0157370_100276854 156
242 3300013104 Ga0157370_10036447 Ga0157370_100364475 156
243 3300013104 Ga0157370_10115258 Ga0157370_101152582 156
244 3300013104 Ga0157370_10128414 Ga0157370_101284142 156
245 3300013104 Ga0157370_10799651 Ga0157370_107996511 156
246 3300013105 Ga0157369_10044986 Ga0157369_100449863 156
247 3300013105 Ga0157369_10095621 Ga0157369_100956213 156
248 3300013105 Ga0157369_10292162 Ga0157369_102921621 156
249 3300013105 Ga0157369_10332336 Ga0157369_103323362 156
250 3300013105 Ga0157369_10526319 Ga0157369_105263192 156
251 3300013306 Ga0163162_10376773 Ga0163162_103767734 156
252 3300013307 Ga0157372_10006610 Ga0157372_1000661011 156
253 3300013307 Ga0157372_10040415 Ga0157372_100404157 156
254 3300013307 Ga0157372_10099833 Ga0157372_100998334 156
255 3300013307 Ga0157372_10419630 Ga0157372_104196303 156
256 3300013307 Ga0157372_10879822 Ga0157372_108798222 156
257 3300014325 Ga0163163_11295194 Ga0163163_112951942 156
258 3300014497 Ga0182008_10029428 Ga0182008_100294282 156
259 3300014497 Ga0182008_10047630 Ga0182008_100476302 156
260 3300014969 Ga0157376_10510136 Ga0157376_105101361 156
261 3300015261 Ga0182006_1017810 Ga0182006_10178103 156
262 3300015261 Ga0182006_1070115 Ga0182006_10701153 156
263 3300015262 Ga0182007_10022205 Ga0182007_100222054 156
264 3300015262 Ga0182007_10360031 Ga0182007_103600311 156
265 3300015685 Ga0183369_1004 Ga0183369_1004405 156
266 3300015687 Ga0183368_1002 Ga0183368_10021383 156
267 3300017792 Ga0163161_10089970 Ga0163161_100899703 156
268 3300020069 Ga0197907_10549321 Ga0197907_105493213 156
269 3300020070 Ga0206356_10106703 Ga0206356_101067031 156
270 3300020075 Ga0206349_1019390 Ga0206349_10193902 156
271 3300020078 Ga0206352_10038571 Ga0206352_100385711 156
272 3300020080 Ga0206350_11086872 Ga0206350_110868722 156
273 3300020081 Ga0206354_10250520 Ga0206354_102505202 156
274 3300020081 Ga0206354_11158424 Ga0206354_111584241 156
275 3300020082 Ga0206353_12018004 Ga0206353_120180042 156
276 3300022467 Ga0224712_10054345 Ga0224712_100543453 156
277 3300022467 Ga0224712_10240571 Ga0224712_102405711 156
278 3300025206 Ga0209435_105809 Ga0209435_1058092 156
279 3300025206 Ga0209435_127180 Ga0209435_1271801 156
280 3300025207 Ga0209760_100626 Ga0209760_1006267 156
281 3300025224 Ga0209784_100053 Ga0209784_10005375 156
282 3300025225 Ga0209566_103166 Ga0209566_1031662 156
283 3300025225 Ga0209566_106075 Ga0209566_1060752 156
284 3300025226 Ga0209674_100014 Ga0209674_10001476 156
285 3300025226 Ga0209674_100197 Ga0209674_10019757 156
286 3300025226 Ga0209674_100550 Ga0209674_1005504 156
287 3300025226 Ga0209674_101609 Ga0209674_1016097 156
288 3300025228 Ga0209672_100004 Ga0209672_100004402 156
289 3300025228 Ga0209672_100008 Ga0209672_100008301 156
290 3300025228 Ga0209672_100089 Ga0209672_10008940 156
291 3300025228 Ga0209672_100826 Ga0209672_10082613 156
292 3300025228 Ga0209672_100831 Ga0209672_10083112 156
293 3300025228 Ga0209672_107708 Ga0209672_1077083 156
294 3300025230 Ga0209563_100097 Ga0209563_100097109 156
295 3300025231 Ga0207427_100051 Ga0207427_100051103 156
296 3300025231 Ga0207427_100061 Ga0207427_10006182 156
297 3300025231 Ga0207427_100177 Ga0207427_10017715 156
298 3300025231 Ga0207427_102367 Ga0207427_1023672 156
299 3300025231 Ga0207427_102424 Ga0207427_1024246 156
300 3300025233 Ga0209437_100037 Ga0209437_100037241 156
301 3300025233 Ga0209437_100152 Ga0209437_10015250 156
302 3300025233 Ga0209437_100643 Ga0209437_10064315 156
303 3300025233 Ga0209437_100682 Ga0209437_10068214 156
304 3300025242 Ga0209258_100003 Ga0209258_100003402 156
305 3300025242 Ga0209258_100004 Ga0209258_100004889 156
306 3300025242 Ga0209258_100008 Ga0209258_100008514 156
307 3300025242 Ga0209258_100090 Ga0209258_10009093 156
308 3300025242 Ga0209258_100101 Ga0209258_10010123 156
309 3300025242 Ga0209258_100138 Ga0209258_10013892 156
310 3300025242 Ga0209258_100479 Ga0209258_10047936 156
311 3300025242 Ga0209258_101864 Ga0209258_1018645 156
312 3300025246 Ga0209646_1000605 Ga0209646_100060512 156
313 3300025246 Ga0209646_1000808 Ga0209646_10008084 156
314 3300025246 Ga0209646_1004736 Ga0209646_10047363 156
315 3300025250 Ga0209026_1000064 Ga0209026_1000064111 156
316 3300025250 Ga0209026_1000104 Ga0209026_100010482 156
317 3300025250 Ga0209026_1000143 Ga0209026_100014316 156
318 3300025250 Ga0209026_1000294 Ga0209026_100029424 156
319 3300025250 Ga0209026_1000384 Ga0209026_100038424 156
320 3300025250 Ga0209026_1002853 Ga0209026_10028536 156
321 3300025250 Ga0209026_1012227 Ga0209026_10122273 156
322 3300025253 Ga0209677_103854 Ga0209677_1038544 156
323 3300025254 Ga0209148_1000001 Ga0209148_1000001269 156
324 3300025254 Ga0209148_1000002 Ga0209148_1000002239 156
325 3300025254 Ga0209148_1000016 Ga0209148_1000016402 156
326 3300025254 Ga0209148_1000041 Ga0209148_100004116 156
327 3300025254 Ga0209148_1000065 Ga0209148_100006593 156
328 3300025254 Ga0209148_1000079 Ga0209148_1000079163 156
329 3300025256 Ga0209759_1000165 Ga0209759_100016519 156
330 3300025256 Ga0209759_1000220 Ga0209759_100022032 156
331 3300025256 Ga0209759_1000449 Ga0209759_100044930 156
332 3300025256 Ga0209759_1009733 Ga0209759_10097335 156
333 3300025256 Ga0209759_1013162 Ga0209759_10131623 156
334 3300025258 Ga0209129_1006594 Ga0209129_10065946 156
335 3300025261 Ga0209233_1000002 Ga0209233_10000021962 156
336 3300025261 Ga0209233_1000099 Ga0209233_1000099167 156
337 3300025261 Ga0209233_1000237 Ga0209233_100023777 156
338 3300025261 Ga0209233_1000554 Ga0209233_100055414 156
339 3300025261 Ga0209233_1029613 Ga0209233_10296131 156
340 3300025261 Ga0209233_1054791 Ga0209233_10547911 156
341 3300025272 Ga0209455_1000004 Ga0209455_1000004402 156
342 3300025272 Ga0209455_1000007 Ga0209455_1000007634 156
343 3300025272 Ga0209455_1000016 Ga0209455_1000016164 156
344 3300025272 Ga0209455_1000079 Ga0209455_100007982 156
345 3300025272 Ga0209455_1000257 Ga0209455_100025710 156
346 3300025272 Ga0209455_1002079 Ga0209455_10020797 156
347 3300025284 Ga0209130_1003681 Ga0209130_10036812 156
348 3300025292 Ga0209676_1000018 Ga0209676_1000018281 156
349 3300025292 Ga0209676_1000592 Ga0209676_100059238 156
350 3300025292 Ga0209676_1000601 Ga0209676_100060138 156
351 3300025297 Ga0209758_1000840 Ga0209758_100084041 156
352 3300025297 Ga0209758_1032829 Ga0209758_10328293 156
353 3300025298 Ga0209050_1003212 Ga0209050_10032126 156
354 3300025299 Ga0209256_1002286 Ga0209256_100228614 156
355 3300025303 Ga0209051_1009702 Ga0209051_10097022 156
356 3300025304 Ga0209257_1000035 Ga0209257_1000035281 156
357 3300025304 Ga0209257_1000594 Ga0209257_100059446 156
358 3300025728 Ga0207655_1094533 Ga0207655_10945332 156
359 3300025898 Ga0207692_10051943 Ga0207692_100519434 156
360 3300025904 Ga0207647_10003953 Ga0207647_1000395315 156
361 3300025904 Ga0207647_10004147 Ga0207647_100041479 156
362 3300025904 Ga0207647_10011946 Ga0207647_100119465 156
363 3300025909 Ga0207705_10042118 Ga0207705_100421185 156
364 3300025909 Ga0207705_11298696 Ga0207705_112986961 156
365 3300025911 Ga0207654_10135853 Ga0207654_101358532 156
366 3300025912 Ga0207707_10002356 Ga0207707_1000235613 156
367 3300025912 Ga0207707_10003266 Ga0207707_1000326612 156
368 3300025912 Ga0207707_10012489 Ga0207707_100124893 156
369 3300025913 Ga0207695_10000291 Ga0207695_1000029120 156
370 3300025913 Ga0207695_10004892 Ga0207695_1000489214 156
371 3300025913 Ga0207695_10006861 Ga0207695_100068613 156
372 3300025913 Ga0207695_10075964 Ga0207695_100759644 156
373 3300025913 Ga0207695_10201598 Ga0207695_102015983 156
374 3300025914 Ga0207671_10000009 Ga0207671_10000009373 156
375 3300025914 Ga0207671_10235645 Ga0207671_102356452 156
376 3300025914 Ga0207671_10764392 Ga0207671_107643921 156
377 3300025915 Ga0207693_10123816 Ga0207693_101238164 156
378 3300025917 Ga0207660_11172860 Ga0207660_111728601 156
379 3300025919 Ga0207657_10030170 Ga0207657_100301702 156
380 3300025920 Ga0207649_10498207 Ga0207649_104982072 156
381 3300025921 Ga0207652_10075881 Ga0207652_100758813 156
382 3300025924 Ga0207694_10006052 Ga0207694_100060524 156
383 3300025924 Ga0207694_10021419 Ga0207694_100214192 156
384 3300025924 Ga0207694_10169233 Ga0207694_101692333 156
385 3300025924 Ga0207694_10220975 Ga0207694_102209753 156
386 3300025928 Ga0207700_10002997 Ga0207700_1000299712 156
387 3300025929 Ga0207664_10000499 Ga0207664_1000049911 156
388 3300025929 Ga0207664_10000670 Ga0207664_1000067015 156
389 3300025932 Ga0207690_10000499 Ga0207690_1000049912 156
390 3300025932 Ga0207690_10001115 Ga0207690_1000111513 156
391 3300025932 Ga0207690_10009857 Ga0207690_100098578 156
392 3300025932 Ga0207690_10031552 Ga0207690_100315525 156
393 3300025932 Ga0207690_10074232 Ga0207690_100742323 156
394 3300025932 Ga0207690_10085128 Ga0207690_100851283 156
395 3300025935 Ga0207709_10001882 Ga0207709_100018829 156
396 3300025935 Ga0207709_10895144 Ga0207709_108951442 156
397 3300025936 Ga0207670_10000619 Ga0207670_100006195 156
398 3300025945 Ga0207679_10372579 Ga0207679_103725791 156
399 3300025949 Ga0207667_10000077 Ga0207667_1000007739 156
400 3300025949 Ga0207667_10000491 Ga0207667_1000049120 156
401 3300025949 Ga0207667_10002460 Ga0207667_1000246014 156
402 3300025949 Ga0207667_10383328 Ga0207667_103833283 156
403 3300025949 Ga0207667_11033226 Ga0207667_110332262 156
404 3300025961 Ga0207712_10146852 Ga0207712_101468523 156
405 3300025972 Ga0207668_10003459 Ga0207668_100034591 156
406 3300025981 Ga0207640_10000380 Ga0207640_1000038033 156
407 3300025981 Ga0207640_10015746 Ga0207640_100157467 156
408 3300025981 Ga0207640_10076772 Ga0207640_100767724 156
409 3300025981 Ga0207640_10110266 Ga0207640_101102662 156
410 3300026035 Ga0207703_10291324 Ga0207703_102913241 156
411 3300026041 Ga0207639_10008859 Ga0207639_100088597 156
412 3300026041 Ga0207639_10310241 Ga0207639_103102412 156
413 3300026067 Ga0207678_10088693 Ga0207678_100886933 156
414 3300026067 Ga0207678_10168201 Ga0207678_101682013 156
415 3300026067 Ga0207678_10399825 Ga0207678_103998251 156
416 3300026078 Ga0207702_10000299 Ga0207702_1000029912 156
417 3300026078 Ga0207702_10000740 Ga0207702_1000074015 156
418 3300026078 Ga0207702_10681524 Ga0207702_106815242 156
419 3300026116 Ga0207674_10000128 Ga0207674_1000012843 156
420 3300026116 Ga0207674_10040597 Ga0207674_100405976 156
421 3300026116 Ga0207674_10330008 Ga0207674_103300083 156
422 3300026121 Ga0207683_10014874 Ga0207683_100148743 156
423 3300026142 Ga0207698_10245269 Ga0207698_102452692 156
424 3300027312 Ga0209371_1000018 Ga0209371_1000018270 156
425 3300028379 Ga0268266_10056320 Ga0268266_100563203 156
426 3300028381 Ga0268264_10327205 Ga0268264_103272051 156
427 3300030500 Ga0268256_1000016 Ga0268256_1000016270 156
428 3300030732 Ga0316176_1088322 Ga0316176_10883221 156
429 3300031238 Ga0265332_10271152 Ga0265332_102711521 156
430 3300032004 Ga0307414_10424305 Ga0307414_104243051 156
431 3300037312 Ga0395899_0000313 Ga0395899_0000313_19259_19729 156
432 3300037418 Ga0395900_0000011 Ga0395900_0000011_27077_27547 156
433 3300037466 Ga0395898_0000013 Ga0395898_0000013_28653_29123 156
434 3300037466 Ga0395898_0000058 Ga0395898_0000058_26774_27244 156
435 3300037466 Ga0395898_0008343 Ga0395898_0008343_3187_3657 156
436 3300038443 Ga0395901_0000201 Ga0395901_0000201_72518_72988 156
437 3300038443 Ga0395901_0014897 Ga0395901_0014897_3923_4393 156
438 3300038443 Ga0395901_0151570 Ga0395901_0151570_125_595 156
439 3300038443 Ga0395901_0375264 Ga0395901_0375264_917_1387 156
440 3300039447 Ga0436361_1172006 Ga0436361_1172006_390_860 156
441 3300041451 Ga0451791_0751358 Ga0451791_0751358_346_822 156
442 3300041452 Ga0451793_1473683 Ga0451793_1473683_934_1410 156
443 3300041453 Ga0451797_1106049 Ga0451797_1106049_1740_2216 156
444 3300041486 Ga0451807_0503423 Ga0451807_0503423_1677_2153 156
445 3300042000 Ga0439437_004154 Ga0439437_004154_145_615 156
446 3300042006 Ga0439432_011961 Ga0439432_011961_1268_1738 156
447 3300042012 Ga0439455_0028996 Ga0439455_0028996_76_546 156
448 3300042533 Ga0450901_000990 Ga0450901_000990_1631_2101 156
449 3300044536 Ga0466988_0161536 Ga0466988_0161536_392_862 156
450 3300044656 Ga0466969_0029592 Ga0466969_0029592_1194_1664 156
451 3300044656 Ga0466969_0031920 Ga0466969_0031920_1364_1834 156
452 3300044656 Ga0466969_0066660 Ga0466969_0066660_1178_1648 156
453 3300044658 Ga0466972_0020423 Ga0466972_0020423_2769_3239 156
454 3300044661 Ga0466975_0306164 Ga0466975_0306164_374_844 156
455 3300044666 Ga0466977_0304176 Ga0466977_0304176_405_875 156
456 3300044672 Ga0466982_0000001 Ga0466982_0000001_439705_440175 156
457 3300044683 Ga0466965_0012502 Ga0466965_0012502_483_953 156
458 3300044683 Ga0466965_0022464 Ga0466965_0022464_1231_1701 156
459 3300044683 Ga0466965_0365194 Ga0466965_0365194_132_602 156
460 3300044684 Ga0466966_0008456 Ga0466966_0008456_3233_3703 156
461 3300044684 Ga0466966_0021893 Ga0466966_0021893_1581_2051 156
462 3300044684 Ga0466966_0024360 Ga0466966_0024360_221_691 156
463 3300044693 Ga0466961_0001123 Ga0466961_0001123_3902_4372 156
464 3300044693 Ga0466961_0002879 Ga0466961_0002879_5890_6360 156
465 3300044693 Ga0466961_0010515 Ga0466961_0010515_1194_1664 156
466 3300044693 Ga0466961_0063988 Ga0466961_0063988_802_1272 156
467 3300044693 Ga0466961_0172987 Ga0466961_0172987_847_1317 156
468 3300044694 Ga0466963_0319947 Ga0466963_0319947_218_688 156
469 3300044706 Ga0466964_0001080 Ga0466964_0001080_5931_6401 156
470 3300044719 Ga0466971_0000358 Ga0466971_0000358_15310_15780 156
471 3300044719 Ga0466971_0024916 Ga0466971_0024916_63_533 156
472 3300044719 Ga0466971_0105482 Ga0466971_0105482_51_521 156
473 3300044735 Ga0466968_0019270 Ga0466968_0019270_974_1444 156
474 3300044735 Ga0466968_0105991 Ga0466968_0105991_390_860 156
475 3300044765 Ga0466970_0003545 Ga0466970_0003545_2450_2920 156
476 3300044765 Ga0466970_0028277 Ga0466970_0028277_2274_2744 156
477 3300044765 Ga0466970_0105801 Ga0466970_0105801_1009_1479 156
478 3300044765 Ga0466970_0167399 Ga0466970_0167399_11_481 156
479 3300044842 Ga0466957_0001515 Ga0466957_0001515_1261_1731 156
480 3300044842 Ga0466957_0003488 Ga0466957_0003488_5508_5978 156
481 3300044842 Ga0466957_0694545 Ga0466957_0694545_185_655 156
482 3300044901 Ga0466960_0001294 Ga0466960_0001294_1596_2066 156
483 3300045049 Ga0466959_0047563 Ga0466959_0047563_1756_2226 156
484 3300045049 Ga0466959_0057445 Ga0466959_0057445_173_643 156
485 3300045049 Ga0466959_0118449 Ga0466959_0118449_1194_1664 156
486 3300045049 Ga0466959_0181321 Ga0466959_0181321_576_1046 156
487 3300045049 Ga0466959_0736677 Ga0466959_0736677_37_507 156
488 3300045836 Ga0466958_0016010 Ga0466958_0016010_3783_4253 156
489 3300045836 Ga0466958_0053133 Ga0466958_0053133_555_1025 156
490 3300045836 Ga0466958_0071222 Ga0466958_0071222_63_533 156
491 3300045836 Ga0466958_0147809 Ga0466958_0147809_312_782 156
492 3300045976 Ga0466967_0042580 Ga0466967_0042580_2684_3154 156
493 3300045976 Ga0466967_0329202 Ga0466967_0329202_951_1421 156
494 3300046453 Ga0495627_101812 Ga0495627_101812_173_643 156
495 3300046460 Ga0495638_0000290 Ga0495638_0000290_61864_62334 156
496 3300046460 Ga0495638_0001087 Ga0495638_0001087_21907_22377 156
497 3300046471 Ga0495650_0000210 Ga0495650_0000210_61909_62379 156
498 3300046507 Ga0495606_0000016 Ga0495606_0000016_42878_43348 156
499 3300046557 Ga0495622_0013844 Ga0495622_0013844_2911_3381 156
500 3300046558 Ga0495633_0002208 Ga0495633_0002208_12061_12531 156
501 3300046660 Ga0495625_0024105 Ga0495625_0024105_911_1381 156
502 3300046694 Ga0495649_0000450 Ga0495649_0000450_10452_10922 156
503 3300048907 Ga0496104_0090411 Ga0496104_0090411_1607_2077 156
504 3300048908 Ga0496105_0002876 Ga0496105_0002876_2420_2890 156
505 3300048909 Ga0496106_0119136 Ga0496106_0119136_1355_1825 156
506 3300048916 Ga0496113_0006282 Ga0496113_0006282_5991_6461 156
507 3300048917 Ga0496114_0575194 Ga0496114_0575194_284_754 156
508 3300048918 Ga0496115_0000095 Ga0496115_0000095_42891_43361 156
509 3300048918 Ga0496115_0002018 Ga0496115_0002018_4508_4978 156
510 3300048918 Ga0496115_0029277 Ga0496115_0029277_2251_2721 156
511 3300048918 Ga0496115_0291179 Ga0496115_0291179_413_883 156
512 3300048919 Ga0496116_0001905 Ga0496116_0001905_2081_2551 156
513 3300048920 Ga0496117_0054835 Ga0496117_0054835_512_982 156
514 3300048921 Ga0496118_0008228 Ga0496118_0008228_2162_2632 156
515 3300048921 Ga0496118_0050850 Ga0496118_0050850_227_697 156
516 3300048922 Ga0496119_0000966 Ga0496119_0000966_27298_27768 156
517 3300048922 Ga0496119_0008465 Ga0496119_0008465_2623_3093 156
518 3300048923 Ga0496120_0000409 Ga0496120_0000409_41246_41716 156
519 3300048923 Ga0496120_0001143 Ga0496120_0001143_2030_2500 156
520 3300048924 Ga0496121_0005906 Ga0496121_0005906_12780_13250 156
521 3300048924 Ga0496121_0009013 Ga0496121_0009013_10958_11428 156
522 3300048924 Ga0496121_0024979 Ga0496121_0024979_98_568 156
523 3300048924 Ga0496121_0059838 Ga0496121_0059838_2396_2866 156
524 3300048925 Ga0496122_0374085 Ga0496122_0374085_113_583 156
525 3300048927 Ga0496124_0013344 Ga0496124_0013344_5708_6256 156
526 3300048927 Ga0496124_0071614 Ga0496124_0071614_1815_2285 156
527 3300048928 Ga0496125_0000088 Ga0496125_0000088_51354_51824 156
528 3300048928 Ga0496125_0340036 Ga0496125_0340036_99_569 156
529 3300048929 Ga0496126_0006276 Ga0496126_0006276_4375_4845 156
530 3300048929 Ga0496126_0049430 Ga0496126_0049430_1010_1480 156
531 3300048929 Ga0496126_0596706 Ga0496126_0596706_54_524 156
532 3300049459 Ga0495678_026942 Ga0495678_026942_1433_1903 156
533 3300049460 Ga0495682_0001620 Ga0495682_0001620_3076_3546 156
534 3300049568 Ga0501031_0094212 Ga0501031_0094212_220_690 156
535 3300049569 Ga0501032_0103960 Ga0501032_0103960_171_641 156
536 3300049570 Ga0501033_0005277 Ga0501033_0005277_7824_8294 156
537 3300049570 Ga0501033_0009344 Ga0501033_0009344_6242_6712 156
538 3300049570 Ga0501033_0021541 Ga0501033_0021541_4019_4489 156
539 3300049571 Ga0501034_0023334 Ga0501034_0023334_5691_6161 156
540 3300049571 Ga0501034_0045115 Ga0501034_0045115_3679_4149 156
541 3300049571 Ga0501034_0045969 Ga0501034_0045969_3373_3843 156
542 3300049572 Ga0501036_0113556 Ga0501036_0113556_524_994 156
543 3300049572 Ga0501036_0119167 Ga0501036_0119167_717_1187 156
544 3300049573 Ga0501037_0017102 Ga0501037_0017102_2326_2796 156
545 3300049573 Ga0501037_0105161 Ga0501037_0105161_1494_1964 156
546 3300049573 Ga0501037_0125713 Ga0501037_0125713_190_744 156
547 3300049574 Ga0501038_0025505 Ga0501038_0025505_1601_2071 156
548 3300049575 Ga0501039_0053215 Ga0501039_0053215_2072_2542 156
549 3300049576 Ga0501040_0236655 Ga0501040_0236655_722_1192 156
550 3300049578 Ga0501042_0067633 Ga0501042_0067633_531_1001 156
551 3300049579 Ga0501043_0019693 Ga0501043_0019693_407_877 156
552 3300049579 Ga0501043_0036109 Ga0501043_0036109_884_1354 156
553 3300049579 Ga0501043_0049136 Ga0501043_0049136_159_629 156
554 3300049580 Ga0501046_0015963 Ga0501046_0015963_4996_5466 156
555 3300049581 Ga0501047_0013749 Ga0501047_0013749_1539_2009 156
556 3300049581 Ga0501047_0060398 Ga0501047_0060398_2264_2818 156
557 3300049581 Ga0501047_1149526 Ga0501047_1149526_22_492 156
558 3300049582 Ga0501048_0090878 Ga0501048_0090878_1292_1762 156
559 3300049582 Ga0501048_0599385 Ga0501048_0599385_60_530 156
560 3300049583 Ga0501067_0198405 Ga0501067_0198405_265_735 156
561 3300049586 Ga0501070_0050469 Ga0501070_0050469_2226_2696 156
562 3300049586 Ga0501070_0223882 Ga0501070_0223882_1031_1501 156
563 3300049589 Ga0501073_0043570 Ga0501073_0043570_513_983 156
564 3300049741 Ga0501079_0129119 Ga0501079_0129119_788_1258 156
565 3300049742 Ga0501080_0032186 Ga0501080_0032186_1783_2253 156
566 3300049822 Ga0501035_0013687 Ga0501035_0013687_6618_7088 156
567 3300049822 Ga0501035_0024637 Ga0501035_0024637_4946_5416 156
568 3300049822 Ga0501035_0037095 Ga0501035_0037095_1187_1657 156
569 3300049822 Ga0501035_0275331 Ga0501035_0275331_13_483 156
570 3300049822 Ga0501035_0333309 Ga0501035_0333309_615_1085 156
571 3300049823 Ga0501044_0017049 Ga0501044_0017049_5106_5576 156
572 3300049823 Ga0501044_0050029 Ga0501044_0050029_2654_3124 156
573 3300049823 Ga0501044_0140755 Ga0501044_0140755_1864_2334 156
574 3300049823 Ga0501044_0530805 Ga0501044_0530805_482_952 156
575 3300050491 nmdc:mga00v17_25_c1 nmdc:mga00v17_25_c1_23201_23671 156
576 3300053151 Ga0500604_0080094 Ga0500604_0080094_263_766 156
577 3300059503 Ga0587080_068454 Ga0587080_068454_121_591 156
578 3300059510 Ga0587090_031824 Ga0587090_031824_115_585 156
579 3300059642 Ga0587069_105280 Ga0587069_105280_37_507 156
580 3300059645 Ga0587076_034795 Ga0587076_034795_119_589 156
581 3300059646 Ga0587078_037146 Ga0587078_037146_69_539 156
582 3300060346 Ga0587111_0200159 Ga0587111_0200159_53_523 156
583 3300003792 Ga0055540_1032434 Ga0055540_10324342 158
584 3300005289 Ga0065704_10395925 Ga0065704_103959251 158
585 3300025303 Ga0209051_1026529 Ga0209051_10265293 158
586 3300031548 Ga0307408_100086899 Ga0307408_1000868993 158
587 3300031731 Ga0307405_10023448 Ga0307405_100234483 158
588 3300031901 Ga0307406_10030241 Ga0307406_100302414 158
589 3300031911 Ga0307412_10030790 Ga0307412_100307902 158
590 3300031995 Ga0307409_100023226 Ga0307409_1000232265 158
591 3300032002 Ga0307416_100037916 Ga0307416_1000379163 158
592 3300039062 Ga0400483_003006 Ga0400483_003006_1068_1544 158
593 3300041507 Ga0451851_1268479 Ga0451851_1268479_80_556 158
594 3300044712 Ga0453684_0041068 Ga0453684_0041068_5199_5675 158
595 3300045051 Ga0451576_0316807 Ga0451576_0316807_108_584 158
596 3300049593 Ga0501077_0757601 Ga0501077_0757601_31_507 158
597 3300049669 Ga0501235_133586 Ga0501235_133586_141_617 158
598 3300061734 Ga0530510_0537885 Ga0530510_0537885_311_787 158
599 3300001904 JGI24736J21556_1006931 JGI24736J21556_10069311 159
600 3300001979 JGI24740J21852_10046037 JGI24740J21852_100460371 159
601 3300002067 JGI24735J21928_10034707 JGI24735J21928_100347072 159
602 3300002075 JGI24738J21930_10000134 JGI24738J21930_100001347 159
603 3300002737 JGI25162J39368_1009221 JGI25162J39368_10092211 159
604 3300003578 Ga0006562J51391_1026967 Ga0006562J51391_102696717 159
605 3300003578 Ga0006562J51391_1026969 Ga0006562J51391_10269695 159
606 3300005262 Ga0065165_1001600 Ga0065165_100160013 159
607 3300005327 Ga0070658_10002151 Ga0070658_1000215117 159
608 3300005335 Ga0070666_10000001 Ga0070666_10000001118 159
609 3300005344 Ga0070661_100012331 Ga0070661_1000123317 159
610 3300005344 Ga0070661_100020178 Ga0070661_1000201781 159
611 3300005367 Ga0070667_100006964 Ga0070667_1000069646 159
612 3300005436 Ga0070713_100278234 Ga0070713_1002782342 159
613 3300005436 Ga0070713_100344861 Ga0070713_1003448612 159
614 3300005439 Ga0070711_101507507 Ga0070711_1015075071 159
615 3300005440 Ga0070705_100525476 Ga0070705_1005254761 159
616 3300005455 Ga0070663_100321872 Ga0070663_1003218722 159
617 3300005467 Ga0070706_101223212 Ga0070706_1012232121 159
618 3300005546 Ga0070696_100644576 Ga0070696_1006445761 159
619 3300005548 Ga0070665_100174034 Ga0070665_1001740343 159
620 3300005577 Ga0068857_100675440 Ga0068857_1006754401 159
621 3300005842 Ga0068858_100334273 Ga0068858_1003342733 159
622 3300005843 Ga0068860_100040218 Ga0068860_1000402185 159
623 3300005844 Ga0068862_100191160 Ga0068862_1001911602 159
624 3300006028 Ga0070717_10194523 Ga0070717_101945231 159
625 3300006028 Ga0070717_10373156 Ga0070717_103731562 159
626 3300006163 Ga0070715_10668246 Ga0070715_106682461 159
627 3300006175 Ga0070712_100215883 Ga0070712_1002158832 159
628 3300006353 Ga0075370_10003280 Ga0075370_100032805 159
629 3300006358 Ga0068871_101432345 Ga0068871_1014323451 159
630 3300006844 Ga0075428_100014713 Ga0075428_1000147135 159
631 3300006846 Ga0075430_100194747 Ga0075430_1001947472 159
632 3300006847 Ga0075431_100020748 Ga0075431_1000207484 159
633 3300006871 Ga0075434_100618681 Ga0075434_1006186812 159
634 3300006880 Ga0075429_100535692 Ga0075429_1005356921 159
635 3300007788 Ga0099795_10008350 Ga0099795_100083503 159
636 3300007788 Ga0099795_10054573 Ga0099795_100545732 159
637 3300009036 Ga0105244_10130145 Ga0105244_101301452 159
638 3300009093 Ga0105240_11944773 Ga0105240_119447731 159
639 3300009101 Ga0105247_10004311 Ga0105247_100043112 159
640 3300009147 Ga0114129_10007316 Ga0114129_100073169 159
641 3300009147 Ga0114129_11363296 Ga0114129_113632961 159
642 3300009148 Ga0105243_11510667 Ga0105243_115106671 159
643 3300009545 Ga0105237_10075974 Ga0105237_100759742 159
644 3300009551 Ga0105238_10000729 Ga0105238_1000072932 159
645 3300009551 Ga0105238_10016831 Ga0105238_1001683112 159
646 3300010159 Ga0099796_10033943 Ga0099796_100339431 159
647 3300010375 Ga0105239_10001310 Ga0105239_1000131025 159
648 3300013104 Ga0157370_10014299 Ga0157370_1001429911 159
649 3300013104 Ga0157370_10290784 Ga0157370_102907842 159
650 3300013105 Ga0157369_10006739 Ga0157369_1000673913 159
651 3300013306 Ga0163162_10002846 Ga0163162_1000284613 159
652 3300013306 Ga0163162_10196314 Ga0163162_101963142 159
653 3300013308 Ga0157375_10204716 Ga0157375_102047165 159
654 3300014326 Ga0157380_10323470 Ga0157380_103234702 159
655 3300014497 Ga0182008_10004786 Ga0182008_100047868 159
656 3300014497 Ga0182008_10041003 Ga0182008_100410031 159
657 3300015261 Ga0182006_1000041 Ga0182006_100004112 159
658 3300015261 Ga0182006_1000133 Ga0182006_100013310 159
659 3300015262 Ga0182007_10029244 Ga0182007_100292442 159
660 3300015262 Ga0182007_10085253 Ga0182007_100852532 159
661 3300015265 Ga0182005_1000257 Ga0182005_100025726 159
662 3300015265 Ga0182005_1000685 Ga0182005_100068514 159
663 3300015265 Ga0182005_1017371 Ga0182005_10173711 159
664 3300017792 Ga0163161_10002121 Ga0163161_1000212115 159
665 3300021361 Ga0213872_10084492 Ga0213872_100844921 159
666 3300025226 Ga0209674_100524 Ga0209674_1005247 159
667 3300025233 Ga0209437_102395 Ga0209437_1023954 159
668 3300025254 Ga0209148_1002008 Ga0209148_10020088 159
669 3300025258 Ga0209129_1001756 Ga0209129_10017562 159
670 3300025299 Ga0209256_1008385 Ga0209256_10083857 159
671 3300025302 Ga0207426_1040207 Ga0207426_10402072 159
672 3300025900 Ga0207710_10010942 Ga0207710_100109422 159
673 3300025903 Ga0207680_10000003 Ga0207680_10000003167 159
674 3300025904 Ga0207647_10000002 Ga0207647_1000000266 159
675 3300025906 Ga0207699_10604990 Ga0207699_106049902 159
676 3300025909 Ga0207705_10001085 Ga0207705_1000108517 159
677 3300025910 Ga0207684_10413903 Ga0207684_104139031 159
678 3300025914 Ga0207671_10041576 Ga0207671_100415765 159
679 3300025915 Ga0207693_10070023 Ga0207693_100700232 159
680 3300025920 Ga0207649_10011998 Ga0207649_100119987 159
681 3300025920 Ga0207649_10016528 Ga0207649_100165284 159
682 3300025924 Ga0207694_10000336 Ga0207694_1000033616 159
683 3300025924 Ga0207694_10093538 Ga0207694_100935384 159
684 3300025928 Ga0207700_10052810 Ga0207700_100528103 159
685 3300025928 Ga0207700_10424411 Ga0207700_104244112 159
686 3300025981 Ga0207640_11028750 Ga0207640_110287502 159
687 3300025986 Ga0207658_10239807 Ga0207658_102398072 159
688 3300026035 Ga0207703_10256521 Ga0207703_102565213 159
689 3300026067 Ga0207678_10314280 Ga0207678_103142802 159
690 3300026116 Ga0207674_11455515 Ga0207674_114555151 159
691 3300028379 Ga0268266_10000011 Ga0268266_10000011140 159
692 3300028380 Ga0268265_10127875 Ga0268265_101278754 159
693 3300028381 Ga0268264_10032087 Ga0268264_100320875 159
694 3300031090 Ga0265760_10066329 Ga0265760_100663291 159
695 3300031731 Ga0307405_10171222 Ga0307405_101712221 159
696 3300031911 Ga0307412_10006273 Ga0307412_100062735 159
697 3300033180 Ga0307510_10025234 Ga0307510_100252347 159
698 3300035724 Ga0373933_0120026 Ga0373933_0120026_39_530 159
699 3300035725 Ga0373947_0131280 Ga0373947_0131280_966_1448 159
700 3300036401 Ga0373937_0225514 Ga0373937_0225514_1039_1530 159
701 3300037068 Ga0373925_0185546 Ga0373925_0185546_759_1241 159
702 3300037471 Ga0395905_0034566 Ga0395905_0034566_76_561 159
703 3300039447 Ga0436361_0026274 Ga0436361_0026274_1137_1622 159
704 3300039447 Ga0436361_0188259 Ga0436361_0188259_2938_3426 159
705 3300041404 Ga0439436_0000004 Ga0439436_0000004_3260_3739 159
706 3300041413 Ga0439465_0004169 Ga0439465_0004169_1208_1687 159
707 3300041494 Ga0451837_0804861 Ga0451837_0804861_17_496 159
708 3300042438 Ga0439459_0002347 Ga0439459_0002347_1819_2298 159
709 3300044656 Ga0466969_0000832 Ga0466969_0000832_5047_5532 159
710 3300044672 Ga0466982_0000938 Ga0466982_0000938_5937_6416 159
711 3300044684 Ga0466966_0004925 Ga0466966_0004925_952_1437 159
712 3300044693 Ga0466961_0023027 Ga0466961_0023027_3303_3788 159
713 3300044735 Ga0466968_0000061 Ga0466968_0000061_25921_26403 159
714 3300044842 Ga0466957_0014896 Ga0466957_0014896_1033_1512 159
715 3300045049 Ga0466959_0000072 Ga0466959_0000072_9174_9659 159
716 3300045836 Ga0466958_0102175 Ga0466958_0102175_136_621 159
717 3300046452 Ga0495617_000085 Ga0495617_000085_62434_62913 159
718 3300046452 Ga0495617_000550 Ga0495617_000550_14186_14665 159
719 3300046460 Ga0495638_0000236 Ga0495638_0000236_29625_30104 159
720 3300046460 Ga0495638_0000754 Ga0495638_0000754_29120_29599 159
721 3300046461 Ga0495641_0459239 Ga0495641_0459239_21_503 159
722 3300046471 Ga0495650_0000191 Ga0495650_0000191_53234_53713 159
723 3300046471 Ga0495650_0007083 Ga0495650_0007083_6000_6479 159
724 3300046471 Ga0495650_0016818 Ga0495650_0016818_3056_3535 159
725 3300046472 Ga0495580_1002082 Ga0495580_1002082_31_513 159
726 3300046474 Ga0495605_0108397 Ga0495605_0108397_591_1070 159
727 3300046491 Ga0495584_0001936 Ga0495584_0001936_9217_9696 159
728 3300046492 Ga0495585_0005239 Ga0495585_0005239_1169_1648 159
729 3300046492 Ga0495585_0045531 Ga0495585_0045531_314_793 159
730 3300046501 Ga0495607_0000006 Ga0495607_0000006_187774_188256 159
731 3300046501 Ga0495607_0000131 Ga0495607_0000131_50665_51144 159
732 3300046501 Ga0495607_0054911 Ga0495607_0054911_1515_1997 159
733 3300046507 Ga0495606_0001253 Ga0495606_0001253_5952_6431 159
734 3300046507 Ga0495606_0001443 Ga0495606_0001443_2871_3350 159
735 3300046507 Ga0495606_0005058 Ga0495606_0005058_3970_4449 159
736 3300046507 Ga0495606_0031226 Ga0495606_0031226_2938_3417 159
737 3300046507 Ga0495606_0262916 Ga0495606_0262916_231_710 159
738 3300046512 Ga0495610_0002949 Ga0495610_0002949_4458_4937 159
739 3300046512 Ga0495610_0089717 Ga0495610_0089717_101_580 159
740 3300046513 Ga0495616_0000401 Ga0495616_0000401_4758_5237 159
741 3300046513 Ga0495616_0015631 Ga0495616_0015631_3056_3535 159
742 3300046515 Ga0495620_0000365 Ga0495620_0000365_25951_26430 159
743 3300046515 Ga0495620_0131360 Ga0495620_0131360_238_717 159
744 3300046518 Ga0495631_0009431 Ga0495631_0009431_289_768 159
745 3300046518 Ga0495631_0020021 Ga0495631_0020021_314_793 159
746 3300046519 Ga0495632_0000531 Ga0495632_0000531_5900_6379 159
747 3300046519 Ga0495632_0007769 Ga0495632_0007769_5855_6334 159
748 3300046520 Ga0495637_0006532 Ga0495637_0006532_3456_3935 159
749 3300046522 Ga0495643_0037770 Ga0495643_0037770_14_493 159
750 3300046524 Ga0495648_0000878 Ga0495648_0000878_3489_3968 159
751 3300046524 Ga0495648_0031592 Ga0495648_0031592_2780_3259 159
752 3300046538 Ga0495609_0004007 Ga0495609_0004007_6394_6873 159
753 3300046616 Ga0495668_0004627 Ga0495668_0004627_5686_6165 159
754 3300046648 Ga0495611_0000002 Ga0495611_0000002_494832_495311 159
755 3300046648 Ga0495611_0006414 Ga0495611_0006414_386_865 159
756 3300046660 Ga0495625_0000002 Ga0495625_0000002_499317_499796 159
757 3300046660 Ga0495625_0013448 Ga0495625_0013448_5974_6453 159
758 3300046660 Ga0495625_0429785 Ga0495625_0429785_246_725 159
759 3300046665 Ga0495661_0046789 Ga0495661_0046789_369_848 159
760 3300046665 Ga0495661_0142491 Ga0495661_0142491_244_723 159
761 3300046691 Ga0495670_0000227 Ga0495670_0000227_22188_22667 159
762 3300046691 Ga0495670_0002779 Ga0495670_0002779_4375_4854 159
763 3300046691 Ga0495670_0125706 Ga0495670_0125706_205_684 159
764 3300046692 Ga0495671_0002392 Ga0495671_0002392_10915_11394 159
765 3300046694 Ga0495649_0003337 Ga0495649_0003337_3813_4292 159
766 3300046794 Ga0495589_0000190 Ga0495589_0000190_35455_35934 159
767 3300046810 Ga0495660_0000437 Ga0495660_0000437_5221_5700 159
768 3300046810 Ga0495660_0000447 Ga0495660_0000447_29120_29599 159
769 3300047321 Ga0495676_0294856 Ga0495676_0294856_537_1016 159
770 3300047323 Ga0495683_0000679 Ga0495683_0000679_15625_16104 159
771 3300047446 Ga0495679_000003 Ga0495679_000003_300607_301086 159
772 3300047469 Ga0495673_0000004 Ga0495673_0000004_1246611_1247090 159
773 3300047469 Ga0495673_0000062 Ga0495673_0000062_72851_73330 159
774 3300047469 Ga0495673_0014368 Ga0495673_0014368_682_1161 159
775 3300047470 Ga0495681_0098538 Ga0495681_0098538_713_1192 159
776 3300047472 Ga0495686_0000426 Ga0495686_0000426_7659_8141 159
777 3300047472 Ga0495686_0001228 Ga0495686_0001228_25904_26383 159
778 3300047472 Ga0495686_0028923 Ga0495686_0028923_257_736 159
779 3300048903 Ga0496100_0034642 Ga0496100_0034642_2178_2657 159
780 3300048904 Ga0496101_0000807 Ga0496101_0000807_12237_12716 159
781 3300048905 Ga0496102_0417674 Ga0496102_0417674_233_715 159
782 3300048909 Ga0496106_0000168 Ga0496106_0000168_9028_9507 159
783 3300048910 Ga0496107_0260702 Ga0496107_0260702_495_974 159
784 3300048919 Ga0496116_0117442 Ga0496116_0117442_34_516 159
785 3300048920 Ga0496117_0015396 Ga0496117_0015396_4089_4571 159
786 3300048920 Ga0496117_0105616 Ga0496117_0105616_1140_1622 159
787 3300048921 Ga0496118_0002160 Ga0496118_0002160_1262_1741 159
788 3300048921 Ga0496118_0003450 Ga0496118_0003450_15396_15878 159
789 3300048922 Ga0496119_0026020 Ga0496119_0026020_3505_3984 159
790 3300048924 Ga0496121_0000116 Ga0496121_0000116_102255_102734 159
791 3300048924 Ga0496121_0004519 Ga0496121_0004519_14672_15151 159
792 3300048924 Ga0496121_0005025 Ga0496121_0005025_3130_3609 159
793 3300048924 Ga0496121_0034038 Ga0496121_0034038_3665_4144 159
794 3300048924 Ga0496121_0510861 Ga0496121_0510861_230_709 159
795 3300048925 Ga0496122_0026416 Ga0496122_0026416_257_739 159
796 3300048925 Ga0496122_0097560 Ga0496122_0097560_211_690 159
797 3300048926 Ga0496123_0021108 Ga0496123_0021108_4046_4525 159
798 3300048926 Ga0496123_0021504 Ga0496123_0021504_3740_4219 159
799 3300048926 Ga0496123_0023563 Ga0496123_0023563_3926_4408 159
800 3300048927 Ga0496124_0006663 Ga0496124_0006663_6346_6828 159
801 3300048928 Ga0496125_0085003 Ga0496125_0085003_1011_1490 159
802 3300048928 Ga0496125_0150581 Ga0496125_0150581_734_1213 159
803 3300048929 Ga0496126_0010165 Ga0496126_0010165_2605_3084 159
804 3300048929 Ga0496126_0068718 Ga0496126_0068718_1406_1885 159
805 3300048929 Ga0496126_0768188 Ga0496126_0768188_183_662 159
806 3300049459 Ga0495678_000019 Ga0495678_000019_18439_18918 159
807 3300049460 Ga0495682_0009177 Ga0495682_0009177_847_1326 159
808 3300049571 Ga0501034_0046998 Ga0501034_0046998_524_1009 159
809 3300049579 Ga0501043_0051472 Ga0501043_0051472_198_683 159
810 3300049744 Ga0501083_0244603 Ga0501083_0244603_409_894 159
811 3300049823 Ga0501044_0068761 Ga0501044_0068761_2349_2831 159
812 3300050493 nmdc:mga0k408_434685_c1 nmdc:mga0k408_434685_c1_223_702 159
813 3300050496 nmdc:mga07m45_4934_c1 nmdc:mga07m45_4934_c1_4014_4493 159
814 3300050507 nmdc:mga05p37_8922_c1 nmdc:mga05p37_8922_c1_4063_4545 159
815 3300050508 nmdc:mga09592_485568_c1 nmdc:mga09592_485568_c1_553_1035 159
816 3300050509 nmdc:mga0qj67_1232157_c1 nmdc:mga0qj67_1232157_c1_18_554 159
817 3300050509 nmdc:mga0qj67_179968_c1 nmdc:mga0qj67_179968_c1_474_956 159
818 3300050510 nmdc:mga06r32_18031_c1 nmdc:mga06r32_18031_c1_1719_2201 159
819 3300050512 nmdc:mga0n895_57402_c1 nmdc:mga0n895_57402_c1_3235_3720 159
820 3300050516 nmdc:mga0sz30_11202_c1 nmdc:mga0sz30_11202_c1_949_1431 159
821 3300053087 Ga0500643_000101 Ga0500643_000101_10502_10981 159
822 3300053090 Ga0500646_0018922 Ga0500646_0018922_576_1055 159
823 3300053103 Ga0500555_000584 Ga0500555_000584_11082_11561 159
824 3300053121 Ga0500607_000007 Ga0500607_000007_94859_95338 159
825 3300053136 Ga0500559_0001214 Ga0500559_0001214_12847_13326 159
826 3300053160 Ga0500633_0054274 Ga0500633_0054274_226_705 159
827 3300053178 Ga0500637_0016186 Ga0500637_0016186_1345_1824 159
828 3300053730 Ga0500645_014997 Ga0500645_014997_269_748 159
829 3300053730 Ga0500645_040269 Ga0500645_040269_769_1248 159
830 3300059645 Ga0587076_158354 Ga0587076_158354_50_535 159
831 3300060353 Ga0501082_0923000 Ga0501082_0923000_155_646 159
832 3300061719 Ga0466962_0015079 Ga0466962_0015079_152_637 159

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00210

Ferritin

Ferritin-like domain

36

172

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4tob-assembly1.cif.gz_F 1.95a resolution structure of bfrb (q151l) from pseudomonas aeruginosa 0.9954 2 154
4tob-assembly1.cif.gz_W 1.95a resolution structure of bfrb (q151l) from pseudomonas aeruginosa 0.9951 2 154
5zur-assembly1.cif.gz_B achromobacter dh1f bacterioferritin 0.9931 1 155
4to9-assembly1.cif.gz_S 2.0a resolution structure of bfrb (n148l) from pseudomonas aeruginosa 0.993 2 156
4toc-assembly1.cif.gz_L 2.25a resolution structure of iron bound bfrb (q151l) from pseudomonas aeruginosa 0.9927 2 156
ID Description Score Start End Superfamily
af_P0ABD3_1_158_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9961 1 154 1.20.1260.10
5zurA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9934 1 153 1.20.1260.10
5d8rA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9916 1 156 1.20.1260.10
4am2B00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9914 1 159 1.20.1260.10
3is7J00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9905 3 156 1.20.1260.10

Feature Viewer

pLDDT pTM Quality
96.24 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map