F482732
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 832 | 419 | 772 | 157 |
Family's Representative Sequence
| Representative Sequence | 3300049573|Ga0501037_0125713|Ga0501037_0125713_190_744 |
| Length | 184 |
| Sequence | MREPLAFAFRHGSGRIRIVPPSTPTETAMKGDAKVIEFLNKVLYNELTAINQYFLHYRMFKDWGYQELAEHEYKESIEEMKHADHLIERILFLDGLPNLQHLGKLRIGENVLECIQGDLDLELVAAKDLRAAIAHAEGIADYVSRDLFKNILHDEEEHIDWLETQQSLVKDIGAERYLQNKMGD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2526164512 | Azovibrio restrictus DSM 23866 | Isolate | Unclassified |
| 2 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 3 | 2547132130 | Stenotrophomonas maltophilia RR-10 | Isolate | Unclassified |
| 4 | 2565956521 | Vibrio rhizosphaerae DSM 18581 | Isolate | Rhizosphere |
| 5 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 6 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 7 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 8 | 2643221562 | Rhodanobacter sp. Root561 | Isolate | Unclassified |
| 9 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 10 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 11 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 12 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 13 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 14 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 15 | 2747842428 | Stenotrophomonas sp. WCS2014-113 | Isolate | Unclassified |
| 16 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 17 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 18 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 19 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 20 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 21 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 22 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 23 | 2842757796 | Stenotrophomonas sp. R-72406 | Isolate | Unclassified |
| 24 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 25 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 26 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 27 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 28 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 29 | 2874220319 | Stenotrophomonas maltophilia PS5 | Isolate | Unclassified |
| 30 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 31 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 32 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 33 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 34 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 35 | 2919089067 | Stenotrophomonas sp. 1337 | Isolate | Rhizosphere |
| 36 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 37 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 38 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 39 | 2928496128 | Stenotrophomonas indicatrix 1163 | Isolate | Unclassified |
| 40 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 41 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 42 | 2931380184 | Stenotrophomonas sp. DR822 | Isolate | Rhizosphere |
| 43 | 2937610967 | Stenotrophomonas maltophilia EP20 | Isolate | Unclassified |
| 44 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 45 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 46 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 47 | 2939626828 | Stenotrophomonas sp. 2694 | Isolate | Rhizosphere |
| 48 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 49 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 50 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 51 | 2961047084 | Stenotrophomonas maltophilia EP5 | Isolate | Unclassified |
| 52 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 53 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 54 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 55 | 2984514374 | Stenotrophomonas sp. SORGH_AS282 | Isolate | Aerial Root |
| 56 | 2987605356 | Stenotrophomonas sp. ATCM1_4 | Isolate | Unclassified |
| 57 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 58 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 59 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 60 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 61 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 62 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 63 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 64 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 65 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 66 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 67 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 68 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 69 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 70 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 71 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 72 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 73 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 74 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 75 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 76 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 77 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 78 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 79 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 80 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 81 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 82 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 83 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 84 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 85 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 86 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 88 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 90 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 91 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 93 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 95 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 98 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 102 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 103 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 106 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 110 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 111 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 112 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 113 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 114 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 118 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 120 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 121 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 122 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 123 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 124 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 125 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 126 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 127 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 128 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 129 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 130 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 131 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 132 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 133 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 134 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 135 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 136 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 137 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 138 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 139 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 140 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 141 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 142 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 152 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 154 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 155 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 156 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 166 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 168 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 169 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 170 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 171 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 172 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 174 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 175 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 176 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 177 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 178 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 179 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 180 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 181 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 182 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 183 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 193 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 194 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 197 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 198 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 200 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 201 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 202 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 205 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 206 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 207 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 208 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 249 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 250 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 251 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 252 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 253 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 254 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 255 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 256 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 257 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 258 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 259 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 260 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 261 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 262 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 263 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 264 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 265 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 266 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 267 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 268 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 269 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 270 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 271 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 272 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 273 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 274 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 275 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 276 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 277 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 278 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 279 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 280 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 281 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 282 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 283 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 284 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 285 | 3300044536 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E | Metagenome | Unclassified |
| 286 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 287 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 288 | 3300044661 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E | Metagenome | Unclassified |
| 289 | 3300044666 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E | Metagenome | Unclassified |
| 290 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 291 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 292 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 293 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 294 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 295 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 296 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 297 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 298 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 299 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 300 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 301 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 302 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 303 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 304 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 305 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 306 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 344 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 345 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 346 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 347 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 348 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 349 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 350 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 351 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 352 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 353 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 354 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 355 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 356 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 357 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 358 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 359 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 360 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 361 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 362 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 363 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 364 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 385 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 391 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 392 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 393 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 399 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 400 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 401 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 402 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 403 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 404 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 405 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 406 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 407 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 408 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 409 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 410 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 411 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 412 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 413 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 414 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 415 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 416 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 417 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 418 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 419 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.26 |
| Metatranscriptomes | 2.52 |
| Isolates | 7.21 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.12 |
| Bulb | 0 |
| Endosphere | 16.23 |
| Nodule | 0.12 |
| Rhizoplane | 2.16 |
| Rhizosphere | 66.95 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.42 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1006931 | 3300001904 | Bacteria | 1908 |
| 2 | JGI24740J21852_10006437 | 3300001979 | Bacteria | 4864 |
| 3 | JGI24740J21852_10046037 | 3300001979 | Bacteria | 1283 |
| 4 | JGI24739J22299_10005117 | 3300001989 | Bacteria | 4994 |
| 5 | JGI24737J22298_10003429 | 3300001990 | Bacteria | 5605 |
| 6 | JGI24737J22298_10007318 | 3300001990 | Bacteria | 3732 |
| 7 | JGI24737J22298_10042862 | 3300001990 | Bacteria | 1386 |
| 8 | JGI24735J21928_10004506 | 3300002067 | Bacteria | 4685 |
| 9 | JGI24735J21928_10007432 | 3300002067 | Bacteria | 3574 |
| 10 | JGI24735J21928_10034707 | 3300002067 | Bacteria | 1486 |
| 11 | JGI24738J21930_10000134 | 3300002075 | Bacteria | 18117 |
| 12 | JGI24738J21930_10065776 | 3300002075 | Bacteria | 747 |
| 13 | JGI25156J39149_1006761 | 3300002705 | Bacteria | 3092 |
| 14 | JGI25156J39149_1022847 | 3300002705 | Bacteria | 1055 |
| 15 | JGI25162J39368_1000115 | 3300002737 | Bacteria | 88006 |
| 16 | JGI25162J39368_1000402 | 3300002737 | Bacteria | 35934 |
| 17 | JGI25162J39368_1003198 | 3300002737 | Bacteria | 5089 |
| 18 | JGI25162J39368_1004010 | 3300002737 | Bacteria | 3716 |
| 19 | JGI25162J39368_1009221 | 3300002737 | Bacteria | 1340 |
| 20 | JGI25154J39366_1006347 | 3300002738 | Bacteria | 1745 |
| 21 | JGI25157J39369_1000132 | 3300002741 | Bacteria | 62647 |
| 22 | JGI25157J39369_1000313 | 3300002741 | Bacteria | 35036 |
| 23 | JGI25157J39369_1000344 | 3300002741 | Bacteria | 32837 |
| 24 | JGI25157J39369_1000452 | 3300002741 | Bacteria | 26160 |
| 25 | JGI25157J39369_1000453 | 3300002741 | Bacteria | 26066 |
| 26 | JGI25157J39369_1003094 | 3300002741 | Bacteria | 3589 |
| 27 | JGI25163J39215_1000758 | 3300002771 | Bacteria | 8028 |
| 28 | JGI25164J39214_1000090 | 3300002772 | Bacteria | 90565 |
| 29 | JGI25164J39214_1000117 | 3300002772 | Bacteria | 76695 |
| 30 | JGI25164J39214_1000522 | 3300002772 | Bacteria | 18167 |
| 31 | JGI25164J39214_1001570 | 3300002772 | Bacteria | 4926 |
| 32 | JGI25165J46597_1000194 | 3300003214 | Bacteria | 91012 |
| 33 | JGI25165J46597_1000235 | 3300003214 | Bacteria | 76684 |
| 34 | JGI25165J46597_1002775 | 3300003214 | Bacteria | 5089 |
| 35 | rootH2_10001214 | 3300003320 | Bacteria | 12480 |
| 36 | Ga0006562J51391_1003311 | 3300003578 | Bacteria | 6730 |
| 37 | Ga0006562J51391_1026967 | 3300003578 | Bacteria | 18790 |
| 38 | Ga0006562J51391_1026969 | 3300003578 | Bacteria | 12990 |
| 39 | Ga0055538_1002959 | 3300003751 | Bacteria | 2292 |
| 40 | Ga0055533_1001362 | 3300003756 | Bacteria | 6544 |
| 41 | Ga0055533_1001537 | 3300003756 | Bacteria | 6014 |
| 42 | Ga0055533_1007754 | 3300003756 | Bacteria | 1424 |
| 43 | Ga0055525_1000082 | 3300003759 | Bacteria | 159396 |
| 44 | Ga0055527_1000176 | 3300003760 | Bacteria | 43621 |
| 45 | Ga0055527_1000179 | 3300003760 | Bacteria | 42841 |
| 46 | Ga0055527_1005250 | 3300003760 | Bacteria | 1701 |
| 47 | Ga0055535_1000106 | 3300003761 | Bacteria | 90565 |
| 48 | Ga0055535_1000373 | 3300003761 | Bacteria | 42794 |
| 49 | Ga0055535_1000405 | 3300003761 | Bacteria | 40615 |
| 50 | Ga0055535_1000487 | 3300003761 | Bacteria | 35749 |
| 51 | Ga0055535_1001357 | 3300003761 | Bacteria | 12869 |
| 52 | Ga0055535_1001457 | 3300003761 | Bacteria | 11944 |
| 53 | Ga0055535_1001699 | 3300003761 | Bacteria | 10025 |
| 54 | Ga0055542_1000150 | 3300003762 | Bacteria | 88006 |
| 55 | Ga0055542_1000245 | 3300003762 | Bacteria | 62120 |
| 56 | Ga0055542_1000394 | 3300003762 | Bacteria | 43618 |
| 57 | Ga0055542_1000429 | 3300003762 | Bacteria | 40523 |
| 58 | Ga0055542_1000431 | 3300003762 | Bacteria | 40271 |
| 59 | Ga0055542_1000734 | 3300003762 | Bacteria | 25435 |
| 60 | Ga0055529_1000168 | 3300003763 | Bacteria | 90565 |
| 61 | Ga0055529_1000178 | 3300003763 | Bacteria | 86969 |
| 62 | Ga0055529_1000314 | 3300003763 | Bacteria | 55435 |
| 63 | Ga0055529_1000420 | 3300003763 | Bacteria | 43618 |
| 64 | Ga0055529_1000428 | 3300003763 | Bacteria | 42837 |
| 65 | Ga0055536_1000766 | 3300003781 | Bacteria | 21387 |
| 66 | Ga0055536_1000908 | 3300003781 | Bacteria | 19136 |
| 67 | Ga0055530_10002816 | 3300003791 | Bacteria | 10690 |
| 68 | Ga0055540_1020526 | 3300003792 | Bacteria | 1744 |
| 69 | Ga0055540_1032434 | 3300003792 | Bacteria | 1192 |
| 70 | Ga0055531_10005486 | 3300003794 | Bacteria | 7420 |
| 71 | Ga0058692_1000004 | 3300003856 | Bacteria | 431119 |
| 72 | Ga0065165_1001600 | 3300005262 | Bacteria | 23230 |
| 73 | Ga0065704_10041565 | 3300005289 | Bacteria | 939 |
| 74 | Ga0065704_10395925 | 3300005289 | Bacteria | 757 |
| 75 | Ga0070658_10002151 | 3300005327 | Bacteria | 16517 |
| 76 | Ga0070658_10153551 | 3300005327 | Bacteria | 1929 |
| 77 | Ga0070683_100587141 | 3300005329 | Bacteria | 1066 |
| 78 | Ga0070666_10000001 | 3300005335 | Bacteria | 543080 |
| 79 | Ga0070680_100214885 | 3300005336 | Bacteria | 1623 |
| 80 | Ga0070682_100001661 | 3300005337 | Bacteria | 12376 |
| 81 | Ga0070682_100012513 | 3300005337 | Bacteria | 4867 |
| 82 | Ga0070682_100074554 | 3300005337 | Bacteria | 2179 |
| 83 | Ga0070682_100202603 | 3300005337 | Bacteria | 1401 |
| 84 | Ga0070660_100115019 | 3300005339 | Bacteria | 2144 |
| 85 | Ga0070660_100165679 | 3300005339 | Bacteria | 1783 |
| 86 | Ga0070689_100004904 | 3300005340 | Bacteria | 9077 |
| 87 | Ga0070661_100012331 | 3300005344 | Bacteria | 5980 |
| 88 | Ga0070661_100020178 | 3300005344 | Bacteria | 4751 |
| 89 | Ga0070661_100021242 | 3300005344 | Bacteria | 4634 |
| 90 | Ga0070661_100075635 | 3300005344 | Bacteria | 2481 |
| 91 | Ga0070692_10008876 | 3300005345 | Bacteria | 4504 |
| 92 | Ga0070692_10247756 | 3300005345 | Bacteria | 1065 |
| 93 | Ga0070668_100008631 | 3300005347 | Bacteria | 7568 |
| 94 | Ga0070669_100381917 | 3300005353 | Bacteria | 1149 |
| 95 | Ga0070688_100114170 | 3300005365 | Bacteria | 1800 |
| 96 | Ga0070659_100001906 | 3300005366 | Bacteria | 14915 |
| 97 | Ga0070659_100002475 | 3300005366 | Bacteria | 13114 |
| 98 | Ga0070667_100006964 | 3300005367 | Bacteria | 9393 |
| 99 | Ga0070714_100000749 | 3300005435 | Bacteria | 22993 |
| 100 | Ga0070714_100001553 | 3300005435 | Bacteria | 16723 |
| 101 | Ga0070714_100007691 | 3300005435 | Bacteria | 8393 |
| 102 | Ga0070713_100000602 | 3300005436 | Bacteria | 22854 |
| 103 | Ga0070713_100278234 | 3300005436 | Bacteria | 1534 |
| 104 | Ga0070713_100344861 | 3300005436 | Bacteria | 1381 |
| 105 | Ga0070710_10032588 | 3300005437 | Bacteria | 2824 |
| 106 | Ga0070711_100807841 | 3300005439 | Bacteria | 796 |
| 107 | Ga0070711_101507507 | 3300005439 | Bacteria | 587 |
| 108 | Ga0070705_100525476 | 3300005440 | Bacteria | 903 |
| 109 | Ga0070694_100985686 | 3300005444 | Bacteria | 699 |
| 110 | Ga0070663_100018335 | 3300005455 | Bacteria | 4587 |
| 111 | Ga0070663_100081346 | 3300005455 | Bacteria | 2381 |
| 112 | Ga0070663_100321872 | 3300005455 | Bacteria | 1244 |
| 113 | Ga0070663_100406035 | 3300005455 | Bacteria | 1115 |
| 114 | Ga0070663_100539021 | 3300005455 | Bacteria | 974 |
| 115 | Ga0070678_100011516 | 3300005456 | Bacteria | 5463 |
| 116 | Ga0070662_100022988 | 3300005457 | Bacteria | 4277 |
| 117 | Ga0070681_10003017 | 3300005458 | Bacteria | 15620 |
| 118 | Ga0070681_10010816 | 3300005458 | Bacteria | 9019 |
| 119 | Ga0070681_10286291 | 3300005458 | Bacteria | 1558 |
| 120 | Ga0070681_11303941 | 3300005458 | Bacteria | 649 |
| 121 | Ga0070706_101223212 | 3300005467 | Bacteria | 690 |
| 122 | Ga0070679_100027315 | 3300005530 | Bacteria | 5617 |
| 123 | Ga0070679_100279657 | 3300005530 | Bacteria | 1622 |
| 124 | Ga0070679_101640567 | 3300005530 | Bacteria | 591 |
| 125 | Ga0070684_100561902 | 3300005535 | Bacteria | 1059 |
| 126 | Ga0068853_100006253 | 3300005539 | Bacteria | 9438 |
| 127 | Ga0068853_100169361 | 3300005539 | Bacteria | 1975 |
| 128 | Ga0068853_100258383 | 3300005539 | Bacteria | 1600 |
| 129 | Ga0070696_100015645 | 3300005546 | Bacteria | 5097 |
| 130 | Ga0070696_100113397 | 3300005546 | Bacteria | 1954 |
| 131 | Ga0070696_100359714 | 3300005546 | Bacteria | 1129 |
| 132 | Ga0070696_100644576 | 3300005546 | Bacteria | 858 |
| 133 | Ga0070693_100043943 | 3300005547 | Bacteria | 2526 |
| 134 | Ga0070693_100113977 | 3300005547 | Bacteria | 1667 |
| 135 | Ga0070665_100017480 | 3300005548 | Bacteria | 7202 |
| 136 | Ga0070665_100174034 | 3300005548 | Bacteria | 2153 |
| 137 | Ga0068855_100165702 | 3300005563 | Bacteria | 2505 |
| 138 | Ga0068855_100178419 | 3300005563 | Bacteria | 2402 |
| 139 | Ga0068855_100679439 | 3300005563 | Bacteria | 1103 |
| 140 | Ga0070664_100457627 | 3300005564 | Bacteria | 1172 |
| 141 | Ga0068857_100007224 | 3300005577 | Bacteria | 9565 |
| 142 | Ga0068857_100083154 | 3300005577 | Bacteria | 2859 |
| 143 | Ga0068857_100278611 | 3300005577 | Bacteria | 1538 |
| 144 | Ga0068857_100675440 | 3300005577 | Bacteria | 980 |
| 145 | Ga0068854_100000026 | 3300005578 | Bacteria | 118880 |
| 146 | Ga0068854_100033812 | 3300005578 | Bacteria | 3566 |
| 147 | Ga0068854_100074560 | 3300005578 | Bacteria | 2489 |
| 148 | Ga0068854_100131868 | 3300005578 | Bacteria | 1909 |
| 149 | Ga0068856_100000132 | 3300005614 | Bacteria | 75819 |
| 150 | Ga0068856_100000138 | 3300005614 | Bacteria | 73748 |
| 151 | Ga0068856_100156438 | 3300005614 | Bacteria | 2289 |
| 152 | Ga0068852_100059059 | 3300005616 | Bacteria | 3325 |
| 153 | Ga0068851_10063461 | 3300005834 | Bacteria | 1897 |
| 154 | Ga0068858_100076429 | 3300005842 | Bacteria | 3109 |
| 155 | Ga0068858_100334273 | 3300005842 | Bacteria | 1449 |
| 156 | Ga0068860_100040218 | 3300005843 | Bacteria | 4470 |
| 157 | Ga0068860_100093958 | 3300005843 | Bacteria | 2859 |
| 158 | Ga0068862_100191160 | 3300005844 | Bacteria | 1842 |
| 159 | Ga0081540_1001656 | 3300005983 | Bacteria | 18948 |
| 160 | Ga0081539_10013089 | 3300005985 | Bacteria | 6289 |
| 161 | Ga0070717_10194523 | 3300006028 | Bacteria | 1773 |
| 162 | Ga0070717_10373156 | 3300006028 | Bacteria | 1278 |
| 163 | Ga0075364_10000769 | 3300006051 | Bacteria | 16847 |
| 164 | Ga0075364_10027694 | 3300006051 | Bacteria | 3622 |
| 165 | Ga0075364_10726542 | 3300006051 | Bacteria | 677 |
| 166 | Ga0070715_10668246 | 3300006163 | Bacteria | 617 |
| 167 | Ga0070712_100215883 | 3300006175 | Bacteria | 1515 |
| 168 | Ga0070712_100346463 | 3300006175 | Bacteria | 1215 |
| 169 | Ga0075369_10027448 | 3300006186 | Bacteria | 2380 |
| 170 | Ga0075370_10003280 | 3300006353 | Bacteria | 7677 |
| 171 | Ga0068871_101432345 | 3300006358 | Bacteria | 652 |
| 172 | Ga0075428_100014713 | 3300006844 | Bacteria | 8690 |
| 173 | Ga0075430_100194747 | 3300006846 | Bacteria | 1684 |
| 174 | Ga0075431_100020748 | 3300006847 | Bacteria | 6714 |
| 175 | Ga0075434_100618681 | 3300006871 | Bacteria | 1102 |
| 176 | Ga0075429_100535692 | 3300006880 | Bacteria | 1026 |
| 177 | Ga0099795_10008350 | 3300007788 | Bacteria | 2947 |
| 178 | Ga0099795_10054573 | 3300007788 | Bacteria | 1466 |
| 179 | Ga0105244_10057268 | 3300009036 | Bacteria | 1970 |
| 180 | Ga0105244_10082339 | 3300009036 | Bacteria | 1591 |
| 181 | Ga0105244_10130145 | 3300009036 | Bacteria | 1215 |
| 182 | Ga0105240_10001223 | 3300009093 | Bacteria | 44659 |
| 183 | Ga0105240_10007527 | 3300009093 | Bacteria | 15797 |
| 184 | Ga0105240_10224484 | 3300009093 | Bacteria | 2186 |
| 185 | Ga0105240_10250368 | 3300009093 | Bacteria | 2049 |
| 186 | Ga0105240_10832982 | 3300009093 | Bacteria | 997 |
| 187 | Ga0105240_11944773 | 3300009093 | Bacteria | 612 |
| 188 | Ga0105247_10004311 | 3300009101 | Bacteria | 9094 |
| 189 | Ga0114129_10007316 | 3300009147 | Bacteria | 15716 |
| 190 | Ga0114129_11363296 | 3300009147 | Bacteria | 876 |
| 191 | Ga0105243_10025020 | 3300009148 | Bacteria | 4559 |
| 192 | Ga0105243_11510667 | 3300009148 | Bacteria | 696 |
| 193 | Ga0105241_10131103 | 3300009174 | Bacteria | 2030 |
| 194 | Ga0105241_10620480 | 3300009174 | Bacteria | 979 |
| 195 | Ga0105237_10000079 | 3300009545 | Bacteria | 127925 |
| 196 | Ga0105237_10000387 | 3300009545 | Bacteria | 62716 |
| 197 | Ga0105237_10075974 | 3300009545 | Bacteria | 3350 |
| 198 | Ga0105237_10081547 | 3300009545 | Bacteria | 3226 |
| 199 | Ga0105237_11092360 | 3300009545 | Bacteria | 804 |
| 200 | Ga0105238_10000729 | 3300009551 | Bacteria | 34322 |
| 201 | Ga0105238_10001523 | 3300009551 | Bacteria | 23225 |
| 202 | Ga0105238_10015059 | 3300009551 | Bacteria | 7833 |
| 203 | Ga0105238_10016831 | 3300009551 | Bacteria | 7415 |
| 204 | Ga0105238_10097882 | 3300009551 | Bacteria | 2918 |
| 205 | Ga0105238_10532286 | 3300009551 | Bacteria | 1178 |
| 206 | Ga0105249_10986325 | 3300009553 | Bacteria | 911 |
| 207 | Ga0099796_10033943 | 3300010159 | Bacteria | 1682 |
| 208 | Ga0105239_10000830 | 3300010375 | Bacteria | 43916 |
| 209 | Ga0105239_10001310 | 3300010375 | Bacteria | 33536 |
| 210 | Ga0105239_10038489 | 3300010375 | Bacteria | 5241 |
| 211 | Ga0157314_1001498 | 3300012500 | Bacteria | 1670 |
| 212 | Ga0157347_1000485 | 3300012502 | Bacteria | 2613 |
| 213 | Ga0157339_1003353 | 3300012505 | Bacteria | 1150 |
| 214 | Ga0157373_10000971 | 3300013100 | Bacteria | 22248 |
| 215 | Ga0157373_10048421 | 3300013100 | Bacteria | 3030 |
| 216 | Ga0157373_10067819 | 3300013100 | Bacteria | 2522 |
| 217 | Ga0157371_10011477 | 3300013102 | Bacteria | 6817 |
| 218 | Ga0157371_10060109 | 3300013102 | Bacteria | 2694 |
| 219 | Ga0157370_10012805 | 3300013104 | Bacteria | 8672 |
| 220 | Ga0157370_10013410 | 3300013104 | Bacteria | 8443 |
| 221 | Ga0157370_10014299 | 3300013104 | Bacteria | 8123 |
| 222 | Ga0157370_10027685 | 3300013104 | Bacteria | 5588 |
| 223 | Ga0157370_10036447 | 3300013104 | Bacteria | 4772 |
| 224 | Ga0157370_10115258 | 3300013104 | Bacteria | 2510 |
| 225 | Ga0157370_10128414 | 3300013104 | Bacteria | 2366 |
| 226 | Ga0157370_10290784 | 3300013104 | Bacteria | 1509 |
| 227 | Ga0157370_10799651 | 3300013104 | Bacteria | 858 |
| 228 | Ga0157369_10006739 | 3300013105 | Bacteria | 13255 |
| 229 | Ga0157369_10044986 | 3300013105 | Bacteria | 4803 |
| 230 | Ga0157369_10095621 | 3300013105 | Bacteria | 3169 |
| 231 | Ga0157369_10292162 | 3300013105 | Bacteria | 1697 |
| 232 | Ga0157369_10332336 | 3300013105 | Bacteria | 1579 |
| 233 | Ga0157369_10526319 | 3300013105 | Bacteria | 1223 |
| 234 | Ga0163162_10002846 | 3300013306 | Bacteria | 16475 |
| 235 | Ga0163162_10196314 | 3300013306 | Bacteria | 2147 |
| 236 | Ga0163162_10376773 | 3300013306 | Bacteria | 1552 |
| 237 | Ga0157372_10006610 | 3300013307 | Bacteria | 12337 |
| 238 | Ga0157372_10040415 | 3300013307 | Bacteria | 5152 |
| 239 | Ga0157372_10099833 | 3300013307 | Bacteria | 3312 |
| 240 | Ga0157372_10419630 | 3300013307 | Bacteria | 1559 |
| 241 | Ga0157372_10879822 | 3300013307 | Bacteria | 1040 |
| 242 | Ga0157375_10204716 | 3300013308 | Bacteria | 2130 |
| 243 | Ga0163163_11295194 | 3300014325 | Bacteria | 791 |
| 244 | Ga0157380_10323470 | 3300014326 | Bacteria | 1431 |
| 245 | Ga0182008_10004786 | 3300014497 | Bacteria | 7827 |
| 246 | Ga0182008_10029428 | 3300014497 | Bacteria | 2775 |
| 247 | Ga0182008_10041003 | 3300014497 | Bacteria | 2310 |
| 248 | Ga0182008_10047630 | 3300014497 | Bacteria | 2130 |
| 249 | Ga0157376_10510136 | 3300014969 | Bacteria | 1183 |
| 250 | Ga0182006_1000041 | 3300015261 | Bacteria | 203413 |
| 251 | Ga0182006_1000133 | 3300015261 | Bacteria | 80418 |
| 252 | Ga0182006_1017810 | 3300015261 | Bacteria | 3012 |
| 253 | Ga0182006_1070115 | 3300015261 | Bacteria | 1302 |
| 254 | Ga0182007_10022205 | 3300015262 | Bacteria | 2243 |
| 255 | Ga0182007_10029244 | 3300015262 | Bacteria | 1887 |
| 256 | Ga0182007_10085253 | 3300015262 | Bacteria | 1038 |
| 257 | Ga0182007_10360031 | 3300015262 | Bacteria | 548 |
| 258 | Ga0182005_1000257 | 3300015265 | Bacteria | 33567 |
| 259 | Ga0182005_1000685 | 3300015265 | Bacteria | 15850 |
| 260 | Ga0182005_1017371 | 3300015265 | Bacteria | 1992 |
| 261 | Ga0183369_1004 | 3300015685 | Bacteria | 539301 |
| 262 | Ga0183368_1002 | 3300015687 | Bacteria | 1865598 |
| 263 | Ga0163161_10002121 | 3300017792 | Bacteria | 14346 |
| 264 | Ga0163161_10089970 | 3300017792 | Bacteria | 2271 |
| 265 | Ga0197907_10549321 | 3300020069 | Bacteria | 1266 |
| 266 | Ga0206356_10106703 | 3300020070 | Bacteria | 602 |
| 267 | Ga0206349_1019390 | 3300020075 | Bacteria | 761 |
| 268 | Ga0206352_10038571 | 3300020078 | Bacteria | 850 |
| 269 | Ga0206350_11086872 | 3300020080 | Bacteria | 1328 |
| 270 | Ga0206354_10250520 | 3300020081 | Bacteria | 1343 |
| 271 | Ga0206354_11158424 | 3300020081 | Bacteria | 1308 |
| 272 | Ga0206353_12018004 | 3300020082 | Bacteria | 1402 |
| 273 | Ga0213872_10084492 | 3300021361 | Bacteria | 1423 |
| 274 | Ga0224712_10054345 | 3300022467 | Bacteria | 1571 |
| 275 | Ga0224712_10240571 | 3300022467 | Bacteria | 834 |
| 276 | Ga0209435_105809 | 3300025206 | Bacteria | 1382 |
| 277 | Ga0209435_127180 | 3300025206 | Bacteria | 526 |
| 278 | Ga0209760_100626 | 3300025207 | Bacteria | 6014 |
| 279 | Ga0209784_100053 | 3300025224 | Bacteria | 182075 |
| 280 | Ga0209566_103166 | 3300025225 | Bacteria | 2640 |
| 281 | Ga0209566_106075 | 3300025225 | Bacteria | 1454 |
| 282 | Ga0209674_100014 | 3300025226 | Bacteria | 704989 |
| 283 | Ga0209674_100197 | 3300025226 | Bacteria | 62877 |
| 284 | Ga0209674_100524 | 3300025226 | Bacteria | 15556 |
| 285 | Ga0209674_100550 | 3300025226 | Bacteria | 14925 |
| 286 | Ga0209674_101609 | 3300025226 | Bacteria | 5670 |
| 287 | Ga0209672_100004 | 3300025228 | Bacteria | 1467504 |
| 288 | Ga0209672_100008 | 3300025228 | Bacteria | 946876 |
| 289 | Ga0209672_100089 | 3300025228 | Bacteria | 120658 |
| 290 | Ga0209672_100826 | 3300025228 | Bacteria | 14489 |
| 291 | Ga0209672_100831 | 3300025228 | Bacteria | 14391 |
| 292 | Ga0209672_107708 | 3300025228 | Bacteria | 1638 |
| 293 | Ga0209563_100097 | 3300025230 | Bacteria | 159453 |
| 294 | Ga0207427_100051 | 3300025231 | Bacteria | 218792 |
| 295 | Ga0207427_100061 | 3300025231 | Bacteria | 182815 |
| 296 | Ga0207427_100177 | 3300025231 | Bacteria | 69113 |
| 297 | Ga0207427_102367 | 3300025231 | Bacteria | 5143 |
| 298 | Ga0207427_102424 | 3300025231 | Bacteria | 5047 |
| 299 | Ga0209437_100037 | 3300025233 | Bacteria | 459730 |
| 300 | Ga0209437_100152 | 3300025233 | Bacteria | 154551 |
| 301 | Ga0209437_100643 | 3300025233 | Bacteria | 20413 |
| 302 | Ga0209437_100682 | 3300025233 | Bacteria | 18176 |
| 303 | Ga0209437_102395 | 3300025233 | Bacteria | 3639 |
| 304 | Ga0209258_100003 | 3300025242 | Bacteria | 1467504 |
| 305 | Ga0209258_100004 | 3300025242 | Bacteria | 1376422 |
| 306 | Ga0209258_100008 | 3300025242 | Bacteria | 1009355 |
| 307 | Ga0209258_100090 | 3300025242 | Bacteria | 232619 |
| 308 | Ga0209258_100101 | 3300025242 | Bacteria | 210252 |
| 309 | Ga0209258_100138 | 3300025242 | Bacteria | 167495 |
| 310 | Ga0209258_100479 | 3300025242 | Bacteria | 42065 |
| 311 | Ga0209258_101864 | 3300025242 | Bacteria | 6364 |
| 312 | Ga0209646_1000605 | 3300025246 | Bacteria | 14339 |
| 313 | Ga0209646_1000808 | 3300025246 | Bacteria | 10638 |
| 314 | Ga0209646_1004736 | 3300025246 | Bacteria | 2453 |
| 315 | Ga0209026_1000064 | 3300025250 | Bacteria | 211303 |
| 316 | Ga0209026_1000104 | 3300025250 | Bacteria | 152614 |
| 317 | Ga0209026_1000143 | 3300025250 | Bacteria | 113602 |
| 318 | Ga0209026_1000294 | 3300025250 | Bacteria | 55402 |
| 319 | Ga0209026_1000384 | 3300025250 | Bacteria | 40186 |
| 320 | Ga0209026_1002853 | 3300025250 | Bacteria | 6099 |
| 321 | Ga0209026_1012227 | 3300025250 | Bacteria | 1506 |
| 322 | Ga0209677_103854 | 3300025253 | Bacteria | 4610 |
| 323 | Ga0209148_1000001 | 3300025254 | Bacteria | 2545271 |
| 324 | Ga0209148_1000002 | 3300025254 | Bacteria | 2399500 |
| 325 | Ga0209148_1000016 | 3300025254 | Bacteria | 804369 |
| 326 | Ga0209148_1000041 | 3300025254 | Bacteria | 469323 |
| 327 | Ga0209148_1000065 | 3300025254 | Bacteria | 344489 |
| 328 | Ga0209148_1000079 | 3300025254 | Bacteria | 288992 |
| 329 | Ga0209148_1002008 | 3300025254 | Bacteria | 7971 |
| 330 | Ga0209759_1000165 | 3300025256 | Bacteria | 113117 |
| 331 | Ga0209759_1000220 | 3300025256 | Bacteria | 87504 |
| 332 | Ga0209759_1000449 | 3300025256 | Bacteria | 47711 |
| 333 | Ga0209759_1009733 | 3300025256 | Bacteria | 2882 |
| 334 | Ga0209759_1013162 | 3300025256 | Bacteria | 2251 |
| 335 | Ga0209129_1001756 | 3300025258 | Bacteria | 11615 |
| 336 | Ga0209129_1006594 | 3300025258 | Bacteria | 3699 |
| 337 | Ga0209233_1000002 | 3300025261 | Bacteria | 2501366 |
| 338 | Ga0209233_1000099 | 3300025261 | Bacteria | 293995 |
| 339 | Ga0209233_1000237 | 3300025261 | Bacteria | 92427 |
| 340 | Ga0209233_1000554 | 3300025261 | Bacteria | 20406 |
| 341 | Ga0209233_1029613 | 3300025261 | Bacteria | 1299 |
| 342 | Ga0209233_1054791 | 3300025261 | Bacteria | 794 |
| 343 | Ga0209455_1000004 | 3300025272 | Bacteria | 1467504 |
| 344 | Ga0209455_1000007 | 3300025272 | Bacteria | 1157983 |
| 345 | Ga0209455_1000016 | 3300025272 | Bacteria | 753097 |
| 346 | Ga0209455_1000079 | 3300025272 | Bacteria | 268778 |
| 347 | Ga0209455_1000257 | 3300025272 | Bacteria | 62293 |
| 348 | Ga0209455_1002079 | 3300025272 | Bacteria | 8026 |
| 349 | Ga0209130_1003681 | 3300025284 | Bacteria | 6327 |
| 350 | Ga0209676_1000018 | 3300025292 | Bacteria | 631385 |
| 351 | Ga0209676_1000592 | 3300025292 | Bacteria | 54132 |
| 352 | Ga0209676_1000601 | 3300025292 | Bacteria | 53177 |
| 353 | Ga0209758_1000840 | 3300025297 | Bacteria | 42856 |
| 354 | Ga0209758_1032829 | 3300025297 | Bacteria | 2099 |
| 355 | Ga0209050_1003212 | 3300025298 | Bacteria | 12364 |
| 356 | Ga0209256_1002286 | 3300025299 | Bacteria | 16163 |
| 357 | Ga0209256_1008385 | 3300025299 | Bacteria | 4809 |
| 358 | Ga0207426_1040207 | 3300025302 | Bacteria | 1459 |
| 359 | Ga0209051_1009702 | 3300025303 | Bacteria | 4935 |
| 360 | Ga0209051_1026529 | 3300025303 | Bacteria | 2332 |
| 361 | Ga0209257_1000035 | 3300025304 | Bacteria | 631463 |
| 362 | Ga0209257_1000594 | 3300025304 | Bacteria | 60372 |
| 363 | Ga0207655_1094533 | 3300025728 | Bacteria | 1044 |
| 364 | Ga0207692_10051943 | 3300025898 | Bacteria | 2080 |
| 365 | Ga0207710_10010942 | 3300025900 | Bacteria | 3822 |
| 366 | Ga0207680_10000003 | 3300025903 | Bacteria | 925264 |
| 367 | Ga0207647_10000002 | 3300025904 | Bacteria | 400771 |
| 368 | Ga0207647_10003953 | 3300025904 | Bacteria | 11063 |
| 369 | Ga0207647_10004147 | 3300025904 | Bacteria | 10748 |
| 370 | Ga0207647_10011946 | 3300025904 | Bacteria | 6063 |
| 371 | Ga0207699_10604990 | 3300025906 | Bacteria | 798 |
| 372 | Ga0207705_10001085 | 3300025909 | Bacteria | 22127 |
| 373 | Ga0207705_10042118 | 3300025909 | Bacteria | 3278 |
| 374 | Ga0207705_11298696 | 3300025909 | Bacteria | 556 |
| 375 | Ga0207684_10413903 | 3300025910 | Bacteria | 1158 |
| 376 | Ga0207654_10135853 | 3300025911 | Bacteria | 1562 |
| 377 | Ga0207707_10002356 | 3300025912 | Bacteria | 17021 |
| 378 | Ga0207707_10003266 | 3300025912 | Bacteria | 14408 |
| 379 | Ga0207707_10012489 | 3300025912 | Bacteria | 7384 |
| 380 | Ga0207695_10000291 | 3300025913 | Bacteria | 124555 |
| 381 | Ga0207695_10004892 | 3300025913 | Bacteria | 18056 |
| 382 | Ga0207695_10006861 | 3300025913 | Bacteria | 14660 |
| 383 | Ga0207695_10075964 | 3300025913 | Bacteria | 3417 |
| 384 | Ga0207695_10201598 | 3300025913 | Bacteria | 1904 |
| 385 | Ga0207671_10000009 | 3300025914 | Bacteria | 724862 |
| 386 | Ga0207671_10041576 | 3300025914 | Bacteria | 3402 |
| 387 | Ga0207671_10235645 | 3300025914 | Bacteria | 1437 |
| 388 | Ga0207671_10764392 | 3300025914 | Bacteria | 767 |
| 389 | Ga0207693_10070023 | 3300025915 | Bacteria | 2745 |
| 390 | Ga0207693_10123816 | 3300025915 | Bacteria | 2031 |
| 391 | Ga0207660_11172860 | 3300025917 | Bacteria | 625 |
| 392 | Ga0207657_10030170 | 3300025919 | Bacteria | 4926 |
| 393 | Ga0207649_10011998 | 3300025920 | Bacteria | 4793 |
| 394 | Ga0207649_10016528 | 3300025920 | Bacteria | 4165 |
| 395 | Ga0207649_10498207 | 3300025920 | Bacteria | 926 |
| 396 | Ga0207652_10075881 | 3300025921 | Bacteria | 2930 |
| 397 | Ga0207694_10000336 | 3300025924 | Bacteria | 44443 |
| 398 | Ga0207694_10006052 | 3300025924 | Bacteria | 9256 |
| 399 | Ga0207694_10021419 | 3300025924 | Bacteria | 4899 |
| 400 | Ga0207694_10093538 | 3300025924 | Bacteria | 2375 |
| 401 | Ga0207694_10169233 | 3300025924 | Bacteria | 1769 |
| 402 | Ga0207694_10220975 | 3300025924 | Bacteria | 1545 |
| 403 | Ga0207700_10002997 | 3300025928 | Bacteria | 9735 |
| 404 | Ga0207700_10052810 | 3300025928 | Bacteria | 3041 |
| 405 | Ga0207700_10424411 | 3300025928 | Bacteria | 1168 |
| 406 | Ga0207664_10000499 | 3300025929 | Bacteria | 27964 |
| 407 | Ga0207664_10000670 | 3300025929 | Bacteria | 23513 |
| 408 | Ga0207690_10000499 | 3300025932 | Bacteria | 25369 |
| 409 | Ga0207690_10001115 | 3300025932 | Bacteria | 17127 |
| 410 | Ga0207690_10009857 | 3300025932 | Bacteria | 5673 |
| 411 | Ga0207690_10031552 | 3300025932 | Bacteria | 3392 |
| 412 | Ga0207690_10074232 | 3300025932 | Bacteria | 2355 |
| 413 | Ga0207690_10085128 | 3300025932 | Bacteria | 2218 |
| 414 | Ga0207709_10001882 | 3300025935 | Bacteria | 13876 |
| 415 | Ga0207709_10895144 | 3300025935 | Bacteria | 721 |
| 416 | Ga0207670_10000619 | 3300025936 | Bacteria | 19127 |
| 417 | Ga0207679_10372579 | 3300025945 | Bacteria | 1250 |
| 418 | Ga0207667_10000077 | 3300025949 | Bacteria | 166095 |
| 419 | Ga0207667_10000491 | 3300025949 | Bacteria | 52271 |
| 420 | Ga0207667_10002460 | 3300025949 | Bacteria | 23159 |
| 421 | Ga0207667_10383328 | 3300025949 | Bacteria | 1432 |
| 422 | Ga0207667_11033226 | 3300025949 | Bacteria | 808 |
| 423 | Ga0207712_10146852 | 3300025961 | Bacteria | 1816 |
| 424 | Ga0207668_10003459 | 3300025972 | Bacteria | 9267 |
| 425 | Ga0207640_10000380 | 3300025981 | Bacteria | 28559 |
| 426 | Ga0207640_10015746 | 3300025981 | Bacteria | 4383 |
| 427 | Ga0207640_10076772 | 3300025981 | Bacteria | 2269 |
| 428 | Ga0207640_10110266 | 3300025981 | Bacteria | 1949 |
| 429 | Ga0207640_11028750 | 3300025981 | Bacteria | 726 |
| 430 | Ga0207658_10239807 | 3300025986 | Bacteria | 1535 |
| 431 | Ga0207703_10256521 | 3300026035 | Bacteria | 1579 |
| 432 | Ga0207703_10291324 | 3300026035 | Bacteria | 1486 |
| 433 | Ga0207639_10008859 | 3300026041 | Bacteria | 6920 |
| 434 | Ga0207639_10310241 | 3300026041 | Bacteria | 1397 |
| 435 | Ga0207678_10088693 | 3300026067 | Bacteria | 2643 |
| 436 | Ga0207678_10168201 | 3300026067 | Bacteria | 1872 |
| 437 | Ga0207678_10314280 | 3300026067 | Bacteria | 1347 |
| 438 | Ga0207678_10399825 | 3300026067 | Bacteria | 1189 |
| 439 | Ga0207702_10000299 | 3300026078 | Bacteria | 57201 |
| 440 | Ga0207702_10000740 | 3300026078 | Bacteria | 34919 |
| 441 | Ga0207702_10681524 | 3300026078 | Bacteria | 1012 |
| 442 | Ga0207674_10000128 | 3300026116 | Bacteria | 88789 |
| 443 | Ga0207674_10040597 | 3300026116 | Bacteria | 4819 |
| 444 | Ga0207674_10330008 | 3300026116 | Bacteria | 1475 |
| 445 | Ga0207674_11455515 | 3300026116 | Bacteria | 654 |
| 446 | Ga0207683_10014874 | 3300026121 | Bacteria | 6627 |
| 447 | Ga0207698_10245269 | 3300026142 | Bacteria | 1635 |
| 448 | Ga0209371_1000018 | 3300027312 | Bacteria | 614700 |
| 449 | Ga0268266_10000011 | 3300028379 | Bacteria | 757403 |
| 450 | Ga0268266_10056320 | 3300028379 | Bacteria | 3382 |
| 451 | Ga0268265_10127875 | 3300028380 | Bacteria | 2106 |
| 452 | Ga0268264_10032087 | 3300028381 | Bacteria | 4310 |
| 453 | Ga0268264_10327205 | 3300028381 | Bacteria | 1451 |
| 454 | Ga0268256_1000016 | 3300030500 | Bacteria | 614700 |
| 455 | Ga0316176_1088322 | 3300030732 | Bacteria | 887 |
| 456 | Ga0265760_10066329 | 3300031090 | Bacteria | 1103 |
| 457 | Ga0265332_10271152 | 3300031238 | Bacteria | 701 |
| 458 | Ga0307408_100086899 | 3300031548 | Bacteria | 2351 |
| 459 | Ga0307405_10023448 | 3300031731 | Bacteria | 3507 |
| 460 | Ga0307405_10171222 | 3300031731 | Bacteria | 1549 |
| 461 | Ga0307406_10030241 | 3300031901 | Bacteria | 3287 |
| 462 | Ga0307407_10179616 | 3300031903 | Bacteria | 1402 |
| 463 | Ga0307412_10006273 | 3300031911 | Bacteria | 6712 |
| 464 | Ga0307412_10030790 | 3300031911 | Bacteria | 3383 |
| 465 | Ga0307409_100023226 | 3300031995 | Bacteria | 4292 |
| 466 | Ga0307416_100037916 | 3300032002 | Bacteria | 3713 |
| 467 | Ga0307414_10424305 | 3300032004 | Bacteria | 1160 |
| 468 | Ga0307510_10025234 | 3300033180 | Bacteria | 6859 |
| 469 | Ga0373933_0120026 | 3300035724 | Bacteria | 1646 |
| 470 | Ga0373947_0131280 | 3300035725 | Bacteria | 1599 |
| 471 | Ga0373937_0225514 | 3300036401 | Bacteria | 1764 |
| 472 | Ga0373925_0185546 | 3300037068 | Bacteria | 1649 |
| 473 | Ga0395899_0000313 | 3300037312 | Bacteria | 62233 |
| 474 | Ga0395899_0008130 | 3300037312 | Bacteria | 8081 |
| 475 | Ga0395899_0041326 | 3300037312 | Bacteria | 3445 |
| 476 | Ga0395900_0000011 | 3300037418 | Bacteria | 421926 |
| 477 | Ga0395900_0003994 | 3300037418 | Bacteria | 15756 |
| 478 | Ga0395900_0032143 | 3300037418 | Bacteria | 5394 |
| 479 | Ga0395900_0092654 | 3300037418 | Bacteria | 3104 |
| 480 | Ga0395898_0000013 | 3300037466 | Bacteria | 458788 |
| 481 | Ga0395898_0000058 | 3300037466 | Bacteria | 277701 |
| 482 | Ga0395898_0004893 | 3300037466 | Bacteria | 14544 |
| 483 | Ga0395898_0008343 | 3300037466 | Bacteria | 10951 |
| 484 | Ga0395898_0554457 | 3300037466 | Bacteria | 1091 |
| 485 | Ga0395905_0033957 | 3300037471 | Bacteria | 4791 |
| 486 | Ga0395905_0034566 | 3300037471 | Bacteria | 4747 |
| 487 | Ga0395901_0000201 | 3300038443 | Bacteria | 74798 |
| 488 | Ga0395901_0002392 | 3300038443 | Bacteria | 19071 |
| 489 | Ga0395901_0014897 | 3300038443 | Bacteria | 7901 |
| 490 | Ga0395901_0151570 | 3300038443 | Bacteria | 2436 |
| 491 | Ga0395901_0306831 | 3300038443 | Bacteria | 1644 |
| 492 | Ga0395901_0375264 | 3300038443 | Bacteria | 1464 |
| 493 | Ga0400483_003006 | 3300039062 | Bacteria | 1850 |
| 494 | Ga0436361_0026274 | 3300039447 | Bacteria | 2897 |
| 495 | Ga0436361_0188259 | 3300039447 | Bacteria | 21708 |
| 496 | Ga0436361_1172006 | 3300039447 | Bacteria | 945 |
| 497 | Ga0439436_0000004 | 3300041404 | Bacteria | 175137 |
| 498 | Ga0439465_0004169 | 3300041413 | Bacteria | 4703 |
| 499 | Ga0451791_0751358 | 3300041451 | Bacteria | 1179 |
| 500 | Ga0451793_1473683 | 3300041452 | Bacteria | 2126 |
| 501 | Ga0451797_1106049 | 3300041453 | Bacteria | 2527 |
| 502 | Ga0451807_0503423 | 3300041486 | Bacteria | 2384 |
| 503 | Ga0451837_0804861 | 3300041494 | Bacteria | 618 |
| 504 | Ga0451851_1268479 | 3300041507 | Bacteria | 616 |
| 505 | Ga0439437_004154 | 3300042000 | Bacteria | 1577 |
| 506 | Ga0439432_011961 | 3300042006 | Bacteria | 2982 |
| 507 | Ga0439455_0028996 | 3300042012 | Bacteria | 1366 |
| 508 | Ga0439459_0002347 | 3300042438 | Bacteria | 2907 |
| 509 | Ga0450901_000990 | 3300042533 | Bacteria | 3301 |
| 510 | Ga0466988_0161536 | 3300044536 | Bacteria | 1299 |
| 511 | Ga0466969_0000832 | 3300044656 | Bacteria | 16785 |
| 512 | Ga0466969_0029592 | 3300044656 | Bacteria | 2795 |
| 513 | Ga0466969_0031920 | 3300044656 | Bacteria | 2679 |
| 514 | Ga0466969_0066660 | 3300044656 | Bacteria | 1737 |
| 515 | Ga0466972_0020423 | 3300044658 | Bacteria | 3309 |
| 516 | Ga0466975_0306164 | 3300044661 | Bacteria | 1019 |
| 517 | Ga0466977_0304176 | 3300044666 | Bacteria | 964 |
| 518 | Ga0466982_0000001 | 3300044672 | Bacteria | 514662 |
| 519 | Ga0466982_0000938 | 3300044672 | Bacteria | 9779 |
| 520 | Ga0466965_0012502 | 3300044683 | Bacteria | 3994 |
| 521 | Ga0466965_0022464 | 3300044683 | Bacteria | 3040 |
| 522 | Ga0466965_0365194 | 3300044683 | Bacteria | 793 |
| 523 | Ga0466966_0004925 | 3300044684 | Bacteria | 8781 |
| 524 | Ga0466966_0008456 | 3300044684 | Bacteria | 6813 |
| 525 | Ga0466966_0021893 | 3300044684 | Bacteria | 4197 |
| 526 | Ga0466966_0024360 | 3300044684 | Bacteria | 3959 |
| 527 | Ga0466961_0001123 | 3300044693 | Bacteria | 16415 |
| 528 | Ga0466961_0002879 | 3300044693 | Bacteria | 10672 |
| 529 | Ga0466961_0010515 | 3300044693 | Bacteria | 5904 |
| 530 | Ga0466961_0023027 | 3300044693 | Bacteria | 4006 |
| 531 | Ga0466961_0063988 | 3300044693 | Bacteria | 2337 |
| 532 | Ga0466961_0172987 | 3300044693 | Bacteria | 1343 |
| 533 | Ga0466963_0319947 | 3300044694 | Bacteria | 1092 |
| 534 | Ga0466964_0001080 | 3300044706 | Bacteria | 9130 |
| 535 | Ga0453684_0041068 | 3300044712 | Bacteria | 6264 |
| 536 | Ga0466971_0000358 | 3300044719 | Bacteria | 17447 |
| 537 | Ga0466971_0024916 | 3300044719 | Bacteria | 2671 |
| 538 | Ga0466971_0105482 | 3300044719 | Bacteria | 1298 |
| 539 | Ga0466968_0000061 | 3300044735 | Bacteria | 31791 |
| 540 | Ga0466968_0019270 | 3300044735 | Bacteria | 2746 |
| 541 | Ga0466968_0105991 | 3300044735 | Bacteria | 1259 |
| 542 | Ga0466970_0003545 | 3300044765 | Bacteria | 7602 |
| 543 | Ga0466970_0028277 | 3300044765 | Bacteria | 2944 |
| 544 | Ga0466970_0105801 | 3300044765 | Bacteria | 1534 |
| 545 | Ga0466970_0167399 | 3300044765 | Bacteria | 1217 |
| 546 | Ga0466957_0001515 | 3300044842 | Bacteria | 12203 |
| 547 | Ga0466957_0003488 | 3300044842 | Bacteria | 8639 |
| 548 | Ga0466957_0014896 | 3300044842 | Bacteria | 4535 |
| 549 | Ga0466957_0694545 | 3300044842 | Bacteria | 718 |
| 550 | Ga0466960_0001294 | 3300044901 | Bacteria | 9082 |
| 551 | Ga0466959_0000072 | 3300045049 | Bacteria | 66935 |
| 552 | Ga0466959_0047563 | 3300045049 | Bacteria | 3155 |
| 553 | Ga0466959_0057445 | 3300045049 | Bacteria | 2836 |
| 554 | Ga0466959_0118449 | 3300045049 | Bacteria | 1884 |
| 555 | Ga0466959_0181321 | 3300045049 | Bacteria | 1472 |
| 556 | Ga0466959_0736677 | 3300045049 | Bacteria | 660 |
| 557 | Ga0451576_0316807 | 3300045051 | Bacteria | 1632 |
| 558 | Ga0466958_0016010 | 3300045836 | Bacteria | 4311 |
| 559 | Ga0466958_0053133 | 3300045836 | Bacteria | 2457 |
| 560 | Ga0466958_0071222 | 3300045836 | Bacteria | 2129 |
| 561 | Ga0466958_0102175 | 3300045836 | Bacteria | 1783 |
| 562 | Ga0466958_0147809 | 3300045836 | Bacteria | 1481 |
| 563 | Ga0466967_0042580 | 3300045976 | Bacteria | 3925 |
| 564 | Ga0466967_0329202 | 3300045976 | Bacteria | 1475 |
| 565 | Ga0495617_000085 | 3300046452 | Bacteria | 67837 |
| 566 | Ga0495617_000550 | 3300046452 | Bacteria | 19362 |
| 567 | Ga0495627_101812 | 3300046453 | Bacteria | 819 |
| 568 | Ga0495638_0000236 | 3300046460 | Bacteria | 75732 |
| 569 | Ga0495638_0000290 | 3300046460 | Bacteria | 66116 |
| 570 | Ga0495638_0000754 | 3300046460 | Bacteria | 34482 |
| 571 | Ga0495638_0001087 | 3300046460 | Bacteria | 26471 |
| 572 | Ga0495641_0459239 | 3300046461 | Bacteria | 580 |
| 573 | Ga0495650_0000191 | 3300046471 | Bacteria | 132016 |
| 574 | Ga0495650_0000210 | 3300046471 | Bacteria | 125249 |
| 575 | Ga0495650_0007083 | 3300046471 | Bacteria | 6810 |
| 576 | Ga0495650_0016818 | 3300046471 | Bacteria | 3686 |
| 577 | Ga0495580_1002082 | 3300046472 | Bacteria | 532 |
| 578 | Ga0495605_0108397 | 3300046474 | Bacteria | 1270 |
| 579 | Ga0495584_0001936 | 3300046491 | Bacteria | 11904 |
| 580 | Ga0495585_0005239 | 3300046492 | Bacteria | 8215 |
| 581 | Ga0495585_0045531 | 3300046492 | Bacteria | 2448 |
| 582 | Ga0495607_0000006 | 3300046501 | Bacteria | 281664 |
| 583 | Ga0495607_0000131 | 3300046501 | Bacteria | 80259 |
| 584 | Ga0495607_0054911 | 3300046501 | Bacteria | 2294 |
| 585 | Ga0495606_0000016 | 3300046507 | Bacteria | 284865 |
| 586 | Ga0495606_0001253 | 3300046507 | Bacteria | 35422 |
| 587 | Ga0495606_0001443 | 3300046507 | Bacteria | 31874 |
| 588 | Ga0495606_0005058 | 3300046507 | Bacteria | 12831 |
| 589 | Ga0495606_0031226 | 3300046507 | Bacteria | 3707 |
| 590 | Ga0495606_0262916 | 3300046507 | Bacteria | 951 |
| 591 | Ga0495610_0002949 | 3300046512 | Bacteria | 13726 |
| 592 | Ga0495610_0089717 | 3300046512 | Bacteria | 1395 |
| 593 | Ga0495616_0000401 | 3300046513 | Bacteria | 33353 |
| 594 | Ga0495616_0015631 | 3300046513 | Bacteria | 4216 |
| 595 | Ga0495620_0000365 | 3300046515 | Bacteria | 31131 |
| 596 | Ga0495620_0131360 | 3300046515 | Bacteria | 982 |
| 597 | Ga0495631_0009431 | 3300046518 | Bacteria | 4878 |
| 598 | Ga0495631_0020021 | 3300046518 | Bacteria | 3131 |
| 599 | Ga0495632_0000531 | 3300046519 | Bacteria | 36042 |
| 600 | Ga0495632_0007769 | 3300046519 | Bacteria | 6686 |
| 601 | Ga0495637_0006532 | 3300046520 | Bacteria | 5842 |
| 602 | Ga0495643_0037770 | 3300046522 | Bacteria | 2647 |
| 603 | Ga0495648_0000878 | 3300046524 | Bacteria | 31691 |
| 604 | Ga0495648_0031592 | 3300046524 | Bacteria | 3484 |
| 605 | Ga0495609_0004007 | 3300046538 | Bacteria | 8223 |
| 606 | Ga0495622_0013844 | 3300046557 | Bacteria | 3742 |
| 607 | Ga0495633_0002208 | 3300046558 | Bacteria | 13932 |
| 608 | Ga0495668_0004627 | 3300046616 | Bacteria | 9669 |
| 609 | Ga0495611_0000002 | 3300046648 | Bacteria | 705677 |
| 610 | Ga0495611_0006414 | 3300046648 | Bacteria | 5013 |
| 611 | Ga0495625_0000002 | 3300046660 | Bacteria | 813323 |
| 612 | Ga0495625_0013448 | 3300046660 | Bacteria | 6578 |
| 613 | Ga0495625_0024105 | 3300046660 | Bacteria | 4637 |
| 614 | Ga0495625_0429785 | 3300046660 | Bacteria | 819 |
| 615 | Ga0495661_0046789 | 3300046665 | Bacteria | 2639 |
| 616 | Ga0495661_0142491 | 3300046665 | Bacteria | 1302 |
| 617 | Ga0495670_0000227 | 3300046691 | Bacteria | 25531 |
| 618 | Ga0495670_0002779 | 3300046691 | Bacteria | 8651 |
| 619 | Ga0495670_0125706 | 3300046691 | Bacteria | 1334 |
| 620 | Ga0495671_0002392 | 3300046692 | Bacteria | 11895 |
| 621 | Ga0495649_0000450 | 3300046694 | Bacteria | 35527 |
| 622 | Ga0495649_0003337 | 3300046694 | Bacteria | 10892 |
| 623 | Ga0495589_0000190 | 3300046794 | Bacteria | 54374 |
| 624 | Ga0495660_0000437 | 3300046810 | Bacteria | 34919 |
| 625 | Ga0495660_0000447 | 3300046810 | Bacteria | 34412 |
| 626 | Ga0495676_0294856 | 3300047321 | Bacteria | 1095 |
| 627 | Ga0495683_0000679 | 3300047323 | Bacteria | 25118 |
| 628 | Ga0495679_000003 | 3300047446 | Bacteria | 787868 |
| 629 | Ga0495673_0000004 | 3300047469 | Bacteria | 1354526 |
| 630 | Ga0495673_0000062 | 3300047469 | Bacteria | 226461 |
| 631 | Ga0495673_0014368 | 3300047469 | Bacteria | 4119 |
| 632 | Ga0495681_0098538 | 3300047470 | Bacteria | 1281 |
| 633 | Ga0495686_0000426 | 3300047472 | Bacteria | 66285 |
| 634 | Ga0495686_0001228 | 3300047472 | Bacteria | 29296 |
| 635 | Ga0495686_0028923 | 3300047472 | Bacteria | 3607 |
| 636 | Ga0496100_0034642 | 3300048903 | Bacteria | 3170 |
| 637 | Ga0496101_0000807 | 3300048904 | Bacteria | 18486 |
| 638 | Ga0496102_0417674 | 3300048905 | Bacteria | 1260 |
| 639 | Ga0496104_0090411 | 3300048907 | Bacteria | 2925 |
| 640 | Ga0496105_0002876 | 3300048908 | Bacteria | 12611 |
| 641 | Ga0496106_0000168 | 3300048909 | Bacteria | 47597 |
| 642 | Ga0496106_0119136 | 3300048909 | Bacteria | 2062 |
| 643 | Ga0496107_0260702 | 3300048910 | Bacteria | 1290 |
| 644 | Ga0496113_0006282 | 3300048916 | Bacteria | 7514 |
| 645 | Ga0496114_0575194 | 3300048917 | Bacteria | 994 |
| 646 | Ga0496115_0000095 | 3300048918 | Bacteria | 82835 |
| 647 | Ga0496115_0002018 | 3300048918 | Bacteria | 14510 |
| 648 | Ga0496115_0029277 | 3300048918 | Bacteria | 4324 |
| 649 | Ga0496115_0291179 | 3300048918 | Bacteria | 1339 |
| 650 | Ga0496116_0001905 | 3300048919 | Bacteria | 22494 |
| 651 | Ga0496116_0117442 | 3300048919 | Bacteria | 1548 |
| 652 | Ga0496117_0015396 | 3300048920 | Bacteria | 6522 |
| 653 | Ga0496117_0054835 | 3300048920 | Bacteria | 2789 |
| 654 | Ga0496117_0105616 | 3300048920 | Bacteria | 1770 |
| 655 | Ga0496118_0002160 | 3300048921 | Bacteria | 27394 |
| 656 | Ga0496118_0003450 | 3300048921 | Bacteria | 19899 |
| 657 | Ga0496118_0008228 | 3300048921 | Bacteria | 10822 |
| 658 | Ga0496118_0050850 | 3300048921 | Bacteria | 3175 |
| 659 | Ga0496119_0000966 | 3300048922 | Bacteria | 36886 |
| 660 | Ga0496119_0008465 | 3300048922 | Bacteria | 9030 |
| 661 | Ga0496119_0026020 | 3300048922 | Bacteria | 4069 |
| 662 | Ga0496120_0000409 | 3300048923 | Bacteria | 68984 |
| 663 | Ga0496120_0001143 | 3300048923 | Bacteria | 34091 |
| 664 | Ga0496121_0000116 | 3300048924 | Bacteria | 177260 |
| 665 | Ga0496121_0004519 | 3300048924 | Bacteria | 18628 |
| 666 | Ga0496121_0005025 | 3300048924 | Bacteria | 17293 |
| 667 | Ga0496121_0005906 | 3300048924 | Bacteria | 15493 |
| 668 | Ga0496121_0009013 | 3300048924 | Bacteria | 11564 |
| 669 | Ga0496121_0024979 | 3300048924 | Bacteria | 5691 |
| 670 | Ga0496121_0034038 | 3300048924 | Bacteria | 4594 |
| 671 | Ga0496121_0059838 | 3300048924 | Bacteria | 3138 |
| 672 | Ga0496121_0510861 | 3300048924 | Bacteria | 760 |
| 673 | Ga0496122_0026416 | 3300048925 | Bacteria | 5006 |
| 674 | Ga0496122_0097560 | 3300048925 | Bacteria | 1977 |
| 675 | Ga0496122_0374085 | 3300048925 | Bacteria | 734 |
| 676 | Ga0496123_0021108 | 3300048926 | Bacteria | 5072 |
| 677 | Ga0496123_0021504 | 3300048926 | Bacteria | 5011 |
| 678 | Ga0496123_0023563 | 3300048926 | Bacteria | 4708 |
| 679 | Ga0496124_0006663 | 3300048927 | Bacteria | 12525 |
| 680 | Ga0496124_0013344 | 3300048927 | Bacteria | 8028 |
| 681 | Ga0496124_0071614 | 3300048927 | Bacteria | 2872 |
| 682 | Ga0496125_0000088 | 3300048928 | Bacteria | 214942 |
| 683 | Ga0496125_0085003 | 3300048928 | Bacteria | 2399 |
| 684 | Ga0496125_0150581 | 3300048928 | Bacteria | 1599 |
| 685 | Ga0496125_0340036 | 3300048928 | Bacteria | 901 |
| 686 | Ga0496126_0006276 | 3300048929 | Bacteria | 13272 |
| 687 | Ga0496126_0010165 | 3300048929 | Bacteria | 9906 |
| 688 | Ga0496126_0049430 | 3300048929 | Bacteria | 3839 |
| 689 | Ga0496126_0068718 | 3300048929 | Bacteria | 3162 |
| 690 | Ga0496126_0596706 | 3300048929 | Bacteria | 870 |
| 691 | Ga0496126_0768188 | 3300048929 | Bacteria | 742 |
| 692 | Ga0495678_000019 | 3300049459 | Bacteria | 269723 |
| 693 | Ga0495678_026942 | 3300049459 | Bacteria | 2445 |
| 694 | Ga0495682_0001620 | 3300049460 | Bacteria | 11602 |
| 695 | Ga0495682_0009177 | 3300049460 | Bacteria | 3871 |
| 696 | Ga0501031_0094212 | 3300049568 | Bacteria | 1954 |
| 697 | Ga0501032_0103960 | 3300049569 | Bacteria | 1881 |
| 698 | Ga0501033_0005277 | 3300049570 | Bacteria | 10253 |
| 699 | Ga0501033_0009344 | 3300049570 | Bacteria | 7549 |
| 700 | Ga0501033_0021541 | 3300049570 | Bacteria | 4862 |
| 701 | Ga0501034_0023334 | 3300049571 | Bacteria | 6305 |
| 702 | Ga0501034_0045115 | 3300049571 | Bacteria | 4455 |
| 703 | Ga0501034_0045969 | 3300049571 | Bacteria | 4411 |
| 704 | Ga0501034_0046998 | 3300049571 | Bacteria | 4360 |
| 705 | Ga0501036_0113556 | 3300049572 | Bacteria | 2289 |
| 706 | Ga0501036_0119167 | 3300049572 | Bacteria | 2229 |
| 707 | Ga0501037_0017102 | 3300049573 | Bacteria | 5337 |
| 708 | Ga0501037_0105161 | 3300049573 | Bacteria | 2034 |
| 709 | Ga0501037_0125713 | 3300049573 | Bacteria | 1841 |
| 710 | Ga0501038_0025505 | 3300049574 | Bacteria | 5268 |
| 711 | Ga0501039_0053215 | 3300049575 | Bacteria | 3132 |
| 712 | Ga0501040_0236655 | 3300049576 | Bacteria | 1301 |
| 713 | Ga0501042_0067633 | 3300049578 | Bacteria | 2554 |
| 714 | Ga0501043_0019693 | 3300049579 | Bacteria | 5299 |
| 715 | Ga0501043_0036109 | 3300049579 | Bacteria | 3887 |
| 716 | Ga0501043_0049136 | 3300049579 | Bacteria | 3316 |
| 717 | Ga0501043_0051472 | 3300049579 | Bacteria | 3236 |
| 718 | Ga0501046_0015963 | 3300049580 | Bacteria | 6298 |
| 719 | Ga0501047_0013749 | 3300049581 | Bacteria | 7686 |
| 720 | Ga0501047_0060398 | 3300049581 | Bacteria | 3658 |
| 721 | Ga0501047_1149526 | 3300049581 | Bacteria | 590 |
| 722 | Ga0501048_0090878 | 3300049582 | Bacteria | 2153 |
| 723 | Ga0501048_0599385 | 3300049582 | Bacteria | 791 |
| 724 | Ga0501067_0198405 | 3300049583 | Bacteria | 1118 |
| 725 | Ga0501070_0050469 | 3300049586 | Bacteria | 3454 |
| 726 | Ga0501070_0223882 | 3300049586 | Bacteria | 1542 |
| 727 | Ga0501073_0043570 | 3300049589 | Bacteria | 3165 |
| 728 | Ga0501077_0757601 | 3300049593 | Bacteria | 624 |
| 729 | Ga0501235_133586 | 3300049669 | Bacteria | 630 |
| 730 | Ga0501079_0129119 | 3300049741 | Bacteria | 1967 |
| 731 | Ga0501080_0032186 | 3300049742 | Bacteria | 4889 |
| 732 | Ga0501083_0244603 | 3300049744 | Bacteria | 1168 |
| 733 | Ga0501035_0013687 | 3300049822 | Bacteria | 7485 |
| 734 | Ga0501035_0024637 | 3300049822 | Bacteria | 5517 |
| 735 | Ga0501035_0037095 | 3300049822 | Bacteria | 4415 |
| 736 | Ga0501035_0275331 | 3300049822 | Bacteria | 1423 |
| 737 | Ga0501035_0333309 | 3300049822 | Bacteria | 1273 |
| 738 | Ga0501044_0017049 | 3300049823 | Bacteria | 7794 |
| 739 | Ga0501044_0050029 | 3300049823 | Bacteria | 4314 |
| 740 | Ga0501044_0068761 | 3300049823 | Bacteria | 3607 |
| 741 | Ga0501044_0140755 | 3300049823 | Bacteria | 2401 |
| 742 | Ga0501044_0530805 | 3300049823 | Bacteria | 1076 |
| 743 | nmdc:mga00v17_25_c1 | 3300050491 | Bacteria | 101679 |
| 744 | nmdc:mga0k408_434685_c1 | 3300050493 | Bacteria | 780 |
| 745 | nmdc:mga07m45_4934_c1 | 3300050496 | Bacteria | 6574 |
| 746 | nmdc:mga05p37_8922_c1 | 3300050507 | Bacteria | 11851 |
| 747 | nmdc:mga09592_485568_c1 | 3300050508 | Bacteria | 1064 |
| 748 | nmdc:mga0qj67_1232157_c1 | 3300050509 | Bacteria | 581 |
| 749 | nmdc:mga0qj67_179968_c1 | 3300050509 | Bacteria | 1717 |
| 750 | nmdc:mga06r32_18031_c1 | 3300050510 | Bacteria | 6455 |
| 751 | nmdc:mga0n895_57402_c1 | 3300050512 | Bacteria | 3837 |
| 752 | nmdc:mga0sz30_11202_c1 | 3300050516 | Bacteria | 3455 |
| 753 | Ga0500643_000101 | 3300053087 | Bacteria | 88318 |
| 754 | Ga0500646_0018922 | 3300053090 | Bacteria | 1818 |
| 755 | Ga0500555_000584 | 3300053103 | Bacteria | 14374 |
| 756 | Ga0500607_000007 | 3300053121 | Bacteria | 134097 |
| 757 | Ga0500559_0001214 | 3300053136 | Bacteria | 15283 |
| 758 | Ga0500604_0080094 | 3300053151 | Bacteria | 1054 |
| 759 | Ga0500633_0054274 | 3300053160 | Bacteria | 1392 |
| 760 | Ga0500637_0016186 | 3300053178 | Bacteria | 3971 |
| 761 | Ga0500645_014997 | 3300053730 | Bacteria | 2462 |
| 762 | Ga0500645_040269 | 3300053730 | Bacteria | 1382 |
| 763 | Ga0587080_068454 | 3300059503 | Bacteria | 706 |
| 764 | Ga0587090_031824 | 3300059510 | Bacteria | 886 |
| 765 | Ga0587069_105280 | 3300059642 | Bacteria | 581 |
| 766 | Ga0587076_034795 | 3300059645 | Bacteria | 912 |
| 767 | Ga0587076_158354 | 3300059645 | Bacteria | 555 |
| 768 | Ga0587078_037146 | 3300059646 | Bacteria | 677 |
| 769 | Ga0587111_0200159 | 3300060346 | Bacteria | 566 |
| 770 | Ga0501082_0923000 | 3300060353 | Bacteria | 764 |
| 771 | Ga0466962_0015079 | 3300061719 | Bacteria | 3726 |
| 772 | Ga0530510_0537885 | 3300061734 | Bacteria | 887 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2537561836 | 2538833447 | 152 |
| 2 | iso_pu_bacteria | 2547132130 | 2547499947 | 152 |
| 3 | iso_pu_bacteria | 2547132130 | 2547503136 | 152 |
| 4 | iso_pu_bacteria | 2576861471 | 2578456664 | 152 |
| 5 | iso_pu_bacteria | 2643221562 | 2643831800 | 152 |
| 6 | iso_pu_bacteria | 2643221577 | 2643896008 | 152 |
| 7 | iso_pu_bacteria | 2643221685 | 2644478215 | 152 |
| 8 | iso_pu_bacteria | 2739367700 | 2739733231 | 152 |
| 9 | iso_pu_bacteria | 2747842428 | 2747949056 | 152 |
| 10 | iso_pu_bacteria | 2747842501 | 2748017401 | 152 |
| 11 | iso_pu_bacteria | 2765235840 | 2765580821 | 152 |
| 12 | iso_pu_bacteria | 2816332141 | 2816518189 | 152 |
| 13 | iso_pu_bacteria | 2818991457 | 2819662224 | 152 |
| 14 | iso_pu_bacteria | 2842391507 | 2842395147 | 152 |
| 15 | iso_pu_bacteria | 2842757796 | 2842760961 | 152 |
| 16 | iso_pu_bacteria | 2852649853 | 2852651867 | 152 |
| 17 | iso_pu_bacteria | 2852684882 | 2852688075 | 152 |
| 18 | iso_pu_bacteria | 2857442823 | 2857444900 | 152 |
| 19 | iso_pu_bacteria | 2874220319 | 2874223467 | 152 |
| 20 | iso_pu_bacteria | 2884411467 | 2884415673 | 152 |
| 21 | iso_pu_bacteria | 2895395659 | 2895395845 | 152 |
| 22 | iso_pu_bacteria | 2919089067 | 2919092229 | 152 |
| 23 | iso_pu_bacteria | 2919130084 | 2919132865 | 152 |
| 24 | iso_pu_bacteria | 2919134579 | 2919136720 | 152 |
| 25 | iso_pu_bacteria | 2928496128 | 2928497149 | 152 |
| 26 | iso_pu_bacteria | 2928963466 | 2928966964 | 152 |
| 27 | iso_pu_bacteria | 2929195423 | 2929199498 | 152 |
| 28 | iso_pu_bacteria | 2931380184 | 2931383121 | 152 |
| 29 | iso_pu_bacteria | 2937610967 | 2937614052 | 152 |
| 30 | iso_pu_bacteria | 2939589442 | 2939590103 | 152 |
| 31 | iso_pu_bacteria | 2939611941 | 2939613818 | 152 |
| 32 | iso_pu_bacteria | 2939622612 | 2939623724 | 152 |
| 33 | iso_pu_bacteria | 2939626828 | 2939630817 | 152 |
| 34 | iso_pu_bacteria | 2941475908 | 2941478504 | 152 |
| 35 | iso_pu_bacteria | 2961047084 | 2961050231 | 152 |
| 36 | iso_pu_bacteria | 2961064222 | 2961064622 | 152 |
| 37 | iso_pu_bacteria | 2974307012 | 2974307295 | 152 |
| 38 | iso_pu_bacteria | 2977247770 | 2977248041 | 152 |
| 39 | iso_pu_bacteria | 2984514374 | 2984517504 | 152 |
| 40 | iso_pu_bacteria | 2987605356 | 2987606541 | 152 |
| 41 | iso_pu_bacteria | 8021622325 | 8021622777 | 152 |
| 42 | iso_pu_bacteria | 8021626552 | 8021626651 | 152 |
| 43 | iso_pu_bacteria | 8021648035 | 8021651667 | 152 |
| 44 | iso_pu_bacteria | 2526164512 | 2526210851 | 154 |
| 45 | iso_pu_bacteria | 2565956521 | 2566037991 | 154 |
| 46 | 3300031903 | Ga0307407_10179616 | Ga0307407_101796162 | 155 |
| 47 | 3300037312 | Ga0395899_0008130 | Ga0395899_0008130_6321_6788 | 155 |
| 48 | 3300037312 | Ga0395899_0041326 | Ga0395899_0041326_2504_2971 | 155 |
| 49 | 3300037418 | Ga0395900_0003994 | Ga0395900_0003994_1599_2066 | 155 |
| 50 | 3300037418 | Ga0395900_0032143 | Ga0395900_0032143_712_1179 | 155 |
| 51 | 3300037418 | Ga0395900_0092654 | Ga0395900_0092654_1915_2382 | 155 |
| 52 | 3300037466 | Ga0395898_0004893 | Ga0395898_0004893_12925_13392 | 155 |
| 53 | 3300037466 | Ga0395898_0554457 | Ga0395898_0554457_517_984 | 155 |
| 54 | 3300037471 | Ga0395905_0033957 | Ga0395905_0033957_4220_4687 | 155 |
| 55 | 3300038443 | Ga0395901_0002392 | Ga0395901_0002392_4501_4968 | 155 |
| 56 | 3300038443 | Ga0395901_0306831 | Ga0395901_0306831_455_922 | 155 |
| 57 | iso_pu_bacteria | 2593339238 | 2595448887 | 155 |
| 58 | iso_pu_bacteria | 2593339239 | 2595450582 | 155 |
| 59 | iso_pu_bacteria | 2718218334 | 2721025497 | 155 |
| 60 | iso_pu_bacteria | 2734482264 | 2735834530 | 155 |
| 61 | iso_pu_bacteria | 2738543009 | 2739225981 | 155 |
| 62 | iso_pu_bacteria | 2818991440 | 2819564802 | 155 |
| 63 | iso_pu_bacteria | 2828305725 | 2828309461 | 155 |
| 64 | iso_pu_bacteria | 2842914999 | 2842915719 | 155 |
| 65 | iso_pu_bacteria | 2842918807 | 2842920949 | 155 |
| 66 | iso_pu_bacteria | 2884338543 | 2884338841 | 155 |
| 67 | iso_pu_bacteria | 2904463128 | 2904465678 | 155 |
| 68 | iso_pu_bacteria | 2919085039 | 2919086466 | 155 |
| 69 | iso_pu_bacteria | 2919404418 | 2919407494 | 155 |
| 70 | iso_pu_bacteria | 2941471342 | 2941472028 | 155 |
| 71 | iso_pu_bacteria | 2953994433 | 2953996219 | 155 |
| 72 | 3300001979 | JGI24740J21852_10006437 | JGI24740J21852_100064376 | 156 |
| 73 | 3300001989 | JGI24739J22299_10005117 | JGI24739J22299_100051175 | 156 |
| 74 | 3300001990 | JGI24737J22298_10003429 | JGI24737J22298_100034297 | 156 |
| 75 | 3300001990 | JGI24737J22298_10007318 | JGI24737J22298_100073186 | 156 |
| 76 | 3300001990 | JGI24737J22298_10042862 | JGI24737J22298_100428622 | 156 |
| 77 | 3300002067 | JGI24735J21928_10004506 | JGI24735J21928_100045064 | 156 |
| 78 | 3300002067 | JGI24735J21928_10007432 | JGI24735J21928_100074324 | 156 |
| 79 | 3300002075 | JGI24738J21930_10065776 | JGI24738J21930_100657761 | 156 |
| 80 | 3300002705 | JGI25156J39149_1006761 | JGI25156J39149_10067612 | 156 |
| 81 | 3300002705 | JGI25156J39149_1022847 | JGI25156J39149_10228472 | 156 |
| 82 | 3300002737 | JGI25162J39368_1000115 | JGI25162J39368_100011542 | 156 |
| 83 | 3300002737 | JGI25162J39368_1000402 | JGI25162J39368_100040218 | 156 |
| 84 | 3300002737 | JGI25162J39368_1003198 | JGI25162J39368_10031986 | 156 |
| 85 | 3300002737 | JGI25162J39368_1004010 | JGI25162J39368_10040106 | 156 |
| 86 | 3300002738 | JGI25154J39366_1006347 | JGI25154J39366_10063472 | 156 |
| 87 | 3300002741 | JGI25157J39369_1000132 | JGI25157J39369_100013212 | 156 |
| 88 | 3300002741 | JGI25157J39369_1000313 | JGI25157J39369_10003134 | 156 |
| 89 | 3300002741 | JGI25157J39369_1000344 | JGI25157J39369_100034410 | 156 |
| 90 | 3300002741 | JGI25157J39369_1000452 | JGI25157J39369_100045212 | 156 |
| 91 | 3300002741 | JGI25157J39369_1000453 | JGI25157J39369_10004537 | 156 |
| 92 | 3300002741 | JGI25157J39369_1003094 | JGI25157J39369_10030942 | 156 |
| 93 | 3300002771 | JGI25163J39215_1000758 | JGI25163J39215_10007581 | 156 |
| 94 | 3300002772 | JGI25164J39214_1000090 | JGI25164J39214_100009034 | 156 |
| 95 | 3300002772 | JGI25164J39214_1000117 | JGI25164J39214_100011751 | 156 |
| 96 | 3300002772 | JGI25164J39214_1000522 | JGI25164J39214_10005224 | 156 |
| 97 | 3300002772 | JGI25164J39214_1001570 | JGI25164J39214_10015704 | 156 |
| 98 | 3300003214 | JGI25165J46597_1000194 | JGI25165J46597_100019447 | 156 |
| 99 | 3300003214 | JGI25165J46597_1000235 | JGI25165J46597_100023550 | 156 |
| 100 | 3300003214 | JGI25165J46597_1002775 | JGI25165J46597_10027756 | 156 |
| 101 | 3300003320 | rootH2_10001214 | rootH2_100012148 | 156 |
| 102 | 3300003578 | Ga0006562J51391_1003311 | Ga0006562J51391_10033113 | 156 |
| 103 | 3300003751 | Ga0055538_1002959 | Ga0055538_10029593 | 156 |
| 104 | 3300003756 | Ga0055533_1001362 | Ga0055533_10013624 | 156 |
| 105 | 3300003756 | Ga0055533_1001537 | Ga0055533_10015375 | 156 |
| 106 | 3300003756 | Ga0055533_1007754 | Ga0055533_10077542 | 156 |
| 107 | 3300003759 | Ga0055525_1000082 | Ga0055525_1000082107 | 156 |
| 108 | 3300003760 | Ga0055527_1000176 | Ga0055527_100017616 | 156 |
| 109 | 3300003760 | Ga0055527_1000179 | Ga0055527_100017916 | 156 |
| 110 | 3300003760 | Ga0055527_1005250 | Ga0055527_10052502 | 156 |
| 111 | 3300003761 | Ga0055535_1000106 | Ga0055535_100010634 | 156 |
| 112 | 3300003761 | Ga0055535_1000373 | Ga0055535_100037316 | 156 |
| 113 | 3300003761 | Ga0055535_1000405 | Ga0055535_100040512 | 156 |
| 114 | 3300003761 | Ga0055535_1000487 | Ga0055535_10004874 | 156 |
| 115 | 3300003761 | Ga0055535_1001357 | Ga0055535_100135712 | 156 |
| 116 | 3300003761 | Ga0055535_1001457 | Ga0055535_10014572 | 156 |
| 117 | 3300003761 | Ga0055535_1001699 | Ga0055535_10016992 | 156 |
| 118 | 3300003762 | Ga0055542_1000150 | Ga0055542_100015042 | 156 |
| 119 | 3300003762 | Ga0055542_1000245 | Ga0055542_100024530 | 156 |
| 120 | 3300003762 | Ga0055542_1000394 | Ga0055542_100039430 | 156 |
| 121 | 3300003762 | Ga0055542_1000429 | Ga0055542_100042914 | 156 |
| 122 | 3300003762 | Ga0055542_1000431 | Ga0055542_100043111 | 156 |
| 123 | 3300003762 | Ga0055542_1000734 | Ga0055542_100073413 | 156 |
| 124 | 3300003763 | Ga0055529_1000168 | Ga0055529_100016847 | 156 |
| 125 | 3300003763 | Ga0055529_1000178 | Ga0055529_100017835 | 156 |
| 126 | 3300003763 | Ga0055529_1000314 | Ga0055529_100031429 | 156 |
| 127 | 3300003763 | Ga0055529_1000420 | Ga0055529_100042030 | 156 |
| 128 | 3300003763 | Ga0055529_1000428 | Ga0055529_100042831 | 156 |
| 129 | 3300003781 | Ga0055536_1000766 | Ga0055536_100076617 | 156 |
| 130 | 3300003781 | Ga0055536_1000908 | Ga0055536_100090816 | 156 |
| 131 | 3300003791 | Ga0055530_10002816 | Ga0055530_100028161 | 156 |
| 132 | 3300003792 | Ga0055540_1020526 | Ga0055540_10205264 | 156 |
| 133 | 3300003794 | Ga0055531_10005486 | Ga0055531_100054865 | 156 |
| 134 | 3300003856 | Ga0058692_1000004 | Ga0058692_1000004123 | 156 |
| 135 | 3300005289 | Ga0065704_10041565 | Ga0065704_100415652 | 156 |
| 136 | 3300005327 | Ga0070658_10153551 | Ga0070658_101535515 | 156 |
| 137 | 3300005329 | Ga0070683_100587141 | Ga0070683_1005871412 | 156 |
| 138 | 3300005336 | Ga0070680_100214885 | Ga0070680_1002148852 | 156 |
| 139 | 3300005337 | Ga0070682_100001661 | Ga0070682_1000016618 | 156 |
| 140 | 3300005337 | Ga0070682_100012513 | Ga0070682_1000125132 | 156 |
| 141 | 3300005337 | Ga0070682_100074554 | Ga0070682_1000745543 | 156 |
| 142 | 3300005337 | Ga0070682_100202603 | Ga0070682_1002026033 | 156 |
| 143 | 3300005339 | Ga0070660_100115019 | Ga0070660_1001150192 | 156 |
| 144 | 3300005339 | Ga0070660_100165679 | Ga0070660_1001656792 | 156 |
| 145 | 3300005340 | Ga0070689_100004904 | Ga0070689_1000049045 | 156 |
| 146 | 3300005344 | Ga0070661_100021242 | Ga0070661_1000212424 | 156 |
| 147 | 3300005344 | Ga0070661_100075635 | Ga0070661_1000756352 | 156 |
| 148 | 3300005345 | Ga0070692_10008876 | Ga0070692_100088768 | 156 |
| 149 | 3300005345 | Ga0070692_10247756 | Ga0070692_102477562 | 156 |
| 150 | 3300005347 | Ga0070668_100008631 | Ga0070668_1000086315 | 156 |
| 151 | 3300005353 | Ga0070669_100381917 | Ga0070669_1003819172 | 156 |
| 152 | 3300005365 | Ga0070688_100114170 | Ga0070688_1001141703 | 156 |
| 153 | 3300005366 | Ga0070659_100001906 | Ga0070659_10000190616 | 156 |
| 154 | 3300005366 | Ga0070659_100002475 | Ga0070659_1000024757 | 156 |
| 155 | 3300005435 | Ga0070714_100000749 | Ga0070714_10000074912 | 156 |
| 156 | 3300005435 | Ga0070714_100001553 | Ga0070714_1000015536 | 156 |
| 157 | 3300005435 | Ga0070714_100007691 | Ga0070714_1000076916 | 156 |
| 158 | 3300005436 | Ga0070713_100000602 | Ga0070713_1000006023 | 156 |
| 159 | 3300005437 | Ga0070710_10032588 | Ga0070710_100325884 | 156 |
| 160 | 3300005439 | Ga0070711_100807841 | Ga0070711_1008078411 | 156 |
| 161 | 3300005444 | Ga0070694_100985686 | Ga0070694_1009856861 | 156 |
| 162 | 3300005455 | Ga0070663_100018335 | Ga0070663_1000183356 | 156 |
| 163 | 3300005455 | Ga0070663_100081346 | Ga0070663_1000813463 | 156 |
| 164 | 3300005455 | Ga0070663_100406035 | Ga0070663_1004060352 | 156 |
| 165 | 3300005455 | Ga0070663_100539021 | Ga0070663_1005390212 | 156 |
| 166 | 3300005456 | Ga0070678_100011516 | Ga0070678_1000115163 | 156 |
| 167 | 3300005457 | Ga0070662_100022988 | Ga0070662_1000229887 | 156 |
| 168 | 3300005458 | Ga0070681_10003017 | Ga0070681_100030178 | 156 |
| 169 | 3300005458 | Ga0070681_10010816 | Ga0070681_100108162 | 156 |
| 170 | 3300005458 | Ga0070681_10286291 | Ga0070681_102862912 | 156 |
| 171 | 3300005458 | Ga0070681_11303941 | Ga0070681_113039411 | 156 |
| 172 | 3300005530 | Ga0070679_100027315 | Ga0070679_1000273153 | 156 |
| 173 | 3300005530 | Ga0070679_100279657 | Ga0070679_1002796572 | 156 |
| 174 | 3300005530 | Ga0070679_101640567 | Ga0070679_1016405671 | 156 |
| 175 | 3300005535 | Ga0070684_100561902 | Ga0070684_1005619023 | 156 |
| 176 | 3300005539 | Ga0068853_100006253 | Ga0068853_10000625310 | 156 |
| 177 | 3300005539 | Ga0068853_100169361 | Ga0068853_1001693611 | 156 |
| 178 | 3300005539 | Ga0068853_100258383 | Ga0068853_1002583831 | 156 |
| 179 | 3300005546 | Ga0070696_100015645 | Ga0070696_1000156456 | 156 |
| 180 | 3300005546 | Ga0070696_100113397 | Ga0070696_1001133972 | 156 |
| 181 | 3300005546 | Ga0070696_100359714 | Ga0070696_1003597142 | 156 |
| 182 | 3300005547 | Ga0070693_100043943 | Ga0070693_1000439433 | 156 |
| 183 | 3300005547 | Ga0070693_100113977 | Ga0070693_1001139772 | 156 |
| 184 | 3300005548 | Ga0070665_100017480 | Ga0070665_1000174803 | 156 |
| 185 | 3300005563 | Ga0068855_100165702 | Ga0068855_1001657024 | 156 |
| 186 | 3300005563 | Ga0068855_100178419 | Ga0068855_1001784192 | 156 |
| 187 | 3300005563 | Ga0068855_100679439 | Ga0068855_1006794391 | 156 |
| 188 | 3300005564 | Ga0070664_100457627 | Ga0070664_1004576271 | 156 |
| 189 | 3300005577 | Ga0068857_100007224 | Ga0068857_1000072248 | 156 |
| 190 | 3300005577 | Ga0068857_100083154 | Ga0068857_1000831545 | 156 |
| 191 | 3300005577 | Ga0068857_100278611 | Ga0068857_1002786113 | 156 |
| 192 | 3300005578 | Ga0068854_100000026 | Ga0068854_100000026102 | 156 |
| 193 | 3300005578 | Ga0068854_100033812 | Ga0068854_1000338126 | 156 |
| 194 | 3300005578 | Ga0068854_100074560 | Ga0068854_1000745603 | 156 |
| 195 | 3300005578 | Ga0068854_100131868 | Ga0068854_1001318683 | 156 |
| 196 | 3300005614 | Ga0068856_100000132 | Ga0068856_10000013235 | 156 |
| 197 | 3300005614 | Ga0068856_100000138 | Ga0068856_10000013846 | 156 |
| 198 | 3300005614 | Ga0068856_100156438 | Ga0068856_1001564385 | 156 |
| 199 | 3300005616 | Ga0068852_100059059 | Ga0068852_1000590593 | 156 |
| 200 | 3300005834 | Ga0068851_10063461 | Ga0068851_100634613 | 156 |
| 201 | 3300005842 | Ga0068858_100076429 | Ga0068858_1000764291 | 156 |
| 202 | 3300005843 | Ga0068860_100093958 | Ga0068860_1000939583 | 156 |
| 203 | 3300005983 | Ga0081540_1001656 | Ga0081540_100165612 | 156 |
| 204 | 3300005985 | Ga0081539_10013089 | Ga0081539_100130893 | 156 |
| 205 | 3300006051 | Ga0075364_10000769 | Ga0075364_1000076914 | 156 |
| 206 | 3300006051 | Ga0075364_10027694 | Ga0075364_100276944 | 156 |
| 207 | 3300006051 | Ga0075364_10726542 | Ga0075364_107265421 | 156 |
| 208 | 3300006175 | Ga0070712_100346463 | Ga0070712_1003464632 | 156 |
| 209 | 3300006186 | Ga0075369_10027448 | Ga0075369_100274484 | 156 |
| 210 | 3300009036 | Ga0105244_10057268 | Ga0105244_100572684 | 156 |
| 211 | 3300009036 | Ga0105244_10082339 | Ga0105244_100823391 | 156 |
| 212 | 3300009093 | Ga0105240_10001223 | Ga0105240_1000122314 | 156 |
| 213 | 3300009093 | Ga0105240_10007527 | Ga0105240_1000752712 | 156 |
| 214 | 3300009093 | Ga0105240_10224484 | Ga0105240_102244843 | 156 |
| 215 | 3300009093 | Ga0105240_10250368 | Ga0105240_102503682 | 156 |
| 216 | 3300009093 | Ga0105240_10832982 | Ga0105240_108329822 | 156 |
| 217 | 3300009148 | Ga0105243_10025020 | Ga0105243_100250208 | 156 |
| 218 | 3300009174 | Ga0105241_10131103 | Ga0105241_101311033 | 156 |
| 219 | 3300009174 | Ga0105241_10620480 | Ga0105241_106204802 | 156 |
| 220 | 3300009545 | Ga0105237_10000079 | Ga0105237_100000794 | 156 |
| 221 | 3300009545 | Ga0105237_10000387 | Ga0105237_1000038724 | 156 |
| 222 | 3300009545 | Ga0105237_10081547 | Ga0105237_100815477 | 156 |
| 223 | 3300009545 | Ga0105237_11092360 | Ga0105237_110923601 | 156 |
| 224 | 3300009551 | Ga0105238_10001523 | Ga0105238_1000152313 | 156 |
| 225 | 3300009551 | Ga0105238_10015059 | Ga0105238_100150592 | 156 |
| 226 | 3300009551 | Ga0105238_10097882 | Ga0105238_100978821 | 156 |
| 227 | 3300009551 | Ga0105238_10532286 | Ga0105238_105322863 | 156 |
| 228 | 3300009553 | Ga0105249_10986325 | Ga0105249_109863252 | 156 |
| 229 | 3300010375 | Ga0105239_10000830 | Ga0105239_1000083016 | 156 |
| 230 | 3300010375 | Ga0105239_10038489 | Ga0105239_100384895 | 156 |
| 231 | 3300012500 | Ga0157314_1001498 | Ga0157314_10014984 | 156 |
| 232 | 3300012502 | Ga0157347_1000485 | Ga0157347_10004855 | 156 |
| 233 | 3300012505 | Ga0157339_1003353 | Ga0157339_10033531 | 156 |
| 234 | 3300013100 | Ga0157373_10000971 | Ga0157373_1000097111 | 156 |
| 235 | 3300013100 | Ga0157373_10048421 | Ga0157373_100484213 | 156 |
| 236 | 3300013100 | Ga0157373_10067819 | Ga0157373_100678194 | 156 |
| 237 | 3300013102 | Ga0157371_10011477 | Ga0157371_100114777 | 156 |
| 238 | 3300013102 | Ga0157371_10060109 | Ga0157371_100601095 | 156 |
| 239 | 3300013104 | Ga0157370_10012805 | Ga0157370_100128057 | 156 |
| 240 | 3300013104 | Ga0157370_10013410 | Ga0157370_100134108 | 156 |
| 241 | 3300013104 | Ga0157370_10027685 | Ga0157370_100276854 | 156 |
| 242 | 3300013104 | Ga0157370_10036447 | Ga0157370_100364475 | 156 |
| 243 | 3300013104 | Ga0157370_10115258 | Ga0157370_101152582 | 156 |
| 244 | 3300013104 | Ga0157370_10128414 | Ga0157370_101284142 | 156 |
| 245 | 3300013104 | Ga0157370_10799651 | Ga0157370_107996511 | 156 |
| 246 | 3300013105 | Ga0157369_10044986 | Ga0157369_100449863 | 156 |
| 247 | 3300013105 | Ga0157369_10095621 | Ga0157369_100956213 | 156 |
| 248 | 3300013105 | Ga0157369_10292162 | Ga0157369_102921621 | 156 |
| 249 | 3300013105 | Ga0157369_10332336 | Ga0157369_103323362 | 156 |
| 250 | 3300013105 | Ga0157369_10526319 | Ga0157369_105263192 | 156 |
| 251 | 3300013306 | Ga0163162_10376773 | Ga0163162_103767734 | 156 |
| 252 | 3300013307 | Ga0157372_10006610 | Ga0157372_1000661011 | 156 |
| 253 | 3300013307 | Ga0157372_10040415 | Ga0157372_100404157 | 156 |
| 254 | 3300013307 | Ga0157372_10099833 | Ga0157372_100998334 | 156 |
| 255 | 3300013307 | Ga0157372_10419630 | Ga0157372_104196303 | 156 |
| 256 | 3300013307 | Ga0157372_10879822 | Ga0157372_108798222 | 156 |
| 257 | 3300014325 | Ga0163163_11295194 | Ga0163163_112951942 | 156 |
| 258 | 3300014497 | Ga0182008_10029428 | Ga0182008_100294282 | 156 |
| 259 | 3300014497 | Ga0182008_10047630 | Ga0182008_100476302 | 156 |
| 260 | 3300014969 | Ga0157376_10510136 | Ga0157376_105101361 | 156 |
| 261 | 3300015261 | Ga0182006_1017810 | Ga0182006_10178103 | 156 |
| 262 | 3300015261 | Ga0182006_1070115 | Ga0182006_10701153 | 156 |
| 263 | 3300015262 | Ga0182007_10022205 | Ga0182007_100222054 | 156 |
| 264 | 3300015262 | Ga0182007_10360031 | Ga0182007_103600311 | 156 |
| 265 | 3300015685 | Ga0183369_1004 | Ga0183369_1004405 | 156 |
| 266 | 3300015687 | Ga0183368_1002 | Ga0183368_10021383 | 156 |
| 267 | 3300017792 | Ga0163161_10089970 | Ga0163161_100899703 | 156 |
| 268 | 3300020069 | Ga0197907_10549321 | Ga0197907_105493213 | 156 |
| 269 | 3300020070 | Ga0206356_10106703 | Ga0206356_101067031 | 156 |
| 270 | 3300020075 | Ga0206349_1019390 | Ga0206349_10193902 | 156 |
| 271 | 3300020078 | Ga0206352_10038571 | Ga0206352_100385711 | 156 |
| 272 | 3300020080 | Ga0206350_11086872 | Ga0206350_110868722 | 156 |
| 273 | 3300020081 | Ga0206354_10250520 | Ga0206354_102505202 | 156 |
| 274 | 3300020081 | Ga0206354_11158424 | Ga0206354_111584241 | 156 |
| 275 | 3300020082 | Ga0206353_12018004 | Ga0206353_120180042 | 156 |
| 276 | 3300022467 | Ga0224712_10054345 | Ga0224712_100543453 | 156 |
| 277 | 3300022467 | Ga0224712_10240571 | Ga0224712_102405711 | 156 |
| 278 | 3300025206 | Ga0209435_105809 | Ga0209435_1058092 | 156 |
| 279 | 3300025206 | Ga0209435_127180 | Ga0209435_1271801 | 156 |
| 280 | 3300025207 | Ga0209760_100626 | Ga0209760_1006267 | 156 |
| 281 | 3300025224 | Ga0209784_100053 | Ga0209784_10005375 | 156 |
| 282 | 3300025225 | Ga0209566_103166 | Ga0209566_1031662 | 156 |
| 283 | 3300025225 | Ga0209566_106075 | Ga0209566_1060752 | 156 |
| 284 | 3300025226 | Ga0209674_100014 | Ga0209674_10001476 | 156 |
| 285 | 3300025226 | Ga0209674_100197 | Ga0209674_10019757 | 156 |
| 286 | 3300025226 | Ga0209674_100550 | Ga0209674_1005504 | 156 |
| 287 | 3300025226 | Ga0209674_101609 | Ga0209674_1016097 | 156 |
| 288 | 3300025228 | Ga0209672_100004 | Ga0209672_100004402 | 156 |
| 289 | 3300025228 | Ga0209672_100008 | Ga0209672_100008301 | 156 |
| 290 | 3300025228 | Ga0209672_100089 | Ga0209672_10008940 | 156 |
| 291 | 3300025228 | Ga0209672_100826 | Ga0209672_10082613 | 156 |
| 292 | 3300025228 | Ga0209672_100831 | Ga0209672_10083112 | 156 |
| 293 | 3300025228 | Ga0209672_107708 | Ga0209672_1077083 | 156 |
| 294 | 3300025230 | Ga0209563_100097 | Ga0209563_100097109 | 156 |
| 295 | 3300025231 | Ga0207427_100051 | Ga0207427_100051103 | 156 |
| 296 | 3300025231 | Ga0207427_100061 | Ga0207427_10006182 | 156 |
| 297 | 3300025231 | Ga0207427_100177 | Ga0207427_10017715 | 156 |
| 298 | 3300025231 | Ga0207427_102367 | Ga0207427_1023672 | 156 |
| 299 | 3300025231 | Ga0207427_102424 | Ga0207427_1024246 | 156 |
| 300 | 3300025233 | Ga0209437_100037 | Ga0209437_100037241 | 156 |
| 301 | 3300025233 | Ga0209437_100152 | Ga0209437_10015250 | 156 |
| 302 | 3300025233 | Ga0209437_100643 | Ga0209437_10064315 | 156 |
| 303 | 3300025233 | Ga0209437_100682 | Ga0209437_10068214 | 156 |
| 304 | 3300025242 | Ga0209258_100003 | Ga0209258_100003402 | 156 |
| 305 | 3300025242 | Ga0209258_100004 | Ga0209258_100004889 | 156 |
| 306 | 3300025242 | Ga0209258_100008 | Ga0209258_100008514 | 156 |
| 307 | 3300025242 | Ga0209258_100090 | Ga0209258_10009093 | 156 |
| 308 | 3300025242 | Ga0209258_100101 | Ga0209258_10010123 | 156 |
| 309 | 3300025242 | Ga0209258_100138 | Ga0209258_10013892 | 156 |
| 310 | 3300025242 | Ga0209258_100479 | Ga0209258_10047936 | 156 |
| 311 | 3300025242 | Ga0209258_101864 | Ga0209258_1018645 | 156 |
| 312 | 3300025246 | Ga0209646_1000605 | Ga0209646_100060512 | 156 |
| 313 | 3300025246 | Ga0209646_1000808 | Ga0209646_10008084 | 156 |
| 314 | 3300025246 | Ga0209646_1004736 | Ga0209646_10047363 | 156 |
| 315 | 3300025250 | Ga0209026_1000064 | Ga0209026_1000064111 | 156 |
| 316 | 3300025250 | Ga0209026_1000104 | Ga0209026_100010482 | 156 |
| 317 | 3300025250 | Ga0209026_1000143 | Ga0209026_100014316 | 156 |
| 318 | 3300025250 | Ga0209026_1000294 | Ga0209026_100029424 | 156 |
| 319 | 3300025250 | Ga0209026_1000384 | Ga0209026_100038424 | 156 |
| 320 | 3300025250 | Ga0209026_1002853 | Ga0209026_10028536 | 156 |
| 321 | 3300025250 | Ga0209026_1012227 | Ga0209026_10122273 | 156 |
| 322 | 3300025253 | Ga0209677_103854 | Ga0209677_1038544 | 156 |
| 323 | 3300025254 | Ga0209148_1000001 | Ga0209148_1000001269 | 156 |
| 324 | 3300025254 | Ga0209148_1000002 | Ga0209148_1000002239 | 156 |
| 325 | 3300025254 | Ga0209148_1000016 | Ga0209148_1000016402 | 156 |
| 326 | 3300025254 | Ga0209148_1000041 | Ga0209148_100004116 | 156 |
| 327 | 3300025254 | Ga0209148_1000065 | Ga0209148_100006593 | 156 |
| 328 | 3300025254 | Ga0209148_1000079 | Ga0209148_1000079163 | 156 |
| 329 | 3300025256 | Ga0209759_1000165 | Ga0209759_100016519 | 156 |
| 330 | 3300025256 | Ga0209759_1000220 | Ga0209759_100022032 | 156 |
| 331 | 3300025256 | Ga0209759_1000449 | Ga0209759_100044930 | 156 |
| 332 | 3300025256 | Ga0209759_1009733 | Ga0209759_10097335 | 156 |
| 333 | 3300025256 | Ga0209759_1013162 | Ga0209759_10131623 | 156 |
| 334 | 3300025258 | Ga0209129_1006594 | Ga0209129_10065946 | 156 |
| 335 | 3300025261 | Ga0209233_1000002 | Ga0209233_10000021962 | 156 |
| 336 | 3300025261 | Ga0209233_1000099 | Ga0209233_1000099167 | 156 |
| 337 | 3300025261 | Ga0209233_1000237 | Ga0209233_100023777 | 156 |
| 338 | 3300025261 | Ga0209233_1000554 | Ga0209233_100055414 | 156 |
| 339 | 3300025261 | Ga0209233_1029613 | Ga0209233_10296131 | 156 |
| 340 | 3300025261 | Ga0209233_1054791 | Ga0209233_10547911 | 156 |
| 341 | 3300025272 | Ga0209455_1000004 | Ga0209455_1000004402 | 156 |
| 342 | 3300025272 | Ga0209455_1000007 | Ga0209455_1000007634 | 156 |
| 343 | 3300025272 | Ga0209455_1000016 | Ga0209455_1000016164 | 156 |
| 344 | 3300025272 | Ga0209455_1000079 | Ga0209455_100007982 | 156 |
| 345 | 3300025272 | Ga0209455_1000257 | Ga0209455_100025710 | 156 |
| 346 | 3300025272 | Ga0209455_1002079 | Ga0209455_10020797 | 156 |
| 347 | 3300025284 | Ga0209130_1003681 | Ga0209130_10036812 | 156 |
| 348 | 3300025292 | Ga0209676_1000018 | Ga0209676_1000018281 | 156 |
| 349 | 3300025292 | Ga0209676_1000592 | Ga0209676_100059238 | 156 |
| 350 | 3300025292 | Ga0209676_1000601 | Ga0209676_100060138 | 156 |
| 351 | 3300025297 | Ga0209758_1000840 | Ga0209758_100084041 | 156 |
| 352 | 3300025297 | Ga0209758_1032829 | Ga0209758_10328293 | 156 |
| 353 | 3300025298 | Ga0209050_1003212 | Ga0209050_10032126 | 156 |
| 354 | 3300025299 | Ga0209256_1002286 | Ga0209256_100228614 | 156 |
| 355 | 3300025303 | Ga0209051_1009702 | Ga0209051_10097022 | 156 |
| 356 | 3300025304 | Ga0209257_1000035 | Ga0209257_1000035281 | 156 |
| 357 | 3300025304 | Ga0209257_1000594 | Ga0209257_100059446 | 156 |
| 358 | 3300025728 | Ga0207655_1094533 | Ga0207655_10945332 | 156 |
| 359 | 3300025898 | Ga0207692_10051943 | Ga0207692_100519434 | 156 |
| 360 | 3300025904 | Ga0207647_10003953 | Ga0207647_1000395315 | 156 |
| 361 | 3300025904 | Ga0207647_10004147 | Ga0207647_100041479 | 156 |
| 362 | 3300025904 | Ga0207647_10011946 | Ga0207647_100119465 | 156 |
| 363 | 3300025909 | Ga0207705_10042118 | Ga0207705_100421185 | 156 |
| 364 | 3300025909 | Ga0207705_11298696 | Ga0207705_112986961 | 156 |
| 365 | 3300025911 | Ga0207654_10135853 | Ga0207654_101358532 | 156 |
| 366 | 3300025912 | Ga0207707_10002356 | Ga0207707_1000235613 | 156 |
| 367 | 3300025912 | Ga0207707_10003266 | Ga0207707_1000326612 | 156 |
| 368 | 3300025912 | Ga0207707_10012489 | Ga0207707_100124893 | 156 |
| 369 | 3300025913 | Ga0207695_10000291 | Ga0207695_1000029120 | 156 |
| 370 | 3300025913 | Ga0207695_10004892 | Ga0207695_1000489214 | 156 |
| 371 | 3300025913 | Ga0207695_10006861 | Ga0207695_100068613 | 156 |
| 372 | 3300025913 | Ga0207695_10075964 | Ga0207695_100759644 | 156 |
| 373 | 3300025913 | Ga0207695_10201598 | Ga0207695_102015983 | 156 |
| 374 | 3300025914 | Ga0207671_10000009 | Ga0207671_10000009373 | 156 |
| 375 | 3300025914 | Ga0207671_10235645 | Ga0207671_102356452 | 156 |
| 376 | 3300025914 | Ga0207671_10764392 | Ga0207671_107643921 | 156 |
| 377 | 3300025915 | Ga0207693_10123816 | Ga0207693_101238164 | 156 |
| 378 | 3300025917 | Ga0207660_11172860 | Ga0207660_111728601 | 156 |
| 379 | 3300025919 | Ga0207657_10030170 | Ga0207657_100301702 | 156 |
| 380 | 3300025920 | Ga0207649_10498207 | Ga0207649_104982072 | 156 |
| 381 | 3300025921 | Ga0207652_10075881 | Ga0207652_100758813 | 156 |
| 382 | 3300025924 | Ga0207694_10006052 | Ga0207694_100060524 | 156 |
| 383 | 3300025924 | Ga0207694_10021419 | Ga0207694_100214192 | 156 |
| 384 | 3300025924 | Ga0207694_10169233 | Ga0207694_101692333 | 156 |
| 385 | 3300025924 | Ga0207694_10220975 | Ga0207694_102209753 | 156 |
| 386 | 3300025928 | Ga0207700_10002997 | Ga0207700_1000299712 | 156 |
| 387 | 3300025929 | Ga0207664_10000499 | Ga0207664_1000049911 | 156 |
| 388 | 3300025929 | Ga0207664_10000670 | Ga0207664_1000067015 | 156 |
| 389 | 3300025932 | Ga0207690_10000499 | Ga0207690_1000049912 | 156 |
| 390 | 3300025932 | Ga0207690_10001115 | Ga0207690_1000111513 | 156 |
| 391 | 3300025932 | Ga0207690_10009857 | Ga0207690_100098578 | 156 |
| 392 | 3300025932 | Ga0207690_10031552 | Ga0207690_100315525 | 156 |
| 393 | 3300025932 | Ga0207690_10074232 | Ga0207690_100742323 | 156 |
| 394 | 3300025932 | Ga0207690_10085128 | Ga0207690_100851283 | 156 |
| 395 | 3300025935 | Ga0207709_10001882 | Ga0207709_100018829 | 156 |
| 396 | 3300025935 | Ga0207709_10895144 | Ga0207709_108951442 | 156 |
| 397 | 3300025936 | Ga0207670_10000619 | Ga0207670_100006195 | 156 |
| 398 | 3300025945 | Ga0207679_10372579 | Ga0207679_103725791 | 156 |
| 399 | 3300025949 | Ga0207667_10000077 | Ga0207667_1000007739 | 156 |
| 400 | 3300025949 | Ga0207667_10000491 | Ga0207667_1000049120 | 156 |
| 401 | 3300025949 | Ga0207667_10002460 | Ga0207667_1000246014 | 156 |
| 402 | 3300025949 | Ga0207667_10383328 | Ga0207667_103833283 | 156 |
| 403 | 3300025949 | Ga0207667_11033226 | Ga0207667_110332262 | 156 |
| 404 | 3300025961 | Ga0207712_10146852 | Ga0207712_101468523 | 156 |
| 405 | 3300025972 | Ga0207668_10003459 | Ga0207668_100034591 | 156 |
| 406 | 3300025981 | Ga0207640_10000380 | Ga0207640_1000038033 | 156 |
| 407 | 3300025981 | Ga0207640_10015746 | Ga0207640_100157467 | 156 |
| 408 | 3300025981 | Ga0207640_10076772 | Ga0207640_100767724 | 156 |
| 409 | 3300025981 | Ga0207640_10110266 | Ga0207640_101102662 | 156 |
| 410 | 3300026035 | Ga0207703_10291324 | Ga0207703_102913241 | 156 |
| 411 | 3300026041 | Ga0207639_10008859 | Ga0207639_100088597 | 156 |
| 412 | 3300026041 | Ga0207639_10310241 | Ga0207639_103102412 | 156 |
| 413 | 3300026067 | Ga0207678_10088693 | Ga0207678_100886933 | 156 |
| 414 | 3300026067 | Ga0207678_10168201 | Ga0207678_101682013 | 156 |
| 415 | 3300026067 | Ga0207678_10399825 | Ga0207678_103998251 | 156 |
| 416 | 3300026078 | Ga0207702_10000299 | Ga0207702_1000029912 | 156 |
| 417 | 3300026078 | Ga0207702_10000740 | Ga0207702_1000074015 | 156 |
| 418 | 3300026078 | Ga0207702_10681524 | Ga0207702_106815242 | 156 |
| 419 | 3300026116 | Ga0207674_10000128 | Ga0207674_1000012843 | 156 |
| 420 | 3300026116 | Ga0207674_10040597 | Ga0207674_100405976 | 156 |
| 421 | 3300026116 | Ga0207674_10330008 | Ga0207674_103300083 | 156 |
| 422 | 3300026121 | Ga0207683_10014874 | Ga0207683_100148743 | 156 |
| 423 | 3300026142 | Ga0207698_10245269 | Ga0207698_102452692 | 156 |
| 424 | 3300027312 | Ga0209371_1000018 | Ga0209371_1000018270 | 156 |
| 425 | 3300028379 | Ga0268266_10056320 | Ga0268266_100563203 | 156 |
| 426 | 3300028381 | Ga0268264_10327205 | Ga0268264_103272051 | 156 |
| 427 | 3300030500 | Ga0268256_1000016 | Ga0268256_1000016270 | 156 |
| 428 | 3300030732 | Ga0316176_1088322 | Ga0316176_10883221 | 156 |
| 429 | 3300031238 | Ga0265332_10271152 | Ga0265332_102711521 | 156 |
| 430 | 3300032004 | Ga0307414_10424305 | Ga0307414_104243051 | 156 |
| 431 | 3300037312 | Ga0395899_0000313 | Ga0395899_0000313_19259_19729 | 156 |
| 432 | 3300037418 | Ga0395900_0000011 | Ga0395900_0000011_27077_27547 | 156 |
| 433 | 3300037466 | Ga0395898_0000013 | Ga0395898_0000013_28653_29123 | 156 |
| 434 | 3300037466 | Ga0395898_0000058 | Ga0395898_0000058_26774_27244 | 156 |
| 435 | 3300037466 | Ga0395898_0008343 | Ga0395898_0008343_3187_3657 | 156 |
| 436 | 3300038443 | Ga0395901_0000201 | Ga0395901_0000201_72518_72988 | 156 |
| 437 | 3300038443 | Ga0395901_0014897 | Ga0395901_0014897_3923_4393 | 156 |
| 438 | 3300038443 | Ga0395901_0151570 | Ga0395901_0151570_125_595 | 156 |
| 439 | 3300038443 | Ga0395901_0375264 | Ga0395901_0375264_917_1387 | 156 |
| 440 | 3300039447 | Ga0436361_1172006 | Ga0436361_1172006_390_860 | 156 |
| 441 | 3300041451 | Ga0451791_0751358 | Ga0451791_0751358_346_822 | 156 |
| 442 | 3300041452 | Ga0451793_1473683 | Ga0451793_1473683_934_1410 | 156 |
| 443 | 3300041453 | Ga0451797_1106049 | Ga0451797_1106049_1740_2216 | 156 |
| 444 | 3300041486 | Ga0451807_0503423 | Ga0451807_0503423_1677_2153 | 156 |
| 445 | 3300042000 | Ga0439437_004154 | Ga0439437_004154_145_615 | 156 |
| 446 | 3300042006 | Ga0439432_011961 | Ga0439432_011961_1268_1738 | 156 |
| 447 | 3300042012 | Ga0439455_0028996 | Ga0439455_0028996_76_546 | 156 |
| 448 | 3300042533 | Ga0450901_000990 | Ga0450901_000990_1631_2101 | 156 |
| 449 | 3300044536 | Ga0466988_0161536 | Ga0466988_0161536_392_862 | 156 |
| 450 | 3300044656 | Ga0466969_0029592 | Ga0466969_0029592_1194_1664 | 156 |
| 451 | 3300044656 | Ga0466969_0031920 | Ga0466969_0031920_1364_1834 | 156 |
| 452 | 3300044656 | Ga0466969_0066660 | Ga0466969_0066660_1178_1648 | 156 |
| 453 | 3300044658 | Ga0466972_0020423 | Ga0466972_0020423_2769_3239 | 156 |
| 454 | 3300044661 | Ga0466975_0306164 | Ga0466975_0306164_374_844 | 156 |
| 455 | 3300044666 | Ga0466977_0304176 | Ga0466977_0304176_405_875 | 156 |
| 456 | 3300044672 | Ga0466982_0000001 | Ga0466982_0000001_439705_440175 | 156 |
| 457 | 3300044683 | Ga0466965_0012502 | Ga0466965_0012502_483_953 | 156 |
| 458 | 3300044683 | Ga0466965_0022464 | Ga0466965_0022464_1231_1701 | 156 |
| 459 | 3300044683 | Ga0466965_0365194 | Ga0466965_0365194_132_602 | 156 |
| 460 | 3300044684 | Ga0466966_0008456 | Ga0466966_0008456_3233_3703 | 156 |
| 461 | 3300044684 | Ga0466966_0021893 | Ga0466966_0021893_1581_2051 | 156 |
| 462 | 3300044684 | Ga0466966_0024360 | Ga0466966_0024360_221_691 | 156 |
| 463 | 3300044693 | Ga0466961_0001123 | Ga0466961_0001123_3902_4372 | 156 |
| 464 | 3300044693 | Ga0466961_0002879 | Ga0466961_0002879_5890_6360 | 156 |
| 465 | 3300044693 | Ga0466961_0010515 | Ga0466961_0010515_1194_1664 | 156 |
| 466 | 3300044693 | Ga0466961_0063988 | Ga0466961_0063988_802_1272 | 156 |
| 467 | 3300044693 | Ga0466961_0172987 | Ga0466961_0172987_847_1317 | 156 |
| 468 | 3300044694 | Ga0466963_0319947 | Ga0466963_0319947_218_688 | 156 |
| 469 | 3300044706 | Ga0466964_0001080 | Ga0466964_0001080_5931_6401 | 156 |
| 470 | 3300044719 | Ga0466971_0000358 | Ga0466971_0000358_15310_15780 | 156 |
| 471 | 3300044719 | Ga0466971_0024916 | Ga0466971_0024916_63_533 | 156 |
| 472 | 3300044719 | Ga0466971_0105482 | Ga0466971_0105482_51_521 | 156 |
| 473 | 3300044735 | Ga0466968_0019270 | Ga0466968_0019270_974_1444 | 156 |
| 474 | 3300044735 | Ga0466968_0105991 | Ga0466968_0105991_390_860 | 156 |
| 475 | 3300044765 | Ga0466970_0003545 | Ga0466970_0003545_2450_2920 | 156 |
| 476 | 3300044765 | Ga0466970_0028277 | Ga0466970_0028277_2274_2744 | 156 |
| 477 | 3300044765 | Ga0466970_0105801 | Ga0466970_0105801_1009_1479 | 156 |
| 478 | 3300044765 | Ga0466970_0167399 | Ga0466970_0167399_11_481 | 156 |
| 479 | 3300044842 | Ga0466957_0001515 | Ga0466957_0001515_1261_1731 | 156 |
| 480 | 3300044842 | Ga0466957_0003488 | Ga0466957_0003488_5508_5978 | 156 |
| 481 | 3300044842 | Ga0466957_0694545 | Ga0466957_0694545_185_655 | 156 |
| 482 | 3300044901 | Ga0466960_0001294 | Ga0466960_0001294_1596_2066 | 156 |
| 483 | 3300045049 | Ga0466959_0047563 | Ga0466959_0047563_1756_2226 | 156 |
| 484 | 3300045049 | Ga0466959_0057445 | Ga0466959_0057445_173_643 | 156 |
| 485 | 3300045049 | Ga0466959_0118449 | Ga0466959_0118449_1194_1664 | 156 |
| 486 | 3300045049 | Ga0466959_0181321 | Ga0466959_0181321_576_1046 | 156 |
| 487 | 3300045049 | Ga0466959_0736677 | Ga0466959_0736677_37_507 | 156 |
| 488 | 3300045836 | Ga0466958_0016010 | Ga0466958_0016010_3783_4253 | 156 |
| 489 | 3300045836 | Ga0466958_0053133 | Ga0466958_0053133_555_1025 | 156 |
| 490 | 3300045836 | Ga0466958_0071222 | Ga0466958_0071222_63_533 | 156 |
| 491 | 3300045836 | Ga0466958_0147809 | Ga0466958_0147809_312_782 | 156 |
| 492 | 3300045976 | Ga0466967_0042580 | Ga0466967_0042580_2684_3154 | 156 |
| 493 | 3300045976 | Ga0466967_0329202 | Ga0466967_0329202_951_1421 | 156 |
| 494 | 3300046453 | Ga0495627_101812 | Ga0495627_101812_173_643 | 156 |
| 495 | 3300046460 | Ga0495638_0000290 | Ga0495638_0000290_61864_62334 | 156 |
| 496 | 3300046460 | Ga0495638_0001087 | Ga0495638_0001087_21907_22377 | 156 |
| 497 | 3300046471 | Ga0495650_0000210 | Ga0495650_0000210_61909_62379 | 156 |
| 498 | 3300046507 | Ga0495606_0000016 | Ga0495606_0000016_42878_43348 | 156 |
| 499 | 3300046557 | Ga0495622_0013844 | Ga0495622_0013844_2911_3381 | 156 |
| 500 | 3300046558 | Ga0495633_0002208 | Ga0495633_0002208_12061_12531 | 156 |
| 501 | 3300046660 | Ga0495625_0024105 | Ga0495625_0024105_911_1381 | 156 |
| 502 | 3300046694 | Ga0495649_0000450 | Ga0495649_0000450_10452_10922 | 156 |
| 503 | 3300048907 | Ga0496104_0090411 | Ga0496104_0090411_1607_2077 | 156 |
| 504 | 3300048908 | Ga0496105_0002876 | Ga0496105_0002876_2420_2890 | 156 |
| 505 | 3300048909 | Ga0496106_0119136 | Ga0496106_0119136_1355_1825 | 156 |
| 506 | 3300048916 | Ga0496113_0006282 | Ga0496113_0006282_5991_6461 | 156 |
| 507 | 3300048917 | Ga0496114_0575194 | Ga0496114_0575194_284_754 | 156 |
| 508 | 3300048918 | Ga0496115_0000095 | Ga0496115_0000095_42891_43361 | 156 |
| 509 | 3300048918 | Ga0496115_0002018 | Ga0496115_0002018_4508_4978 | 156 |
| 510 | 3300048918 | Ga0496115_0029277 | Ga0496115_0029277_2251_2721 | 156 |
| 511 | 3300048918 | Ga0496115_0291179 | Ga0496115_0291179_413_883 | 156 |
| 512 | 3300048919 | Ga0496116_0001905 | Ga0496116_0001905_2081_2551 | 156 |
| 513 | 3300048920 | Ga0496117_0054835 | Ga0496117_0054835_512_982 | 156 |
| 514 | 3300048921 | Ga0496118_0008228 | Ga0496118_0008228_2162_2632 | 156 |
| 515 | 3300048921 | Ga0496118_0050850 | Ga0496118_0050850_227_697 | 156 |
| 516 | 3300048922 | Ga0496119_0000966 | Ga0496119_0000966_27298_27768 | 156 |
| 517 | 3300048922 | Ga0496119_0008465 | Ga0496119_0008465_2623_3093 | 156 |
| 518 | 3300048923 | Ga0496120_0000409 | Ga0496120_0000409_41246_41716 | 156 |
| 519 | 3300048923 | Ga0496120_0001143 | Ga0496120_0001143_2030_2500 | 156 |
| 520 | 3300048924 | Ga0496121_0005906 | Ga0496121_0005906_12780_13250 | 156 |
| 521 | 3300048924 | Ga0496121_0009013 | Ga0496121_0009013_10958_11428 | 156 |
| 522 | 3300048924 | Ga0496121_0024979 | Ga0496121_0024979_98_568 | 156 |
| 523 | 3300048924 | Ga0496121_0059838 | Ga0496121_0059838_2396_2866 | 156 |
| 524 | 3300048925 | Ga0496122_0374085 | Ga0496122_0374085_113_583 | 156 |
| 525 | 3300048927 | Ga0496124_0013344 | Ga0496124_0013344_5708_6256 | 156 |
| 526 | 3300048927 | Ga0496124_0071614 | Ga0496124_0071614_1815_2285 | 156 |
| 527 | 3300048928 | Ga0496125_0000088 | Ga0496125_0000088_51354_51824 | 156 |
| 528 | 3300048928 | Ga0496125_0340036 | Ga0496125_0340036_99_569 | 156 |
| 529 | 3300048929 | Ga0496126_0006276 | Ga0496126_0006276_4375_4845 | 156 |
| 530 | 3300048929 | Ga0496126_0049430 | Ga0496126_0049430_1010_1480 | 156 |
| 531 | 3300048929 | Ga0496126_0596706 | Ga0496126_0596706_54_524 | 156 |
| 532 | 3300049459 | Ga0495678_026942 | Ga0495678_026942_1433_1903 | 156 |
| 533 | 3300049460 | Ga0495682_0001620 | Ga0495682_0001620_3076_3546 | 156 |
| 534 | 3300049568 | Ga0501031_0094212 | Ga0501031_0094212_220_690 | 156 |
| 535 | 3300049569 | Ga0501032_0103960 | Ga0501032_0103960_171_641 | 156 |
| 536 | 3300049570 | Ga0501033_0005277 | Ga0501033_0005277_7824_8294 | 156 |
| 537 | 3300049570 | Ga0501033_0009344 | Ga0501033_0009344_6242_6712 | 156 |
| 538 | 3300049570 | Ga0501033_0021541 | Ga0501033_0021541_4019_4489 | 156 |
| 539 | 3300049571 | Ga0501034_0023334 | Ga0501034_0023334_5691_6161 | 156 |
| 540 | 3300049571 | Ga0501034_0045115 | Ga0501034_0045115_3679_4149 | 156 |
| 541 | 3300049571 | Ga0501034_0045969 | Ga0501034_0045969_3373_3843 | 156 |
| 542 | 3300049572 | Ga0501036_0113556 | Ga0501036_0113556_524_994 | 156 |
| 543 | 3300049572 | Ga0501036_0119167 | Ga0501036_0119167_717_1187 | 156 |
| 544 | 3300049573 | Ga0501037_0017102 | Ga0501037_0017102_2326_2796 | 156 |
| 545 | 3300049573 | Ga0501037_0105161 | Ga0501037_0105161_1494_1964 | 156 |
| 546 | 3300049573 | Ga0501037_0125713 | Ga0501037_0125713_190_744 | 156 |
| 547 | 3300049574 | Ga0501038_0025505 | Ga0501038_0025505_1601_2071 | 156 |
| 548 | 3300049575 | Ga0501039_0053215 | Ga0501039_0053215_2072_2542 | 156 |
| 549 | 3300049576 | Ga0501040_0236655 | Ga0501040_0236655_722_1192 | 156 |
| 550 | 3300049578 | Ga0501042_0067633 | Ga0501042_0067633_531_1001 | 156 |
| 551 | 3300049579 | Ga0501043_0019693 | Ga0501043_0019693_407_877 | 156 |
| 552 | 3300049579 | Ga0501043_0036109 | Ga0501043_0036109_884_1354 | 156 |
| 553 | 3300049579 | Ga0501043_0049136 | Ga0501043_0049136_159_629 | 156 |
| 554 | 3300049580 | Ga0501046_0015963 | Ga0501046_0015963_4996_5466 | 156 |
| 555 | 3300049581 | Ga0501047_0013749 | Ga0501047_0013749_1539_2009 | 156 |
| 556 | 3300049581 | Ga0501047_0060398 | Ga0501047_0060398_2264_2818 | 156 |
| 557 | 3300049581 | Ga0501047_1149526 | Ga0501047_1149526_22_492 | 156 |
| 558 | 3300049582 | Ga0501048_0090878 | Ga0501048_0090878_1292_1762 | 156 |
| 559 | 3300049582 | Ga0501048_0599385 | Ga0501048_0599385_60_530 | 156 |
| 560 | 3300049583 | Ga0501067_0198405 | Ga0501067_0198405_265_735 | 156 |
| 561 | 3300049586 | Ga0501070_0050469 | Ga0501070_0050469_2226_2696 | 156 |
| 562 | 3300049586 | Ga0501070_0223882 | Ga0501070_0223882_1031_1501 | 156 |
| 563 | 3300049589 | Ga0501073_0043570 | Ga0501073_0043570_513_983 | 156 |
| 564 | 3300049741 | Ga0501079_0129119 | Ga0501079_0129119_788_1258 | 156 |
| 565 | 3300049742 | Ga0501080_0032186 | Ga0501080_0032186_1783_2253 | 156 |
| 566 | 3300049822 | Ga0501035_0013687 | Ga0501035_0013687_6618_7088 | 156 |
| 567 | 3300049822 | Ga0501035_0024637 | Ga0501035_0024637_4946_5416 | 156 |
| 568 | 3300049822 | Ga0501035_0037095 | Ga0501035_0037095_1187_1657 | 156 |
| 569 | 3300049822 | Ga0501035_0275331 | Ga0501035_0275331_13_483 | 156 |
| 570 | 3300049822 | Ga0501035_0333309 | Ga0501035_0333309_615_1085 | 156 |
| 571 | 3300049823 | Ga0501044_0017049 | Ga0501044_0017049_5106_5576 | 156 |
| 572 | 3300049823 | Ga0501044_0050029 | Ga0501044_0050029_2654_3124 | 156 |
| 573 | 3300049823 | Ga0501044_0140755 | Ga0501044_0140755_1864_2334 | 156 |
| 574 | 3300049823 | Ga0501044_0530805 | Ga0501044_0530805_482_952 | 156 |
| 575 | 3300050491 | nmdc:mga00v17_25_c1 | nmdc:mga00v17_25_c1_23201_23671 | 156 |
| 576 | 3300053151 | Ga0500604_0080094 | Ga0500604_0080094_263_766 | 156 |
| 577 | 3300059503 | Ga0587080_068454 | Ga0587080_068454_121_591 | 156 |
| 578 | 3300059510 | Ga0587090_031824 | Ga0587090_031824_115_585 | 156 |
| 579 | 3300059642 | Ga0587069_105280 | Ga0587069_105280_37_507 | 156 |
| 580 | 3300059645 | Ga0587076_034795 | Ga0587076_034795_119_589 | 156 |
| 581 | 3300059646 | Ga0587078_037146 | Ga0587078_037146_69_539 | 156 |
| 582 | 3300060346 | Ga0587111_0200159 | Ga0587111_0200159_53_523 | 156 |
| 583 | 3300003792 | Ga0055540_1032434 | Ga0055540_10324342 | 158 |
| 584 | 3300005289 | Ga0065704_10395925 | Ga0065704_103959251 | 158 |
| 585 | 3300025303 | Ga0209051_1026529 | Ga0209051_10265293 | 158 |
| 586 | 3300031548 | Ga0307408_100086899 | Ga0307408_1000868993 | 158 |
| 587 | 3300031731 | Ga0307405_10023448 | Ga0307405_100234483 | 158 |
| 588 | 3300031901 | Ga0307406_10030241 | Ga0307406_100302414 | 158 |
| 589 | 3300031911 | Ga0307412_10030790 | Ga0307412_100307902 | 158 |
| 590 | 3300031995 | Ga0307409_100023226 | Ga0307409_1000232265 | 158 |
| 591 | 3300032002 | Ga0307416_100037916 | Ga0307416_1000379163 | 158 |
| 592 | 3300039062 | Ga0400483_003006 | Ga0400483_003006_1068_1544 | 158 |
| 593 | 3300041507 | Ga0451851_1268479 | Ga0451851_1268479_80_556 | 158 |
| 594 | 3300044712 | Ga0453684_0041068 | Ga0453684_0041068_5199_5675 | 158 |
| 595 | 3300045051 | Ga0451576_0316807 | Ga0451576_0316807_108_584 | 158 |
| 596 | 3300049593 | Ga0501077_0757601 | Ga0501077_0757601_31_507 | 158 |
| 597 | 3300049669 | Ga0501235_133586 | Ga0501235_133586_141_617 | 158 |
| 598 | 3300061734 | Ga0530510_0537885 | Ga0530510_0537885_311_787 | 158 |
| 599 | 3300001904 | JGI24736J21556_1006931 | JGI24736J21556_10069311 | 159 |
| 600 | 3300001979 | JGI24740J21852_10046037 | JGI24740J21852_100460371 | 159 |
| 601 | 3300002067 | JGI24735J21928_10034707 | JGI24735J21928_100347072 | 159 |
| 602 | 3300002075 | JGI24738J21930_10000134 | JGI24738J21930_100001347 | 159 |
| 603 | 3300002737 | JGI25162J39368_1009221 | JGI25162J39368_10092211 | 159 |
| 604 | 3300003578 | Ga0006562J51391_1026967 | Ga0006562J51391_102696717 | 159 |
| 605 | 3300003578 | Ga0006562J51391_1026969 | Ga0006562J51391_10269695 | 159 |
| 606 | 3300005262 | Ga0065165_1001600 | Ga0065165_100160013 | 159 |
| 607 | 3300005327 | Ga0070658_10002151 | Ga0070658_1000215117 | 159 |
| 608 | 3300005335 | Ga0070666_10000001 | Ga0070666_10000001118 | 159 |
| 609 | 3300005344 | Ga0070661_100012331 | Ga0070661_1000123317 | 159 |
| 610 | 3300005344 | Ga0070661_100020178 | Ga0070661_1000201781 | 159 |
| 611 | 3300005367 | Ga0070667_100006964 | Ga0070667_1000069646 | 159 |
| 612 | 3300005436 | Ga0070713_100278234 | Ga0070713_1002782342 | 159 |
| 613 | 3300005436 | Ga0070713_100344861 | Ga0070713_1003448612 | 159 |
| 614 | 3300005439 | Ga0070711_101507507 | Ga0070711_1015075071 | 159 |
| 615 | 3300005440 | Ga0070705_100525476 | Ga0070705_1005254761 | 159 |
| 616 | 3300005455 | Ga0070663_100321872 | Ga0070663_1003218722 | 159 |
| 617 | 3300005467 | Ga0070706_101223212 | Ga0070706_1012232121 | 159 |
| 618 | 3300005546 | Ga0070696_100644576 | Ga0070696_1006445761 | 159 |
| 619 | 3300005548 | Ga0070665_100174034 | Ga0070665_1001740343 | 159 |
| 620 | 3300005577 | Ga0068857_100675440 | Ga0068857_1006754401 | 159 |
| 621 | 3300005842 | Ga0068858_100334273 | Ga0068858_1003342733 | 159 |
| 622 | 3300005843 | Ga0068860_100040218 | Ga0068860_1000402185 | 159 |
| 623 | 3300005844 | Ga0068862_100191160 | Ga0068862_1001911602 | 159 |
| 624 | 3300006028 | Ga0070717_10194523 | Ga0070717_101945231 | 159 |
| 625 | 3300006028 | Ga0070717_10373156 | Ga0070717_103731562 | 159 |
| 626 | 3300006163 | Ga0070715_10668246 | Ga0070715_106682461 | 159 |
| 627 | 3300006175 | Ga0070712_100215883 | Ga0070712_1002158832 | 159 |
| 628 | 3300006353 | Ga0075370_10003280 | Ga0075370_100032805 | 159 |
| 629 | 3300006358 | Ga0068871_101432345 | Ga0068871_1014323451 | 159 |
| 630 | 3300006844 | Ga0075428_100014713 | Ga0075428_1000147135 | 159 |
| 631 | 3300006846 | Ga0075430_100194747 | Ga0075430_1001947472 | 159 |
| 632 | 3300006847 | Ga0075431_100020748 | Ga0075431_1000207484 | 159 |
| 633 | 3300006871 | Ga0075434_100618681 | Ga0075434_1006186812 | 159 |
| 634 | 3300006880 | Ga0075429_100535692 | Ga0075429_1005356921 | 159 |
| 635 | 3300007788 | Ga0099795_10008350 | Ga0099795_100083503 | 159 |
| 636 | 3300007788 | Ga0099795_10054573 | Ga0099795_100545732 | 159 |
| 637 | 3300009036 | Ga0105244_10130145 | Ga0105244_101301452 | 159 |
| 638 | 3300009093 | Ga0105240_11944773 | Ga0105240_119447731 | 159 |
| 639 | 3300009101 | Ga0105247_10004311 | Ga0105247_100043112 | 159 |
| 640 | 3300009147 | Ga0114129_10007316 | Ga0114129_100073169 | 159 |
| 641 | 3300009147 | Ga0114129_11363296 | Ga0114129_113632961 | 159 |
| 642 | 3300009148 | Ga0105243_11510667 | Ga0105243_115106671 | 159 |
| 643 | 3300009545 | Ga0105237_10075974 | Ga0105237_100759742 | 159 |
| 644 | 3300009551 | Ga0105238_10000729 | Ga0105238_1000072932 | 159 |
| 645 | 3300009551 | Ga0105238_10016831 | Ga0105238_1001683112 | 159 |
| 646 | 3300010159 | Ga0099796_10033943 | Ga0099796_100339431 | 159 |
| 647 | 3300010375 | Ga0105239_10001310 | Ga0105239_1000131025 | 159 |
| 648 | 3300013104 | Ga0157370_10014299 | Ga0157370_1001429911 | 159 |
| 649 | 3300013104 | Ga0157370_10290784 | Ga0157370_102907842 | 159 |
| 650 | 3300013105 | Ga0157369_10006739 | Ga0157369_1000673913 | 159 |
| 651 | 3300013306 | Ga0163162_10002846 | Ga0163162_1000284613 | 159 |
| 652 | 3300013306 | Ga0163162_10196314 | Ga0163162_101963142 | 159 |
| 653 | 3300013308 | Ga0157375_10204716 | Ga0157375_102047165 | 159 |
| 654 | 3300014326 | Ga0157380_10323470 | Ga0157380_103234702 | 159 |
| 655 | 3300014497 | Ga0182008_10004786 | Ga0182008_100047868 | 159 |
| 656 | 3300014497 | Ga0182008_10041003 | Ga0182008_100410031 | 159 |
| 657 | 3300015261 | Ga0182006_1000041 | Ga0182006_100004112 | 159 |
| 658 | 3300015261 | Ga0182006_1000133 | Ga0182006_100013310 | 159 |
| 659 | 3300015262 | Ga0182007_10029244 | Ga0182007_100292442 | 159 |
| 660 | 3300015262 | Ga0182007_10085253 | Ga0182007_100852532 | 159 |
| 661 | 3300015265 | Ga0182005_1000257 | Ga0182005_100025726 | 159 |
| 662 | 3300015265 | Ga0182005_1000685 | Ga0182005_100068514 | 159 |
| 663 | 3300015265 | Ga0182005_1017371 | Ga0182005_10173711 | 159 |
| 664 | 3300017792 | Ga0163161_10002121 | Ga0163161_1000212115 | 159 |
| 665 | 3300021361 | Ga0213872_10084492 | Ga0213872_100844921 | 159 |
| 666 | 3300025226 | Ga0209674_100524 | Ga0209674_1005247 | 159 |
| 667 | 3300025233 | Ga0209437_102395 | Ga0209437_1023954 | 159 |
| 668 | 3300025254 | Ga0209148_1002008 | Ga0209148_10020088 | 159 |
| 669 | 3300025258 | Ga0209129_1001756 | Ga0209129_10017562 | 159 |
| 670 | 3300025299 | Ga0209256_1008385 | Ga0209256_10083857 | 159 |
| 671 | 3300025302 | Ga0207426_1040207 | Ga0207426_10402072 | 159 |
| 672 | 3300025900 | Ga0207710_10010942 | Ga0207710_100109422 | 159 |
| 673 | 3300025903 | Ga0207680_10000003 | Ga0207680_10000003167 | 159 |
| 674 | 3300025904 | Ga0207647_10000002 | Ga0207647_1000000266 | 159 |
| 675 | 3300025906 | Ga0207699_10604990 | Ga0207699_106049902 | 159 |
| 676 | 3300025909 | Ga0207705_10001085 | Ga0207705_1000108517 | 159 |
| 677 | 3300025910 | Ga0207684_10413903 | Ga0207684_104139031 | 159 |
| 678 | 3300025914 | Ga0207671_10041576 | Ga0207671_100415765 | 159 |
| 679 | 3300025915 | Ga0207693_10070023 | Ga0207693_100700232 | 159 |
| 680 | 3300025920 | Ga0207649_10011998 | Ga0207649_100119987 | 159 |
| 681 | 3300025920 | Ga0207649_10016528 | Ga0207649_100165284 | 159 |
| 682 | 3300025924 | Ga0207694_10000336 | Ga0207694_1000033616 | 159 |
| 683 | 3300025924 | Ga0207694_10093538 | Ga0207694_100935384 | 159 |
| 684 | 3300025928 | Ga0207700_10052810 | Ga0207700_100528103 | 159 |
| 685 | 3300025928 | Ga0207700_10424411 | Ga0207700_104244112 | 159 |
| 686 | 3300025981 | Ga0207640_11028750 | Ga0207640_110287502 | 159 |
| 687 | 3300025986 | Ga0207658_10239807 | Ga0207658_102398072 | 159 |
| 688 | 3300026035 | Ga0207703_10256521 | Ga0207703_102565213 | 159 |
| 689 | 3300026067 | Ga0207678_10314280 | Ga0207678_103142802 | 159 |
| 690 | 3300026116 | Ga0207674_11455515 | Ga0207674_114555151 | 159 |
| 691 | 3300028379 | Ga0268266_10000011 | Ga0268266_10000011140 | 159 |
| 692 | 3300028380 | Ga0268265_10127875 | Ga0268265_101278754 | 159 |
| 693 | 3300028381 | Ga0268264_10032087 | Ga0268264_100320875 | 159 |
| 694 | 3300031090 | Ga0265760_10066329 | Ga0265760_100663291 | 159 |
| 695 | 3300031731 | Ga0307405_10171222 | Ga0307405_101712221 | 159 |
| 696 | 3300031911 | Ga0307412_10006273 | Ga0307412_100062735 | 159 |
| 697 | 3300033180 | Ga0307510_10025234 | Ga0307510_100252347 | 159 |
| 698 | 3300035724 | Ga0373933_0120026 | Ga0373933_0120026_39_530 | 159 |
| 699 | 3300035725 | Ga0373947_0131280 | Ga0373947_0131280_966_1448 | 159 |
| 700 | 3300036401 | Ga0373937_0225514 | Ga0373937_0225514_1039_1530 | 159 |
| 701 | 3300037068 | Ga0373925_0185546 | Ga0373925_0185546_759_1241 | 159 |
| 702 | 3300037471 | Ga0395905_0034566 | Ga0395905_0034566_76_561 | 159 |
| 703 | 3300039447 | Ga0436361_0026274 | Ga0436361_0026274_1137_1622 | 159 |
| 704 | 3300039447 | Ga0436361_0188259 | Ga0436361_0188259_2938_3426 | 159 |
| 705 | 3300041404 | Ga0439436_0000004 | Ga0439436_0000004_3260_3739 | 159 |
| 706 | 3300041413 | Ga0439465_0004169 | Ga0439465_0004169_1208_1687 | 159 |
| 707 | 3300041494 | Ga0451837_0804861 | Ga0451837_0804861_17_496 | 159 |
| 708 | 3300042438 | Ga0439459_0002347 | Ga0439459_0002347_1819_2298 | 159 |
| 709 | 3300044656 | Ga0466969_0000832 | Ga0466969_0000832_5047_5532 | 159 |
| 710 | 3300044672 | Ga0466982_0000938 | Ga0466982_0000938_5937_6416 | 159 |
| 711 | 3300044684 | Ga0466966_0004925 | Ga0466966_0004925_952_1437 | 159 |
| 712 | 3300044693 | Ga0466961_0023027 | Ga0466961_0023027_3303_3788 | 159 |
| 713 | 3300044735 | Ga0466968_0000061 | Ga0466968_0000061_25921_26403 | 159 |
| 714 | 3300044842 | Ga0466957_0014896 | Ga0466957_0014896_1033_1512 | 159 |
| 715 | 3300045049 | Ga0466959_0000072 | Ga0466959_0000072_9174_9659 | 159 |
| 716 | 3300045836 | Ga0466958_0102175 | Ga0466958_0102175_136_621 | 159 |
| 717 | 3300046452 | Ga0495617_000085 | Ga0495617_000085_62434_62913 | 159 |
| 718 | 3300046452 | Ga0495617_000550 | Ga0495617_000550_14186_14665 | 159 |
| 719 | 3300046460 | Ga0495638_0000236 | Ga0495638_0000236_29625_30104 | 159 |
| 720 | 3300046460 | Ga0495638_0000754 | Ga0495638_0000754_29120_29599 | 159 |
| 721 | 3300046461 | Ga0495641_0459239 | Ga0495641_0459239_21_503 | 159 |
| 722 | 3300046471 | Ga0495650_0000191 | Ga0495650_0000191_53234_53713 | 159 |
| 723 | 3300046471 | Ga0495650_0007083 | Ga0495650_0007083_6000_6479 | 159 |
| 724 | 3300046471 | Ga0495650_0016818 | Ga0495650_0016818_3056_3535 | 159 |
| 725 | 3300046472 | Ga0495580_1002082 | Ga0495580_1002082_31_513 | 159 |
| 726 | 3300046474 | Ga0495605_0108397 | Ga0495605_0108397_591_1070 | 159 |
| 727 | 3300046491 | Ga0495584_0001936 | Ga0495584_0001936_9217_9696 | 159 |
| 728 | 3300046492 | Ga0495585_0005239 | Ga0495585_0005239_1169_1648 | 159 |
| 729 | 3300046492 | Ga0495585_0045531 | Ga0495585_0045531_314_793 | 159 |
| 730 | 3300046501 | Ga0495607_0000006 | Ga0495607_0000006_187774_188256 | 159 |
| 731 | 3300046501 | Ga0495607_0000131 | Ga0495607_0000131_50665_51144 | 159 |
| 732 | 3300046501 | Ga0495607_0054911 | Ga0495607_0054911_1515_1997 | 159 |
| 733 | 3300046507 | Ga0495606_0001253 | Ga0495606_0001253_5952_6431 | 159 |
| 734 | 3300046507 | Ga0495606_0001443 | Ga0495606_0001443_2871_3350 | 159 |
| 735 | 3300046507 | Ga0495606_0005058 | Ga0495606_0005058_3970_4449 | 159 |
| 736 | 3300046507 | Ga0495606_0031226 | Ga0495606_0031226_2938_3417 | 159 |
| 737 | 3300046507 | Ga0495606_0262916 | Ga0495606_0262916_231_710 | 159 |
| 738 | 3300046512 | Ga0495610_0002949 | Ga0495610_0002949_4458_4937 | 159 |
| 739 | 3300046512 | Ga0495610_0089717 | Ga0495610_0089717_101_580 | 159 |
| 740 | 3300046513 | Ga0495616_0000401 | Ga0495616_0000401_4758_5237 | 159 |
| 741 | 3300046513 | Ga0495616_0015631 | Ga0495616_0015631_3056_3535 | 159 |
| 742 | 3300046515 | Ga0495620_0000365 | Ga0495620_0000365_25951_26430 | 159 |
| 743 | 3300046515 | Ga0495620_0131360 | Ga0495620_0131360_238_717 | 159 |
| 744 | 3300046518 | Ga0495631_0009431 | Ga0495631_0009431_289_768 | 159 |
| 745 | 3300046518 | Ga0495631_0020021 | Ga0495631_0020021_314_793 | 159 |
| 746 | 3300046519 | Ga0495632_0000531 | Ga0495632_0000531_5900_6379 | 159 |
| 747 | 3300046519 | Ga0495632_0007769 | Ga0495632_0007769_5855_6334 | 159 |
| 748 | 3300046520 | Ga0495637_0006532 | Ga0495637_0006532_3456_3935 | 159 |
| 749 | 3300046522 | Ga0495643_0037770 | Ga0495643_0037770_14_493 | 159 |
| 750 | 3300046524 | Ga0495648_0000878 | Ga0495648_0000878_3489_3968 | 159 |
| 751 | 3300046524 | Ga0495648_0031592 | Ga0495648_0031592_2780_3259 | 159 |
| 752 | 3300046538 | Ga0495609_0004007 | Ga0495609_0004007_6394_6873 | 159 |
| 753 | 3300046616 | Ga0495668_0004627 | Ga0495668_0004627_5686_6165 | 159 |
| 754 | 3300046648 | Ga0495611_0000002 | Ga0495611_0000002_494832_495311 | 159 |
| 755 | 3300046648 | Ga0495611_0006414 | Ga0495611_0006414_386_865 | 159 |
| 756 | 3300046660 | Ga0495625_0000002 | Ga0495625_0000002_499317_499796 | 159 |
| 757 | 3300046660 | Ga0495625_0013448 | Ga0495625_0013448_5974_6453 | 159 |
| 758 | 3300046660 | Ga0495625_0429785 | Ga0495625_0429785_246_725 | 159 |
| 759 | 3300046665 | Ga0495661_0046789 | Ga0495661_0046789_369_848 | 159 |
| 760 | 3300046665 | Ga0495661_0142491 | Ga0495661_0142491_244_723 | 159 |
| 761 | 3300046691 | Ga0495670_0000227 | Ga0495670_0000227_22188_22667 | 159 |
| 762 | 3300046691 | Ga0495670_0002779 | Ga0495670_0002779_4375_4854 | 159 |
| 763 | 3300046691 | Ga0495670_0125706 | Ga0495670_0125706_205_684 | 159 |
| 764 | 3300046692 | Ga0495671_0002392 | Ga0495671_0002392_10915_11394 | 159 |
| 765 | 3300046694 | Ga0495649_0003337 | Ga0495649_0003337_3813_4292 | 159 |
| 766 | 3300046794 | Ga0495589_0000190 | Ga0495589_0000190_35455_35934 | 159 |
| 767 | 3300046810 | Ga0495660_0000437 | Ga0495660_0000437_5221_5700 | 159 |
| 768 | 3300046810 | Ga0495660_0000447 | Ga0495660_0000447_29120_29599 | 159 |
| 769 | 3300047321 | Ga0495676_0294856 | Ga0495676_0294856_537_1016 | 159 |
| 770 | 3300047323 | Ga0495683_0000679 | Ga0495683_0000679_15625_16104 | 159 |
| 771 | 3300047446 | Ga0495679_000003 | Ga0495679_000003_300607_301086 | 159 |
| 772 | 3300047469 | Ga0495673_0000004 | Ga0495673_0000004_1246611_1247090 | 159 |
| 773 | 3300047469 | Ga0495673_0000062 | Ga0495673_0000062_72851_73330 | 159 |
| 774 | 3300047469 | Ga0495673_0014368 | Ga0495673_0014368_682_1161 | 159 |
| 775 | 3300047470 | Ga0495681_0098538 | Ga0495681_0098538_713_1192 | 159 |
| 776 | 3300047472 | Ga0495686_0000426 | Ga0495686_0000426_7659_8141 | 159 |
| 777 | 3300047472 | Ga0495686_0001228 | Ga0495686_0001228_25904_26383 | 159 |
| 778 | 3300047472 | Ga0495686_0028923 | Ga0495686_0028923_257_736 | 159 |
| 779 | 3300048903 | Ga0496100_0034642 | Ga0496100_0034642_2178_2657 | 159 |
| 780 | 3300048904 | Ga0496101_0000807 | Ga0496101_0000807_12237_12716 | 159 |
| 781 | 3300048905 | Ga0496102_0417674 | Ga0496102_0417674_233_715 | 159 |
| 782 | 3300048909 | Ga0496106_0000168 | Ga0496106_0000168_9028_9507 | 159 |
| 783 | 3300048910 | Ga0496107_0260702 | Ga0496107_0260702_495_974 | 159 |
| 784 | 3300048919 | Ga0496116_0117442 | Ga0496116_0117442_34_516 | 159 |
| 785 | 3300048920 | Ga0496117_0015396 | Ga0496117_0015396_4089_4571 | 159 |
| 786 | 3300048920 | Ga0496117_0105616 | Ga0496117_0105616_1140_1622 | 159 |
| 787 | 3300048921 | Ga0496118_0002160 | Ga0496118_0002160_1262_1741 | 159 |
| 788 | 3300048921 | Ga0496118_0003450 | Ga0496118_0003450_15396_15878 | 159 |
| 789 | 3300048922 | Ga0496119_0026020 | Ga0496119_0026020_3505_3984 | 159 |
| 790 | 3300048924 | Ga0496121_0000116 | Ga0496121_0000116_102255_102734 | 159 |
| 791 | 3300048924 | Ga0496121_0004519 | Ga0496121_0004519_14672_15151 | 159 |
| 792 | 3300048924 | Ga0496121_0005025 | Ga0496121_0005025_3130_3609 | 159 |
| 793 | 3300048924 | Ga0496121_0034038 | Ga0496121_0034038_3665_4144 | 159 |
| 794 | 3300048924 | Ga0496121_0510861 | Ga0496121_0510861_230_709 | 159 |
| 795 | 3300048925 | Ga0496122_0026416 | Ga0496122_0026416_257_739 | 159 |
| 796 | 3300048925 | Ga0496122_0097560 | Ga0496122_0097560_211_690 | 159 |
| 797 | 3300048926 | Ga0496123_0021108 | Ga0496123_0021108_4046_4525 | 159 |
| 798 | 3300048926 | Ga0496123_0021504 | Ga0496123_0021504_3740_4219 | 159 |
| 799 | 3300048926 | Ga0496123_0023563 | Ga0496123_0023563_3926_4408 | 159 |
| 800 | 3300048927 | Ga0496124_0006663 | Ga0496124_0006663_6346_6828 | 159 |
| 801 | 3300048928 | Ga0496125_0085003 | Ga0496125_0085003_1011_1490 | 159 |
| 802 | 3300048928 | Ga0496125_0150581 | Ga0496125_0150581_734_1213 | 159 |
| 803 | 3300048929 | Ga0496126_0010165 | Ga0496126_0010165_2605_3084 | 159 |
| 804 | 3300048929 | Ga0496126_0068718 | Ga0496126_0068718_1406_1885 | 159 |
| 805 | 3300048929 | Ga0496126_0768188 | Ga0496126_0768188_183_662 | 159 |
| 806 | 3300049459 | Ga0495678_000019 | Ga0495678_000019_18439_18918 | 159 |
| 807 | 3300049460 | Ga0495682_0009177 | Ga0495682_0009177_847_1326 | 159 |
| 808 | 3300049571 | Ga0501034_0046998 | Ga0501034_0046998_524_1009 | 159 |
| 809 | 3300049579 | Ga0501043_0051472 | Ga0501043_0051472_198_683 | 159 |
| 810 | 3300049744 | Ga0501083_0244603 | Ga0501083_0244603_409_894 | 159 |
| 811 | 3300049823 | Ga0501044_0068761 | Ga0501044_0068761_2349_2831 | 159 |
| 812 | 3300050493 | nmdc:mga0k408_434685_c1 | nmdc:mga0k408_434685_c1_223_702 | 159 |
| 813 | 3300050496 | nmdc:mga07m45_4934_c1 | nmdc:mga07m45_4934_c1_4014_4493 | 159 |
| 814 | 3300050507 | nmdc:mga05p37_8922_c1 | nmdc:mga05p37_8922_c1_4063_4545 | 159 |
| 815 | 3300050508 | nmdc:mga09592_485568_c1 | nmdc:mga09592_485568_c1_553_1035 | 159 |
| 816 | 3300050509 | nmdc:mga0qj67_1232157_c1 | nmdc:mga0qj67_1232157_c1_18_554 | 159 |
| 817 | 3300050509 | nmdc:mga0qj67_179968_c1 | nmdc:mga0qj67_179968_c1_474_956 | 159 |
| 818 | 3300050510 | nmdc:mga06r32_18031_c1 | nmdc:mga06r32_18031_c1_1719_2201 | 159 |
| 819 | 3300050512 | nmdc:mga0n895_57402_c1 | nmdc:mga0n895_57402_c1_3235_3720 | 159 |
| 820 | 3300050516 | nmdc:mga0sz30_11202_c1 | nmdc:mga0sz30_11202_c1_949_1431 | 159 |
| 821 | 3300053087 | Ga0500643_000101 | Ga0500643_000101_10502_10981 | 159 |
| 822 | 3300053090 | Ga0500646_0018922 | Ga0500646_0018922_576_1055 | 159 |
| 823 | 3300053103 | Ga0500555_000584 | Ga0500555_000584_11082_11561 | 159 |
| 824 | 3300053121 | Ga0500607_000007 | Ga0500607_000007_94859_95338 | 159 |
| 825 | 3300053136 | Ga0500559_0001214 | Ga0500559_0001214_12847_13326 | 159 |
| 826 | 3300053160 | Ga0500633_0054274 | Ga0500633_0054274_226_705 | 159 |
| 827 | 3300053178 | Ga0500637_0016186 | Ga0500637_0016186_1345_1824 | 159 |
| 828 | 3300053730 | Ga0500645_014997 | Ga0500645_014997_269_748 | 159 |
| 829 | 3300053730 | Ga0500645_040269 | Ga0500645_040269_769_1248 | 159 |
| 830 | 3300059645 | Ga0587076_158354 | Ga0587076_158354_50_535 | 159 |
| 831 | 3300060353 | Ga0501082_0923000 | Ga0501082_0923000_155_646 | 159 |
| 832 | 3300061719 | Ga0466962_0015079 | Ga0466962_0015079_152_637 | 159 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4tob-assembly1.cif.gz_F | 1.95a resolution structure of bfrb (q151l) from pseudomonas aeruginosa | 0.9954 | 2 | 154 |
| 4tob-assembly1.cif.gz_W | 1.95a resolution structure of bfrb (q151l) from pseudomonas aeruginosa | 0.9951 | 2 | 154 |
| 5zur-assembly1.cif.gz_B | achromobacter dh1f bacterioferritin | 0.9931 | 1 | 155 |
| 4to9-assembly1.cif.gz_S | 2.0a resolution structure of bfrb (n148l) from pseudomonas aeruginosa | 0.993 | 2 | 156 |
| 4toc-assembly1.cif.gz_L | 2.25a resolution structure of iron bound bfrb (q151l) from pseudomonas aeruginosa | 0.9927 | 2 | 156 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0ABD3_1_158_1.20.1260.10 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9961 | 1 | 154 | 1.20.1260.10 |
| 5zurA00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9934 | 1 | 153 | 1.20.1260.10 |
| 5d8rA00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9916 | 1 | 156 | 1.20.1260.10 |
| 4am2B00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9914 | 1 | 159 | 1.20.1260.10 |
| 3is7J00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9905 | 3 | 156 | 1.20.1260.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X7R6Y5-F1-model_v4 | Bacterioferritin | 1.003 | 1 | 87 |
GO:0004322
GO:0005829 GO:0006826 GO:0006880 GO:0008199 GO:0020037 |
| AF-A0A2V9SKB7-F1-model_v4 | Bacterioferritin | 1.001 | 1 | 107 |
GO:0004322
GO:0005829 GO:0006826 GO:0006880 GO:0008199 GO:0020037 |
| AF-A0A529Y1N4-F1-model_v4 | Bacterioferritin | 1.001 | 1 | 87 |
GO:0004322
GO:0005829 GO:0006826 GO:0006880 GO:0008199 GO:0020037 |
| AF-A0A526RXZ1-F1-model_v4 | Bacterioferritin | 0.9996 | 1 | 102 |
GO:0004322
GO:0005829 GO:0006826 GO:0006880 GO:0008199 GO:0020037 |
| AF-A0A258LLL3-F1-model_v4 | Bacterioferritin | 0.9994 | 1 | 133 |
GO:0004322
GO:0005829 GO:0006826 GO:0006880 GO:0008199 GO:0020037 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar