F482553

General Info

Members Datasets Scaffolds Average Seq Length
828 508 784 210

Family's Representative Sequence

Representative Sequence 3300006051|Ga0075364_10193236|Ga0075364_101932362
Length 238
Sequence MTASPRIQEPRFQELGVVHRNIQRADAAAVEQLSRHGVSTVHEAMGRLGLMQPRIRPIYPLARCCGPAVTVLLQPGDNWMLHVAAEQIQPGDVVVAACTADSTDGFFGDLLATSFLSRGCRGLVIDGGVRDVRDLTEMNFPVFSRAIHAKGTIKATLGSVNVPVVCAGALVNPGDVVVADIDGVVVVPAHMAQQVSVAAQAREDNEHAKRQKLASGVLGLDMYAMREPLARAGLRYVD

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
3 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
4 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
5 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
6 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
7 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
8 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
9 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
10 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
11 2643221597 Microbacterium sp. Root180 Isolate Unclassified
12 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
13 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
14 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
15 2643221658 Variovorax sp. Root411 Isolate Unclassified
16 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
17 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
18 2738541277 Variovorax sp. GV051 Isolate Unclassified
19 2738541307 Variovorax sp. GV008 Isolate Unclassified
20 2738543013 Variovorax sp. BT01 Isolate Unclassified
21 2738543019 Variovorax sp. GV040 Isolate Unclassified
22 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
23 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
24 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
25 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
26 2851182111 Bosea sp. Tri-44 Isolate Nodule
27 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
28 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
29 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
30 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
31 2885198086 Variovorax sp. 679 Isolate Unclassified
32 2885211737 Variovorax sp. 553 Isolate Unclassified
33 2885266251 Ralstonia sp. SET104 Isolate Nodule
34 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
35 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
36 2919395869 Microbacterium resistens 2980 Isolate Unclassified
37 2928070936 Variovorax gossypii 1167 Isolate Unclassified
38 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
39 2929520902 Variovorax beijingensis 502 Isolate Unclassified
40 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
41 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
42 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
43 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
44 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
45 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
46 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
47 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
48 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
49 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
50 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
51 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
52 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
53 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
54 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
55 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
56 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
57 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
58 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
59 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
60 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
61 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
62 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
63 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
64 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
65 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
66 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
67 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
68 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
69 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
70 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
71 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
72 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
73 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
74 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
75 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
76 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
77 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
78 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
79 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
80 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
81 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
82 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
83 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
84 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
85 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
86 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
87 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
88 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
89 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
90 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
91 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
92 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
93 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
94 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
95 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
96 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
97 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
98 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
99 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
100 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
101 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
102 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
103 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
104 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
105 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
106 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
107 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
108 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
109 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
110 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
111 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
112 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
113 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
114 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
115 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
116 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
117 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
118 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
119 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
120 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
121 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
122 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
123 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
124 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
125 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
126 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
127 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
128 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
129 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
130 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
131 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
132 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
133 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
134 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
135 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
136 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
137 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
138 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
139 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
140 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
141 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
142 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
143 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
144 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
145 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
146 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
147 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
148 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
149 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
150 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
151 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
152 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
153 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
154 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
155 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
156 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
157 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
158 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
159 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
160 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
161 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
162 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
163 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
164 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
165 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
166 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
167 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
168 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
169 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
170 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
171 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
172 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
173 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
174 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
175 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
176 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
177 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
178 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
179 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
180 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
181 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
182 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
183 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
184 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
185 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
186 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
188 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
191 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
192 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
193 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
194 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
196 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
197 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
198 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
199 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
200 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
201 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
202 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
203 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
204 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
205 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
206 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
207 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
262 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
263 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
264 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
265 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
266 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
269 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
270 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
271 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
272 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
273 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
274 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
275 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
276 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
277 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
278 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
279 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
280 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
281 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
282 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
283 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
284 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
285 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
286 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
287 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
288 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
289 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
290 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
291 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
292 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
293 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
294 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
295 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
296 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
297 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
298 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
299 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
300 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
301 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
302 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
303 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
304 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
305 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
306 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
307 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
308 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
309 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
310 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
311 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
312 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
313 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
314 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
315 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
316 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
317 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
318 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
319 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
320 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
321 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
322 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
323 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
324 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
325 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
326 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
327 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
328 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
329 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
330 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
331 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
332 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
333 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
334 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
335 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
336 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
337 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
338 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
339 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
340 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
341 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
342 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
343 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
344 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
345 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
346 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
347 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
348 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
349 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
350 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
351 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
352 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
353 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
354 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
355 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
356 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
357 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
358 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
359 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
360 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
361 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
362 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
363 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
364 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
365 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
366 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
367 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
368 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
369 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
370 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
371 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
372 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
373 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
374 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
375 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
376 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
377 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
378 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
379 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
380 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
381 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
382 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
383 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
384 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
385 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
386 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
387 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
388 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
389 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
390 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
391 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
392 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
393 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
394 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
395 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
396 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
397 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
398 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
399 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
400 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
401 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
402 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
403 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
404 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
405 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
406 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
407 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
408 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
409 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
410 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
411 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
412 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
413 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
414 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
415 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
416 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
417 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
418 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
419 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
420 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
421 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
422 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
423 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
424 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
425 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
426 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
427 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
428 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
429 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
430 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
431 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
432 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
433 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
434 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
435 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
436 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
437 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
438 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
439 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
440 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
441 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
442 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
443 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
444 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
445 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
446 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
447 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
448 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
449 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
450 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
451 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
452 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
453 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
454 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
455 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
456 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
457 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
458 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
459 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
460 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
461 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
462 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
463 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
464 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
465 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
466 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
467 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
468 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
469 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
470 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
471 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
472 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
473 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
474 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
475 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
476 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
477 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
478 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
479 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
480 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
481 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
482 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
483 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
484 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
485 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
486 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
487 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
488 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
489 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
490 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
491 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
492 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
493 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
494 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
495 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
496 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
497 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
498 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
499 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
500 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
501 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
502 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
503 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
504 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
505 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
506 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
507 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
508 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.96
Metatranscriptomes 0.6
Isolates 5.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.03
Nodule 0.97
Rhizoplane 3.99
Rhizosphere 67.15
Stem 0
Stem Tuber 0
Unclassified 10.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214772979 2209111006 Bacteria 12601
2 ARcpr5oldR_c000279 3300000041 Bacteria 7583
3 ARSoilYngRDRAFT_c00279 3300000042 Bacteria 7581
4 ARcpr5yngRDRAFT_c000249 3300000043 Bacteria 7823
5 ARSoilOldRDRAFT_c000048 3300000044 Bacteria 25523
6 ARCol0oldRDRAFT_c00131 3300000045 Bacteria 6675
7 ARCol0yngRDRAFT_1000302 3300000652 Bacteria 7582
8 JGI24740J21852_10019006 3300001979 Bacteria 2426
9 JGI24739J22299_10000894 3300001989 Bacteria 11018
10 JGI24739J22299_10030805 3300001989 Bacteria 1858
11 JGI24743J22301_10044254 3300001991 Bacteria 898
12 JGI24735J21928_10041374 3300002067 Bacteria 1343
13 JGI24738J21930_10003008 3300002075 Bacteria 4309
14 JGI25156J39149_1015083 3300002705 Bacteria 1563
15 JGI25159J45721_1007113 3300002987 Bacteria 3252
16 JGI25151J46595_10000577 3300003187 Bacteria 32678
17 JGI25151J46595_10003021 3300003187 Bacteria 9562
18 JGI25165J46597_1000104 3300003214 Bacteria 152363
19 JGI25153J46596_10000515 3300003215 Bacteria 24363
20 JGI25153J46596_10002993 3300003215 Bacteria 9562
21 rootH1_10072304 3300003316 Bacteria 11888
22 rootH1_10072304 3300003323 Bacteria 1468
23 JGI25160J50197_1034686 3300003354 Bacteria 1249
24 Ga0006562J51391_1049413 3300003578 Bacteria 3810
25 Ga0006562J51391_1049414 3300003578 Bacteria 5540
26 Ga0006562J51391_1101676 3300003578 Bacteria 4950
27 Ga0006562J51391_1101677 3300003578 Bacteria 1887
28 Ga0006562J51391_1162870 3300003578 Bacteria 1322
29 Ga0055535_1000047 3300003761 Bacteria 139836
30 Ga0055529_1000193 3300003763 Bacteria 83459
31 Ga0055524_1001147 3300003775 Bacteria 15953
32 Ga0055536_1003357 3300003781 Bacteria 8644
33 Ga0055536_1004808 3300003781 Bacteria 6764
34 Ga0055534_1001653 3300003784 Bacteria 8599
35 Ga0055528_1012023 3300003790 Bacteria 3391
36 Ga0055530_10000311 3300003791 Bacteria 44214
37 Ga0055530_10015323 3300003791 Bacteria 2509
38 Ga0055540_1000754 3300003792 Bacteria 21953
39 Ga0055540_1001497 3300003792 Bacteria 13893
40 Ga0055540_1001826 3300003792 Bacteria 12052
41 Ga0055531_10001302 3300003794 Bacteria 18802
42 Ga0055531_10002563 3300003794 Bacteria 12070
43 Ga0065165_1002832 3300005262 Bacteria 13534
44 Ga0065165_1012709 3300005262 Bacteria 3407
45 Ga0065165_1031744 3300005262 Bacteria 1664
46 Ga0065717_1000124 3300005276 Bacteria 2934
47 Ga0065716_1001916 3300005277 Bacteria 2767
48 Ga0065714_10004847 3300005288 Bacteria 6992
49 Ga0065714_10141774 3300005288 Bacteria 1165
50 Ga0065704_10104541 3300005289 Bacteria 2137
51 Ga0065707_10207902 3300005295 Bacteria 1279
52 Ga0070676_10000192 3300005328 Bacteria 25516
53 Ga0070676_10001674 3300005328 Bacteria 11268
54 Ga0070670_100253635 3300005331 Bacteria 1533
55 Ga0070677_10002127 3300005333 Bacteria 6322
56 Ga0070677_10055875 3300005333 Bacteria 1613
57 Ga0068869_100000212 3300005334 Bacteria 30223
58 Ga0070680_100332941 3300005336 Bacteria 1290
59 Ga0070680_100683007 3300005336 Bacteria 883
60 Ga0068868_100001386 3300005338 Bacteria 16724
61 Ga0068868_100028693 3300005338 Bacteria 4257
62 Ga0070689_100185063 3300005340 Bacteria 1693
63 Ga0070692_10137658 3300005345 Bacteria 1379
64 Ga0070668_100005618 3300005347 Bacteria 9297
65 Ga0070669_100102905 3300005353 Bacteria 2157
66 Ga0070669_100665284 3300005353 Bacteria 877
67 Ga0070675_100005609 3300005354 Bacteria 9608
68 Ga0070675_100041359 3300005354 Bacteria 3765
69 Ga0070671_100010636 3300005355 Bacteria 7384
70 Ga0070671_100303396 3300005355 Bacteria 1360
71 Ga0070674_100011027 3300005356 Bacteria 5483
72 Ga0070673_100000011 3300005364 Bacteria 145332
73 Ga0070673_100112649 3300005364 Bacteria 2258
74 Ga0070688_100030695 3300005365 Bacteria 3227
75 Ga0070688_100275917 3300005365 Bacteria 1206
76 Ga0070659_100376212 3300005366 Bacteria 1195
77 Ga0070659_100389836 3300005366 Bacteria 1174
78 Ga0070667_100218920 3300005367 Bacteria 1694
79 Ga0070709_10562360 3300005434 Bacteria 874
80 Ga0070714_100987611 3300005435 Bacteria 819
81 Ga0070711_100001539 3300005439 Bacteria 12700
82 Ga0070705_100268733 3300005440 Bacteria 1206
83 Ga0070663_100165890 3300005455 Bacteria 1704
84 Ga0070678_100007462 3300005456 Bacteria 6493
85 Ga0070678_100117733 3300005456 Bacteria 2090
86 Ga0070662_100004161 3300005457 Bacteria 9107
87 Ga0070662_100047598 3300005457 Bacteria 3085
88 Ga0070662_100296302 3300005457 Bacteria 1313
89 Ga0068867_100000049 3300005459 Bacteria 72604
90 Ga0070685_10316947 3300005466 Bacteria 1056
91 Ga0070706_100003229 3300005467 Bacteria 16104
92 Ga0070707_100023650 3300005468 Bacteria 5812
93 Ga0070698_100818242 3300005471 Bacteria 876
94 Ga0070684_100421175 3300005535 Bacteria 1232
95 Ga0068853_100037051 3300005539 Bacteria 4148
96 Ga0068853_100132979 3300005539 Bacteria 2228
97 Ga0068853_100552427 3300005539 Bacteria 1091
98 Ga0068853_100602193 3300005539 Bacteria 1044
99 Ga0070672_100002374 3300005543 Bacteria 11915
100 Ga0070672_100064556 3300005543 Bacteria 2893
101 Ga0070672_100114971 3300005543 Bacteria 2197
102 Ga0070672_100179542 3300005543 Bacteria 1763
103 Ga0070686_100054526 3300005544 Bacteria 2557
104 Ga0070696_100090930 3300005546 Bacteria 2172
105 Ga0070665_100017168 3300005548 Bacteria 7262
106 Ga0070665_100387982 3300005548 Bacteria 1404
107 Ga0070704_100025931 3300005549 Bacteria 3865
108 Ga0068855_100331870 3300005563 Bacteria 1679
109 Ga0068855_100395882 3300005563 Bacteria 1514
110 Ga0068855_100768660 3300005563 Bacteria 1026
111 Ga0068854_100016693 3300005578 Bacteria 4898
112 Ga0068856_100093824 3300005614 Bacteria 2987
113 Ga0068856_100099117 3300005614 Bacteria 2904
114 Ga0068852_100028640 3300005616 Bacteria 4564
115 Ga0068852_100070212 3300005616 Bacteria 3072
116 Ga0068852_100160562 3300005616 Bacteria 2098
117 Ga0068852_100239950 3300005616 Bacteria 1731
118 Ga0068852_101218406 3300005616 Bacteria 774
119 Ga0068859_100041521 3300005617 Bacteria 4620
120 Ga0068859_100485626 3300005617 Bacteria 1331
121 Ga0068859_100536890 3300005617 Bacteria 1264
122 Ga0068864_100034309 3300005618 Bacteria 4315
123 Ga0068864_100280445 3300005618 Bacteria 1555
124 Ga0068866_10321126 3300005718 Bacteria 974
125 Ga0068861_100061248 3300005719 Bacteria 2887
126 Ga0068861_100073755 3300005719 Bacteria 2652
127 Ga0068863_100150622 3300005841 Bacteria 2226
128 Ga0068860_100018313 3300005843 Bacteria 6814
129 Ga0068860_101052116 3300005843 Bacteria 832
130 Ga0068862_100023967 3300005844 Bacteria 5116
131 Ga0081455_10000659 3300005937 Bacteria 44728
132 Ga0081455_10012116 3300005937 Bacteria 8619
133 Ga0081455_10082035 3300005937 Bacteria 2639
134 Ga0081540_1061171 3300005983 Bacteria 1797
135 Ga0081539_10045408 3300005985 Bacteria 2527
136 Ga0075365_10001917 3300006038 Bacteria 9807
137 Ga0075363_100004230 3300006048 Bacteria 6237
138 Ga0075363_100084546 3300006048 Bacteria 1740
139 Ga0075364_10036341 3300006051 Bacteria 3184
140 Ga0075364_10117219 3300006051 Bacteria 1780
141 Ga0075364_10148151 3300006051 Bacteria 1581
142 Ga0075364_10193236 3300006051 Bacteria 1379
143 Ga0075432_10000250 3300006058 Bacteria 14598
144 Ga0075432_10000268 3300006058 Bacteria 14347
145 Ga0075432_10021789 3300006058 Bacteria 2190
146 Ga0070716_100607335 3300006173 Bacteria 824
147 Ga0070712_100566230 3300006175 Bacteria 959
148 Ga0075362_10006104 3300006177 Bacteria 4465
149 Ga0075362_10025434 3300006177 Bacteria 2521
150 Ga0075367_10017641 3300006178 Bacteria 3922
151 Ga0075369_10024805 3300006186 Bacteria 2488
152 Ga0075369_10144235 3300006186 Bacteria 1087
153 Ga0075366_10001920 3300006195 Bacteria 10516
154 Ga0075370_10022952 3300006353 Bacteria 3432
155 Ga0075370_10023108 3300006353 Bacteria 3421
156 Ga0075370_10114864 3300006353 Bacteria 1565
157 Ga0075370_10241532 3300006353 Bacteria 1069
158 Ga0068871_100189138 3300006358 Bacteria 1773
159 Ga0075428_100014031 3300006844 Bacteria 8916
160 Ga0075430_100102446 3300006846 Bacteria 2390
161 Ga0075431_100005130 3300006847 Bacteria 12882
162 Ga0075434_100185304 3300006871 Bacteria 2102
163 Ga0075429_100022932 3300006880 Bacteria 5412
164 Ga0075429_100071205 3300006880 Bacteria 3027
165 Ga0068865_100000012 3300006881 Bacteria 145314
166 Ga0068865_100154035 3300006881 Bacteria 1746
167 Ga0075436_100230375 3300006914 Bacteria 1316
168 Ga0097620_100041523 3300006931 Bacteria 4620
169 Ga0097620_100485610 3300006931 Bacteria 1331
170 Ga0097620_100536936 3300006931 Bacteria 1264
171 Ga0079104_1000198 3300006946 Bacteria 84522
172 Ga0099826_10139611 3300006948 Bacteria 1402
173 Ga0075435_100078023 3300007076 Bacteria 2716
174 Ga0099794_10020302 3300007265 Bacteria 3005
175 Ga0105250_10000186 3300009092 Bacteria 53643
176 Ga0105240_10484581 3300009093 Bacteria 1378
177 Ga0105240_10655369 3300009093 Bacteria 1150
178 Ga0111539_10001617 3300009094 Bacteria 30090
179 Ga0111539_10166530 3300009094 Bacteria 2577
180 Ga0111539_10313312 3300009094 Bacteria 1826
181 Ga0105245_10000097 3300009098 Bacteria 84528
182 Ga0105245_10171428 3300009098 Bacteria 2067
183 Ga0105245_10839192 3300009098 Bacteria 958
184 Ga0105247_10196094 3300009101 Bacteria 1354
185 Ga0114129_10029501 3300009147 Bacteria 7770
186 Ga0105243_10000297 3300009148 Bacteria 55019
187 Ga0105243_10005763 3300009148 Bacteria 9618
188 Ga0105243_10041195 3300009148 Bacteria 3612
189 Ga0105243_10473404 3300009148 Bacteria 1180
190 Ga0105241_10309837 3300009174 Bacteria 1358
191 Ga0105242_10000645 3300009176 Bacteria 27285
192 Ga0105248_10008726 3300009177 Bacteria 11135
193 Ga0105248_11041570 3300009177 Bacteria 924
194 Ga0105237_10122526 3300009545 Bacteria 2594
195 Ga0105237_10129068 3300009545 Bacteria 2522
196 Ga0105237_10482638 3300009545 Bacteria 1246
197 Ga0105237_10537513 3300009545 Bacteria 1175
198 Ga0105238_10043549 3300009551 Bacteria 4541
199 Ga0105249_10000079 3300009553 Bacteria 139904
200 Ga0105249_10046536 3300009553 Bacteria 3948
201 Ga0105249_10355414 3300009553 Bacteria 1485
202 Ga0105239_10231697 3300010375 Bacteria 2072
203 Ga0105239_10928114 3300010375 Bacteria 999
204 Ga0105246_10006686 3300011119 Bacteria 7048
205 Ga0105246_10130385 3300011119 Bacteria 1877
206 Ga0157347_1005209 3300012502 Bacteria 1235
207 Ga0157338_1004523 3300012515 Bacteria 1206
208 Ga0157371_10096623 3300013102 Bacteria 2094
209 Ga0157370_10384107 3300013104 Bacteria 1293
210 Ga0157374_10000936 3300013296 Bacteria 25437
211 Ga0157378_10001079 3300013297 Bacteria 24942
212 Ga0157378_10215667 3300013297 Bacteria 1822
213 Ga0157378_10309204 3300013297 Bacteria 1532
214 Ga0157378_10489160 3300013297 Bacteria 1227
215 Ga0163162_10015009 3300013306 Bacteria 7566
216 Ga0163162_10063775 3300013306 Bacteria 3729
217 Ga0157372_10210917 3300013307 Bacteria 2251
218 Ga0157375_10000294 3300013308 Bacteria 45311
219 Ga0157375_10020347 3300013308 Bacteria 6060
220 Ga0163163_10024962 3300014325 Bacteria 5692
221 Ga0163163_10276740 3300014325 Bacteria 1730
222 Ga0157380_10264773 3300014326 Bacteria 1563
223 Ga0157380_10441420 3300014326 Bacteria 1247
224 Ga0182008_10013307 3300014497 Bacteria 4326
225 Ga0182008_10028241 3300014497 Bacteria 2837
226 Ga0182008_10259856 3300014497 Bacteria 898
227 Ga0157379_10000207 3300014968 Bacteria 45489
228 Ga0157376_10000251 3300014969 Bacteria 37177
229 Ga0163161_10020018 3300017792 Bacteria 4693
230 Ga0163161_10039167 3300017792 Bacteria 3401
231 Ga0163161_10119235 3300017792 Bacteria 1981
232 Ga0163161_10163405 3300017792 Bacteria 1699
233 Ga0213874_10138033 3300021377 Bacteria 842
234 Ga0209435_105843 3300025206 Bacteria 1377
235 Ga0209258_100072 3300025242 Bacteria 274355
236 Ga0209258_102632 3300025242 Bacteria 4459
237 Ga0207425_1001488 3300025245 Bacteria 9731
238 Ga0209677_100280 3300025253 Bacteria 34034
239 Ga0209148_1011479 3300025254 Bacteria 1644
240 Ga0209759_1002338 3300025256 Bacteria 8493
241 Ga0209759_1007262 3300025256 Bacteria 3590
242 Ga0209129_1001072 3300025258 Bacteria 16142
243 Ga0209129_1002187 3300025258 Bacteria 9834
244 Ga0209233_1002090 3300025261 Bacteria 7536
245 Ga0209565_1007550 3300025263 Bacteria 2922
246 Ga0209455_1000053 3300025272 Bacteria 365949
247 Ga0209455_1000337 3300025272 Bacteria 44758
248 Ga0209455_1011608 3300025272 Bacteria 2159
249 Ga0209673_1001087 3300025273 Bacteria 30591
250 Ga0209130_1002441 3300025284 Bacteria 9309
251 Ga0209675_1002042 3300025291 Bacteria 10779
252 Ga0209675_1007616 3300025291 Bacteria 4117
253 Ga0209675_1037851 3300025291 Bacteria 1080
254 Ga0209676_1000004 3300025292 Bacteria 1138360
255 Ga0209676_1000172 3300025292 Bacteria 153664
256 Ga0209025_1000432 3300025294 Bacteria 82875
257 Ga0209025_1005956 3300025294 Bacteria 9704
258 Ga0209564_1011501 3300025295 Bacteria 3958
259 Ga0209758_1004631 3300025297 Bacteria 11269
260 Ga0209050_1000002 3300025298 Bacteria 1792849
261 Ga0209050_1000509 3300025298 Bacteria 65792
262 Ga0209050_1001066 3300025298 Bacteria 33709
263 Ga0209050_1004407 3300025298 Bacteria 9528
264 Ga0209256_1000045 3300025299 Bacteria 325506
265 Ga0209256_1000460 3300025299 Bacteria 61538
266 Ga0207426_1000264 3300025302 Bacteria 110747
267 Ga0207426_1010976 3300025302 Bacteria 3481
268 Ga0209051_1000002 3300025303 Bacteria 1631846
269 Ga0209051_1000074 3300025303 Bacteria 208667
270 Ga0209051_1000096 3300025303 Bacteria 167399
271 Ga0209051_1000128 3300025303 Bacteria 142159
272 Ga0209257_1000002 3300025304 Bacteria 1767052
273 Ga0209257_1000072 3300025304 Bacteria 332791
274 Ga0209257_1061033 3300025304 Bacteria 1024
275 Ga0207697_10026585 3300025315 Bacteria 2366
276 Ga0207656_10008913 3300025321 Bacteria 3716
277 Ga0207696_1000072 3300025711 Bacteria 224214
278 Ga0207655_1005843 3300025728 Bacteria 8255
279 Ga0207653_10028609 3300025885 Bacteria 1793
280 Ga0207682_10012510 3300025893 Bacteria 3311
281 Ga0207688_10019333 3300025901 Bacteria 3709
282 Ga0207680_10067513 3300025903 Bacteria 2203
283 Ga0207647_10091381 3300025904 Bacteria 1815
284 Ga0207645_10001889 3300025907 Bacteria 16906
285 Ga0207645_10004586 3300025907 Bacteria 10186
286 Ga0207684_10043697 3300025910 Bacteria 3799
287 Ga0207654_10026739 3300025911 Bacteria 3128
288 Ga0207707_10334184 3300025912 Bacteria 1307
289 Ga0207707_10521598 3300025912 Bacteria 1012
290 Ga0207695_10140600 3300025913 Bacteria 2363
291 Ga0207671_10021491 3300025914 Bacteria 4895
292 Ga0207693_10022195 3300025915 Bacteria 5045
293 Ga0207693_10155913 3300025915 Bacteria 1796
294 Ga0207663_10111256 3300025916 Bacteria 1859
295 Ga0207663_10254355 3300025916 Bacteria 1294
296 Ga0207649_10374068 3300025920 Bacteria 1060
297 Ga0207652_10396192 3300025921 Bacteria 1246
298 Ga0207646_10046772 3300025922 Bacteria 3882
299 Ga0207681_10086205 3300025923 Bacteria 2231
300 Ga0207681_10285437 3300025923 Bacteria 1301
301 Ga0207681_10287099 3300025923 Bacteria 1297
302 Ga0207650_10339095 3300025925 Bacteria 1234
303 Ga0207659_10003624 3300025926 Bacteria 9300
304 Ga0207687_10002448 3300025927 Bacteria 12604
305 Ga0207687_10178042 3300025927 Bacteria 1645
306 Ga0207700_10305808 3300025928 Bacteria 1374
307 Ga0207664_10473574 3300025929 Bacteria 1120
308 Ga0207644_10037323 3300025931 Bacteria 3417
309 Ga0207690_10037333 3300025932 Bacteria 3154
310 Ga0207706_10033294 3300025933 Bacteria 4588
311 Ga0207706_10033883 3300025933 Bacteria 4546
312 Ga0207706_10320887 3300025933 Bacteria 1348
313 Ga0207686_10001355 3300025934 Bacteria 13947
314 Ga0207709_10000299 3300025935 Bacteria 54506
315 Ga0207709_10027366 3300025935 Bacteria 3284
316 Ga0207709_10122372 3300025935 Bacteria 1759
317 Ga0207709_10134028 3300025935 Bacteria 1692
318 Ga0207669_10155613 3300025937 Bacteria 1607
319 Ga0207669_10234580 3300025937 Bacteria 1356
320 Ga0207704_10000021 3300025938 Bacteria 148508
321 Ga0207704_10083009 3300025938 Bacteria 2078
322 Ga0207704_10129662 3300025938 Bacteria 1744
323 Ga0207665_10061487 3300025939 Bacteria 2546
324 Ga0207691_10000111 3300025940 Bacteria 72961
325 Ga0207691_10007985 3300025940 Bacteria 10177
326 Ga0207691_10147320 3300025940 Bacteria 2071
327 Ga0207689_10000132 3300025942 Bacteria 63321
328 Ga0207667_10068267 3300025949 Bacteria 3702
329 Ga0207667_10162547 3300025949 Bacteria 2296
330 Ga0207651_10000012 3300025960 Bacteria 189928
331 Ga0207651_10018903 3300025960 Bacteria 4115
332 Ga0207712_10000030 3300025961 Bacteria 216514
333 Ga0207712_10359199 3300025961 Bacteria 1213
334 Ga0207668_10037606 3300025972 Bacteria 3241
335 Ga0207668_10065476 3300025972 Bacteria 2572
336 Ga0207668_10276139 3300025972 Bacteria 1376
337 Ga0207668_10686525 3300025972 Bacteria 899
338 Ga0207658_10123062 3300025986 Bacteria 2071
339 Ga0207658_10305928 3300025986 Bacteria 1371
340 Ga0207658_10536505 3300025986 Bacteria 1046
341 Ga0207677_10000170 3300026023 Bacteria 51603
342 Ga0207677_10031837 3300026023 Bacteria 3382
343 Ga0207677_10212667 3300026023 Bacteria 1545
344 Ga0207703_10441896 3300026035 Bacteria 1213
345 Ga0207639_10155969 3300026041 Bacteria 1918
346 Ga0207639_10205825 3300026041 Bacteria 1691
347 Ga0207639_10476978 3300026041 Bacteria 1136
348 Ga0207639_10627407 3300026041 Bacteria 993
349 Ga0207678_10172887 3300026067 Bacteria 1844
350 Ga0207708_10008148 3300026075 Bacteria 7761
351 Ga0207702_10021218 3300026078 Bacteria 5376
352 Ga0207702_10199983 3300026078 Bacteria 1851
353 Ga0207641_10127641 3300026088 Bacteria 2279
354 Ga0207641_10151855 3300026088 Bacteria 2098
355 Ga0207641_10161713 3300026088 Bacteria 2036
356 Ga0207648_10000051 3300026089 Bacteria 108363
357 Ga0207648_10013752 3300026089 Bacteria 7513
358 Ga0207648_10078204 3300026089 Bacteria 2885
359 Ga0207648_10098622 3300026089 Bacteria 2558
360 Ga0207676_10086561 3300026095 Bacteria 2560
361 Ga0207676_10655273 3300026095 Bacteria 1013
362 Ga0207674_10181641 3300026116 Bacteria 2055
363 Ga0207675_100000071 3300026118 Bacteria 77575
364 Ga0207675_100024838 3300026118 Bacteria 5576
365 Ga0207675_100089563 3300026118 Bacteria 2892
366 Ga0207675_100222695 3300026118 Bacteria 1818
367 Ga0207683_10006288 3300026121 Bacteria 10178
368 Ga0207683_10084701 3300026121 Bacteria 2818
369 Ga0207698_10145305 3300026142 Bacteria 2050
370 Ga0207698_10395710 3300026142 Bacteria 1319
371 Ga0207698_10770574 3300026142 Bacteria 962
372 Ga0209281_1000457 3300027111 Bacteria 57515
373 Ga0209968_1008330 3300027526 Bacteria 1579
374 Ga0210002_1002746 3300027617 Bacteria 2552
375 Ga0209998_10032756 3300027717 Bacteria 1156
376 Ga0207428_10000506 3300027907 Bacteria 46593
377 Ga0207428_10004342 3300027907 Bacteria 13543
378 Ga0207428_10021454 3300027907 Bacteria 5470
379 Ga0207428_10207261 3300027907 Bacteria 1474
380 Ga0268266_10027683 3300028379 Bacteria 4819
381 Ga0268266_10062015 3300028379 Bacteria 3225
382 Ga0268264_10070355 3300028381 Bacteria 2962
383 Ga0268264_10357720 3300028381 Bacteria 1391
384 Ga0268264_10503636 3300028381 Bacteria 1181
385 Ga0265337_1001439 3300028556 Bacteria 11715
386 Ga0265326_10001380 3300028558 Bacteria 8553
387 Ga0265319_1002798 3300028563 Bacteria 9365
388 Ga0265334_10005260 3300028573 Bacteria 5665
389 Ga0265318_10003474 3300028577 Bacteria 7906
390 Ga0265323_10000992 3300028653 Bacteria 14760
391 Ga0265322_10002589 3300028654 Bacteria 5560
392 Ga0265336_10000063 3300028666 Bacteria 98413
393 Ga0307515_10028520 3300028794 Bacteria 9485
394 Ga0265338_10000154 3300028800 Bacteria 125708
395 Ga0265324_10001590 3300029957 Bacteria 12642
396 Ga0265324_10022835 3300029957 Bacteria 2233
397 Ga0265330_10052459 3300031235 Bacteria 1786
398 Ga0265340_10174371 3300031247 Bacteria 973
399 Ga0265339_10004845 3300031249 Bacteria 9093
400 Ga0265339_10055930 3300031249 Bacteria 2138
401 Ga0265331_10038744 3300031250 Bacteria 2328
402 Ga0307513_10188025 3300031456 Bacteria 1920
403 Ga0307513_10204466 3300031456 Bacteria 1812
404 Ga0307509_10127158 3300031507 Bacteria 2512
405 Ga0307509_10190737 3300031507 Bacteria 1901
406 Ga0307408_100000205 3300031548 Bacteria 63434
407 Ga0307408_100222351 3300031548 Bacteria 1541
408 Ga0307508_10014131 3300031616 Bacteria 7284
409 Ga0307514_10002374 3300031649 Bacteria 19732
410 Ga0316575_10055627 3300031665 Bacteria 1576
411 Ga0265314_10018231 3300031711 Bacteria 5478
412 Ga0265314_10202995 3300031711 Bacteria 1170
413 Ga0265342_10012785 3300031712 Bacteria 5668
414 Ga0307516_10432637 3300031730 Bacteria 973
415 Ga0316577_10022266 3300031733 Bacteria 3518
416 Ga0307410_10288207 3300031852 Bacteria 1291
417 Ga0307406_10000154 3300031901 Bacteria 40922
418 Ga0307406_10015406 3300031901 Bacteria 4423
419 Ga0307406_10352734 3300031901 Bacteria 1150
420 Ga0307407_10607521 3300031903 Bacteria 815
421 Ga0307412_10000876 3300031911 Bacteria 17305
422 Ga0307412_10076536 3300031911 Bacteria 2299
423 Ga0307412_10124972 3300031911 Bacteria 1859
424 Ga0307412_10430620 3300031911 Bacteria 1081
425 Ga0307412_10532345 3300031911 Bacteria 984
426 Ga0307412_10616015 3300031911 Bacteria 921
427 Ga0307409_100126228 3300031995 Bacteria 2177
428 Ga0307416_100012087 3300032002 Bacteria 5797
429 Ga0307416_100305892 3300032002 Bacteria 1583
430 Ga0307414_10364490 3300032004 Bacteria 1244
431 Ga0307414_10473345 3300032004 Bacteria 1103
432 Ga0307414_10539240 3300032004 Bacteria 1038
433 Ga0316580_10049610 3300032139 Bacteria 1293
434 Ga0307507_10044588 3300033179 Bacteria 4380
435 Ga0307510_10066040 3300033180 Bacteria 3656
436 Ga0307510_10288589 3300033180 Bacteria 1107
437 Ga0373930_0003273 3300034816 Bacteria 2561
438 Ga0373948_0000090 3300034817 Bacteria 9277
439 Ga0373950_0000160 3300034818 Bacteria 9783
440 Ga0373958_0003557 3300034819 Bacteria 2255
441 Ga0373959_0008220 3300034820 Bacteria 1770
442 Ga0373938_0008431 3300034957 Bacteria 1840
443 Ga0373928_0000463 3300035084 Bacteria 8020
444 Ga0373929_0005210 3300035085 Bacteria 2337
445 Ga0373940_0000121 3300035088 Bacteria 9849
446 Ga0373949_0000342 3300035090 Bacteria 16550
447 Ga0373949_0001402 3300035090 Bacteria 6913
448 Ga0373951_0000526 3300035091 Bacteria 10784
449 Ga0373952_0001660 3300035092 Bacteria 4050
450 Ga0373932_0000087 3300035112 Bacteria 24305
451 Ga0373939_0000357 3300035114 Bacteria 11592
452 Ga0373953_0246825 3300035117 Bacteria 775
453 Ga0373954_0003173 3300035118 Bacteria 6946
454 Ga0373957_0008409 3300035120 Bacteria 3341
455 Ga0373957_0175994 3300035120 Bacteria 885
456 Ga0373946_0084466 3300035171 Bacteria 1396
457 Ga0373942_0003123 3300035207 Bacteria 3918
458 Ga0373961_0000165 3300035241 Bacteria 32291
459 Ga0316574_0072432 3300035398 Bacteria 2177
460 Ga0373924_0023501 3300035410 Bacteria 2420
461 Ga0373924_0045399 3300035410 Bacteria 1807
462 Ga0373931_0023792 3300035691 Bacteria 3095
463 Ga0373935_0097527 3300035692 Bacteria 1934
464 Ga0373933_0076697 3300035724 Bacteria 2042
465 Ga0373933_0123419 3300035724 Bacteria 1623
466 Ga0373937_0000847 3300036401 Bacteria 26243
467 Ga0373937_0075852 3300036401 Bacteria 3104
468 Ga0316582_0000235 3300036647 Bacteria 18349
469 Ga0395900_0126698 3300037418 Bacteria 2619
470 Ga0395905_0093833 3300037471 Bacteria 2815
471 Ga0395905_0097558 3300037471 Bacteria 2759
472 Ga0395901_0043260 3300038443 Bacteria 4673
473 Ga0395901_0080987 3300038443 Bacteria 3391
474 Ga0237816_02303 3300039145 Bacteria 1471
475 Ga0436360_0404370 3300039438 Bacteria 677
476 Ga0436360_1192691 3300039438 Bacteria 3786
477 Ga0436361_0150699 3300039447 Bacteria 1752
478 Ga0436361_0682546 3300039447 Bacteria 3671
479 Ga0436363_1390579 3300039450 Bacteria 1257
480 Ga0436362_0896897 3300039453 Bacteria 1419
481 Ga0439465_0046973 3300041413 Bacteria 1406
482 Ga0439443_000271 3300042003 Bacteria 4177
483 Ga0439445_0024166 3300042004 Bacteria 1543
484 Ga0439455_0035826 3300042012 Bacteria 1254
485 Ga0450919_004672 3300042121 Bacteria 1668
486 Ga0450920_010942 3300042122 Bacteria 1685
487 Ga0450908_002803 3300042184 Bacteria 3389
488 Ga0439434_0085206 3300042435 Bacteria 1006
489 Ga0450918_001177 3300042531 Bacteria 5356
490 Ga0450918_001940 3300042531 Bacteria 3992
491 Ga0451577_0106470 3300042876 Bacteria 2507
492 Ga0466972_0019436 3300044658 Bacteria 3396
493 Ga0466965_0033467 3300044683 Bacteria 2512
494 Ga0466961_0032129 3300044693 Bacteria 3373
495 Ga0453684_0000583 3300044712 Bacteria 135940
496 Ga0453684_0082942 3300044712 Bacteria 3992
497 Ga0453684_0781780 3300044712 Bacteria 1031
498 Ga0451576_0000137 3300045051 Bacteria 185212
499 Ga0451576_0191636 3300045051 Bacteria 2135
500 Ga0451576_0900840 3300045051 Bacteria 928
501 Ga0466967_0050379 3300045976 Bacteria 3646
502 Ga0495627_030335 3300046453 Bacteria 1714
503 Ga0495592_0231026 3300046454 Bacteria 1231
504 Ga0495629_0045994 3300046459 Bacteria 3062
505 Ga0495629_0112667 3300046459 Bacteria 1896
506 Ga0495638_0000646 3300046460 Bacteria 38171
507 Ga0495651_0004621 3300046462 Bacteria 10527
508 Ga0495651_0061857 3300046462 Bacteria 2865
509 Ga0495651_0408938 3300046462 Bacteria 884
510 Ga0495653_0007505 3300046463 Bacteria 8918
511 Ga0495653_0056447 3300046463 Bacteria 2993
512 Ga0495580_0271119 3300046472 Bacteria 1159
513 Ga0495582_0194417 3300046473 Bacteria 1158
514 Ga0495662_0131568 3300046476 Bacteria 1230
515 Ga0495664_0066527 3300046477 Bacteria 2149
516 Ga0495664_0066699 3300046477 Bacteria 2147
517 Ga0495664_0082271 3300046477 Bacteria 1931
518 Ga0495596_0000782 3300046500 Bacteria 19374
519 Ga0495607_0043870 3300046501 Bacteria 2641
520 Ga0495583_0000418 3300046506 Bacteria 64708
521 Ga0495606_0036792 3300046507 Bacteria 3330
522 Ga0495606_0059450 3300046507 Bacteria 2452
523 Ga0495606_0298905 3300046507 Bacteria 873
524 Ga0495608_0261302 3300046511 Bacteria 1078
525 Ga0495610_0005638 3300046512 Bacteria 8831
526 Ga0495610_0092814 3300046512 Bacteria 1365
527 Ga0495616_0000877 3300046513 Bacteria 21821
528 Ga0495616_0075514 3300046513 Bacteria 1622
529 Ga0495618_0081888 3300046514 Bacteria 2061
530 Ga0495620_0037103 3300046515 Bacteria 2174
531 Ga0495620_0047835 3300046515 Bacteria 1838
532 Ga0495628_0007404 3300046516 Bacteria 9502
533 Ga0495628_0009719 3300046516 Bacteria 8205
534 Ga0495628_0179993 3300046516 Bacteria 1599
535 Ga0495630_0011854 3300046517 Bacteria 6318
536 Ga0495630_0096003 3300046517 Bacteria 2241
537 Ga0495630_0126739 3300046517 Bacteria 1938
538 Ga0495631_0000620 3300046518 Bacteria 23340
539 Ga0495632_0188677 3300046519 Bacteria 942
540 Ga0495637_0098427 3300046520 Bacteria 1146
541 Ga0495648_0000865 3300046524 Bacteria 31943
542 Ga0495642_0044967 3300046528 Bacteria 1804
543 Ga0495642_0091339 3300046528 Bacteria 1289
544 Ga0495652_0002605 3300046529 Bacteria 18448
545 Ga0495652_0005313 3300046529 Bacteria 12146
546 Ga0495654_0062205 3300046530 Bacteria 1790
547 Ga0495654_0129154 3300046530 Bacteria 1136
548 Ga0495665_0000331 3300046531 Bacteria 23974
549 Ga0495640_0034294 3300046533 Bacteria 3600
550 Ga0495640_0215541 3300046533 Bacteria 1212
551 Ga0495587_0003463 3300046536 Bacteria 10519
552 Ga0495587_0225087 3300046536 Bacteria 1057
553 Ga0495609_0083879 3300046538 Bacteria 1391
554 Ga0495645_0030687 3300046543 Bacteria 3916
555 Ga0495645_0095615 3300046543 Bacteria 2118
556 Ga0495645_0137696 3300046543 Bacteria 1706
557 Ga0495622_0114732 3300046557 Bacteria 1232
558 Ga0495667_0012622 3300046559 Bacteria 5727
559 Ga0495656_0000383 3300046615 Bacteria 14729
560 Ga0495634_0567927 3300046642 Bacteria 660
561 Ga0495625_0000056 3300046660 Bacteria 186024
562 Ga0495625_0184886 3300046660 Bacteria 1383
563 Ga0495625_0320335 3300046660 Bacteria 987
564 Ga0495635_0018536 3300046663 Bacteria 4856
565 Ga0495661_0056820 3300046665 Bacteria 2339
566 Ga0495588_0054766 3300046674 Bacteria 2058
567 Ga0495588_0094645 3300046674 Bacteria 1566
568 Ga0495588_0122925 3300046674 Bacteria 1368
569 Ga0495657_0005167 3300046675 Bacteria 10338
570 Ga0495599_0052640 3300046678 Bacteria 2550
571 Ga0495599_0102611 3300046678 Bacteria 1782
572 Ga0495599_0118913 3300046678 Bacteria 1643
573 Ga0495623_0006437 3300046679 Bacteria 7639
574 Ga0495623_0020874 3300046679 Bacteria 4233
575 Ga0495623_0023896 3300046679 Bacteria 3943
576 Ga0495646_0001657 3300046680 Bacteria 13308
577 Ga0495646_0059596 3300046680 Bacteria 2279
578 Ga0495646_0106489 3300046680 Bacteria 1601
579 Ga0495646_0439346 3300046680 Bacteria 675
580 Ga0495658_0094675 3300046683 Bacteria 1774
581 Ga0495613_0190236 3300046689 Bacteria 1451
582 Ga0495613_0333903 3300046689 Bacteria 1044
583 Ga0495613_0550108 3300046689 Bacteria 772
584 Ga0495624_0087548 3300046690 Bacteria 1923
585 Ga0495624_0200374 3300046690 Bacteria 1213
586 Ga0495671_0006764 3300046692 Bacteria 6598
587 Ga0495649_0000599 3300046694 Bacteria 30033
588 Ga0495589_0005432 3300046794 Bacteria 6725
589 Ga0495600_0002461 3300046809 Bacteria 10629
590 Ga0495600_0238865 3300046809 Bacteria 1158
591 Ga0495581_0107234 3300047315 Bacteria 1624
592 Ga0495581_0167415 3300047315 Bacteria 1285
593 Ga0495604_0001823 3300047317 Bacteria 17347
594 Ga0495604_0006469 3300047317 Bacteria 9292
595 Ga0495636_0003446 3300047318 Bacteria 6139
596 Ga0495674_0003950 3300047319 Bacteria 14380
597 Ga0495674_0007892 3300047319 Bacteria 10161
598 Ga0495674_0080289 3300047319 Bacteria 2799
599 Ga0495672_0109801 3300047320 Bacteria 1482
600 Ga0495676_0091166 3300047321 Bacteria 2279
601 Ga0495676_0310915 3300047321 Bacteria 1060
602 Ga0495680_0001202 3300047322 Bacteria 28406
603 Ga0495680_0001849 3300047322 Bacteria 22313
604 Ga0495680_0133909 3300047322 Bacteria 1818
605 Ga0495675_0013433 3300047444 Bacteria 5169
606 Ga0495675_0025572 3300047444 Bacteria 3763
607 Ga0495675_0032794 3300047444 Bacteria 3313
608 Ga0495675_0062704 3300047444 Bacteria 2353
609 Ga0495685_138388 3300047447 Bacteria 794
610 Ga0495684_0165386 3300047471 Bacteria 1648
611 Ga0495684_0184891 3300047471 Bacteria 1543
612 Ga0495686_0000062 3300047472 Bacteria 235234
613 Ga0495686_0035909 3300047472 Bacteria 3182
614 Ga0495686_0069259 3300047472 Bacteria 2175
615 Ga0495593_0000855 3300047673 Bacteria 17646
616 Ga0495593_0103328 3300047673 Bacteria 1460
617 Ga0495593_0138255 3300047673 Bacteria 1234
618 Ga0495602_0001702 3300048088 Bacteria 21886
619 Ga0495602_0007968 3300048088 Bacteria 11068
620 Ga0495602_0261813 3300048088 Bacteria 1282
621 Ga0495614_0003366 3300048089 Bacteria 7147
622 Ga0495615_0034129 3300048090 Bacteria 1236
623 Ga0495626_0000826 3300048091 Bacteria 27802
624 Ga0496100_0058813 3300048903 Bacteria 2524
625 Ga0496100_0289682 3300048903 Bacteria 1223
626 Ga0496101_0018225 3300048904 Bacteria 4771
627 Ga0496101_0068383 3300048904 Bacteria 2597
628 Ga0496101_0080656 3300048904 Bacteria 2404
629 Ga0496101_0090807 3300048904 Bacteria 2272
630 Ga0496102_0385695 3300048905 Bacteria 1318
631 Ga0496102_0561829 3300048905 Bacteria 1064
632 Ga0496103_0056945 3300048906 Bacteria 2427
633 Ga0496103_0057538 3300048906 Bacteria 2414
634 Ga0496104_0040440 3300048907 Bacteria 4369
635 Ga0496104_0057335 3300048907 Bacteria 3685
636 Ga0496104_0150355 3300048907 Bacteria 2235
637 Ga0496105_0087785 3300048908 Bacteria 2569
638 Ga0496105_0379747 3300048908 Bacteria 1124
639 Ga0496106_0063386 3300048909 Bacteria 2809
640 Ga0496108_0152845 3300048911 Bacteria 1992
641 Ga0496108_0458423 3300048911 Bacteria 1114
642 Ga0496109_0381997 3300048912 Bacteria 1330
643 Ga0496109_0390899 3300048912 Bacteria 1314
644 Ga0496112_0000004 3300048915 Bacteria 553294
645 Ga0496112_0016075 3300048915 Bacteria 6997
646 Ga0496112_0058928 3300048915 Bacteria 3783
647 Ga0496112_0110949 3300048915 Bacteria 2713
648 Ga0496112_0677570 3300048915 Bacteria 960
649 Ga0496113_0061589 3300048916 Bacteria 2832
650 Ga0496113_0317348 3300048916 Bacteria 1249
651 Ga0496114_0031119 3300048917 Bacteria 4390
652 Ga0496115_0218288 3300048918 Bacteria 1574
653 Ga0496116_0000017 3300048919 Bacteria 554463
654 Ga0496116_0005353 3300048919 Bacteria 11950
655 Ga0496116_0006031 3300048919 Bacteria 11095
656 Ga0496117_0022285 3300048920 Bacteria 5085
657 Ga0496117_0123324 3300048920 Bacteria 1587
658 Ga0496117_0266831 3300048920 Bacteria 924
659 Ga0496118_0049440 3300048921 Bacteria 3238
660 Ga0496118_0063583 3300048921 Bacteria 2714
661 Ga0496118_0073574 3300048921 Bacteria 2447
662 Ga0496118_0109343 3300048921 Bacteria 1840
663 Ga0496118_0146325 3300048921 Bacteria 1487
664 Ga0496118_0172262 3300048921 Bacteria 1320
665 Ga0496119_0081454 3300048922 Bacteria 1864
666 Ga0496120_0164501 3300048923 Bacteria 1103
667 Ga0496121_0005300 3300048924 Bacteria 16598
668 Ga0496121_0029822 3300048924 Bacteria 5028
669 Ga0496121_0190993 3300048924 Bacteria 1468
670 Ga0496121_0312070 3300048924 Bacteria 1062
671 Ga0496121_0344565 3300048924 Bacteria 994
672 Ga0496122_0001063 3300048925 Bacteria 47771
673 Ga0496122_0003783 3300048925 Bacteria 19501
674 Ga0496122_0010744 3300048925 Bacteria 9391
675 Ga0496122_0137604 3300048925 Bacteria 1535
676 Ga0496122_0217627 3300048925 Bacteria 1099
677 Ga0496123_0000246 3300048926 Bacteria 109397
678 Ga0496123_0000389 3300048926 Bacteria 82399
679 Ga0496123_0036404 3300048926 Bacteria 3491
680 Ga0496123_0062416 3300048926 Bacteria 2388
681 Ga0496123_0106989 3300048926 Bacteria 1610
682 Ga0496124_0033617 3300048927 Bacteria 4509
683 Ga0496124_0299403 3300048927 Bacteria 1163
684 Ga0496125_0000060 3300048928 Bacteria 264143
685 Ga0496125_0004628 3300048928 Bacteria 15725
686 Ga0496125_0065181 3300048928 Bacteria 2888
687 Ga0496125_0089835 3300048928 Bacteria 2308
688 Ga0496125_0162767 3300048928 Bacteria 1513
689 Ga0496126_0056230 3300048929 Bacteria 3557
690 Ga0496126_0087236 3300048929 Bacteria 2749
691 Ga0496126_0115548 3300048929 Bacteria 2333
692 Ga0496126_0148246 3300048929 Bacteria 2013
693 Ga0501032_0033975 3300049569 Bacteria 3492
694 Ga0501034_0006090 3300049571 Bacteria 13019
695 Ga0501036_0071806 3300049572 Bacteria 2926
696 Ga0501038_0045248 3300049574 Bacteria 3821
697 Ga0501039_0070467 3300049575 Bacteria 2716
698 Ga0501047_0156393 3300049581 Bacteria 2153
699 Ga0501075_0157363 3300049591 Bacteria 1733
700 Ga0501076_0054797 3300049592 Bacteria 3161
701 Ga0501217_034905 3300049661 Bacteria 1256
702 Ga0501083_0206207 3300049744 Bacteria 1282
703 Ga0501044_0030190 3300049823 Bacteria 5713
704 nmdc:mga03683_3366_c1 3300050489 Bacteria 5145
705 nmdc:mga03683_40835_c2 3300050489 Bacteria 1174
706 nmdc:mga03n38_366325_c1 3300050490 Bacteria 787
707 nmdc:mga03n38_6245_c1 3300050490 Bacteria 4125
708 nmdc:mga00v17_188799_c1 3300050491 Bacteria 1330
709 nmdc:mga00v17_195_c1 3300050491 Bacteria 36325
710 nmdc:mga00v17_27373_c1 3300050491 Bacteria 3328
711 nmdc:mga00v17_517750_c1 3300050491 Bacteria 773
712 nmdc:mga0yw44_6339_c1 3300050492 Bacteria 5709
713 nmdc:mga0k408_2031_c1 3300050493 Bacteria 10832
714 nmdc:mga0k408_2540_c1 3300050493 Bacteria 9702
715 nmdc:mga06z11_30436_c1 3300050494 Bacteria 2612
716 nmdc:mga06z11_46832_c1 3300050494 Bacteria 2193
717 nmdc:mga07m45_193112_c1 3300050496 Bacteria 1184
718 nmdc:mga07m45_29641_c1 3300050496 Bacteria 3028
719 nmdc:mga07m45_359608_c1 3300050496 Bacteria 846
720 nmdc:mga07m45_39287_c1 3300050496 Bacteria 2644
721 nmdc:mga05p37_219_c1 3300050507 Bacteria 57577
722 nmdc:mga05p37_33643_c1 3300050507 Bacteria 6278
723 nmdc:mga0qj67_11735_c1 3300050509 Bacteria 6575
724 nmdc:mga0qj67_698465_c1 3300050509 Bacteria 807
725 nmdc:mga06r32_36396_c1 3300050510 Bacteria 4650
726 nmdc:mga06r32_92393_c1 3300050510 Bacteria 2959
727 nmdc:mga08y16_3461_c1 3300050511 Bacteria 16385
728 nmdc:mga08y16_50855_c1 3300050511 Bacteria 4336
729 nmdc:mga08y16_94115_c1 3300050511 Bacteria 3122
730 nmdc:mga0n895_3422_c1 3300050512 Bacteria 12798
731 nmdc:mga0n895_610285_c1 3300050512 Bacteria 1093
732 nmdc:mga0rr50_538008_c1 3300050513 Bacteria 994
733 nmdc:mga0rr50_97418_c1 3300050513 Bacteria 2303
734 nmdc:mga08x19_216990_c1 3300050514 Bacteria 1314
735 nmdc:mga0a205_555746_c1 3300050515 Bacteria 1003
736 nmdc:mga0a205_81906_c1 3300050515 Bacteria 3118
737 nmdc:mga0sz30_107433_c1 3300050516 Bacteria 1221
738 nmdc:mga0sz30_3474_c2 3300050516 Bacteria 4650
739 Ga0495601_0072215 3300053077 Bacteria 2205
740 Ga0495601_0234724 3300053077 Bacteria 1197
741 Ga0495612_0029214 3300053078 Bacteria 2220
742 Ga0500610_0001170 3300053079 Bacteria 8670
743 Ga0500610_0007937 3300053079 Bacteria 4590
744 Ga0500610_0211737 3300053079 Bacteria 925
745 Ga0495595_0099306 3300053084 Bacteria 1403
746 Ga0500643_007434 3300053087 Bacteria 4419
747 Ga0500643_017749 3300053087 Bacteria 2376
748 Ga0500644_0007939 3300053088 Bacteria 2782
749 Ga0500646_0008184 3300053090 Bacteria 2674
750 Ga0500646_0057799 3300053090 Bacteria 1134
751 Ga0500651_0000087 3300053093 Bacteria 59423
752 Ga0500651_0046532 3300053093 Bacteria 2729
753 Ga0500566_0003255 3300053094 Bacteria 9709
754 Ga0500562_051227 3300053108 Bacteria 1104
755 Ga0500569_022573 3300053109 Bacteria 1678
756 Ga0500571_000055 3300053110 Bacteria 35434
757 Ga0500592_003596 3300053116 Bacteria 2475
758 Ga0500592_012497 3300053116 Bacteria 1360
759 Ga0500593_000202 3300053117 Bacteria 24296
760 Ga0500594_0030330 3300053118 Bacteria 1419
761 Ga0500595_083464 3300053119 Bacteria 932
762 Ga0500607_000181 3300053121 Bacteria 56273
763 Ga0500608_038217 3300053122 Bacteria 2295
764 Ga0500608_171737 3300053122 Bacteria 928
765 Ga0500618_041008 3300053125 Bacteria 1063
766 Ga0500621_133588 3300053126 Bacteria 949
767 Ga0500626_123769 3300053128 Bacteria 1103
768 Ga0500642_0000016 3300053130 Bacteria 176560
769 Ga0500655_005280 3300053133 Bacteria 2333
770 Ga0500658_0002013 3300053134 Bacteria 7936
771 Ga0500658_0002588 3300053134 Bacteria 6994
772 Ga0500658_0148822 3300053134 Bacteria 1054
773 Ga0500564_058575 3300053138 Bacteria 1750
774 Ga0500568_0009293 3300053139 Bacteria 4681
775 Ga0500574_016275 3300053141 Bacteria 1793
776 Ga0500577_0000062 3300053142 Bacteria 24421
777 Ga0500603_001268 3300053150 Bacteria 5816
778 Ga0500627_0014048 3300053158 Bacteria 3057
779 Ga0500627_0257707 3300053158 Bacteria 770
780 Ga0500636_0220877 3300053177 Bacteria 987
781 Ga0500637_0200711 3300053178 Bacteria 1136
782 Ga0500645_007452 3300053730 Bacteria 3808
783 Ga0500596_017492 3300053735 Bacteria 1075
784 Ga0500661_015830 3300055283 Bacteria 1351

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039438 Ga0436360_0404370 Ga0436360_0404370_12_596 162
2 3300046513 Ga0495616_0075514 Ga0495616_0075514_31_615 162
3 3300046519 Ga0495632_0188677 Ga0495632_0188677_300_884 162
4 3300046642 Ga0495634_0567927 Ga0495634_0567927_37_621 162
5 3300046680 Ga0495646_0439346 Ga0495646_0439346_80_664 162
6 3300048906 Ga0496103_0057538 Ga0496103_0057538_17_601 162
7 3300049661 Ga0501217_034905 Ga0501217_034905_629_1213 162
8 3300050490 nmdc:mga03n38_366325_c1 nmdc:mga03n38_366325_c1_79_660 167
9 3300049744 Ga0501083_0206207 Ga0501083_0206207_666_1268 168
10 3300053090 Ga0500646_0057799 Ga0500646_0057799_513_1124 171
11 3300053109 Ga0500569_022573 Ga0500569_022573_1054_1665 171
12 3300053119 Ga0500595_083464 Ga0500595_083464_11_622 171
13 3300053158 Ga0500627_0257707 Ga0500627_0257707_12_623 171
14 3300044658 Ga0466972_0019436 Ga0466972_0019436_57_731 174
15 3300003354 JGI25160J50197_1034686 JGI25160J50197_10346862 176
16 3300013104 Ga0157370_10384107 Ga0157370_103841072 177
17 3300017792 Ga0163161_10163405 Ga0163161_101634052 181
18 3300031456 Ga0307513_10204466 Ga0307513_102044662 181
19 3300025256 Ga0209759_1007262 Ga0209759_10072622 182
20 3300005578 Ga0068854_100016693 Ga0068854_1000166932 184
21 3300031456 Ga0307513_10188025 Ga0307513_101880252 184
22 3300031616 Ga0307508_10014131 Ga0307508_100141314 184
23 3300031730 Ga0307516_10432637 Ga0307516_104326372 184
24 3300033180 Ga0307510_10066040 Ga0307510_100660402 184
25 3300033180 Ga0307510_10288589 Ga0307510_102885892 184
26 3300046506 Ga0495583_0000418 Ga0495583_0000418_7197_7883 184
27 3300046507 Ga0495606_0036792 Ga0495606_0036792_332_1018 184
28 3300046694 Ga0495649_0000599 Ga0495649_0000599_25022_25708 184
29 3300046794 Ga0495589_0005432 Ga0495589_0005432_4465_5151 184
30 3300001979 JGI24740J21852_10019006 JGI24740J21852_100190062 185
31 3300001989 JGI24739J22299_10000894 JGI24739J22299_100008943 185
32 3300001991 JGI24743J22301_10044254 JGI24743J22301_100442542 185
33 3300002067 JGI24735J21928_10041374 JGI24735J21928_100413742 185
34 3300002075 JGI24738J21930_10003008 JGI24738J21930_100030084 185
35 3300005328 Ga0070676_10000192 Ga0070676_1000019219 185
36 3300005334 Ga0068869_100000212 Ga0068869_10000021229 185
37 3300005338 Ga0068868_100001386 Ga0068868_1000013866 185
38 3300005364 Ga0070673_100000011 Ga0070673_10000001136 185
39 3300005457 Ga0070662_100004161 Ga0070662_1000041614 185
40 3300005459 Ga0068867_100000049 Ga0068867_10000004934 185
41 3300005539 Ga0068853_100037051 Ga0068853_1000370514 185
42 3300005543 Ga0070672_100114971 Ga0070672_1001149713 185
43 3300005616 Ga0068852_101218406 Ga0068852_1012184061 185
44 3300006881 Ga0068865_100000012 Ga0068865_10000001288 185
45 3300009093 Ga0105240_10655369 Ga0105240_106553692 185
46 3300009098 Ga0105245_10000097 Ga0105245_1000009714 185
47 3300009148 Ga0105243_10000297 Ga0105243_1000029736 185
48 3300009176 Ga0105242_10000645 Ga0105242_100006457 185
49 3300009551 Ga0105238_10043549 Ga0105238_100435492 185
50 3300011119 Ga0105246_10006686 Ga0105246_100066867 185
51 3300013296 Ga0157374_10000936 Ga0157374_100009365 185
52 3300013297 Ga0157378_10001079 Ga0157378_100010795 185
53 3300013308 Ga0157375_10000294 Ga0157375_1000029414 185
54 3300014969 Ga0157376_10000251 Ga0157376_100002512 185
55 3300025907 Ga0207645_10001889 Ga0207645_1000188918 185
56 3300025927 Ga0207687_10002448 Ga0207687_1000244813 185
57 3300025934 Ga0207686_10001355 Ga0207686_1000135511 185
58 3300025935 Ga0207709_10000299 Ga0207709_1000029914 185
59 3300025938 Ga0207704_10000021 Ga0207704_1000002136 185
60 3300025940 Ga0207691_10147320 Ga0207691_101473202 185
61 3300025942 Ga0207689_10000132 Ga0207689_1000013235 185
62 3300025960 Ga0207651_10000012 Ga0207651_1000001286 185
63 3300026023 Ga0207677_10000170 Ga0207677_1000017014 185
64 3300026089 Ga0207648_10000051 Ga0207648_1000005157 185
65 3300031507 Ga0307509_10127158 Ga0307509_101271583 185
66 3300033179 Ga0307507_10044588 Ga0307507_100445883 185
67 3300039450 Ga0436363_1390579 Ga0436363_1390579_197_880 185
68 3300005262 Ga0065165_1002832 Ga0065165_10028324 186
69 3300005435 Ga0070714_100987611 Ga0070714_1009876111 186
70 3300005563 Ga0068855_100331870 Ga0068855_1003318702 186
71 3300005614 Ga0068856_100093824 Ga0068856_1000938243 186
72 3300006353 Ga0075370_10114864 Ga0075370_101148642 186
73 3300025929 Ga0207664_10473574 Ga0207664_104735742 186
74 3300025949 Ga0207667_10068267 Ga0207667_100682675 186
75 3300026078 Ga0207702_10021218 Ga0207702_100212183 186
76 3300026088 Ga0207641_10127641 Ga0207641_101276411 186
77 3300026142 Ga0207698_10145305 Ga0207698_101453052 186
78 3300028794 Ga0307515_10028520 Ga0307515_100285207 186
79 3300048915 Ga0496112_0110949 Ga0496112_0110949_1609_2304 186
80 3300053088 Ga0500644_0007939 Ga0500644_0007939_1992_2681 186
81 3300001989 JGI24739J22299_10030805 JGI24739J22299_100308051 187
82 3300003578 Ga0006562J51391_1101676 Ga0006562J51391_11016762 187
83 3300003578 Ga0006562J51391_1101677 Ga0006562J51391_11016772 187
84 3300003792 Ga0055540_1000754 Ga0055540_100075416 187
85 3300005353 Ga0070669_100665284 Ga0070669_1006652842 187
86 3300006048 Ga0075363_100084546 Ga0075363_1000845462 187
87 3300006177 Ga0075362_10025434 Ga0075362_100254341 187
88 3300006178 Ga0075367_10017641 Ga0075367_100176414 187
89 3300006186 Ga0075369_10144235 Ga0075369_101442352 187
90 3300006195 Ga0075366_10001920 Ga0075366_100019203 187
91 3300006353 Ga0075370_10023108 Ga0075370_100231083 187
92 3300009553 Ga0105249_10000079 Ga0105249_1000007938 187
93 3300014497 Ga0182008_10013307 Ga0182008_100133074 187
94 3300025253 Ga0209677_100280 Ga0209677_10028011 187
95 3300025261 Ga0209233_1002090 Ga0209233_10020906 187
96 3300025272 Ga0209455_1011608 Ga0209455_10116082 187
97 3300025303 Ga0209051_1000128 Ga0209051_100012827 187
98 3300025923 Ga0207681_10285437 Ga0207681_102854372 187
99 3300025961 Ga0207712_10000030 Ga0207712_10000030107 187
100 3300031649 Ga0307514_10002374 Ga0307514_1000237417 187
101 3300031901 Ga0307406_10352734 Ga0307406_103527341 187
102 3300031911 Ga0307412_10124972 Ga0307412_101249722 187
103 3300042003 Ga0439443_000271 Ga0439443_000271_2166_2840 187
104 3300042876 Ga0451577_0106470 Ga0451577_0106470_663_1352 187
105 3300044712 Ga0453684_0781780 Ga0453684_0781780_230_919 187
106 3300048927 Ga0496124_0299403 Ga0496124_0299403_392_1063 187
107 3300050493 nmdc:mga0k408_2540_c1 nmdc:mga0k408_2540_c1_3150_3851 187
108 3300050494 nmdc:mga06z11_46832_c1 nmdc:mga06z11_46832_c1_612_1313 187
109 3300050496 nmdc:mga07m45_29641_c1 nmdc:mga07m45_29641_c1_362_1063 187
110 3300053730 Ga0500645_007452 Ga0500645_007452_348_1037 187
111 3300006844 Ga0075428_100014031 Ga0075428_1000140314 188
112 3300006847 Ga0075431_100005130 Ga0075431_1000051308 188
113 3300006880 Ga0075429_100022932 Ga0075429_1000229326 188
114 3300009147 Ga0114129_10029501 Ga0114129_100295016 188
115 3300013297 Ga0157378_10215667 Ga0157378_102156672 188
116 3300025901 Ga0207688_10019333 Ga0207688_100193334 188
117 3300046473 Ga0495582_0194417 Ga0495582_0194417_59_748 188
118 3300046515 Ga0495620_0047835 Ga0495620_0047835_571_1266 188
119 3300046520 Ga0495637_0098427 Ga0495637_0098427_316_1011 188
120 3300046530 Ga0495654_0129154 Ga0495654_0129154_293_988 188
121 3300046660 Ga0495625_0320335 Ga0495625_0320335_32_727 188
122 3300046674 Ga0495588_0122925 Ga0495588_0122925_238_933 188
123 3300050507 nmdc:mga05p37_33643_c1 nmdc:mga05p37_33643_c1_4943_5632 188
124 3300050509 nmdc:mga0qj67_698465_c1 nmdc:mga0qj67_698465_c1_70_759 188
125 3300050510 nmdc:mga06r32_36396_c1 nmdc:mga06r32_36396_c1_706_1395 188
126 3300053079 Ga0500610_0001170 Ga0500610_0001170_1086_1781 188
127 3300053079 Ga0500610_0007937 Ga0500610_0007937_518_1213 188
128 3300053117 Ga0500593_000202 Ga0500593_000202_867_1562 188
129 3300053121 Ga0500607_000181 Ga0500607_000181_15804_16499 188
130 3300053125 Ga0500618_041008 Ga0500618_041008_59_757 188
131 3300053158 Ga0500627_0014048 Ga0500627_0014048_453_1148 188
132 3300003187 JGI25151J46595_10000577 JGI25151J46595_1000057725 189
133 3300003214 JGI25165J46597_1000104 JGI25165J46597_100010465 189
134 3300003791 Ga0055530_10015323 Ga0055530_100153233 189
135 3300005617 Ga0068859_100041521 Ga0068859_1000415216 189
136 3300006931 Ga0097620_100041523 Ga0097620_1000415236 189
137 3300009177 Ga0105248_10008726 Ga0105248_100087267 189
138 3300025258 Ga0209129_1001072 Ga0209129_10010722 189
139 3300025294 Ga0209025_1000432 Ga0209025_100043257 189
140 3300025298 Ga0209050_1001066 Ga0209050_100106625 189
141 3300026118 Ga0207675_100000071 Ga0207675_10000007182 189
142 3300029957 Ga0265324_10022835 Ga0265324_100228352 189
143 3300046453 Ga0495627_030335 Ga0495627_030335_619_1317 189
144 3300046500 Ga0495596_0000782 Ga0495596_0000782_11155_11829 189
145 3300046507 Ga0495606_0059450 Ga0495606_0059450_145_819 189
146 3300046507 Ga0495606_0298905 Ga0495606_0298905_95_808 189
147 3300046512 Ga0495610_0005638 Ga0495610_0005638_5394_6068 189
148 3300046538 Ga0495609_0083879 Ga0495609_0083879_213_920 189
149 3300046692 Ga0495671_0006764 Ga0495671_0006764_4203_4901 189
150 3300048091 Ga0495626_0000826 Ga0495626_0000826_13665_14339 189
151 3300048903 Ga0496100_0289682 Ga0496100_0289682_272_946 189
152 3300048904 Ga0496101_0068383 Ga0496101_0068383_910_1584 189
153 3300048919 Ga0496116_0000017 Ga0496116_0000017_416027_416701 189
154 3300048921 Ga0496118_0109343 Ga0496118_0109343_1049_1723 189
155 3300048924 Ga0496121_0005300 Ga0496121_0005300_15410_16084 189
156 3300048925 Ga0496122_0003783 Ga0496122_0003783_3675_4349 189
157 3300048925 Ga0496122_0137604 Ga0496122_0137604_194_907 189
158 3300048926 Ga0496123_0000389 Ga0496123_0000389_47015_47689 189
159 3300048926 Ga0496123_0106989 Ga0496123_0106989_590_1297 189
160 3300048927 Ga0496124_0033617 Ga0496124_0033617_2168_2842 189
161 3300048928 Ga0496125_0004628 Ga0496125_0004628_6860_7534 189
162 3300048928 Ga0496125_0162767 Ga0496125_0162767_343_1044 189
163 3300048929 Ga0496126_0087236 Ga0496126_0087236_21_695 189
164 3300048929 Ga0496126_0115548 Ga0496126_0115548_21_695 189
165 3300050516 nmdc:mga0sz30_107433_c1 nmdc:mga0sz30_107433_c1_395_1096 189
166 3300053079 Ga0500610_0211737 Ga0500610_0211737_120_821 189
167 3300002987 JGI25159J45721_1007113 JGI25159J45721_10071132 190
168 3300003187 JGI25151J46595_10003021 JGI25151J46595_100030217 190
169 3300003215 JGI25153J46596_10002993 JGI25153J46596_100029937 190
170 3300003323 rootH1_10072304 rootH1_100723042 190
171 3300003578 Ga0006562J51391_1162870 Ga0006562J51391_11628701 190
172 3300003781 Ga0055536_1003357 Ga0055536_10033572 190
173 3300003781 Ga0055536_1004808 Ga0055536_10048085 190
174 3300003784 Ga0055534_1001653 Ga0055534_10016535 190
175 3300003791 Ga0055530_10000311 Ga0055530_1000031110 190
176 3300003792 Ga0055540_1001497 Ga0055540_10014973 190
177 3300003792 Ga0055540_1001826 Ga0055540_100182614 190
178 3300003794 Ga0055531_10001302 Ga0055531_100013023 190
179 3300003794 Ga0055531_10002563 Ga0055531_1000256314 190
180 3300005262 Ga0065165_1031744 Ga0065165_10317442 190
181 3300005355 Ga0070671_100303396 Ga0070671_1003033962 190
182 3300005457 Ga0070662_100296302 Ga0070662_1002963022 190
183 3300005937 Ga0081455_10012116 Ga0081455_1001211613 190
184 3300005983 Ga0081540_1061171 Ga0081540_10611711 190
185 3300005985 Ga0081539_10045408 Ga0081539_100454083 190
186 3300006353 Ga0075370_10241532 Ga0075370_102415322 190
187 3300017792 Ga0163161_10119235 Ga0163161_101192352 190
188 3300021377 Ga0213874_10138033 Ga0213874_101380332 190
189 3300025245 Ga0207425_1001488 Ga0207425_10014886 190
190 3300025258 Ga0209129_1002187 Ga0209129_10021875 190
191 3300025284 Ga0209130_1002441 Ga0209130_10024415 190
192 3300025291 Ga0209675_1002042 Ga0209675_10020428 190
193 3300025292 Ga0209676_1000004 Ga0209676_1000004750 190
194 3300025292 Ga0209676_1000172 Ga0209676_100017215 190
195 3300025294 Ga0209025_1005956 Ga0209025_10059565 190
196 3300025297 Ga0209758_1004631 Ga0209758_10046315 190
197 3300025298 Ga0209050_1000002 Ga0209050_10000021260 190
198 3300025298 Ga0209050_1000509 Ga0209050_100050954 190
199 3300025302 Ga0207426_1000264 Ga0207426_1000264104 190
200 3300025303 Ga0209051_1000002 Ga0209051_10000021030 190
201 3300025303 Ga0209051_1000074 Ga0209051_1000074178 190
202 3300025303 Ga0209051_1000096 Ga0209051_1000096155 190
203 3300025304 Ga0209257_1000002 Ga0209257_10000021171 190
204 3300025304 Ga0209257_1000072 Ga0209257_1000072179 190
205 3300025916 Ga0207663_10254355 Ga0207663_102543552 190
206 3300025928 Ga0207700_10305808 Ga0207700_103058082 190
207 3300028556 Ga0265337_1001439 Ga0265337_10014395 190
208 3300028558 Ga0265326_10001380 Ga0265326_100013804 190
209 3300028563 Ga0265319_1002798 Ga0265319_10027988 190
210 3300028573 Ga0265334_10005260 Ga0265334_100052604 190
211 3300028577 Ga0265318_10003474 Ga0265318_100034746 190
212 3300028653 Ga0265323_10000992 Ga0265323_100009924 190
213 3300028654 Ga0265322_10002589 Ga0265322_100025894 190
214 3300028666 Ga0265336_10000063 Ga0265336_1000006378 190
215 3300028800 Ga0265338_10000154 Ga0265338_1000015416 190
216 3300029957 Ga0265324_10001590 Ga0265324_1000159010 190
217 3300031911 Ga0307412_10532345 Ga0307412_105323451 190
218 3300046462 Ga0495651_0408938 Ga0495651_0408938_72_773 190
219 3300046511 Ga0495608_0261302 Ga0495608_0261302_294_977 190
220 3300046512 Ga0495610_0092814 Ga0495610_0092814_104_805 190
221 3300046513 Ga0495616_0000877 Ga0495616_0000877_15775_16476 190
222 3300046518 Ga0495631_0000620 Ga0495631_0000620_22102_22803 190
223 3300046528 Ga0495642_0091339 Ga0495642_0091339_213_914 190
224 3300046530 Ga0495654_0062205 Ga0495654_0062205_873_1574 190
225 3300046543 Ga0495645_0095615 Ga0495645_0095615_93_788 190
226 3300046557 Ga0495622_0114732 Ga0495622_0114732_87_788 190
227 3300046615 Ga0495656_0000383 Ga0495656_0000383_12939_13640 190
228 3300046660 Ga0495625_0184886 Ga0495625_0184886_236_937 190
229 3300046674 Ga0495588_0094645 Ga0495588_0094645_154_855 190
230 3300046678 Ga0495599_0118913 Ga0495599_0118913_843_1538 190
231 3300046683 Ga0495658_0094675 Ga0495658_0094675_346_1047 190
232 3300046690 Ga0495624_0200374 Ga0495624_0200374_42_743 190
233 3300047321 Ga0495676_0091166 Ga0495676_0091166_1000_1701 190
234 3300047321 Ga0495676_0310915 Ga0495676_0310915_347_1048 190
235 3300047673 Ga0495593_0138255 Ga0495593_0138255_166_867 190
236 3300048089 Ga0495614_0003366 Ga0495614_0003366_248_949 190
237 3300048090 Ga0495615_0034129 Ga0495615_0034129_101_802 190
238 3300048920 Ga0496117_0123324 Ga0496117_0123324_323_1024 190
239 3300048921 Ga0496118_0073574 Ga0496118_0073574_158_841 190
240 3300048921 Ga0496118_0146325 Ga0496118_0146325_208_909 190
241 3300048924 Ga0496121_0312070 Ga0496121_0312070_80_763 190
242 3300048924 Ga0496121_0344565 Ga0496121_0344565_162_863 190
243 3300048928 Ga0496125_0089835 Ga0496125_0089835_363_1046 190
244 3300050496 nmdc:mga07m45_193112_c1 nmdc:mga07m45_193112_c1_29_730 190
245 3300050496 nmdc:mga07m45_359608_c1 nmdc:mga07m45_359608_c1_48_749 190
246 3300053087 Ga0500643_007434 Ga0500643_007434_2958_3659 190
247 3300053093 Ga0500651_0000087 Ga0500651_0000087_53413_54114 190
248 3300053110 Ga0500571_000055 Ga0500571_000055_5153_5854 190
249 3300053118 Ga0500594_0030330 Ga0500594_0030330_355_1056 190
250 3300053122 Ga0500608_171737 Ga0500608_171737_32_733 190
251 3300053128 Ga0500626_123769 Ga0500626_123769_295_996 190
252 3300053133 Ga0500655_005280 Ga0500655_005280_625_1326 190
253 3300053134 Ga0500658_0002013 Ga0500658_0002013_443_1144 190
254 3300053134 Ga0500658_0002588 Ga0500658_0002588_443_1144 190
255 3300053138 Ga0500564_058575 Ga0500564_058575_313_1014 190
256 3300053139 Ga0500568_0009293 Ga0500568_0009293_386_1087 190
257 3300053141 Ga0500574_016275 Ga0500574_016275_799_1500 190
258 3300053177 Ga0500636_0220877 Ga0500636_0220877_167_868 190
259 iso_pu_bacteria 2511231002 2511243185 190
260 iso_pu_bacteria 2511231221 2512036931 190
261 iso_pu_bacteria 2513237166 2514054800 190
262 iso_pu_bacteria 2643221587 2643944604 190
263 iso_pu_bacteria 2643221644 2644243912 190
264 iso_pu_bacteria 2643221677 2644431502 190
265 iso_pu_bacteria 2791355137 2792840868 190
266 iso_pu_bacteria 2974302888 2974305401 190
267 3300005333 Ga0070677_10055875 Ga0070677_100558752 191
268 3300005354 Ga0070675_100005609 Ga0070675_1000056093 191
269 3300005466 Ga0070685_10316947 Ga0070685_103169471 191
270 3300005543 Ga0070672_100002374 Ga0070672_10000237412 191
271 3300005548 Ga0070665_100387982 Ga0070665_1003879822 191
272 3300005719 Ga0068861_100061248 Ga0068861_1000612481 191
273 3300013306 Ga0163162_10015009 Ga0163162_100150095 191
274 3300013308 Ga0157375_10020347 Ga0157375_100203477 191
275 3300017792 Ga0163161_10039167 Ga0163161_100391674 191
276 3300025923 Ga0207681_10287099 Ga0207681_102870992 191
277 3300025926 Ga0207659_10003624 Ga0207659_100036249 191
278 3300025933 Ga0207706_10033883 Ga0207706_100338833 191
279 3300025933 Ga0207706_10320887 Ga0207706_103208871 191
280 3300025940 Ga0207691_10000111 Ga0207691_1000011116 191
281 3300025960 Ga0207651_10018903 Ga0207651_100189035 191
282 3300025961 Ga0207712_10359199 Ga0207712_103591992 191
283 3300025972 Ga0207668_10037606 Ga0207668_100376064 191
284 3300025986 Ga0207658_10305928 Ga0207658_103059282 191
285 3300026023 Ga0207677_10212667 Ga0207677_102126672 191
286 3300026088 Ga0207641_10161713 Ga0207641_101617131 191
287 3300026089 Ga0207648_10098622 Ga0207648_100986222 191
288 3300026095 Ga0207676_10655273 Ga0207676_106552731 191
289 3300026116 Ga0207674_10181641 Ga0207674_101816413 191
290 3300026118 Ga0207675_100089563 Ga0207675_1000895634 191
291 3300026142 Ga0207698_10395710 Ga0207698_103957102 191
292 3300031711 Ga0265314_10202995 Ga0265314_102029952 191
293 3300031911 Ga0307412_10616015 Ga0307412_106160152 191
294 3300042122 Ga0450920_010942 Ga0450920_010942_534_1217 191
295 3300042184 Ga0450908_002803 Ga0450908_002803_1333_2034 191
296 3300042531 Ga0450918_001177 Ga0450918_001177_3488_4171 191
297 3300042531 Ga0450918_001940 Ga0450918_001940_505_1206 191
298 3300046543 Ga0495645_0137696 Ga0495645_0137696_581_1264 191
299 iso_pu_bacteria 2643221631 2644179093 191
300 iso_pu_bacteria 2643221724 2644680789 191
301 iso_pu_bacteria 2919395869 2919398075 191
302 iso_pu_bacteria 2939598168 2939602116 191
303 iso_pu_bacteria 8004025490 8004028494 191
304 3300003775 Ga0055524_1001147 Ga0055524_10011476 192
305 3300003790 Ga0055528_1012023 Ga0055528_10120232 192
306 3300005262 Ga0065165_1012709 Ga0065165_10127092 192
307 3300005288 Ga0065714_10004847 Ga0065714_100048474 192
308 3300005328 Ga0070676_10001674 Ga0070676_100016743 192
309 3300005331 Ga0070670_100253635 Ga0070670_1002536352 192
310 3300005333 Ga0070677_10002127 Ga0070677_100021275 192
311 3300005347 Ga0070668_100005618 Ga0070668_1000056187 192
312 3300005353 Ga0070669_100102905 Ga0070669_1001029052 192
313 3300005354 Ga0070675_100041359 Ga0070675_1000413594 192
314 3300005355 Ga0070671_100010636 Ga0070671_1000106365 192
315 3300005356 Ga0070674_100011027 Ga0070674_1000110275 192
316 3300005364 Ga0070673_100112649 Ga0070673_1001126492 192
317 3300005365 Ga0070688_100275917 Ga0070688_1002759171 192
318 3300005367 Ga0070667_100218920 Ga0070667_1002189202 192
319 3300005434 Ga0070709_10562360 Ga0070709_105623601 192
320 3300005439 Ga0070711_100001539 Ga0070711_10000153911 192
321 3300005456 Ga0070678_100007462 Ga0070678_1000074622 192
322 3300005467 Ga0070706_100003229 Ga0070706_10000322914 192
323 3300005468 Ga0070707_100023650 Ga0070707_1000236502 192
324 3300005539 Ga0068853_100132979 Ga0068853_1001329792 192
325 3300005539 Ga0068853_100552427 Ga0068853_1005524271 192
326 3300005543 Ga0070672_100064556 Ga0070672_1000645563 192
327 3300005548 Ga0070665_100017168 Ga0070665_1000171686 192
328 3300005563 Ga0068855_100768660 Ga0068855_1007686602 192
329 3300005616 Ga0068852_100070212 Ga0068852_1000702121 192
330 3300005618 Ga0068864_100034309 Ga0068864_1000343095 192
331 3300005718 Ga0068866_10321126 Ga0068866_103211261 192
332 3300005719 Ga0068861_100073755 Ga0068861_1000737553 192
333 3300005841 Ga0068863_100150622 Ga0068863_1001506223 192
334 3300005843 Ga0068860_100018313 Ga0068860_1000183133 192
335 3300006038 Ga0075365_10001917 Ga0075365_100019177 192
336 3300006048 Ga0075363_100004230 Ga0075363_1000042305 192
337 3300006051 Ga0075364_10148151 Ga0075364_101481512 192
338 3300006051 Ga0075364_10193236 Ga0075364_101932362 192
339 3300006058 Ga0075432_10000250 Ga0075432_1000025014 192
340 3300006177 Ga0075362_10006104 Ga0075362_100061043 192
341 3300006353 Ga0075370_10022952 Ga0075370_100229523 192
342 3300006846 Ga0075430_100102446 Ga0075430_1001024463 192
343 3300006881 Ga0068865_100154035 Ga0068865_1001540352 192
344 3300006946 Ga0079104_1000198 Ga0079104_10001989 192
345 3300006948 Ga0099826_10139611 Ga0099826_101396112 192
346 3300009092 Ga0105250_10000186 Ga0105250_100001868 192
347 3300009093 Ga0105240_10484581 Ga0105240_104845812 192
348 3300009177 Ga0105248_11041570 Ga0105248_110415702 192
349 3300009545 Ga0105237_10122526 Ga0105237_101225262 192
350 3300009545 Ga0105237_10482638 Ga0105237_104826382 192
351 3300011119 Ga0105246_10130385 Ga0105246_101303852 192
352 3300013297 Ga0157378_10309204 Ga0157378_103092042 192
353 3300014325 Ga0163163_10276740 Ga0163163_102767402 192
354 3300014326 Ga0157380_10264773 Ga0157380_102647731 192
355 3300014968 Ga0157379_10000207 Ga0157379_1000020738 192
356 3300017792 Ga0163161_10020018 Ga0163161_100200182 192
357 3300025206 Ga0209435_105843 Ga0209435_1058432 192
358 3300025242 Ga0209258_102632 Ga0209258_1026325 192
359 3300025263 Ga0209565_1007550 Ga0209565_10075502 192
360 3300025272 Ga0209455_1000337 Ga0209455_100033716 192
361 3300025273 Ga0209673_1001087 Ga0209673_100108716 192
362 3300025291 Ga0209675_1007616 Ga0209675_10076163 192
363 3300025291 Ga0209675_1037851 Ga0209675_10378512 192
364 3300025298 Ga0209050_1004407 Ga0209050_10044077 192
365 3300025299 Ga0209256_1000045 Ga0209256_100004566 192
366 3300025302 Ga0207426_1010976 Ga0207426_10109763 192
367 3300025304 Ga0209257_1061033 Ga0209257_10610331 192
368 3300025321 Ga0207656_10008913 Ga0207656_100089133 192
369 3300025711 Ga0207696_1000072 Ga0207696_1000072200 192
370 3300025893 Ga0207682_10012510 Ga0207682_100125103 192
371 3300025903 Ga0207680_10067513 Ga0207680_100675132 192
372 3300025907 Ga0207645_10004586 Ga0207645_100045865 192
373 3300025910 Ga0207684_10043697 Ga0207684_100436973 192
374 3300025913 Ga0207695_10140600 Ga0207695_101406003 192
375 3300025914 Ga0207671_10021491 Ga0207671_100214912 192
376 3300025922 Ga0207646_10046772 Ga0207646_100467723 192
377 3300025923 Ga0207681_10086205 Ga0207681_100862052 192
378 3300025925 Ga0207650_10339095 Ga0207650_103390952 192
379 3300025931 Ga0207644_10037323 Ga0207644_100373232 192
380 3300025937 Ga0207669_10155613 Ga0207669_101556132 192
381 3300025938 Ga0207704_10129662 Ga0207704_101296622 192
382 3300025940 Ga0207691_10007985 Ga0207691_100079855 192
383 3300025972 Ga0207668_10065476 Ga0207668_100654762 192
384 3300025986 Ga0207658_10123062 Ga0207658_101230623 192
385 3300026035 Ga0207703_10441896 Ga0207703_104418962 192
386 3300026041 Ga0207639_10155969 Ga0207639_101559692 192
387 3300026067 Ga0207678_10172887 Ga0207678_101728872 192
388 3300026088 Ga0207641_10151855 Ga0207641_101518553 192
389 3300026089 Ga0207648_10013752 Ga0207648_100137527 192
390 3300026095 Ga0207676_10086561 Ga0207676_100865612 192
391 3300026118 Ga0207675_100222695 Ga0207675_1002226952 192
392 3300026121 Ga0207683_10006288 Ga0207683_100062887 192
393 3300027111 Ga0209281_1000457 Ga0209281_10004579 192
394 3300027907 Ga0207428_10004342 Ga0207428_100043425 192
395 3300028379 Ga0268266_10062015 Ga0268266_100620152 192
396 3300028381 Ga0268264_10070355 Ga0268264_100703553 192
397 3300031507 Ga0307509_10190737 Ga0307509_101907372 192
398 3300031548 Ga0307408_100222351 Ga0307408_1002223512 192
399 3300031665 Ga0316575_10055627 Ga0316575_100556272 192
400 3300031733 Ga0316577_10022266 Ga0316577_100222663 192
401 3300031852 Ga0307410_10288207 Ga0307410_102882072 192
402 3300031903 Ga0307407_10607521 Ga0307407_106075211 192
403 3300031995 Ga0307409_100126228 Ga0307409_1001262282 192
404 3300032002 Ga0307416_100305892 Ga0307416_1003058922 192
405 3300032004 Ga0307414_10364490 Ga0307414_103644902 192
406 3300032004 Ga0307414_10473345 Ga0307414_104733451 192
407 3300032139 Ga0316580_10049610 Ga0316580_100496102 192
408 3300035090 Ga0373949_0000342 Ga0373949_0000342_15100_15789 192
409 3300035117 Ga0373953_0246825 Ga0373953_0246825_56_739 192
410 3300035118 Ga0373954_0003173 Ga0373954_0003173_6108_6791 192
411 3300035120 Ga0373957_0008409 Ga0373957_0008409_2460_3143 192
412 3300035171 Ga0373946_0084466 Ga0373946_0084466_458_1141 192
413 3300035398 Ga0316574_0072432 Ga0316574_0072432_1074_1763 192
414 3300035410 Ga0373924_0045399 Ga0373924_0045399_270_953 192
415 3300035724 Ga0373933_0076697 Ga0373933_0076697_841_1524 192
416 3300036401 Ga0373937_0000847 Ga0373937_0000847_22676_23359 192
417 3300036647 Ga0316582_0000235 Ga0316582_0000235_4334_5023 192
418 3300037418 Ga0395900_0126698 Ga0395900_0126698_282_977 192
419 3300037471 Ga0395905_0097558 Ga0395905_0097558_1986_2669 192
420 3300038443 Ga0395901_0080987 Ga0395901_0080987_296_991 192
421 3300039438 Ga0436360_1192691 Ga0436360_1192691_1084_1767 192
422 3300039447 Ga0436361_0150699 Ga0436361_0150699_783_1466 192
423 3300039447 Ga0436361_0682546 Ga0436361_0682546_2111_2794 192
424 3300039453 Ga0436362_0896897 Ga0436362_0896897_230_913 192
425 3300041413 Ga0439465_0046973 Ga0439465_0046973_92_775 192
426 3300042004 Ga0439445_0024166 Ga0439445_0024166_617_1300 192
427 3300042121 Ga0450919_004672 Ga0450919_004672_507_1190 192
428 3300042435 Ga0439434_0085206 Ga0439434_0085206_256_939 192
429 3300044693 Ga0466961_0032129 Ga0466961_0032129_145_834 192
430 3300044712 Ga0453684_0000583 Ga0453684_0000583_129975_130664 192
431 3300045051 Ga0451576_0000137 Ga0451576_0000137_5277_5966 192
432 3300045051 Ga0451576_0900840 Ga0451576_0900840_102_785 192
433 3300045976 Ga0466967_0050379 Ga0466967_0050379_2403_3086 192
434 3300046459 Ga0495629_0045994 Ga0495629_0045994_2090_2773 192
435 3300046463 Ga0495653_0007505 Ga0495653_0007505_498_1181 192
436 3300046472 Ga0495580_0271119 Ga0495580_0271119_211_894 192
437 3300046477 Ga0495664_0066699 Ga0495664_0066699_498_1181 192
438 3300046516 Ga0495628_0007404 Ga0495628_0007404_2932_3615 192
439 3300046517 Ga0495630_0011854 Ga0495630_0011854_772_1455 192
440 3300046517 Ga0495630_0126739 Ga0495630_0126739_372_1055 192
441 3300046528 Ga0495642_0044967 Ga0495642_0044967_707_1390 192
442 3300046529 Ga0495652_0005313 Ga0495652_0005313_9316_9999 192
443 3300046531 Ga0495665_0000331 Ga0495665_0000331_15661_16344 192
444 3300046543 Ga0495645_0030687 Ga0495645_0030687_510_1193 192
445 3300046660 Ga0495625_0000056 Ga0495625_0000056_167335_168036 192
446 3300046663 Ga0495635_0018536 Ga0495635_0018536_868_1551 192
447 3300046679 Ga0495623_0023896 Ga0495623_0023896_1788_2471 192
448 3300046680 Ga0495646_0001657 Ga0495646_0001657_8390_9073 192
449 3300046689 Ga0495613_0333903 Ga0495613_0333903_118_807 192
450 3300046690 Ga0495624_0087548 Ga0495624_0087548_848_1531 192
451 3300046809 Ga0495600_0238865 Ga0495600_0238865_200_883 192
452 3300047315 Ga0495581_0167415 Ga0495581_0167415_355_1044 192
453 3300047317 Ga0495604_0006469 Ga0495604_0006469_4647_5330 192
454 3300047318 Ga0495636_0003446 Ga0495636_0003446_4661_5356 192
455 3300047319 Ga0495674_0003950 Ga0495674_0003950_4184_4867 192
456 3300047320 Ga0495672_0109801 Ga0495672_0109801_54_737 192
457 3300047322 Ga0495680_0001202 Ga0495680_0001202_20180_20863 192
458 3300047444 Ga0495675_0025572 Ga0495675_0025572_1338_2021 192
459 3300047447 Ga0495685_138388 Ga0495685_138388_72_755 192
460 3300047472 Ga0495686_0000062 Ga0495686_0000062_121051_121749 192
461 3300047673 Ga0495593_0000855 Ga0495593_0000855_8627_9310 192
462 3300048088 Ga0495602_0001702 Ga0495602_0001702_15520_16203 192
463 3300048903 Ga0496100_0058813 Ga0496100_0058813_944_1627 192
464 3300048904 Ga0496101_0018225 Ga0496101_0018225_332_1048 192
465 3300048904 Ga0496101_0080656 Ga0496101_0080656_982_1665 192
466 3300048907 Ga0496104_0057335 Ga0496104_0057335_684_1367 192
467 3300048908 Ga0496105_0379747 Ga0496105_0379747_252_935 192
468 3300048912 Ga0496109_0390899 Ga0496109_0390899_237_920 192
469 3300048915 Ga0496112_0677570 Ga0496112_0677570_48_749 192
470 3300048916 Ga0496113_0317348 Ga0496113_0317348_255_944 192
471 3300048917 Ga0496114_0031119 Ga0496114_0031119_3170_3853 192
472 3300048919 Ga0496116_0005353 Ga0496116_0005353_2704_3420 192
473 3300048920 Ga0496117_0022285 Ga0496117_0022285_223_939 192
474 3300048924 Ga0496121_0029822 Ga0496121_0029822_2644_3360 192
475 3300048925 Ga0496122_0001063 Ga0496122_0001063_15451_16146 192
476 3300048925 Ga0496122_0217627 Ga0496122_0217627_337_1053 192
477 3300048926 Ga0496123_0000246 Ga0496123_0000246_55072_55767 192
478 3300048926 Ga0496123_0062416 Ga0496123_0062416_492_1208 192
479 3300048929 Ga0496126_0148246 Ga0496126_0148246_222_905 192
480 3300050489 nmdc:mga03683_3366_c1 nmdc:mga03683_3366_c1_1959_2660 192
481 3300050490 nmdc:mga03n38_6245_c1 nmdc:mga03n38_6245_c1_523_1224 192
482 3300050491 nmdc:mga00v17_195_c1 nmdc:mga00v17_195_c1_21965_22666 192
483 3300050493 nmdc:mga0k408_2031_c1 nmdc:mga0k408_2031_c1_10091_10792 192
484 3300050496 nmdc:mga07m45_39287_c1 nmdc:mga07m45_39287_c1_815_1513 192
485 3300053078 Ga0495612_0029214 Ga0495612_0029214_77_760 192
486 3300053090 Ga0500646_0008184 Ga0500646_0008184_260_955 192
487 3300053094 Ga0500566_0003255 Ga0500566_0003255_2466_3149 192
488 3300053116 Ga0500592_012497 Ga0500592_012497_142_843 192
489 3300053122 Ga0500608_038217 Ga0500608_038217_1251_1952 192
490 3300053150 Ga0500603_001268 Ga0500603_001268_1173_1856 192
491 3300053735 Ga0500596_017492 Ga0500596_017492_254_958 192
492 iso_pu_bacteria 2599185214 2599624802 192
493 iso_pu_bacteria 2599185226 2599672814 192
494 iso_pu_bacteria 2599185227 2599682736 192
495 iso_pu_bacteria 2599185229 2599694423 192
496 iso_pu_bacteria 2643221628 2644159237 192
497 iso_pu_bacteria 2643221658 2644329136 192
498 iso_pu_bacteria 2738541277 2738721063 192
499 iso_pu_bacteria 2738541307 2738885747 192
500 iso_pu_bacteria 2738543013 2739249155 192
501 iso_pu_bacteria 2738543019 2739280262 192
502 iso_pu_bacteria 2831265667 2831265861 192
503 iso_pu_bacteria 2884811622 2884812426 192
504 iso_pu_bacteria 2884836552 2884840383 192
505 iso_pu_bacteria 2884852848 2884855639 192
506 iso_pu_bacteria 2885198086 2885203512 192
507 iso_pu_bacteria 2885211737 2885217138 192
508 iso_pu_bacteria 2885266251 2885267956 192
509 iso_pu_bacteria 2896154374 2896157435 192
510 iso_pu_bacteria 2928070936 2928074843 192
511 iso_pu_bacteria 2928084124 2928088991 192
512 iso_pu_bacteria 2929520902 2929522146 192
513 iso_pu_bacteria 2945945610 2945948456 192
514 iso_pu_bacteria 2945972063 2945972506 192
515 3300002705 JGI25156J39149_1015083 JGI25156J39149_10150833 193
516 3300003578 Ga0006562J51391_1049413 Ga0006562J51391_10494134 193
517 3300003578 Ga0006562J51391_1049414 Ga0006562J51391_10494144 193
518 3300003761 Ga0055535_1000047 Ga0055535_1000047128 193
519 3300003763 Ga0055529_1000193 Ga0055529_100019328 193
520 3300005288 Ga0065714_10141774 Ga0065714_101417742 193
521 3300005345 Ga0070692_10137658 Ga0070692_101376582 193
522 3300006051 Ga0075364_10117219 Ga0075364_101172192 193
523 3300006058 Ga0075432_10000268 Ga0075432_1000026817 193
524 3300009148 Ga0105243_10005763 Ga0105243_100057633 193
525 3300009545 Ga0105237_10537513 Ga0105237_105375132 193
526 3300010375 Ga0105239_10928114 Ga0105239_109281142 193
527 3300012502 Ga0157347_1005209 Ga0157347_10052092 193
528 3300013307 Ga0157372_10210917 Ga0157372_102109171 193
529 3300014497 Ga0182008_10028241 Ga0182008_100282413 193
530 3300014497 Ga0182008_10259856 Ga0182008_102598562 193
531 3300025242 Ga0209258_100072 Ga0209258_100072144 193
532 3300025254 Ga0209148_1011479 Ga0209148_10114792 193
533 3300025256 Ga0209759_1002338 Ga0209759_10023386 193
534 3300025272 Ga0209455_1000053 Ga0209455_1000053224 193
535 3300025728 Ga0207655_1005843 Ga0207655_10058437 193
536 3300025935 Ga0207709_10027366 Ga0207709_100273663 193
537 3300026041 Ga0207639_10476978 Ga0207639_104769781 193
538 3300027907 Ga0207428_10207261 Ga0207428_102072612 193
539 3300031548 Ga0307408_100000205 Ga0307408_10000020518 193
540 3300031901 Ga0307406_10000154 Ga0307406_1000015420 193
541 3300031901 Ga0307406_10015406 Ga0307406_100154064 193
542 3300031911 Ga0307412_10000876 Ga0307412_100008768 193
543 3300031911 Ga0307412_10430620 Ga0307412_104306202 193
544 3300032002 Ga0307416_100012087 Ga0307416_1000120877 193
545 3300035120 Ga0373957_0175994 Ga0373957_0175994_109_801 193
546 3300035410 Ga0373924_0023501 Ga0373924_0023501_306_998 193
547 3300035692 Ga0373935_0097527 Ga0373935_0097527_157_849 193
548 3300035724 Ga0373933_0123419 Ga0373933_0123419_877_1569 193
549 3300036401 Ga0373937_0075852 Ga0373937_0075852_647_1339 193
550 3300038443 Ga0395901_0043260 Ga0395901_0043260_1155_1847 193
551 3300046454 Ga0495592_0231026 Ga0495592_0231026_79_771 193
552 3300046459 Ga0495629_0112667 Ga0495629_0112667_1155_1847 193
553 3300046462 Ga0495651_0061857 Ga0495651_0061857_1761_2453 193
554 3300046463 Ga0495653_0056447 Ga0495653_0056447_633_1325 193
555 3300046476 Ga0495662_0131568 Ga0495662_0131568_364_1056 193
556 3300046477 Ga0495664_0082271 Ga0495664_0082271_1013_1705 193
557 3300046514 Ga0495618_0081888 Ga0495618_0081888_66_758 193
558 3300046516 Ga0495628_0179993 Ga0495628_0179993_289_981 193
559 3300046517 Ga0495630_0096003 Ga0495630_0096003_109_801 193
560 3300046533 Ga0495640_0034294 Ga0495640_0034294_619_1311 193
561 3300046536 Ga0495587_0225087 Ga0495587_0225087_92_784 193
562 3300046674 Ga0495588_0054766 Ga0495588_0054766_1084_1782 193
563 3300046678 Ga0495599_0102611 Ga0495599_0102611_1045_1737 193
564 3300046679 Ga0495623_0020874 Ga0495623_0020874_543_1235 193
565 3300046680 Ga0495646_0059596 Ga0495646_0059596_1175_1867 193
566 3300046689 Ga0495613_0190236 Ga0495613_0190236_134_826 193
567 3300047315 Ga0495581_0107234 Ga0495581_0107234_474_1166 193
568 3300047319 Ga0495674_0080289 Ga0495674_0080289_1784_2476 193
569 3300047322 Ga0495680_0133909 Ga0495680_0133909_568_1260 193
570 3300047444 Ga0495675_0013433 Ga0495675_0013433_4171_4863 193
571 3300047471 Ga0495684_0184891 Ga0495684_0184891_552_1244 193
572 3300047673 Ga0495593_0103328 Ga0495593_0103328_36_728 193
573 3300048088 Ga0495602_0261813 Ga0495602_0261813_382_1074 193
574 3300048905 Ga0496102_0385695 Ga0496102_0385695_597_1289 193
575 3300048907 Ga0496104_0150355 Ga0496104_0150355_1461_2153 193
576 3300048908 Ga0496105_0087785 Ga0496105_0087785_924_1616 193
577 3300048911 Ga0496108_0458423 Ga0496108_0458423_344_1036 193
578 3300048912 Ga0496109_0381997 Ga0496109_0381997_113_796 193
579 3300048915 Ga0496112_0058928 Ga0496112_0058928_2523_3215 193
580 3300048922 Ga0496119_0081454 Ga0496119_0081454_755_1447 193
581 3300048923 Ga0496120_0164501 Ga0496120_0164501_236_928 193
582 3300049571 Ga0501034_0006090 Ga0501034_0006090_12094_12786 193
583 3300050491 nmdc:mga00v17_517750_c1 nmdc:mga00v17_517750_c1_57_749 193
584 3300053077 Ga0495601_0234724 Ga0495601_0234724_414_1106 193
585 3300053084 Ga0495595_0099306 Ga0495595_0099306_413_1105 193
586 iso_pu_bacteria 2643221597 2643994653 193
587 iso_pu_bacteria 2851182111 2851187643 193
588 iso_pu_bacteria 2945909444 2945911470 193
589 iso_pu_bacteria 2945984333 2945986189 193
590 3300005617 Ga0068859_100536890 Ga0068859_1005368902 194
591 3300005618 Ga0068864_100280445 Ga0068864_1002804452 194
592 3300006871 Ga0075434_100185304 Ga0075434_1001853042 194
593 3300006914 Ga0075436_100230375 Ga0075436_1002303752 194
594 3300006931 Ga0097620_100536936 Ga0097620_1005369362 194
595 3300007076 Ga0075435_100078023 Ga0075435_1000780233 194
596 3300007265 Ga0099794_10020302 Ga0099794_100203023 194
597 3300009101 Ga0105247_10196094 Ga0105247_101960942 194
598 3300013306 Ga0163162_10063775 Ga0163162_100637753 194
599 3300014325 Ga0163163_10024962 Ga0163163_100249625 194
600 3300025915 Ga0207693_10155913 Ga0207693_101559131 194
601 3300025916 Ga0207663_10111256 Ga0207663_101112562 194
602 3300025921 Ga0207652_10396192 Ga0207652_103961922 194
603 3300048907 Ga0496104_0040440 Ga0496104_0040440_3022_3714 194
604 3300048911 Ga0496108_0152845 Ga0496108_0152845_675_1367 194
605 3300048915 Ga0496112_0016075 Ga0496112_0016075_1309_2001 194
606 3300048916 Ga0496113_0061589 Ga0496113_0061589_651_1343 194
607 3300050512 nmdc:mga0n895_3422_c1 nmdc:mga0n895_3422_c1_7553_8245 194
608 3300050513 nmdc:mga0rr50_538008_c1 nmdc:mga0rr50_538008_c1_147_839 194
609 3300050514 nmdc:mga08x19_216990_c1 nmdc:mga08x19_216990_c1_199_891 194
610 3300053178 Ga0500637_0200711 Ga0500637_0200711_60_752 194
611 iso_pu_bacteria 2602042107 2603856778 194
612 iso_pu_bacteria 2775506901 2776260529 194
613 iso_pu_bacteria 2882456835 2882457469 194
614 iso_pu_bacteria 2894232714 2894233284 194
615 3300003215 JGI25153J46596_10000515 JGI25153J46596_1000051515 195
616 3300005336 Ga0070680_100683007 Ga0070680_1006830071 195
617 3300005366 Ga0070659_100376212 Ga0070659_1003762122 195
618 3300009174 Ga0105241_10309837 Ga0105241_103098372 195
619 3300025912 Ga0207707_10334184 Ga0207707_103341841 195
620 3300039145 Ga0237816_02303 Ga0237816_02303_345_1028 195
621 3300044683 Ga0466965_0033467 Ga0466965_0033467_550_1233 195
622 3300046462 Ga0495651_0004621 Ga0495651_0004621_1157_1840 195
623 3300046477 Ga0495664_0066527 Ga0495664_0066527_1065_1748 195
624 3300046516 Ga0495628_0009719 Ga0495628_0009719_3763_4446 195
625 3300046529 Ga0495652_0002605 Ga0495652_0002605_9762_10445 195
626 3300046533 Ga0495640_0215541 Ga0495640_0215541_391_1074 195
627 3300046536 Ga0495587_0003463 Ga0495587_0003463_1954_2637 195
628 3300046559 Ga0495667_0012622 Ga0495667_0012622_1068_1751 195
629 3300046675 Ga0495657_0005167 Ga0495657_0005167_2620_3303 195
630 3300046678 Ga0495599_0052640 Ga0495599_0052640_1552_2235 195
631 3300046679 Ga0495623_0006437 Ga0495623_0006437_3049_3732 195
632 3300046680 Ga0495646_0106489 Ga0495646_0106489_169_852 195
633 3300046689 Ga0495613_0550108 Ga0495613_0550108_56_739 195
634 3300046809 Ga0495600_0002461 Ga0495600_0002461_5539_6222 195
635 3300047317 Ga0495604_0001823 Ga0495604_0001823_7736_8419 195
636 3300047319 Ga0495674_0007892 Ga0495674_0007892_145_828 195
637 3300047322 Ga0495680_0001849 Ga0495680_0001849_2712_3395 195
638 3300047444 Ga0495675_0062704 Ga0495675_0062704_93_776 195
639 3300047471 Ga0495684_0165386 Ga0495684_0165386_517_1200 195
640 3300048088 Ga0495602_0007968 Ga0495602_0007968_5380_6063 195
641 3300055283 Ga0500661_015830 Ga0500661_015830_546_1229 195
642 iso_pu_bacteria 2821268502 2821271524 195
643 3300048905 Ga0496102_0561829 Ga0496102_0561829_259_948 196
644 3300048915 Ga0496112_0000004 Ga0496112_0000004_358765_359457 196
645 3300005937 Ga0081455_10082035 Ga0081455_100820352 197
646 3300006058 Ga0075432_10021789 Ga0075432_100217893 197
647 3300006173 Ga0070716_100607335 Ga0070716_1006073352 197
648 3300006175 Ga0070712_100566230 Ga0070712_1005662302 197
649 3300006880 Ga0075429_100071205 Ga0075429_1000712052 197
650 3300009094 Ga0111539_10166530 Ga0111539_101665302 197
651 3300009094 Ga0111539_10313312 Ga0111539_103133122 197
652 3300009553 Ga0105249_10355414 Ga0105249_103554142 197
653 3300013102 Ga0157371_10096623 Ga0157371_100966232 197
654 3300025915 Ga0207693_10022195 Ga0207693_100221956 197
655 3300025937 Ga0207669_10234580 Ga0207669_102345802 197
656 3300025972 Ga0207668_10276139 Ga0207668_102761392 197
657 3300027907 Ga0207428_10021454 Ga0207428_100214543 197
658 3300031249 Ga0265339_10055930 Ga0265339_100559303 197
659 3300031250 Ga0265331_10038744 Ga0265331_100387443 197
660 3300031711 Ga0265314_10018231 Ga0265314_100182314 197
661 3300031712 Ga0265342_10012785 Ga0265342_100127854 197
662 3300048904 Ga0496101_0090807 Ga0496101_0090807_1335_2027 197
663 3300048918 Ga0496115_0218288 Ga0496115_0218288_547_1239 197
664 3300050489 nmdc:mga03683_40835_c2 nmdc:mga03683_40835_c2_125_817 197
665 3300050507 nmdc:mga05p37_219_c1 nmdc:mga05p37_219_c1_658_1350 197
666 3300050509 nmdc:mga0qj67_11735_c1 nmdc:mga0qj67_11735_c1_4831_5523 197
667 3300050510 nmdc:mga06r32_92393_c1 nmdc:mga06r32_92393_c1_687_1379 197
668 3300050511 nmdc:mga08y16_50855_c1 nmdc:mga08y16_50855_c1_3336_4028 197
669 3300050511 nmdc:mga08y16_94115_c1 nmdc:mga08y16_94115_c1_84_776 197
670 3300050512 nmdc:mga0n895_610285_c1 nmdc:mga0n895_610285_c1_190_882 197
671 3300050513 nmdc:mga0rr50_97418_c1 nmdc:mga0rr50_97418_c1_1417_2109 197
672 3300050515 nmdc:mga0a205_81906_c1 nmdc:mga0a205_81906_c1_1683_2375 197
673 3300053087 Ga0500643_017749 Ga0500643_017749_1133_1822 197
674 2209111006 2214772979 2213792826 198
675 3300000041 ARcpr5oldR_c000279 ARcpr5oldR_0002792 198
676 3300000042 ARSoilYngRDRAFT_c00279 ARSoilYngRDRAFT_002799 198
677 3300000043 ARcpr5yngRDRAFT_c000249 ARcpr5yngRDRAFT_0002499 198
678 3300000044 ARSoilOldRDRAFT_c000048 ARSoilOldRDRAFT_00004821 198
679 3300000045 ARCol0oldRDRAFT_c00131 ARCol0oldRDRAFT_001312 198
680 3300000652 ARCol0yngRDRAFT_1000302 ARCol0yngRDRAFT_10003029 198
681 3300005276 Ga0065717_1000124 Ga0065717_10001241 198
682 3300005277 Ga0065716_1001916 Ga0065716_10019164 198
683 3300005289 Ga0065704_10104541 Ga0065704_101045413 198
684 3300005295 Ga0065707_10207902 Ga0065707_102079021 198
685 3300005336 Ga0070680_100332941 Ga0070680_1003329412 198
686 3300005338 Ga0068868_100028693 Ga0068868_1000286934 198
687 3300005340 Ga0070689_100185063 Ga0070689_1001850631 198
688 3300005365 Ga0070688_100030695 Ga0070688_1000306951 198
689 3300005366 Ga0070659_100389836 Ga0070659_1003898362 198
690 3300005440 Ga0070705_100268733 Ga0070705_1002687332 198
691 3300005455 Ga0070663_100165890 Ga0070663_1001658902 198
692 3300005456 Ga0070678_100117733 Ga0070678_1001177333 198
693 3300005457 Ga0070662_100047598 Ga0070662_1000475981 198
694 3300005471 Ga0070698_100818242 Ga0070698_1008182421 198
695 3300005535 Ga0070684_100421175 Ga0070684_1004211752 198
696 3300005539 Ga0068853_100602193 Ga0068853_1006021932 198
697 3300005543 Ga0070672_100179542 Ga0070672_1001795422 198
698 3300005544 Ga0070686_100054526 Ga0070686_1000545263 198
699 3300005546 Ga0070696_100090930 Ga0070696_1000909301 198
700 3300005549 Ga0070704_100025931 Ga0070704_1000259314 198
701 3300005563 Ga0068855_100395882 Ga0068855_1003958821 198
702 3300005614 Ga0068856_100099117 Ga0068856_1000991172 198
703 3300005616 Ga0068852_100028640 Ga0068852_1000286404 198
704 3300005616 Ga0068852_100160562 Ga0068852_1001605623 198
705 3300005616 Ga0068852_100239950 Ga0068852_1002399502 198
706 3300005617 Ga0068859_100485626 Ga0068859_1004856262 198
707 3300005843 Ga0068860_101052116 Ga0068860_1010521161 198
708 3300005844 Ga0068862_100023967 Ga0068862_1000239672 198
709 3300005937 Ga0081455_10000659 Ga0081455_1000065911 198
710 3300006051 Ga0075364_10036341 Ga0075364_100363413 198
711 3300006186 Ga0075369_10024805 Ga0075369_100248053 198
712 3300006358 Ga0068871_100189138 Ga0068871_1001891382 198
713 3300006931 Ga0097620_100485610 Ga0097620_1004856102 198
714 3300009094 Ga0111539_10001617 Ga0111539_1000161724 198
715 3300009098 Ga0105245_10171428 Ga0105245_101714282 198
716 3300009098 Ga0105245_10839192 Ga0105245_108391922 198
717 3300009148 Ga0105243_10041195 Ga0105243_100411955 198
718 3300009148 Ga0105243_10473404 Ga0105243_104734042 198
719 3300009545 Ga0105237_10129068 Ga0105237_101290682 198
720 3300009553 Ga0105249_10046536 Ga0105249_100465364 198
721 3300010375 Ga0105239_10231697 Ga0105239_102316973 198
722 3300012515 Ga0157338_1004523 Ga0157338_10045232 198
723 3300013297 Ga0157378_10489160 Ga0157378_104891602 198
724 3300014326 Ga0157380_10441420 Ga0157380_104414202 198
725 3300025295 Ga0209564_1011501 Ga0209564_10115013 198
726 3300025299 Ga0209256_1000460 Ga0209256_100046028 198
727 3300025315 Ga0207697_10026585 Ga0207697_100265853 198
728 3300025885 Ga0207653_10028609 Ga0207653_100286092 198
729 3300025904 Ga0207647_10091381 Ga0207647_100913813 198
730 3300025911 Ga0207654_10026739 Ga0207654_100267392 198
731 3300025912 Ga0207707_10521598 Ga0207707_105215981 198
732 3300025920 Ga0207649_10374068 Ga0207649_103740682 198
733 3300025927 Ga0207687_10178042 Ga0207687_101780422 198
734 3300025932 Ga0207690_10037333 Ga0207690_100373334 198
735 3300025933 Ga0207706_10033294 Ga0207706_100332946 198
736 3300025935 Ga0207709_10122372 Ga0207709_101223722 198
737 3300025935 Ga0207709_10134028 Ga0207709_101340282 198
738 3300025938 Ga0207704_10083009 Ga0207704_100830092 198
739 3300025939 Ga0207665_10061487 Ga0207665_100614873 198
740 3300025949 Ga0207667_10162547 Ga0207667_101625473 198
741 3300025972 Ga0207668_10686525 Ga0207668_106865251 198
742 3300025986 Ga0207658_10536505 Ga0207658_105365051 198
743 3300026023 Ga0207677_10031837 Ga0207677_100318373 198
744 3300026041 Ga0207639_10205825 Ga0207639_102058252 198
745 3300026041 Ga0207639_10627407 Ga0207639_106274072 198
746 3300026075 Ga0207708_10008148 Ga0207708_1000814810 198
747 3300026078 Ga0207702_10199983 Ga0207702_101999832 198
748 3300026089 Ga0207648_10078204 Ga0207648_100782044 198
749 3300026118 Ga0207675_100024838 Ga0207675_1000248382 198
750 3300026121 Ga0207683_10084701 Ga0207683_100847012 198
751 3300026142 Ga0207698_10770574 Ga0207698_107705742 198
752 3300027526 Ga0209968_1008330 Ga0209968_10083303 198
753 3300027617 Ga0210002_1002746 Ga0210002_10027462 198
754 3300027717 Ga0209998_10032756 Ga0209998_100327561 198
755 3300027907 Ga0207428_10000506 Ga0207428_1000050631 198
756 3300028379 Ga0268266_10027683 Ga0268266_100276833 198
757 3300028381 Ga0268264_10357720 Ga0268264_103577202 198
758 3300028381 Ga0268264_10503636 Ga0268264_105036362 198
759 3300031235 Ga0265330_10052459 Ga0265330_100524592 198
760 3300031247 Ga0265340_10174371 Ga0265340_101743711 198
761 3300031249 Ga0265339_10004845 Ga0265339_100048452 198
762 3300031911 Ga0307412_10076536 Ga0307412_100765362 198
763 3300032004 Ga0307414_10539240 Ga0307414_105392402 198
764 3300034816 Ga0373930_0003273 Ga0373930_0003273_849_1541 198
765 3300034817 Ga0373948_0000090 Ga0373948_0000090_8059_8751 198
766 3300034818 Ga0373950_0000160 Ga0373950_0000160_1697_2389 198
767 3300034819 Ga0373958_0003557 Ga0373958_0003557_174_866 198
768 3300034820 Ga0373959_0008220 Ga0373959_0008220_488_1180 198
769 3300034957 Ga0373938_0008431 Ga0373938_0008431_201_893 198
770 3300035084 Ga0373928_0000463 Ga0373928_0000463_7255_7947 198
771 3300035085 Ga0373929_0005210 Ga0373929_0005210_948_1640 198
772 3300035088 Ga0373940_0000121 Ga0373940_0000121_1822_2514 198
773 3300035090 Ga0373949_0001402 Ga0373949_0001402_3294_3986 198
774 3300035091 Ga0373951_0000526 Ga0373951_0000526_3329_4021 198
775 3300035092 Ga0373952_0001660 Ga0373952_0001660_2657_3349 198
776 3300035112 Ga0373932_0000087 Ga0373932_0000087_10964_11656 198
777 3300035114 Ga0373939_0000357 Ga0373939_0000357_8722_9414 198
778 3300035207 Ga0373942_0003123 Ga0373942_0003123_2166_2858 198
779 3300035241 Ga0373961_0000165 Ga0373961_0000165_11955_12647 198
780 3300035691 Ga0373931_0023792 Ga0373931_0023792_526_1218 198
781 3300037471 Ga0395905_0093833 Ga0395905_0093833_2019_2711 198
782 3300042012 Ga0439455_0035826 Ga0439455_0035826_117_809 198
783 3300044712 Ga0453684_0082942 Ga0453684_0082942_641_1333 198
784 3300045051 Ga0451576_0191636 Ga0451576_0191636_802_1494 198
785 3300046460 Ga0495638_0000646 Ga0495638_0000646_4370_5062 198
786 3300046501 Ga0495607_0043870 Ga0495607_0043870_1501_2193 198
787 3300046515 Ga0495620_0037103 Ga0495620_0037103_321_1013 198
788 3300046524 Ga0495648_0000865 Ga0495648_0000865_23314_24006 198
789 3300046665 Ga0495661_0056820 Ga0495661_0056820_724_1416 198
790 3300047444 Ga0495675_0032794 Ga0495675_0032794_753_1445 198
791 3300047472 Ga0495686_0035909 Ga0495686_0035909_971_1663 198
792 3300047472 Ga0495686_0069259 Ga0495686_0069259_745_1437 198
793 3300048906 Ga0496103_0056945 Ga0496103_0056945_729_1421 198
794 3300048909 Ga0496106_0063386 Ga0496106_0063386_1844_2536 198
795 3300048919 Ga0496116_0006031 Ga0496116_0006031_4955_5647 198
796 3300048920 Ga0496117_0266831 Ga0496117_0266831_92_784 198
797 3300048921 Ga0496118_0049440 Ga0496118_0049440_1415_2107 198
798 3300048921 Ga0496118_0063583 Ga0496118_0063583_14_706 198
799 3300048921 Ga0496118_0172262 Ga0496118_0172262_551_1243 198
800 3300048924 Ga0496121_0190993 Ga0496121_0190993_91_783 198
801 3300048925 Ga0496122_0010744 Ga0496122_0010744_2385_3077 198
802 3300048926 Ga0496123_0036404 Ga0496123_0036404_1768_2460 198
803 3300048928 Ga0496125_0000060 Ga0496125_0000060_71410_72102 198
804 3300048928 Ga0496125_0065181 Ga0496125_0065181_1402_2094 198
805 3300048929 Ga0496126_0056230 Ga0496126_0056230_1957_2649 198
806 3300049569 Ga0501032_0033975 Ga0501032_0033975_2782_3474 198
807 3300049572 Ga0501036_0071806 Ga0501036_0071806_2125_2817 198
808 3300049574 Ga0501038_0045248 Ga0501038_0045248_1050_1742 198
809 3300049575 Ga0501039_0070467 Ga0501039_0070467_328_1020 198
810 3300049581 Ga0501047_0156393 Ga0501047_0156393_783_1475 198
811 3300049591 Ga0501075_0157363 Ga0501075_0157363_407_1099 198
812 3300049592 Ga0501076_0054797 Ga0501076_0054797_1171_1863 198
813 3300049823 Ga0501044_0030190 Ga0501044_0030190_1678_2370 198
814 3300050491 nmdc:mga00v17_188799_c1 nmdc:mga00v17_188799_c1_315_1007 198
815 3300050491 nmdc:mga00v17_27373_c1 nmdc:mga00v17_27373_c1_950_1642 198
816 3300050492 nmdc:mga0yw44_6339_c1 nmdc:mga0yw44_6339_c1_3474_4166 198
817 3300050494 nmdc:mga06z11_30436_c1 nmdc:mga06z11_30436_c1_1008_1700 198
818 3300050511 nmdc:mga08y16_3461_c1 nmdc:mga08y16_3461_c1_4301_4993 198
819 3300050515 nmdc:mga0a205_555746_c1 nmdc:mga0a205_555746_c1_28_720 198
820 3300050516 nmdc:mga0sz30_3474_c2 nmdc:mga0sz30_3474_c2_2069_2761 198
821 3300053077 Ga0495601_0072215 Ga0495601_0072215_564_1256 198
822 3300053093 Ga0500651_0046532 Ga0500651_0046532_450_1142 198
823 3300053108 Ga0500562_051227 Ga0500562_051227_357_1049 198
824 3300053116 Ga0500592_003596 Ga0500592_003596_1377_2069 198
825 3300053126 Ga0500621_133588 Ga0500621_133588_41_733 198
826 3300053130 Ga0500642_0000016 Ga0500642_0000016_72707_73399 198
827 3300053134 Ga0500658_0148822 Ga0500658_0148822_24_716 198
828 3300053142 Ga0500577_0000062 Ga0500577_0000062_12213_12905 198

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03737

RraA-like

Aldolase/RraA

38

186

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nxj-assembly1.cif.gz_A structure of rv3853 from mycobacterium tuberculosis 0.8557 42 142
2yjv-assembly1.cif.gz_A crystal structure of e. coli regulator of ribonuclease activity a (rraa) bound to fragment of dead-box protein rhlb 0.8055 36 149
7tzi-assembly2.cif.gz_B structure of a pseudomurein peptide ligase type e from methanothermobacter thermautotrophicus 0.776 72 129
3c8o-assembly1.cif.gz_B the crystal structure of rraa from pao1 0.7575 10 134
1vi4-assembly1.cif.gz_A crystal structure of regulator of ribonuclease activity a protein 1 0.7416 36 161
ID Description Score Start End Superfamily
af_P0A8R0_1_161_3.50.30.40 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like 0.8736 36 134 3.50.30.40
3nojA01 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like 0.7724 27 161 3.50.30.40
af_Q6Z6G8_4_168_3.50.30.40 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like 0.7431 38 161 3.50.30.40
1nxjC00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like 0.7377 42 161 3.50.30.40
2pcnA00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like 0.7366 42 163 3.50.30.40
ID Description Score Start End GO Terms
AF-A0A454JCT5-F1-model_v4 4-carboxy-4-hydroxy-2-oxoadipate aldolase/oxaloacetate decarboxylase 0.9815 56 135 GO:0046872
AF-A0A2M8V5U8-F1-model_v4 deleted 0.9639 39 135
AF-A0A454JCT5-F1-model_v4 4-carboxy-4-hydroxy-2-oxoadipate aldolase/oxaloacetate decarboxylase 0.9579 56 135 GO:0046872
AF-A0A2M8V5U8-F1-model_v4 deleted 0.9267 39 135
AF-A0A7W1K333-F1-model_v4 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase (RraA-like protein) 0.915 3 134 GO:0046872

Feature Viewer

pLDDT pTM Quality
75.28 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map