F482400
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 824 | 514 | 706 | 299 |
Family's Representative Sequence
| Representative Sequence | 3300046543|Ga0495645_0246961|Ga0495645_0246961_111_1121 |
| Length | 336 |
| Sequence | MATEKSAPTDLRDRSNAPTFAMSTDAASAARQPLRWRVGLIGYGEVGQILAEDLRARGLAVSAYDTKLAQAESASLLTRHAAAHGVRLAASHADAAASADLLISAVTASQTLAAAEATSAGLTPRAFFLDFNSASPGAKIRAAEVVAAGGGRYVEGAVMTSLPPYRIRVPLLLGGSHAAALEPLLAAIGFSARVASETLGIASATKMCRSVMIKGLEAMVIESFTTARAYGVEDAVLASLAETFPGINWEKQGAYFFQRVIEHGRRRSEEVREVAETVREAGLTPWSSQGTADRQGWVADLADEGLFGAKGTPEFARSADWRTEADRILGAIKPGK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 3 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 4 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 5 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 6 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 7 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 8 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 9 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 10 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 11 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 12 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 13 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 14 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 15 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 16 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 17 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 18 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 19 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 20 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 21 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 22 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 23 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 24 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 25 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 26 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 27 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 28 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 29 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 30 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 31 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 32 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 33 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 34 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 35 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 36 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 37 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 38 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 39 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 40 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 41 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 42 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 43 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 44 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 45 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 46 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 47 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 48 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 49 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 50 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 51 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 52 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 53 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 54 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 55 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 56 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 57 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 58 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 59 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 60 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 61 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 62 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 63 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 64 | 2904699407 | |||
| 65 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 66 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 67 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 68 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 69 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 70 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 71 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 72 | 2922368715 | |||
| 73 | 2922425934 | |||
| 74 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 75 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 76 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 77 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 78 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 79 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 80 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 81 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 82 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 83 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 84 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 85 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 86 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 87 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 88 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 89 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 90 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 91 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 92 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 93 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 94 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 95 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 96 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 97 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 98 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 99 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 100 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 101 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 102 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 103 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 104 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 105 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 106 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 107 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 108 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 109 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 111 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 112 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 119 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 121 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 123 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 124 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 125 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 127 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 128 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 129 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 130 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 131 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 132 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 133 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 134 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 135 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 136 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 137 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 138 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 139 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 140 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 141 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 142 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 143 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 144 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 145 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 146 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 147 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 148 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 149 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 150 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 151 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 152 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 153 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 154 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 155 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 156 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 157 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 158 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 159 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 160 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 162 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 163 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 164 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 165 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 166 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 167 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 168 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 169 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 170 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 171 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 172 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 173 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 174 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 176 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 177 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 179 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 180 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 181 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 182 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 183 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 184 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 185 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 186 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 187 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 188 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 189 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 190 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 191 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 192 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 193 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 194 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 195 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 196 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 197 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 198 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 199 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 200 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 201 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 202 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 205 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 206 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 207 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 208 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 209 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 210 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 211 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 212 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 213 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 263 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 264 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 265 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 266 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 267 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 271 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 272 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 273 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 274 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 275 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 276 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 277 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 278 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 279 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 280 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 281 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 282 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 283 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 284 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 285 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 286 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 287 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 288 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 289 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 290 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 291 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 292 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 293 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 294 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 295 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 296 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 297 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 298 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 299 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 300 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 301 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 302 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 303 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 304 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 305 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 306 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 307 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 308 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 309 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 310 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 311 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 312 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 313 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 314 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 315 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 316 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 317 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 318 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 319 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 320 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 321 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 322 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 323 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 324 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 325 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 326 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 327 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 328 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 329 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 330 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 331 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 332 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 333 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 334 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 335 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 336 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 337 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 338 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 339 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 340 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 341 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 342 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 411 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 412 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 413 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 414 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 415 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 416 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 417 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 418 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 419 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 420 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 421 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 422 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 423 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 424 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 425 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 426 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 427 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 428 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 429 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 430 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 431 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 432 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 436 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 437 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 438 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 439 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 440 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 441 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 442 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 443 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 444 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 445 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 446 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 447 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 448 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 449 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 451 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 455 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 456 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 457 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 458 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 459 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 460 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 461 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 462 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 463 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 464 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 465 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 466 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 467 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 468 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 469 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 470 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 471 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 472 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 473 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 474 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 475 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 476 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 477 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 478 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 479 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 480 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 481 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 482 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 483 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 484 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 485 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 486 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 487 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 488 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 489 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 490 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 491 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 492 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 493 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 494 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 495 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 496 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 497 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 498 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 499 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 500 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 501 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 502 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 503 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 504 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 505 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 506 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 507 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 508 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 509 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 510 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 511 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 512 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 513 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 514 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 85.99 |
| Metatranscriptomes | 0 |
| Isolates | 14.01 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.2 |
| Nodule | 11.17 |
| Rhizoplane | 2.31 |
| Rhizosphere | 59.83 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.5 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10000427 | 3300003203 | Bacteria | 19396 |
| 2 | JGI25406J46586_10000721 | 3300003203 | Bacteria | 15439 |
| 3 | JGI25153J46596_10000394 | 3300003215 | Bacteria | 29469 |
| 4 | JGI25153J46596_10000515 | 3300003215 | Bacteria | 24363 |
| 5 | JGI25153J46596_10003431 | 3300003215 | Bacteria | 8876 |
| 6 | JGI25160J50197_1000553 | 3300003354 | Bacteria | 21212 |
| 7 | JGI25160J50197_1003853 | 3300003354 | Bacteria | 6586 |
| 8 | JGI25404J52841_10004199 | 3300003659 | Bacteria | 2899 |
| 9 | Ga0055540_1000016 | 3300003792 | Bacteria | 232942 |
| 10 | Ga0055531_10005951 | 3300003794 | Bacteria | 7011 |
| 11 | Ga0055531_10009059 | 3300003794 | Bacteria | 5139 |
| 12 | Ga0065165_1000323 | 3300005262 | Bacteria | 78079 |
| 13 | Ga0065165_1000864 | 3300005262 | Bacteria | 39604 |
| 14 | Ga0065165_1001731 | 3300005262 | Bacteria | 21826 |
| 15 | Ga0065165_1002832 | 3300005262 | Bacteria | 13534 |
| 16 | Ga0065165_1018035 | 3300005262 | Bacteria | 2575 |
| 17 | Ga0065707_10084750 | 3300005295 | Bacteria | 6818 |
| 18 | Ga0070670_100000356 | 3300005331 | Bacteria | 38360 |
| 19 | Ga0070670_100000863 | 3300005331 | Bacteria | 23798 |
| 20 | Ga0070680_100079923 | 3300005336 | Bacteria | 2696 |
| 21 | Ga0070689_100420394 | 3300005340 | Bacteria | 1133 |
| 22 | Ga0070668_100102461 | 3300005347 | Bacteria | 2270 |
| 23 | Ga0070668_100108499 | 3300005347 | Bacteria | 2208 |
| 24 | Ga0070669_100003725 | 3300005353 | Bacteria | 11006 |
| 25 | Ga0070669_100276554 | 3300005353 | Bacteria | 1344 |
| 26 | Ga0070675_100000605 | 3300005354 | Bacteria | 24695 |
| 27 | Ga0070675_100005609 | 3300005354 | Bacteria | 9608 |
| 28 | Ga0070675_100014292 | 3300005354 | Bacteria | 6258 |
| 29 | Ga0070671_100056526 | 3300005355 | Bacteria | 3264 |
| 30 | Ga0070671_100146187 | 3300005355 | Bacteria | 1995 |
| 31 | Ga0070671_100371920 | 3300005355 | Bacteria | 1221 |
| 32 | Ga0070674_100111922 | 3300005356 | Bacteria | 2006 |
| 33 | Ga0070673_100027949 | 3300005364 | Bacteria | 4189 |
| 34 | Ga0070673_100399509 | 3300005364 | Bacteria | 1229 |
| 35 | Ga0070688_100071619 | 3300005365 | Bacteria | 2219 |
| 36 | Ga0070659_100134462 | 3300005366 | Bacteria | 2010 |
| 37 | Ga0070659_100384295 | 3300005366 | Bacteria | 1183 |
| 38 | Ga0070709_10000424 | 3300005434 | Bacteria | 25604 |
| 39 | Ga0070709_10002985 | 3300005434 | Bacteria | 9106 |
| 40 | Ga0070714_100003678 | 3300005435 | Bacteria | 11483 |
| 41 | Ga0070714_100013754 | 3300005435 | Bacteria | 6490 |
| 42 | Ga0070713_100030419 | 3300005436 | Bacteria | 4288 |
| 43 | Ga0070713_100129056 | 3300005436 | Bacteria | 2227 |
| 44 | Ga0070710_10001915 | 3300005437 | Bacteria | 9853 |
| 45 | Ga0070711_100001539 | 3300005439 | Bacteria | 12700 |
| 46 | Ga0070678_100002173 | 3300005456 | Bacteria | 10652 |
| 47 | Ga0070678_100084367 | 3300005456 | Bacteria | 2418 |
| 48 | Ga0070678_100140953 | 3300005456 | Bacteria | 1929 |
| 49 | Ga0070662_100217608 | 3300005457 | Bacteria | 1522 |
| 50 | Ga0068867_100020518 | 3300005459 | Bacteria | 4709 |
| 51 | Ga0068867_100142067 | 3300005459 | Bacteria | 1877 |
| 52 | Ga0070685_10255334 | 3300005466 | Bacteria | 1163 |
| 53 | Ga0070707_100276763 | 3300005468 | Bacteria | 1631 |
| 54 | Ga0070698_100216165 | 3300005471 | Bacteria | 1851 |
| 55 | Ga0070698_100406495 | 3300005471 | Bacteria | 1295 |
| 56 | Ga0070697_100196357 | 3300005536 | Bacteria | 1714 |
| 57 | Ga0068853_100130016 | 3300005539 | Bacteria | 2253 |
| 58 | Ga0068853_100573755 | 3300005539 | Bacteria | 1070 |
| 59 | Ga0070672_100000414 | 3300005543 | Bacteria | 24728 |
| 60 | Ga0070695_100401705 | 3300005545 | Bacteria | 1039 |
| 61 | Ga0070665_100075896 | 3300005548 | Bacteria | 3368 |
| 62 | Ga0070665_100273831 | 3300005548 | Bacteria | 1690 |
| 63 | Ga0070665_100518282 | 3300005548 | Bacteria | 1204 |
| 64 | Ga0070704_100041535 | 3300005549 | Bacteria | 3175 |
| 65 | Ga0070664_100051993 | 3300005564 | Bacteria | 3469 |
| 66 | Ga0068856_100400334 | 3300005614 | Bacteria | 1393 |
| 67 | Ga0068852_100008171 | 3300005616 | Bacteria | 7686 |
| 68 | Ga0068852_100211402 | 3300005616 | Bacteria | 1840 |
| 69 | Ga0068864_100008694 | 3300005618 | Bacteria | 8378 |
| 70 | Ga0068864_100033367 | 3300005618 | Bacteria | 4376 |
| 71 | Ga0068864_100047550 | 3300005618 | Bacteria | 3686 |
| 72 | Ga0068864_100136178 | 3300005618 | Bacteria | 2211 |
| 73 | Ga0068864_100176536 | 3300005618 | Bacteria | 1951 |
| 74 | Ga0068861_100061248 | 3300005719 | Bacteria | 2887 |
| 75 | Ga0068861_100095214 | 3300005719 | Bacteria | 2358 |
| 76 | Ga0068851_10028027 | 3300005834 | Bacteria | 2780 |
| 77 | Ga0068851_10159197 | 3300005834 | Bacteria | 1239 |
| 78 | Ga0068851_10173127 | 3300005834 | Bacteria | 1192 |
| 79 | Ga0068870_10085739 | 3300005840 | Bacteria | 1751 |
| 80 | Ga0068870_10091555 | 3300005840 | Bacteria | 1701 |
| 81 | Ga0068863_100003193 | 3300005841 | Bacteria | 16207 |
| 82 | Ga0068863_100082278 | 3300005841 | Bacteria | 3050 |
| 83 | Ga0068863_100350422 | 3300005841 | Bacteria | 1438 |
| 84 | Ga0068858_100402305 | 3300005842 | Bacteria | 1316 |
| 85 | Ga0068860_100000101 | 3300005843 | Bacteria | 142856 |
| 86 | Ga0068860_100116317 | 3300005843 | Bacteria | 2558 |
| 87 | Ga0068860_100362498 | 3300005843 | Bacteria | 1428 |
| 88 | Ga0068862_100032137 | 3300005844 | Bacteria | 4434 |
| 89 | Ga0068862_100172936 | 3300005844 | Bacteria | 1934 |
| 90 | Ga0081455_10005550 | 3300005937 | Bacteria | 13809 |
| 91 | Ga0081455_10045525 | 3300005937 | Bacteria | 3817 |
| 92 | Ga0081455_10055991 | 3300005937 | Bacteria | 3351 |
| 93 | Ga0081540_1002607 | 3300005983 | Bacteria | 14656 |
| 94 | Ga0081540_1002952 | 3300005983 | Bacteria | 13657 |
| 95 | Ga0081540_1015686 | 3300005983 | Bacteria | 4783 |
| 96 | Ga0081539_10000486 | 3300005985 | Bacteria | 84009 |
| 97 | Ga0081539_10000748 | 3300005985 | Bacteria | 64594 |
| 98 | Ga0070717_10016495 | 3300006028 | Bacteria | 5727 |
| 99 | Ga0075368_10009249 | 3300006042 | Bacteria | 3541 |
| 100 | Ga0075364_10014392 | 3300006051 | Bacteria | 4887 |
| 101 | Ga0075364_10140267 | 3300006051 | Bacteria | 1625 |
| 102 | Ga0070715_10001596 | 3300006163 | Bacteria | 6680 |
| 103 | Ga0070715_10071826 | 3300006163 | Bacteria | 1548 |
| 104 | Ga0070716_100003246 | 3300006173 | Bacteria | 7637 |
| 105 | Ga0070716_100008627 | 3300006173 | Bacteria | 5065 |
| 106 | Ga0070712_100012263 | 3300006175 | Bacteria | 5448 |
| 107 | Ga0070712_100127807 | 3300006175 | Bacteria | 1922 |
| 108 | Ga0075367_10087797 | 3300006178 | Bacteria | 1889 |
| 109 | Ga0075369_10009841 | 3300006186 | Bacteria | 3727 |
| 110 | Ga0075366_10045747 | 3300006195 | Bacteria | 2593 |
| 111 | Ga0075366_10159010 | 3300006195 | Bacteria | 1369 |
| 112 | Ga0097621_100102844 | 3300006237 | Bacteria | 2406 |
| 113 | Ga0097621_100344588 | 3300006237 | Bacteria | 1324 |
| 114 | Ga0068871_100084800 | 3300006358 | Bacteria | 2629 |
| 115 | Ga0075428_100014031 | 3300006844 | Bacteria | 8916 |
| 116 | Ga0075428_100218324 | 3300006844 | Bacteria | 2059 |
| 117 | Ga0075430_100133005 | 3300006846 | Bacteria | 2073 |
| 118 | Ga0075431_100005130 | 3300006847 | Bacteria | 12882 |
| 119 | Ga0075434_100183497 | 3300006871 | Bacteria | 2113 |
| 120 | Ga0075429_100022932 | 3300006880 | Bacteria | 5412 |
| 121 | Ga0068865_100325279 | 3300006881 | Bacteria | 1238 |
| 122 | Ga0099825_1027409 | 3300006941 | Bacteria | 2900 |
| 123 | Ga0099824_1002281 | 3300006942 | Bacteria | 27988 |
| 124 | Ga0099823_1064280 | 3300006944 | Bacteria | 1807 |
| 125 | Ga0099823_1064406 | 3300006944 | Bacteria | 1801 |
| 126 | Ga0079104_1000198 | 3300006946 | Bacteria | 84522 |
| 127 | Ga0099794_10017152 | 3300007265 | Bacteria | 3223 |
| 128 | Ga0105240_10129483 | 3300009093 | Bacteria | 3029 |
| 129 | Ga0105240_10207526 | 3300009093 | Bacteria | 2292 |
| 130 | Ga0111539_10079988 | 3300009094 | Bacteria | 3845 |
| 131 | Ga0105245_10144368 | 3300009098 | Bacteria | 2245 |
| 132 | Ga0105247_10022846 | 3300009101 | Bacteria | 3768 |
| 133 | Ga0114129_10029501 | 3300009147 | Bacteria | 7770 |
| 134 | Ga0105241_10053629 | 3300009174 | Bacteria | 3084 |
| 135 | Ga0105241_10060458 | 3300009174 | Bacteria | 2915 |
| 136 | Ga0105237_10006673 | 3300009545 | Bacteria | 12756 |
| 137 | Ga0105237_10055847 | 3300009545 | Bacteria | 3954 |
| 138 | Ga0105237_10443482 | 3300009545 | Bacteria | 1304 |
| 139 | Ga0105238_10077488 | 3300009551 | Bacteria | 3315 |
| 140 | Ga0099796_10029489 | 3300010159 | Bacteria | 1771 |
| 141 | Ga0105239_10037528 | 3300010375 | Bacteria | 5309 |
| 142 | Ga0105239_10091272 | 3300010375 | Bacteria | 3361 |
| 143 | Ga0105239_10141182 | 3300010375 | Bacteria | 2684 |
| 144 | Ga0105239_10160420 | 3300010375 | Bacteria | 2512 |
| 145 | Ga0105239_10266992 | 3300010375 | Bacteria | 1924 |
| 146 | Ga0105246_10034503 | 3300011119 | Bacteria | 3373 |
| 147 | Ga0157370_10289190 | 3300013104 | Bacteria | 1514 |
| 148 | Ga0157378_10001074 | 3300013297 | Bacteria | 24973 |
| 149 | Ga0157378_10433213 | 3300013297 | Bacteria | 1302 |
| 150 | Ga0163162_10015009 | 3300013306 | Bacteria | 7566 |
| 151 | Ga0163162_10732644 | 3300013306 | Bacteria | 1109 |
| 152 | Ga0157375_10020347 | 3300013308 | Bacteria | 6060 |
| 153 | Ga0157375_10556747 | 3300013308 | Bacteria | 1308 |
| 154 | Ga0163163_10016588 | 3300014325 | Bacteria | 6850 |
| 155 | Ga0163163_10022097 | 3300014325 | Bacteria | 6017 |
| 156 | Ga0163163_10054763 | 3300014325 | Bacteria | 3941 |
| 157 | Ga0163163_10132664 | 3300014325 | Bacteria | 2531 |
| 158 | Ga0157380_10032883 | 3300014326 | Bacteria | 3991 |
| 159 | Ga0157380_10148991 | 3300014326 | Bacteria | 2020 |
| 160 | Ga0157380_10323784 | 3300014326 | Bacteria | 1430 |
| 161 | Ga0157379_10096110 | 3300014968 | Bacteria | 2659 |
| 162 | Ga0157379_10231885 | 3300014968 | Bacteria | 1673 |
| 163 | Ga0157379_10587263 | 3300014968 | Bacteria | 1039 |
| 164 | Ga0157376_10039268 | 3300014969 | Bacteria | 3859 |
| 165 | Ga0157376_10136716 | 3300014969 | Bacteria | 2194 |
| 166 | Ga0163161_10039167 | 3300017792 | Bacteria | 3401 |
| 167 | Ga0214544_1000002 | 3300021320 | Bacteria | 753857 |
| 168 | Ga0214542_1000001 | 3300021321 | Bacteria | 1018696 |
| 169 | Ga0214545_1000001 | 3300021324 | Bacteria | 1092817 |
| 170 | Ga0214545_1026202 | 3300021324 | Bacteria | 3213 |
| 171 | Ga0214543_1000001 | 3300021327 | Bacteria | 776921 |
| 172 | Ga0213872_10000001 | 3300021361 | Bacteria | 662532 |
| 173 | Ga0213876_10003361 | 3300021384 | Bacteria | 9159 |
| 174 | Ga0213871_10000559 | 3300021441 | Bacteria | 5205 |
| 175 | Ga0209563_100899 | 3300025230 | Bacteria | 8806 |
| 176 | Ga0209677_100280 | 3300025253 | Bacteria | 34034 |
| 177 | Ga0209677_102333 | 3300025253 | Bacteria | 7281 |
| 178 | Ga0209148_1000500 | 3300025254 | Bacteria | 39994 |
| 179 | Ga0209148_1010747 | 3300025254 | Bacteria | 1726 |
| 180 | Ga0209233_1002090 | 3300025261 | Bacteria | 7536 |
| 181 | Ga0209233_1005160 | 3300025261 | Bacteria | 4364 |
| 182 | Ga0209455_1001166 | 3300025272 | Bacteria | 12650 |
| 183 | Ga0209673_1024009 | 3300025273 | Bacteria | 2060 |
| 184 | Ga0209564_1000097 | 3300025295 | Bacteria | 231436 |
| 185 | Ga0209564_1006369 | 3300025295 | Bacteria | 6395 |
| 186 | Ga0209564_1017192 | 3300025295 | Bacteria | 2833 |
| 187 | Ga0209758_1000024 | 3300025297 | Bacteria | 591966 |
| 188 | Ga0209758_1000068 | 3300025297 | Bacteria | 286488 |
| 189 | Ga0209758_1001533 | 3300025297 | Bacteria | 26615 |
| 190 | Ga0209758_1008784 | 3300025297 | Bacteria | 6441 |
| 191 | Ga0209758_1036964 | 3300025297 | Bacteria | 1896 |
| 192 | Ga0209050_1000082 | 3300025298 | Bacteria | 266864 |
| 193 | Ga0209050_1004407 | 3300025298 | Bacteria | 9528 |
| 194 | Ga0209256_1001900 | 3300025299 | Bacteria | 19109 |
| 195 | Ga0209256_1016592 | 3300025299 | Bacteria | 2499 |
| 196 | Ga0207426_1000238 | 3300025302 | Bacteria | 124393 |
| 197 | Ga0209051_1000029 | 3300025303 | Bacteria | 403675 |
| 198 | Ga0209257_1000030 | 3300025304 | Bacteria | 689812 |
| 199 | Ga0209257_1001149 | 3300025304 | Bacteria | 33675 |
| 200 | Ga0209257_1011659 | 3300025304 | Bacteria | 4193 |
| 201 | Ga0209257_1036359 | 3300025304 | Bacteria | 1513 |
| 202 | Ga0207697_10020544 | 3300025315 | Bacteria | 2703 |
| 203 | Ga0207656_10011260 | 3300025321 | Bacteria | 3377 |
| 204 | Ga0207682_10011775 | 3300025893 | Bacteria | 3417 |
| 205 | Ga0207692_10000318 | 3300025898 | Bacteria | 16715 |
| 206 | Ga0207692_10000738 | 3300025898 | Bacteria | 11534 |
| 207 | Ga0207642_10063039 | 3300025899 | Bacteria | 1732 |
| 208 | Ga0207647_10013481 | 3300025904 | Bacteria | 5662 |
| 209 | Ga0207685_10003083 | 3300025905 | Bacteria | 3977 |
| 210 | Ga0207699_10000465 | 3300025906 | Bacteria | 20602 |
| 211 | Ga0207699_10067812 | 3300025906 | Bacteria | 2170 |
| 212 | Ga0207645_10013062 | 3300025907 | Bacteria | 5610 |
| 213 | Ga0207643_10012934 | 3300025908 | Bacteria | 4513 |
| 214 | Ga0207643_10041091 | 3300025908 | Bacteria | 2605 |
| 215 | Ga0207643_10111752 | 3300025908 | Bacteria | 1610 |
| 216 | Ga0207654_10049797 | 3300025911 | Bacteria | 2405 |
| 217 | Ga0207695_10000008 | 3300025913 | Bacteria | 1058268 |
| 218 | Ga0207671_10003142 | 3300025914 | Bacteria | 16765 |
| 219 | Ga0207693_10003071 | 3300025915 | Bacteria | 14397 |
| 220 | Ga0207693_10003980 | 3300025915 | Bacteria | 12554 |
| 221 | Ga0207693_10022195 | 3300025915 | Bacteria | 5045 |
| 222 | Ga0207663_10001512 | 3300025916 | Bacteria | 10861 |
| 223 | Ga0207662_10069192 | 3300025918 | Bacteria | 2133 |
| 224 | Ga0207649_10414269 | 3300025920 | Bacteria | 1011 |
| 225 | Ga0207646_10304117 | 3300025922 | Bacteria | 1441 |
| 226 | Ga0207681_10044971 | 3300025923 | Bacteria | 2961 |
| 227 | Ga0207681_10119563 | 3300025923 | Bacteria | 1930 |
| 228 | Ga0207694_10346915 | 3300025924 | Bacteria | 1228 |
| 229 | Ga0207650_10000326 | 3300025925 | Bacteria | 46321 |
| 230 | Ga0207650_10000755 | 3300025925 | Bacteria | 24847 |
| 231 | Ga0207650_10038912 | 3300025925 | Bacteria | 3475 |
| 232 | Ga0207659_10000299 | 3300025926 | Bacteria | 29997 |
| 233 | Ga0207659_10003624 | 3300025926 | Bacteria | 9300 |
| 234 | Ga0207687_10083695 | 3300025927 | Bacteria | 2310 |
| 235 | Ga0207700_10195137 | 3300025928 | Bacteria | 1703 |
| 236 | Ga0207664_10019656 | 3300025929 | Bacteria | 4997 |
| 237 | Ga0207664_10089866 | 3300025929 | Bacteria | 2516 |
| 238 | Ga0207644_10001354 | 3300025931 | Bacteria | 15752 |
| 239 | Ga0207644_10343947 | 3300025931 | Bacteria | 1210 |
| 240 | Ga0207690_10204413 | 3300025932 | Bacteria | 1502 |
| 241 | Ga0207706_10033883 | 3300025933 | Bacteria | 4546 |
| 242 | Ga0207706_10100121 | 3300025933 | Bacteria | 2550 |
| 243 | Ga0207670_10054636 | 3300025936 | Bacteria | 2695 |
| 244 | Ga0207670_10118260 | 3300025936 | Bacteria | 1922 |
| 245 | Ga0207704_10008488 | 3300025938 | Bacteria | 4918 |
| 246 | Ga0207704_10018327 | 3300025938 | Bacteria | 3652 |
| 247 | Ga0207665_10002891 | 3300025939 | Bacteria | 11523 |
| 248 | Ga0207665_10008158 | 3300025939 | Bacteria | 6912 |
| 249 | Ga0207691_10000049 | 3300025940 | Bacteria | 94813 |
| 250 | Ga0207691_10000111 | 3300025940 | Bacteria | 72961 |
| 251 | Ga0207711_10209732 | 3300025941 | Bacteria | 1779 |
| 252 | Ga0207711_10258226 | 3300025941 | Bacteria | 1601 |
| 253 | Ga0207667_10068267 | 3300025949 | Bacteria | 3702 |
| 254 | Ga0207651_10000834 | 3300025960 | Bacteria | 13379 |
| 255 | Ga0207651_10018903 | 3300025960 | Bacteria | 4115 |
| 256 | Ga0207651_10149752 | 3300025960 | Bacteria | 1815 |
| 257 | Ga0207651_10372158 | 3300025960 | Bacteria | 1209 |
| 258 | Ga0207668_10025834 | 3300025972 | Bacteria | 3806 |
| 259 | Ga0207668_10037606 | 3300025972 | Bacteria | 3241 |
| 260 | Ga0207668_10070780 | 3300025972 | Bacteria | 2489 |
| 261 | Ga0207640_10100356 | 3300025981 | Bacteria | 2028 |
| 262 | Ga0207658_10287972 | 3300025986 | Bacteria | 1411 |
| 263 | Ga0207677_10013354 | 3300026023 | Bacteria | 4756 |
| 264 | Ga0207703_10490235 | 3300026035 | Bacteria | 1152 |
| 265 | Ga0207639_10170525 | 3300026041 | Bacteria | 1843 |
| 266 | Ga0207678_10043159 | 3300026067 | Bacteria | 3903 |
| 267 | Ga0207678_10090364 | 3300026067 | Bacteria | 2617 |
| 268 | Ga0207702_10021218 | 3300026078 | Bacteria | 5376 |
| 269 | Ga0207641_10009740 | 3300026088 | Bacteria | 7915 |
| 270 | Ga0207641_10112454 | 3300026088 | Bacteria | 2416 |
| 271 | Ga0207641_10138219 | 3300026088 | Bacteria | 2195 |
| 272 | Ga0207641_10161713 | 3300026088 | Bacteria | 2036 |
| 273 | Ga0207641_10396636 | 3300026088 | Bacteria | 1324 |
| 274 | Ga0207641_10416929 | 3300026088 | Bacteria | 1292 |
| 275 | Ga0207648_10002748 | 3300026089 | Bacteria | 18702 |
| 276 | Ga0207648_10016729 | 3300026089 | Bacteria | 6692 |
| 277 | Ga0207648_10098622 | 3300026089 | Bacteria | 2558 |
| 278 | Ga0207676_10032058 | 3300026095 | Bacteria | 3957 |
| 279 | Ga0207676_10130259 | 3300026095 | Bacteria | 2137 |
| 280 | Ga0207676_10252070 | 3300026095 | Bacteria | 1589 |
| 281 | Ga0207676_10319242 | 3300026095 | Bacteria | 1425 |
| 282 | Ga0207674_10081398 | 3300026116 | Bacteria | 3240 |
| 283 | Ga0207675_100037456 | 3300026118 | Bacteria | 4524 |
| 284 | Ga0207675_100089563 | 3300026118 | Bacteria | 2892 |
| 285 | Ga0207683_10016814 | 3300026121 | Bacteria | 6225 |
| 286 | Ga0207683_10173750 | 3300026121 | Bacteria | 1952 |
| 287 | Ga0207683_10294647 | 3300026121 | Bacteria | 1484 |
| 288 | Ga0209281_1000457 | 3300027111 | Bacteria | 57515 |
| 289 | Ga0209389_1000040 | 3300027296 | Bacteria | 124256 |
| 290 | Ga0209489_120706 | 3300027361 | Bacteria | 1815 |
| 291 | Ga0209489_120707 | 3300027361 | Bacteria | 1815 |
| 292 | Ga0209700_100005 | 3300027363 | Bacteria | 573969 |
| 293 | Ga0209813_10065105 | 3300027866 | Bacteria | 1173 |
| 294 | Ga0268266_10482361 | 3300028379 | Bacteria | 1182 |
| 295 | Ga0268265_10083949 | 3300028380 | Bacteria | 2524 |
| 296 | Ga0268264_10000030 | 3300028381 | Bacteria | 418542 |
| 297 | Ga0268264_10031537 | 3300028381 | Bacteria | 4344 |
| 298 | Ga0268264_10210050 | 3300028381 | Bacteria | 1786 |
| 299 | Ga0268264_10251361 | 3300028381 | Bacteria | 1642 |
| 300 | Ga0268264_10332808 | 3300028381 | Bacteria | 1440 |
| 301 | Ga0265337_1001439 | 3300028556 | Bacteria | 11715 |
| 302 | Ga0265326_10001380 | 3300028558 | Bacteria | 8553 |
| 303 | Ga0265319_1002798 | 3300028563 | Bacteria | 9365 |
| 304 | Ga0265334_10005260 | 3300028573 | Bacteria | 5665 |
| 305 | Ga0265318_10003474 | 3300028577 | Bacteria | 7906 |
| 306 | Ga0265323_10000992 | 3300028653 | Bacteria | 14760 |
| 307 | Ga0265322_10002589 | 3300028654 | Bacteria | 5560 |
| 308 | Ga0265336_10000063 | 3300028666 | Bacteria | 98413 |
| 309 | Ga0307517_10000085 | 3300028786 | Bacteria | 131200 |
| 310 | Ga0307517_10043224 | 3300028786 | Bacteria | 4806 |
| 311 | Ga0307515_10000292 | 3300028794 | Bacteria | 123160 |
| 312 | Ga0307515_10000658 | 3300028794 | Bacteria | 79766 |
| 313 | Ga0307515_10006378 | 3300028794 | Bacteria | 23616 |
| 314 | Ga0307515_10027739 | 3300028794 | Bacteria | 9660 |
| 315 | Ga0307515_10094574 | 3300028794 | Bacteria | 3690 |
| 316 | Ga0307515_10165545 | 3300028794 | Bacteria | 2231 |
| 317 | Ga0265338_10000154 | 3300028800 | Bacteria | 125708 |
| 318 | Ga0265324_10001590 | 3300029957 | Bacteria | 12642 |
| 319 | Ga0265332_10007298 | 3300031238 | Bacteria | 4999 |
| 320 | Ga0265328_10037935 | 3300031239 | Bacteria | 1779 |
| 321 | Ga0265325_10002402 | 3300031241 | Bacteria | 12664 |
| 322 | Ga0265340_10020838 | 3300031247 | Bacteria | 3363 |
| 323 | Ga0265339_10025106 | 3300031249 | Bacteria | 3425 |
| 324 | Ga0265331_10055199 | 3300031250 | Bacteria | 1890 |
| 325 | Ga0265316_10206274 | 3300031344 | Bacteria | 1455 |
| 326 | Ga0307509_10104348 | 3300031507 | Bacteria | 2859 |
| 327 | Ga0307509_10139196 | 3300031507 | Bacteria | 2366 |
| 328 | Ga0307509_10149716 | 3300031507 | Bacteria | 2252 |
| 329 | Ga0307508_10000282 | 3300031616 | Bacteria | 62510 |
| 330 | Ga0307508_10009668 | 3300031616 | Bacteria | 8854 |
| 331 | Ga0307508_10014131 | 3300031616 | Bacteria | 7284 |
| 332 | Ga0307508_10092867 | 3300031616 | Bacteria | 2607 |
| 333 | Ga0307508_10188415 | 3300031616 | Bacteria | 1664 |
| 334 | Ga0307508_10279793 | 3300031616 | Bacteria | 1262 |
| 335 | Ga0265314_10053104 | 3300031711 | Bacteria | 2812 |
| 336 | Ga0265342_10023837 | 3300031712 | Bacteria | 3867 |
| 337 | Ga0265342_10057119 | 3300031712 | Bacteria | 2311 |
| 338 | Ga0307516_10009880 | 3300031730 | Bacteria | 10581 |
| 339 | Ga0307516_10052275 | 3300031730 | Bacteria | 3999 |
| 340 | Ga0307516_10098215 | 3300031730 | Bacteria | 2747 |
| 341 | Ga0307516_10227071 | 3300031730 | Bacteria | 1573 |
| 342 | Ga0307516_10345143 | 3300031730 | Bacteria | 1155 |
| 343 | Ga0307405_10008218 | 3300031731 | Bacteria | 5278 |
| 344 | Ga0307413_10002493 | 3300031824 | Bacteria | 7503 |
| 345 | Ga0307407_10093220 | 3300031903 | Bacteria | 1851 |
| 346 | Ga0307412_10004520 | 3300031911 | Bacteria | 7750 |
| 347 | Ga0307414_10009478 | 3300032004 | Bacteria | 5596 |
| 348 | Ga0307411_10003401 | 3300032005 | Bacteria | 7374 |
| 349 | Ga0307411_10165481 | 3300032005 | Bacteria | 1662 |
| 350 | Ga0307415_100060832 | 3300032126 | Bacteria | 2612 |
| 351 | Ga0307507_10091082 | 3300033179 | Bacteria | 2613 |
| 352 | Ga0307507_10155690 | 3300033179 | Bacteria | 1704 |
| 353 | Ga0307510_10086514 | 3300033180 | Bacteria | 3006 |
| 354 | Ga0316215_1000817 | 3300033544 | Bacteria | 3121 |
| 355 | Ga0373934_0013228 | 3300035086 | Bacteria | 3118 |
| 356 | Ga0373923_0008179 | 3300035111 | Bacteria | 3716 |
| 357 | Ga0373923_0036844 | 3300035111 | Bacteria | 1999 |
| 358 | Ga0373923_0143927 | 3300035111 | Bacteria | 1079 |
| 359 | Ga0373936_0001944 | 3300035113 | Bacteria | 7639 |
| 360 | Ga0373953_0000542 | 3300035117 | Bacteria | 10471 |
| 361 | Ga0373953_0006315 | 3300035117 | Bacteria | 3899 |
| 362 | Ga0373953_0110086 | 3300035117 | Bacteria | 1164 |
| 363 | Ga0373954_0000323 | 3300035118 | Bacteria | 17518 |
| 364 | Ga0373956_0009107 | 3300035119 | Bacteria | 4026 |
| 365 | Ga0373956_0018340 | 3300035119 | Bacteria | 2962 |
| 366 | Ga0373957_0002539 | 3300035120 | Bacteria | 5230 |
| 367 | Ga0373957_0037806 | 3300035120 | Bacteria | 1804 |
| 368 | Ga0373943_0005734 | 3300035170 | Bacteria | 5571 |
| 369 | Ga0373955_0003057 | 3300035172 | Bacteria | 7328 |
| 370 | Ga0373955_0078810 | 3300035172 | Bacteria | 1857 |
| 371 | Ga0373924_0011712 | 3300035410 | Bacteria | 3262 |
| 372 | Ga0373935_0005504 | 3300035692 | Bacteria | 7459 |
| 373 | Ga0373927_0001069 | 3300035695 | Bacteria | 20955 |
| 374 | Ga0373927_0010672 | 3300035695 | Bacteria | 6119 |
| 375 | Ga0373927_0028676 | 3300035695 | Bacteria | 3631 |
| 376 | Ga0373933_0001324 | 3300035724 | Bacteria | 14581 |
| 377 | Ga0373947_0007770 | 3300035725 | Bacteria | 6196 |
| 378 | Ga0373947_0030133 | 3300035725 | Bacteria | 3187 |
| 379 | Ga0373947_0063015 | 3300035725 | Bacteria | 2258 |
| 380 | Ga0373937_0007329 | 3300036401 | Bacteria | 9549 |
| 381 | Ga0373937_0027340 | 3300036401 | Bacteria | 5158 |
| 382 | Ga0373937_0049474 | 3300036401 | Bacteria | 3849 |
| 383 | Ga0373937_0087326 | 3300036401 | Bacteria | 2886 |
| 384 | Ga0373925_0003237 | 3300037068 | Bacteria | 12714 |
| 385 | Ga0373925_0004343 | 3300037068 | Bacteria | 10729 |
| 386 | Ga0395900_0001802 | 3300037418 | Bacteria | 24563 |
| 387 | Ga0395898_0002995 | 3300037466 | Bacteria | 19169 |
| 388 | Ga0395898_0211261 | 3300037466 | Bacteria | 1851 |
| 389 | Ga0395905_0044603 | 3300037471 | Bacteria | 4161 |
| 390 | Ga0395905_0098471 | 3300037471 | Bacteria | 2746 |
| 391 | Ga0395905_0155856 | 3300037471 | Bacteria | 2148 |
| 392 | Ga0436365_0263215 | 3300039437 | Bacteria | 999 |
| 393 | Ga0436365_0619230 | 3300039437 | Bacteria | 1498 |
| 394 | Ga0436365_1549030 | 3300039437 | Bacteria | 8562 |
| 395 | Ga0436360_0271985 | 3300039438 | Bacteria | 4245 |
| 396 | Ga0436360_0376160 | 3300039438 | Bacteria | 1895 |
| 397 | Ga0436361_0028664 | 3300039447 | Bacteria | 69721 |
| 398 | Ga0436361_0833650 | 3300039447 | Bacteria | 10674 |
| 399 | Ga0436362_1138875 | 3300039453 | Bacteria | 1147 |
| 400 | Ga0450919_001148 | 3300042121 | Bacteria | 3442 |
| 401 | Ga0450918_005595 | 3300042531 | Bacteria | 2254 |
| 402 | Ga0450893_0014757 | 3300042532 | Bacteria | 1313 |
| 403 | Ga0451577_0226677 | 3300042876 | Bacteria | 1689 |
| 404 | Ga0451577_0302852 | 3300042876 | Bacteria | 1448 |
| 405 | Ga0466972_0000122 | 3300044658 | Bacteria | 65679 |
| 406 | Ga0466966_0000599 | 3300044684 | Bacteria | 22829 |
| 407 | Ga0466966_0009768 | 3300044684 | Bacteria | 6359 |
| 408 | Ga0466966_0062349 | 3300044684 | Bacteria | 2351 |
| 409 | Ga0466961_0000038 | 3300044693 | Bacteria | 80721 |
| 410 | Ga0466963_0026664 | 3300044694 | Bacteria | 3696 |
| 411 | Ga0466963_0144072 | 3300044694 | Bacteria | 1652 |
| 412 | Ga0453684_0037503 | 3300044712 | Bacteria | 6651 |
| 413 | Ga0453684_0197961 | 3300044712 | Bacteria | 2344 |
| 414 | Ga0466971_0089726 | 3300044719 | Bacteria | 1407 |
| 415 | Ga0466970_0209385 | 3300044765 | Bacteria | 1086 |
| 416 | Ga0466960_0029269 | 3300044901 | Bacteria | 2527 |
| 417 | Ga0466959_0000493 | 3300045049 | Bacteria | 22980 |
| 418 | Ga0466959_0108206 | 3300045049 | Bacteria | 1986 |
| 419 | Ga0451576_0020692 | 3300045051 | Bacteria | 7160 |
| 420 | Ga0451576_0317332 | 3300045051 | Bacteria | 1630 |
| 421 | Ga0451576_0478722 | 3300045051 | Bacteria | 1308 |
| 422 | Ga0466958_0010717 | 3300045836 | Bacteria | 5141 |
| 423 | Ga0495592_0002287 | 3300046454 | Bacteria | 13506 |
| 424 | Ga0495592_0019534 | 3300046454 | Bacteria | 5154 |
| 425 | Ga0495592_0020984 | 3300046454 | Bacteria | 4968 |
| 426 | Ga0495603_0000064 | 3300046455 | Bacteria | 46716 |
| 427 | Ga0495603_0031445 | 3300046455 | Bacteria | 3195 |
| 428 | Ga0495603_0072564 | 3300046455 | Bacteria | 2022 |
| 429 | Ga0495590_0073441 | 3300046457 | Bacteria | 1202 |
| 430 | Ga0495629_0001770 | 3300046459 | Bacteria | 16944 |
| 431 | Ga0495629_0013834 | 3300046459 | Bacteria | 5822 |
| 432 | Ga0495629_0045225 | 3300046459 | Bacteria | 3089 |
| 433 | Ga0495629_0059855 | 3300046459 | Bacteria | 2662 |
| 434 | Ga0495638_0013480 | 3300046460 | Bacteria | 5564 |
| 435 | Ga0495638_0017406 | 3300046460 | Bacteria | 4791 |
| 436 | Ga0495638_0072038 | 3300046460 | Bacteria | 2112 |
| 437 | Ga0495638_0130066 | 3300046460 | Bacteria | 1480 |
| 438 | Ga0495641_0004409 | 3300046461 | Bacteria | 9961 |
| 439 | Ga0495651_0029648 | 3300046462 | Bacteria | 4266 |
| 440 | Ga0495651_0134345 | 3300046462 | Bacteria | 1802 |
| 441 | Ga0495651_0155022 | 3300046462 | Bacteria | 1647 |
| 442 | Ga0495653_0014349 | 3300046463 | Bacteria | 6463 |
| 443 | Ga0495653_0058227 | 3300046463 | Bacteria | 2938 |
| 444 | Ga0495653_0296414 | 3300046463 | Bacteria | 1056 |
| 445 | Ga0495650_0035553 | 3300046471 | Bacteria | 2192 |
| 446 | Ga0495580_0002618 | 3300046472 | Bacteria | 15620 |
| 447 | Ga0495582_0000197 | 3300046473 | Bacteria | 33437 |
| 448 | Ga0495605_0081142 | 3300046474 | Bacteria | 1517 |
| 449 | Ga0495639_0001620 | 3300046475 | Bacteria | 10038 |
| 450 | Ga0495639_0057030 | 3300046475 | Bacteria | 1784 |
| 451 | Ga0495662_0012317 | 3300046476 | Bacteria | 4174 |
| 452 | Ga0495664_0011941 | 3300046477 | Bacteria | 4907 |
| 453 | Ga0495664_0017512 | 3300046477 | Bacteria | 4098 |
| 454 | Ga0495664_0058506 | 3300046477 | Bacteria | 2293 |
| 455 | Ga0495594_0004585 | 3300046499 | Bacteria | 7112 |
| 456 | Ga0495607_0032563 | 3300046501 | Bacteria | 3180 |
| 457 | Ga0495606_0009544 | 3300046507 | Bacteria | 8193 |
| 458 | Ga0495608_0017164 | 3300046511 | Bacteria | 5010 |
| 459 | Ga0495608_0098523 | 3300046511 | Bacteria | 1886 |
| 460 | Ga0495610_0017485 | 3300046512 | Bacteria | 4086 |
| 461 | Ga0495610_0030159 | 3300046512 | Bacteria | 2846 |
| 462 | Ga0495616_0019159 | 3300046513 | Bacteria | 3738 |
| 463 | Ga0495616_0026871 | 3300046513 | Bacteria | 3057 |
| 464 | Ga0495616_0055709 | 3300046513 | Bacteria | 1956 |
| 465 | Ga0495618_0040481 | 3300046514 | Bacteria | 2933 |
| 466 | Ga0495620_0039154 | 3300046515 | Bacteria | 2098 |
| 467 | Ga0495620_0077632 | 3300046515 | Bacteria | 1348 |
| 468 | Ga0495628_0009719 | 3300046516 | Bacteria | 8205 |
| 469 | Ga0495628_0023166 | 3300046516 | Bacteria | 5099 |
| 470 | Ga0495628_0049588 | 3300046516 | Bacteria | 3324 |
| 471 | Ga0495628_0078071 | 3300046516 | Bacteria | 2575 |
| 472 | Ga0495628_0103450 | 3300046516 | Bacteria | 2196 |
| 473 | Ga0495630_0005383 | 3300046517 | Bacteria | 9031 |
| 474 | Ga0495630_0064425 | 3300046517 | Bacteria | 2754 |
| 475 | Ga0495632_0002332 | 3300046519 | Bacteria | 14575 |
| 476 | Ga0495643_0000028 | 3300046522 | Bacteria | 262886 |
| 477 | Ga0495643_0000154 | 3300046522 | Bacteria | 112250 |
| 478 | Ga0495648_0000378 | 3300046524 | Bacteria | 48799 |
| 479 | Ga0495648_0083840 | 3300046524 | Bacteria | 1805 |
| 480 | Ga0495666_0069193 | 3300046526 | Bacteria | 1680 |
| 481 | Ga0495652_0002605 | 3300046529 | Bacteria | 18448 |
| 482 | Ga0495652_0033439 | 3300046529 | Bacteria | 4489 |
| 483 | Ga0495652_0040068 | 3300046529 | Bacteria | 4049 |
| 484 | Ga0495652_0335035 | 3300046529 | Bacteria | 1089 |
| 485 | Ga0495654_0063349 | 3300046530 | Bacteria | 1770 |
| 486 | Ga0495665_0000902 | 3300046531 | Bacteria | 15623 |
| 487 | Ga0495640_0001505 | 3300046533 | Bacteria | 18356 |
| 488 | Ga0495640_0282585 | 3300046533 | Bacteria | 1033 |
| 489 | Ga0495587_0003463 | 3300046536 | Bacteria | 10519 |
| 490 | Ga0495587_0005573 | 3300046536 | Bacteria | 8216 |
| 491 | Ga0495587_0095686 | 3300046536 | Bacteria | 1714 |
| 492 | Ga0495645_0005537 | 3300046543 | Bacteria | 8684 |
| 493 | Ga0495645_0166188 | 3300046543 | Bacteria | 1521 |
| 494 | Ga0495645_0246961 | 3300046543 | Bacteria | 1188 |
| 495 | Ga0495622_0001436 | 3300046557 | Bacteria | 12023 |
| 496 | Ga0495622_0076382 | 3300046557 | Bacteria | 1543 |
| 497 | Ga0495633_0154965 | 3300046558 | Bacteria | 1058 |
| 498 | Ga0495667_0027335 | 3300046559 | Bacteria | 3845 |
| 499 | Ga0495668_0000018 | 3300046616 | Bacteria | 417480 |
| 500 | Ga0495634_0010535 | 3300046642 | Bacteria | 6768 |
| 501 | Ga0495634_0042942 | 3300046642 | Bacteria | 3065 |
| 502 | Ga0495634_0066175 | 3300046642 | Bacteria | 2393 |
| 503 | Ga0495625_0011369 | 3300046660 | Bacteria | 7264 |
| 504 | Ga0495625_0132418 | 3300046660 | Bacteria | 1688 |
| 505 | Ga0495635_0000356 | 3300046663 | Bacteria | 29094 |
| 506 | Ga0495635_0006348 | 3300046663 | Bacteria | 8242 |
| 507 | Ga0495635_0011988 | 3300046663 | Bacteria | 6074 |
| 508 | Ga0495635_0101394 | 3300046663 | Bacteria | 1967 |
| 509 | Ga0495661_0003126 | 3300046665 | Bacteria | 12410 |
| 510 | Ga0495588_0000619 | 3300046674 | Bacteria | 16696 |
| 511 | Ga0495657_0005167 | 3300046675 | Bacteria | 10338 |
| 512 | Ga0495657_0015234 | 3300046675 | Bacteria | 5628 |
| 513 | Ga0495657_0028025 | 3300046675 | Bacteria | 3966 |
| 514 | Ga0495657_0040051 | 3300046675 | Bacteria | 3216 |
| 515 | Ga0495599_0004863 | 3300046678 | Bacteria | 7993 |
| 516 | Ga0495599_0015026 | 3300046678 | Bacteria | 4799 |
| 517 | Ga0495623_0005974 | 3300046679 | Bacteria | 7930 |
| 518 | Ga0495623_0006437 | 3300046679 | Bacteria | 7639 |
| 519 | Ga0495623_0023347 | 3300046679 | Bacteria | 3992 |
| 520 | Ga0495623_0216694 | 3300046679 | Bacteria | 1093 |
| 521 | Ga0495647_0032237 | 3300046681 | Bacteria | 1952 |
| 522 | Ga0495658_0003461 | 3300046683 | Bacteria | 7799 |
| 523 | Ga0495658_0168364 | 3300046683 | Bacteria | 1355 |
| 524 | Ga0495658_0175248 | 3300046683 | Bacteria | 1329 |
| 525 | Ga0495613_0004786 | 3300046689 | Bacteria | 10156 |
| 526 | Ga0495613_0050119 | 3300046689 | Bacteria | 3080 |
| 527 | Ga0495613_0082180 | 3300046689 | Bacteria | 2340 |
| 528 | Ga0495613_0095414 | 3300046689 | Bacteria | 2151 |
| 529 | Ga0495624_0001264 | 3300046690 | Bacteria | 19934 |
| 530 | Ga0495624_0117150 | 3300046690 | Bacteria | 1637 |
| 531 | Ga0495624_0122366 | 3300046690 | Bacteria | 1597 |
| 532 | Ga0495624_0130500 | 3300046690 | Bacteria | 1541 |
| 533 | Ga0495670_0042520 | 3300046691 | Bacteria | 2267 |
| 534 | Ga0495670_0069276 | 3300046691 | Bacteria | 1783 |
| 535 | Ga0495649_0004059 | 3300046694 | Bacteria | 9640 |
| 536 | Ga0495649_0110439 | 3300046694 | Bacteria | 1458 |
| 537 | Ga0495649_0165016 | 3300046694 | Bacteria | 1161 |
| 538 | Ga0495600_0002461 | 3300046809 | Bacteria | 10629 |
| 539 | Ga0495600_0219719 | 3300046809 | Bacteria | 1215 |
| 540 | Ga0495581_0002800 | 3300047315 | Bacteria | 9952 |
| 541 | Ga0495604_0001823 | 3300047317 | Bacteria | 17347 |
| 542 | Ga0495604_0134073 | 3300047317 | Bacteria | 1777 |
| 543 | Ga0495674_0006598 | 3300047319 | Bacteria | 11129 |
| 544 | Ga0495674_0031441 | 3300047319 | Bacteria | 4822 |
| 545 | Ga0495674_0048317 | 3300047319 | Bacteria | 3766 |
| 546 | Ga0495672_0000334 | 3300047320 | Bacteria | 61678 |
| 547 | Ga0495672_0073895 | 3300047320 | Bacteria | 1921 |
| 548 | Ga0495676_0021005 | 3300047321 | Bacteria | 5714 |
| 549 | Ga0495680_0001849 | 3300047322 | Bacteria | 22313 |
| 550 | Ga0495680_0052683 | 3300047322 | Bacteria | 3171 |
| 551 | Ga0495687_025876 | 3300047443 | Bacteria | 2767 |
| 552 | Ga0495675_0003845 | 3300047444 | Bacteria | 9091 |
| 553 | Ga0495675_0039960 | 3300047444 | Bacteria | 2988 |
| 554 | Ga0495675_0061183 | 3300047444 | Bacteria | 2386 |
| 555 | Ga0495681_0029025 | 3300047470 | Bacteria | 2837 |
| 556 | Ga0495684_0005498 | 3300047471 | Bacteria | 9863 |
| 557 | Ga0495686_0003011 | 3300047472 | Bacteria | 14965 |
| 558 | Ga0495686_0063829 | 3300047472 | Bacteria | 2281 |
| 559 | Ga0495686_0124365 | 3300047472 | Bacteria | 1534 |
| 560 | Ga0495686_0153016 | 3300047472 | Bacteria | 1353 |
| 561 | Ga0495593_0000053 | 3300047673 | Bacteria | 47697 |
| 562 | Ga0495593_0013232 | 3300047673 | Bacteria | 4709 |
| 563 | Ga0495602_0007968 | 3300048088 | Bacteria | 11068 |
| 564 | Ga0495602_0098093 | 3300048088 | Bacteria | 2412 |
| 565 | Ga0495626_0044465 | 3300048091 | Bacteria | 2078 |
| 566 | Ga0496101_0210547 | 3300048904 | Bacteria | 1506 |
| 567 | Ga0496102_0414190 | 3300048905 | Bacteria | 1266 |
| 568 | Ga0496103_0007011 | 3300048906 | Bacteria | 6725 |
| 569 | Ga0496105_0138223 | 3300048908 | Bacteria | 2006 |
| 570 | Ga0496106_0019847 | 3300048909 | Bacteria | 4983 |
| 571 | Ga0496107_0134265 | 3300048910 | Bacteria | 1828 |
| 572 | Ga0496108_0198992 | 3300048911 | Bacteria | 1738 |
| 573 | Ga0496110_0315309 | 3300048913 | Bacteria | 1424 |
| 574 | Ga0496110_0536894 | 3300048913 | Bacteria | 1063 |
| 575 | Ga0496112_0000008 | 3300048915 | Bacteria | 310323 |
| 576 | Ga0496112_0054466 | 3300048915 | Bacteria | 3930 |
| 577 | Ga0496112_0089508 | 3300048915 | Bacteria | 3046 |
| 578 | Ga0496112_0110949 | 3300048915 | Bacteria | 2713 |
| 579 | Ga0496113_0227412 | 3300048916 | Bacteria | 1487 |
| 580 | Ga0496114_0253732 | 3300048917 | Bacteria | 1548 |
| 581 | Ga0496115_0058173 | 3300048918 | Bacteria | 3110 |
| 582 | Ga0496115_0185666 | 3300048918 | Bacteria | 1718 |
| 583 | Ga0496115_0290106 | 3300048918 | Bacteria | 1342 |
| 584 | Ga0496116_0005652 | 3300048919 | Bacteria | 11511 |
| 585 | Ga0496117_0010555 | 3300048920 | Bacteria | 8399 |
| 586 | Ga0496117_0025985 | 3300048920 | Bacteria | 4591 |
| 587 | Ga0496118_0004640 | 3300048921 | Bacteria | 16123 |
| 588 | Ga0496118_0014868 | 3300048921 | Bacteria | 7250 |
| 589 | Ga0496118_0040296 | 3300048921 | Bacteria | 3716 |
| 590 | Ga0496118_0060895 | 3300048921 | Bacteria | 2799 |
| 591 | Ga0496118_0073574 | 3300048921 | Bacteria | 2447 |
| 592 | Ga0496118_0140636 | 3300048921 | Bacteria | 1530 |
| 593 | Ga0496119_0077897 | 3300048922 | Bacteria | 1919 |
| 594 | Ga0496119_0104743 | 3300048922 | Bacteria | 1581 |
| 595 | Ga0496120_0022584 | 3300048923 | Bacteria | 3956 |
| 596 | Ga0496120_0092531 | 3300048923 | Bacteria | 1612 |
| 597 | Ga0496121_0000089 | 3300048924 | Bacteria | 219007 |
| 598 | Ga0496121_0011201 | 3300048924 | Bacteria | 9994 |
| 599 | Ga0496121_0024792 | 3300048924 | Bacteria | 5721 |
| 600 | Ga0496121_0029753 | 3300048924 | Bacteria | 5037 |
| 601 | Ga0496121_0115615 | 3300048924 | Bacteria | 2036 |
| 602 | Ga0496121_0332555 | 3300048924 | Bacteria | 1018 |
| 603 | Ga0496123_0101772 | 3300048926 | Bacteria | 1669 |
| 604 | Ga0496123_0141288 | 3300048926 | Bacteria | 1316 |
| 605 | Ga0496124_0089884 | 3300048927 | Bacteria | 2506 |
| 606 | Ga0496125_0000712 | 3300048928 | Bacteria | 54983 |
| 607 | Ga0496125_0000998 | 3300048928 | Bacteria | 44135 |
| 608 | Ga0496125_0002472 | 3300048928 | Bacteria | 23972 |
| 609 | Ga0496125_0014974 | 3300048928 | Bacteria | 7530 |
| 610 | Ga0496125_0053668 | 3300048928 | Bacteria | 3302 |
| 611 | Ga0496125_0070584 | 3300048928 | Bacteria | 2734 |
| 612 | Ga0496125_0089835 | 3300048928 | Bacteria | 2308 |
| 613 | Ga0496126_0003551 | 3300048929 | Bacteria | 19610 |
| 614 | Ga0496126_0015357 | 3300048929 | Bacteria | 7703 |
| 615 | Ga0496126_0044288 | 3300048929 | Bacteria | 4099 |
| 616 | Ga0496126_0067644 | 3300048929 | Bacteria | 3192 |
| 617 | Ga0496126_0235865 | 3300048929 | Bacteria | 1530 |
| 618 | Ga0495678_001099 | 3300049459 | Bacteria | 22809 |
| 619 | Ga0495682_0026552 | 3300049460 | Bacteria | 2149 |
| 620 | Ga0501031_0001824 | 3300049568 | Bacteria | 13399 |
| 621 | Ga0501043_0000053 | 3300049579 | Bacteria | 106085 |
| 622 | Ga0501046_0000018 | 3300049580 | Bacteria | 220589 |
| 623 | Ga0501047_0000020 | 3300049581 | Bacteria | 259377 |
| 624 | Ga0501048_0000795 | 3300049582 | Bacteria | 23148 |
| 625 | Ga0501045_0040544 | 3300049824 | Bacteria | 3387 |
| 626 | nmdc:mga00v17_23838_c2 | 3300050491 | Bacteria | 1115 |
| 627 | nmdc:mga00v17_27496_c1 | 3300050491 | Bacteria | 3321 |
| 628 | nmdc:mga0k408_143779_c1 | 3300050493 | Bacteria | 1419 |
| 629 | nmdc:mga04h51_16669_c1 | 3300050495 | Bacteria | 2136 |
| 630 | nmdc:mga05p37_483940_c1 | 3300050507 | Bacteria | 1425 |
| 631 | nmdc:mga09592_23749_c1 | 3300050508 | Bacteria | 5065 |
| 632 | nmdc:mga06r32_36396_c1 | 3300050510 | Bacteria | 4650 |
| 633 | nmdc:mga08y16_360566_c1 | 3300050511 | Bacteria | 1492 |
| 634 | nmdc:mga0n895_295120_c1 | 3300050512 | Bacteria | 1643 |
| 635 | nmdc:mga0sz30_13929_c1 | 3300050516 | Bacteria | 3157 |
| 636 | nmdc:mga0sz30_4243_c1 | 3300050516 | Bacteria | 5170 |
| 637 | Ga0495601_0036848 | 3300053077 | Bacteria | 3057 |
| 638 | Ga0500635_0001318 | 3300053080 | Bacteria | 5936 |
| 639 | Ga0495655_0041617 | 3300053083 | Bacteria | 1176 |
| 640 | Ga0495595_0011955 | 3300053084 | Bacteria | 3640 |
| 641 | Ga0495595_0029905 | 3300053084 | Bacteria | 2440 |
| 642 | Ga0495619_0010048 | 3300053085 | Bacteria | 5957 |
| 643 | Ga0495619_0154638 | 3300053085 | Bacteria | 1582 |
| 644 | Ga0500578_0023708 | 3300053086 | Bacteria | 3939 |
| 645 | Ga0500578_0068019 | 3300053086 | Bacteria | 2271 |
| 646 | Ga0500643_000035 | 3300053087 | Bacteria | 184794 |
| 647 | Ga0500643_015424 | 3300053087 | Bacteria | 2622 |
| 648 | Ga0500644_0007939 | 3300053088 | Bacteria | 2782 |
| 649 | Ga0500646_0014801 | 3300053090 | Bacteria | 2027 |
| 650 | Ga0500646_0015845 | 3300053090 | Bacteria | 1965 |
| 651 | Ga0500583_0051280 | 3300053092 | Bacteria | 1916 |
| 652 | Ga0500651_0069288 | 3300053093 | Bacteria | 2196 |
| 653 | Ga0500566_0000008 | 3300053094 | Bacteria | 143641 |
| 654 | Ga0500566_0000134 | 3300053094 | Bacteria | 37799 |
| 655 | Ga0500566_0001026 | 3300053094 | Bacteria | 16124 |
| 656 | Ga0500640_000524 | 3300053095 | Bacteria | 9654 |
| 657 | Ga0500641_0018888 | 3300053096 | Bacteria | 2599 |
| 658 | Ga0500650_0001241 | 3300053098 | Bacteria | 7511 |
| 659 | Ga0500650_0122758 | 3300053098 | Bacteria | 1210 |
| 660 | Ga0500555_004027 | 3300053103 | Bacteria | 4175 |
| 661 | Ga0500556_0000015 | 3300053104 | Bacteria | 202598 |
| 662 | Ga0500569_001583 | 3300053109 | Bacteria | 4316 |
| 663 | Ga0500569_004280 | 3300053109 | Bacteria | 2991 |
| 664 | Ga0500572_000555 | 3300053111 | Bacteria | 12715 |
| 665 | Ga0500592_004269 | 3300053116 | Bacteria | 2281 |
| 666 | Ga0500594_0028887 | 3300053118 | Bacteria | 1446 |
| 667 | Ga0500595_036315 | 3300053119 | Bacteria | 1615 |
| 668 | Ga0500608_013977 | 3300053122 | Bacteria | 3571 |
| 669 | Ga0500608_148689 | 3300053122 | Bacteria | 1029 |
| 670 | Ga0500614_000179 | 3300053123 | Bacteria | 16305 |
| 671 | Ga0500614_022979 | 3300053123 | Bacteria | 1461 |
| 672 | Ga0500642_0000019 | 3300053130 | Bacteria | 159944 |
| 673 | Ga0500642_0007766 | 3300053130 | Bacteria | 3624 |
| 674 | Ga0500652_001339 | 3300053131 | Bacteria | 7709 |
| 675 | Ga0500658_0098688 | 3300053134 | Bacteria | 1272 |
| 676 | Ga0500559_0000396 | 3300053136 | Bacteria | 31631 |
| 677 | Ga0500559_0008637 | 3300053136 | Bacteria | 4454 |
| 678 | Ga0500568_0003619 | 3300053139 | Bacteria | 8534 |
| 679 | Ga0500568_0037549 | 3300053139 | Bacteria | 1964 |
| 680 | Ga0500577_0000068 | 3300053142 | Bacteria | 23514 |
| 681 | Ga0500603_000033 | 3300053150 | Bacteria | 33766 |
| 682 | Ga0500603_002208 | 3300053150 | Bacteria | 4292 |
| 683 | Ga0500604_0012463 | 3300053151 | Bacteria | 2295 |
| 684 | Ga0500616_0000041 | 3300053153 | Bacteria | 359328 |
| 685 | Ga0500619_059060 | 3300053154 | Bacteria | 1258 |
| 686 | Ga0500622_0001685 | 3300053156 | Bacteria | 17214 |
| 687 | Ga0500622_0011733 | 3300053156 | Bacteria | 4762 |
| 688 | Ga0500622_0011913 | 3300053156 | Bacteria | 4728 |
| 689 | Ga0500627_0033816 | 3300053158 | Bacteria | 2163 |
| 690 | Ga0500630_000238 | 3300053159 | Bacteria | 21843 |
| 691 | Ga0500638_005827 | 3300053162 | Bacteria | 4968 |
| 692 | Ga0500638_026391 | 3300053162 | Bacteria | 2783 |
| 693 | Ga0500639_000010 | 3300053163 | Bacteria | 136747 |
| 694 | Ga0500636_0000616 | 3300053177 | Bacteria | 19257 |
| 695 | Ga0500636_0001217 | 3300053177 | Bacteria | 13893 |
| 696 | Ga0500636_0093439 | 3300053177 | Bacteria | 1720 |
| 697 | Ga0500636_0140182 | 3300053177 | Bacteria | 1338 |
| 698 | Ga0500637_0035169 | 3300053178 | Bacteria | 2807 |
| 699 | Ga0500637_0040863 | 3300053178 | Bacteria | 2620 |
| 700 | Ga0500625_044318 | 3300053729 | Bacteria | 2081 |
| 701 | Ga0500645_007452 | 3300053730 | Bacteria | 3808 |
| 702 | Ga0500552_011830 | 3300053733 | Bacteria | 1104 |
| 703 | Ga0500596_002070 | 3300053735 | Bacteria | 3997 |
| 704 | Ga0500599_002692 | 3300053736 | Bacteria | 2142 |
| 705 | Ga0500601_000029 | 3300053737 | Bacteria | 32037 |
| 706 | Ga0466962_0091600 | 3300061719 | Bacteria | 1457 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046679 | Ga0495623_0216694 | Ga0495623_0216694_27_803 | 238 |
| 2 | 3300042876 | Ga0451577_0302852 | Ga0451577_0302852_71_985 | 253 |
| 3 | 3300028379 | Ga0268266_10482361 | Ga0268266_104823612 | 255 |
| 4 | 3300050493 | nmdc:mga0k408_143779_c1 | nmdc:mga0k408_143779_c1_222_1118 | 257 |
| 5 | iso_pu_bacteria | 2524023228 | 2524539203 | 259 |
| 6 | 3300046524 | Ga0495648_0000378 | Ga0495648_0000378_22585_23508 | 261 |
| 7 | iso_pu_bacteria | 8019530166 | 8019534233 | 261 |
| 8 | 3300028794 | Ga0307515_10000292 | Ga0307515_100002927 | 262 |
| 9 | 3300006844 | Ga0075428_100014031 | Ga0075428_1000140312 | 263 |
| 10 | 3300006846 | Ga0075430_100133005 | Ga0075430_1001330053 | 263 |
| 11 | 3300006847 | Ga0075431_100005130 | Ga0075431_10000513010 | 263 |
| 12 | 3300006880 | Ga0075429_100022932 | Ga0075429_1000229324 | 263 |
| 13 | 3300009147 | Ga0114129_10029501 | Ga0114129_100295018 | 263 |
| 14 | 3300050507 | nmdc:mga05p37_483940_c1 | nmdc:mga05p37_483940_c1_385_1308 | 263 |
| 15 | 3300050508 | nmdc:mga09592_23749_c1 | nmdc:mga09592_23749_c1_2723_3646 | 263 |
| 16 | 3300050510 | nmdc:mga06r32_36396_c1 | nmdc:mga06r32_36396_c1_2397_3320 | 263 |
| 17 | 3300013297 | Ga0157378_10001074 | Ga0157378_100010747 | 264 |
| 18 | 3300005340 | Ga0070689_100420394 | Ga0070689_1004203942 | 265 |
| 19 | 3300026116 | Ga0207674_10081398 | Ga0207674_100813983 | 265 |
| 20 | iso_pu_bacteria | 2847939898 | 2847946902 | 266 |
| 21 | 3300010159 | Ga0099796_10029489 | Ga0099796_100294892 | 267 |
| 22 | 3300046536 | Ga0495587_0095686 | Ga0495587_0095686_22_873 | 268 |
| 23 | 3300053087 | Ga0500643_000035 | Ga0500643_000035_171009_171926 | 269 |
| 24 | 3300005436 | Ga0070713_100030419 | Ga0070713_1000304192 | 270 |
| 25 | 3300046694 | Ga0495649_0110439 | Ga0495649_0110439_591_1445 | 270 |
| 26 | 3300005844 | Ga0068862_100032137 | Ga0068862_1000321374 | 271 |
| 27 | 3300009094 | Ga0111539_10079988 | Ga0111539_100799883 | 271 |
| 28 | 3300025936 | Ga0207670_10118260 | Ga0207670_101182602 | 271 |
| 29 | 3300025960 | Ga0207651_10372158 | Ga0207651_103721581 | 271 |
| 30 | 3300028794 | Ga0307515_10006378 | Ga0307515_1000637810 | 271 |
| 31 | 3300033179 | Ga0307507_10155690 | Ga0307507_101556902 | 271 |
| 32 | 3300046694 | Ga0495649_0165016 | Ga0495649_0165016_100_1038 | 271 |
| 33 | 3300050511 | nmdc:mga08y16_360566_c1 | nmdc:mga08y16_360566_c1_548_1435 | 271 |
| 34 | 3300005262 | Ga0065165_1002832 | Ga0065165_10028326 | 272 |
| 35 | 3300005937 | Ga0081455_10055991 | Ga0081455_100559913 | 272 |
| 36 | 3300037466 | Ga0395898_0211261 | Ga0395898_0211261_378_1238 | 272 |
| 37 | 3300037471 | Ga0395905_0098471 | Ga0395905_0098471_1419_2279 | 272 |
| 38 | 3300045051 | Ga0451576_0317332 | Ga0451576_0317332_468_1361 | 272 |
| 39 | 3300053088 | Ga0500644_0007939 | Ga0500644_0007939_31_930 | 272 |
| 40 | 3300053730 | Ga0500645_007452 | Ga0500645_007452_2094_2993 | 272 |
| 41 | iso_pu_bacteria | 2511231002 | 2511243183 | 272 |
| 42 | 3300005983 | Ga0081540_1002607 | Ga0081540_10026077 | 273 |
| 43 | 3300014968 | Ga0157379_10231885 | Ga0157379_102318852 | 273 |
| 44 | 3300028381 | Ga0268264_10210050 | Ga0268264_102100502 | 273 |
| 45 | 3300048924 | Ga0496121_0115615 | Ga0496121_0115615_306_1229 | 273 |
| 46 | iso_pu_bacteria | 2513237094 | 2513640555 | 273 |
| 47 | 3300026035 | Ga0207703_10490235 | Ga0207703_104902352 | 274 |
| 48 | 3300005841 | Ga0068863_100350422 | Ga0068863_1003504222 | 276 |
| 49 | 3300005843 | Ga0068860_100000101 | Ga0068860_10000010167 | 276 |
| 50 | 3300028380 | Ga0268265_10083949 | Ga0268265_100839492 | 276 |
| 51 | 3300028381 | Ga0268264_10000030 | Ga0268264_10000030163 | 276 |
| 52 | 3300044684 | Ga0466966_0009768 | Ga0466966_0009768_1015_1887 | 276 |
| 53 | 3300046616 | Ga0495668_0000018 | Ga0495668_0000018_172369_173292 | 276 |
| 54 | 3300046809 | Ga0495600_0219719 | Ga0495600_0219719_292_1179 | 276 |
| 55 | 3300061719 | Ga0466962_0091600 | Ga0466962_0091600_335_1207 | 276 |
| 56 | 3300005456 | Ga0070678_100140953 | Ga0070678_1001409532 | 277 |
| 57 | 3300026121 | Ga0207683_10173750 | Ga0207683_101737502 | 277 |
| 58 | 3300031731 | Ga0307405_10008218 | Ga0307405_100082182 | 277 |
| 59 | 3300026088 | Ga0207641_10416929 | Ga0207641_104169292 | 278 |
| 60 | 3300053090 | Ga0500646_0015845 | Ga0500646_0015845_304_1224 | 279 |
| 61 | 3300048918 | Ga0496115_0058173 | Ga0496115_0058173_75_1007 | 280 |
| 62 | 3300044694 | Ga0466963_0144072 | Ga0466963_0144072_340_1254 | 281 |
| 63 | 3300046455 | Ga0495603_0072564 | Ga0495603_0072564_139_1074 | 281 |
| 64 | 3300053080 | Ga0500635_0001318 | Ga0500635_0001318_3916_4851 | 281 |
| 65 | 3300053150 | Ga0500603_002208 | Ga0500603_002208_793_1728 | 281 |
| 66 | 3300028786 | Ga0307517_10043224 | Ga0307517_100432245 | 282 |
| 67 | 3300033544 | Ga0316215_1000817 | Ga0316215_10008172 | 282 |
| 68 | 3300028794 | Ga0307515_10000658 | Ga0307515_1000065856 | 284 |
| 69 | 3300045836 | Ga0466958_0010717 | Ga0466958_0010717_896_1792 | 284 |
| 70 | 3300010375 | Ga0105239_10037528 | Ga0105239_100375285 | 285 |
| 71 | 3300014326 | Ga0157380_10323784 | Ga0157380_103237842 | 285 |
| 72 | 3300035111 | Ga0373923_0008179 | Ga0373923_0008179_2481_3410 | 285 |
| 73 | 3300035113 | Ga0373936_0001944 | Ga0373936_0001944_219_1148 | 285 |
| 74 | 3300035117 | Ga0373953_0110086 | Ga0373953_0110086_170_1099 | 285 |
| 75 | 3300035170 | Ga0373943_0005734 | Ga0373943_0005734_4142_5071 | 285 |
| 76 | 3300035172 | Ga0373955_0078810 | Ga0373955_0078810_471_1400 | 285 |
| 77 | 3300035692 | Ga0373935_0005504 | Ga0373935_0005504_29_958 | 285 |
| 78 | 3300035695 | Ga0373927_0001069 | Ga0373927_0001069_14961_15890 | 285 |
| 79 | 3300035725 | Ga0373947_0007770 | Ga0373947_0007770_3567_4496 | 285 |
| 80 | 3300037068 | Ga0373925_0003237 | Ga0373925_0003237_3345_4274 | 285 |
| 81 | 3300037068 | Ga0373925_0004343 | Ga0373925_0004343_6679_7587 | 285 |
| 82 | 3300046454 | Ga0495592_0019534 | Ga0495592_0019534_2583_3512 | 285 |
| 83 | 3300046455 | Ga0495603_0000064 | Ga0495603_0000064_40516_41445 | 285 |
| 84 | 3300046459 | Ga0495629_0001770 | Ga0495629_0001770_9200_10129 | 285 |
| 85 | 3300046461 | Ga0495641_0004409 | Ga0495641_0004409_1267_2196 | 285 |
| 86 | 3300046463 | Ga0495653_0296414 | Ga0495653_0296414_24_953 | 285 |
| 87 | 3300046472 | Ga0495580_0002618 | Ga0495580_0002618_9137_10066 | 285 |
| 88 | 3300046473 | Ga0495582_0000197 | Ga0495582_0000197_8725_9654 | 285 |
| 89 | 3300046475 | Ga0495639_0001620 | Ga0495639_0001620_4129_5058 | 285 |
| 90 | 3300046476 | Ga0495662_0012317 | Ga0495662_0012317_1374_2303 | 285 |
| 91 | 3300046477 | Ga0495664_0011941 | Ga0495664_0011941_295_1224 | 285 |
| 92 | 3300046499 | Ga0495594_0004585 | Ga0495594_0004585_1221_2150 | 285 |
| 93 | 3300046517 | Ga0495630_0005383 | Ga0495630_0005383_6142_7071 | 285 |
| 94 | 3300046526 | Ga0495666_0069193 | Ga0495666_0069193_724_1653 | 285 |
| 95 | 3300046529 | Ga0495652_0040068 | Ga0495652_0040068_2088_3017 | 285 |
| 96 | 3300046531 | Ga0495665_0000902 | Ga0495665_0000902_7788_8717 | 285 |
| 97 | 3300046533 | Ga0495640_0001505 | Ga0495640_0001505_7090_8019 | 285 |
| 98 | 3300046557 | Ga0495622_0001436 | Ga0495622_0001436_1137_2066 | 285 |
| 99 | 3300046559 | Ga0495667_0027335 | Ga0495667_0027335_2373_3302 | 285 |
| 100 | 3300046663 | Ga0495635_0000356 | Ga0495635_0000356_7519_8448 | 285 |
| 101 | 3300046674 | Ga0495588_0000619 | Ga0495588_0000619_11500_12429 | 285 |
| 102 | 3300046683 | Ga0495658_0003461 | Ga0495658_0003461_6106_7035 | 285 |
| 103 | 3300046689 | Ga0495613_0004786 | Ga0495613_0004786_4161_5090 | 285 |
| 104 | 3300046690 | Ga0495624_0001264 | Ga0495624_0001264_5553_6482 | 285 |
| 105 | 3300047315 | Ga0495581_0002800 | Ga0495581_0002800_5534_6463 | 285 |
| 106 | 3300047319 | Ga0495674_0006598 | Ga0495674_0006598_787_1716 | 285 |
| 107 | 3300047321 | Ga0495676_0021005 | Ga0495676_0021005_4223_5152 | 285 |
| 108 | 3300047673 | Ga0495593_0000053 | Ga0495593_0000053_40386_41315 | 285 |
| 109 | 3300053085 | Ga0495619_0154638 | Ga0495619_0154638_313_1242 | 285 |
| 110 | 3300005295 | Ga0065707_10084750 | Ga0065707_100847505 | 286 |
| 111 | 3300021361 | Ga0213872_10000001 | Ga0213872_10000001214 | 286 |
| 112 | 3300039447 | Ga0436361_0028664 | Ga0436361_0028664_59510_60427 | 286 |
| 113 | iso_pu_bacteria | 2513237139 | 2513873111 | 286 |
| 114 | iso_pu_bacteria | 2513237161 | 2514016548 | 286 |
| 115 | iso_pu_bacteria | 2617270735 | 2617347023 | 286 |
| 116 | iso_pu_bacteria | 2791355196 | 2793062622 | 286 |
| 117 | iso_pu_bacteria | 2802429603 | 2805914990 | 286 |
| 118 | iso_pu_bacteria | 2824671348 | 2824672012 | 286 |
| 119 | iso_pu_bacteria | 2824687955 | 2824688611 | 286 |
| 120 | iso_pu_bacteria | 2824696289 | 2824697150 | 286 |
| 121 | iso_pu_bacteria | 2824704595 | 2824705279 | 286 |
| 122 | iso_pu_bacteria | 2824753945 | 2824754347 | 286 |
| 123 | iso_pu_bacteria | 2824763712 | 2824767846 | 286 |
| 124 | iso_pu_bacteria | 2824773399 | 2824775276 | 286 |
| 125 | iso_pu_bacteria | 2838122688 | 2838123378 | 286 |
| 126 | iso_pu_bacteria | 2841941048 | 2841946671 | 286 |
| 127 | iso_pu_bacteria | 2841949485 | 2841954095 | 286 |
| 128 | iso_pu_bacteria | 2841966195 | 2841969473 | 286 |
| 129 | iso_pu_bacteria | 2841974524 | 2841974644 | 286 |
| 130 | iso_pu_bacteria | 2841983080 | 2841983798 | 286 |
| 131 | iso_pu_bacteria | 2844315083 | 2844319386 | 286 |
| 132 | iso_pu_bacteria | 2874620515 | 2874626382 | 286 |
| 133 | iso_pu_bacteria | 2885366525 | 2885369237 | 286 |
| 134 | iso_pu_bacteria | 2885409591 | 2885413340 | 286 |
| 135 | iso_pu_bacteria | 2903727486 | 2903734327 | 286 |
| 136 | iso_pu_bacteria | 2904666416 | 2904671721 | 286 |
| 137 | iso_pu_bacteria | 2904711408 | 2904715070 | 286 |
| 138 | iso_pu_bacteria | 2906602504 | 2906605572 | 286 |
| 139 | iso_pu_bacteria | 3005506211 | 3005510647 | 286 |
| 140 | iso_pu_bacteria | 3005594810 | 3005599582 | 286 |
| 141 | iso_pu_bacteria | 3005710791 | 3005715240 | 286 |
| 142 | iso_pu_bacteria | 3005718088 | 3005722624 | 286 |
| 143 | iso_pu_bacteria | 8019648815 | 8019658899 | 286 |
| 144 | iso_pu_bacteria | 8056967851 | 8056968376 | 286 |
| 145 | 3300005353 | Ga0070669_100276554 | Ga0070669_1002765542 | 287 |
| 146 | 3300005354 | Ga0070675_100014292 | Ga0070675_1000142924 | 287 |
| 147 | 3300006195 | Ga0075366_10045747 | Ga0075366_100457472 | 287 |
| 148 | 3300006844 | Ga0075428_100218324 | Ga0075428_1002183241 | 287 |
| 149 | 3300013306 | Ga0163162_10015009 | Ga0163162_100150096 | 287 |
| 150 | 3300013308 | Ga0157375_10020347 | Ga0157375_100203476 | 287 |
| 151 | 3300014325 | Ga0163163_10054763 | Ga0163163_100547632 | 287 |
| 152 | 3300014326 | Ga0157380_10148991 | Ga0157380_101489912 | 287 |
| 153 | 3300025297 | Ga0209758_1008784 | Ga0209758_10087845 | 287 |
| 154 | 3300025923 | Ga0207681_10119563 | Ga0207681_101195632 | 287 |
| 155 | 3300025972 | Ga0207668_10070780 | Ga0207668_100707802 | 287 |
| 156 | 3300042876 | Ga0451577_0226677 | Ga0451577_0226677_348_1256 | 287 |
| 157 | 3300046642 | Ga0495634_0010535 | Ga0495634_0010535_5533_6468 | 287 |
| 158 | iso_pu_bacteria | 2879099564 | 2879108323 | 287 |
| 159 | iso_pu_bacteria | 2922368715 | 2922374864 | 287 |
| 160 | iso_pu_bacteria | 2929615660 | 2929621910 | 287 |
| 161 | iso_pu_bacteria | 2929624759 | 2929629783 | 287 |
| 162 | iso_pu_bacteria | 2932818245 | 2932819156 | 287 |
| 163 | iso_pu_bacteria | 2933577622 | 2933583814 | 287 |
| 164 | iso_pu_bacteria | 2935675223 | 2935675868 | 287 |
| 165 | iso_pu_bacteria | 2935684952 | 2935685865 | 287 |
| 166 | iso_pu_bacteria | 2935713505 | 2935714417 | 287 |
| 167 | iso_pu_bacteria | 2935722832 | 2935725036 | 287 |
| 168 | iso_pu_bacteria | 2935732158 | 2935732605 | 287 |
| 169 | iso_pu_bacteria | 2935741537 | 2935741984 | 287 |
| 170 | iso_pu_bacteria | 2935750917 | 2935751830 | 287 |
| 171 | iso_pu_bacteria | 2935760218 | 2935765087 | 287 |
| 172 | iso_pu_bacteria | 2940556831 | 2940557367 | 287 |
| 173 | iso_pu_bacteria | 8016539877 | 8016547693 | 287 |
| 174 | iso_pu_bacteria | 8016548790 | 8016554444 | 287 |
| 175 | iso_pu_bacteria | 8016566248 | 8016572812 | 287 |
| 176 | iso_pu_bacteria | 8016575299 | 8016576971 | 287 |
| 177 | iso_pu_bacteria | 8016595262 | 8016600592 | 287 |
| 178 | iso_pu_bacteria | 8055742211 | 8055745924 | 287 |
| 179 | 3300005549 | Ga0070704_100041535 | Ga0070704_1000415353 | 288 |
| 180 | 3300025261 | Ga0209233_1005160 | Ga0209233_10051602 | 288 |
| 181 | 3300039438 | Ga0436360_0376160 | Ga0436360_0376160_122_1036 | 288 |
| 182 | 3300048924 | Ga0496121_0332555 | Ga0496121_0332555_36_950 | 288 |
| 183 | iso_pu_bacteria | 2524023205 | 2524437711 | 288 |
| 184 | iso_pu_bacteria | 2816332527 | 2818239695 | 288 |
| 185 | iso_pu_bacteria | 2824626560 | 2824626756 | 288 |
| 186 | iso_pu_bacteria | 2824635225 | 2824636609 | 288 |
| 187 | iso_pu_bacteria | 2824644064 | 2824645143 | 288 |
| 188 | iso_pu_bacteria | 2824714736 | 2824715696 | 288 |
| 189 | iso_pu_bacteria | 2824723954 | 2824725179 | 288 |
| 190 | iso_pu_bacteria | 2847930680 | 2847936556 | 288 |
| 191 | iso_pu_bacteria | 2876761206 | 2876764933 | 288 |
| 192 | iso_pu_bacteria | 2879083081 | 2879089535 | 288 |
| 193 | iso_pu_bacteria | 2906626472 | 2906633651 | 288 |
| 194 | iso_pu_bacteria | 2906643746 | 2906646557 | 288 |
| 195 | iso_pu_bacteria | 2941531003 | 2941533158 | 288 |
| 196 | iso_pu_bacteria | 8016583857 | 8016593235 | 288 |
| 197 | 3300005331 | Ga0070670_100000356 | Ga0070670_10000035644 | 289 |
| 198 | 3300005347 | Ga0070668_100102461 | Ga0070668_1001024613 | 289 |
| 199 | 3300005347 | Ga0070668_100108499 | Ga0070668_1001084992 | 289 |
| 200 | 3300005354 | Ga0070675_100005609 | Ga0070675_1000056092 | 289 |
| 201 | 3300005355 | Ga0070671_100146187 | Ga0070671_1001461872 | 289 |
| 202 | 3300005355 | Ga0070671_100371920 | Ga0070671_1003719202 | 289 |
| 203 | 3300005364 | Ga0070673_100399509 | Ga0070673_1003995092 | 289 |
| 204 | 3300005365 | Ga0070688_100071619 | Ga0070688_1000716192 | 289 |
| 205 | 3300005456 | Ga0070678_100084367 | Ga0070678_1000843671 | 289 |
| 206 | 3300005457 | Ga0070662_100217608 | Ga0070662_1002176082 | 289 |
| 207 | 3300005459 | Ga0068867_100020518 | Ga0068867_1000205184 | 289 |
| 208 | 3300005459 | Ga0068867_100142067 | Ga0068867_1001420672 | 289 |
| 209 | 3300005466 | Ga0070685_10255334 | Ga0070685_102553341 | 289 |
| 210 | 3300005468 | Ga0070707_100276763 | Ga0070707_1002767632 | 289 |
| 211 | 3300005471 | Ga0070698_100216165 | Ga0070698_1002161652 | 289 |
| 212 | 3300005536 | Ga0070697_100196357 | Ga0070697_1001963571 | 289 |
| 213 | 3300005545 | Ga0070695_100401705 | Ga0070695_1004017051 | 289 |
| 214 | 3300005548 | Ga0070665_100518282 | Ga0070665_1005182822 | 289 |
| 215 | 3300005618 | Ga0068864_100008694 | Ga0068864_1000086944 | 289 |
| 216 | 3300005618 | Ga0068864_100047550 | Ga0068864_1000475502 | 289 |
| 217 | 3300005618 | Ga0068864_100136178 | Ga0068864_1001361782 | 289 |
| 218 | 3300005618 | Ga0068864_100176536 | Ga0068864_1001765362 | 289 |
| 219 | 3300005719 | Ga0068861_100061248 | Ga0068861_1000612482 | 289 |
| 220 | 3300005719 | Ga0068861_100095214 | Ga0068861_1000952143 | 289 |
| 221 | 3300005840 | Ga0068870_10085739 | Ga0068870_100857392 | 289 |
| 222 | 3300005841 | Ga0068863_100003193 | Ga0068863_10000319311 | 289 |
| 223 | 3300005841 | Ga0068863_100082278 | Ga0068863_1000822782 | 289 |
| 224 | 3300005843 | Ga0068860_100116317 | Ga0068860_1001163172 | 289 |
| 225 | 3300005843 | Ga0068860_100362498 | Ga0068860_1003624981 | 289 |
| 226 | 3300005844 | Ga0068862_100172936 | Ga0068862_1001729362 | 289 |
| 227 | 3300006237 | Ga0097621_100344588 | Ga0097621_1003445882 | 289 |
| 228 | 3300006358 | Ga0068871_100084800 | Ga0068871_1000848002 | 289 |
| 229 | 3300006881 | Ga0068865_100325279 | Ga0068865_1003252792 | 289 |
| 230 | 3300013297 | Ga0157378_10433213 | Ga0157378_104332132 | 289 |
| 231 | 3300013306 | Ga0163162_10732644 | Ga0163162_107326441 | 289 |
| 232 | 3300013308 | Ga0157375_10556747 | Ga0157375_105567472 | 289 |
| 233 | 3300014325 | Ga0163163_10016588 | Ga0163163_100165882 | 289 |
| 234 | 3300014325 | Ga0163163_10022097 | Ga0163163_100220975 | 289 |
| 235 | 3300014326 | Ga0157380_10032883 | Ga0157380_100328832 | 289 |
| 236 | 3300014968 | Ga0157379_10587263 | Ga0157379_105872631 | 289 |
| 237 | 3300014969 | Ga0157376_10039268 | Ga0157376_100392685 | 289 |
| 238 | 3300014969 | Ga0157376_10136716 | Ga0157376_101367162 | 289 |
| 239 | 3300017792 | Ga0163161_10039167 | Ga0163161_100391673 | 289 |
| 240 | 3300021441 | Ga0213871_10000559 | Ga0213871_100005593 | 289 |
| 241 | 3300025899 | Ga0207642_10063039 | Ga0207642_100630392 | 289 |
| 242 | 3300025907 | Ga0207645_10013062 | Ga0207645_100130621 | 289 |
| 243 | 3300025908 | Ga0207643_10012934 | Ga0207643_100129342 | 289 |
| 244 | 3300025908 | Ga0207643_10111752 | Ga0207643_101117522 | 289 |
| 245 | 3300025918 | Ga0207662_10069192 | Ga0207662_100691923 | 289 |
| 246 | 3300025922 | Ga0207646_10304117 | Ga0207646_103041171 | 289 |
| 247 | 3300025925 | Ga0207650_10000755 | Ga0207650_100007556 | 289 |
| 248 | 3300025925 | Ga0207650_10038912 | Ga0207650_100389125 | 289 |
| 249 | 3300025926 | Ga0207659_10003624 | Ga0207659_1000362410 | 289 |
| 250 | 3300025931 | Ga0207644_10343947 | Ga0207644_103439472 | 289 |
| 251 | 3300025933 | Ga0207706_10033883 | Ga0207706_100338834 | 289 |
| 252 | 3300025936 | Ga0207670_10054636 | Ga0207670_100546363 | 289 |
| 253 | 3300025938 | Ga0207704_10018327 | Ga0207704_100183272 | 289 |
| 254 | 3300025940 | Ga0207691_10000111 | Ga0207691_1000011117 | 289 |
| 255 | 3300025941 | Ga0207711_10209732 | Ga0207711_102097322 | 289 |
| 256 | 3300025960 | Ga0207651_10018903 | Ga0207651_100189034 | 289 |
| 257 | 3300025960 | Ga0207651_10149752 | Ga0207651_101497522 | 289 |
| 258 | 3300025972 | Ga0207668_10037606 | Ga0207668_100376063 | 289 |
| 259 | 3300025986 | Ga0207658_10287972 | Ga0207658_102879722 | 289 |
| 260 | 3300026088 | Ga0207641_10009740 | Ga0207641_100097408 | 289 |
| 261 | 3300026088 | Ga0207641_10112454 | Ga0207641_101124542 | 289 |
| 262 | 3300026088 | Ga0207641_10138219 | Ga0207641_101382191 | 289 |
| 263 | 3300026088 | Ga0207641_10161713 | Ga0207641_101617132 | 289 |
| 264 | 3300026089 | Ga0207648_10016729 | Ga0207648_100167295 | 289 |
| 265 | 3300026089 | Ga0207648_10098622 | Ga0207648_100986223 | 289 |
| 266 | 3300026095 | Ga0207676_10130259 | Ga0207676_101302592 | 289 |
| 267 | 3300026095 | Ga0207676_10252070 | Ga0207676_102520702 | 289 |
| 268 | 3300026095 | Ga0207676_10319242 | Ga0207676_103192422 | 289 |
| 269 | 3300026118 | Ga0207675_100037456 | Ga0207675_1000374565 | 289 |
| 270 | 3300026118 | Ga0207675_100089563 | Ga0207675_1000895633 | 289 |
| 271 | 3300026121 | Ga0207683_10294647 | Ga0207683_102946472 | 289 |
| 272 | 3300028381 | Ga0268264_10332808 | Ga0268264_103328082 | 289 |
| 273 | 3300031616 | Ga0307508_10014131 | Ga0307508_100141313 | 289 |
| 274 | 3300031616 | Ga0307508_10092867 | Ga0307508_100928672 | 289 |
| 275 | 3300031616 | Ga0307508_10188415 | Ga0307508_101884152 | 289 |
| 276 | 3300039437 | Ga0436365_0263215 | Ga0436365_0263215_32_946 | 289 |
| 277 | 3300039438 | Ga0436360_0271985 | Ga0436360_0271985_1049_1984 | 289 |
| 278 | 3300046455 | Ga0495603_0031445 | Ga0495603_0031445_854_1777 | 289 |
| 279 | 3300046475 | Ga0495639_0057030 | Ga0495639_0057030_639_1562 | 289 |
| 280 | 3300046522 | Ga0495643_0000028 | Ga0495643_0000028_257733_258653 | 289 |
| 281 | 3300046660 | Ga0495625_0011369 | Ga0495625_0011369_954_1874 | 289 |
| 282 | 3300046694 | Ga0495649_0004059 | Ga0495649_0004059_7517_8437 | 289 |
| 283 | 3300047320 | Ga0495672_0000334 | Ga0495672_0000334_11918_12838 | 289 |
| 284 | 3300049459 | Ga0495678_001099 | Ga0495678_001099_1141_2061 | 289 |
| 285 | iso_pu_bacteria | 2507262055 | 2507508249 | 289 |
| 286 | iso_pu_bacteria | 2513237096 | 2513655859 | 289 |
| 287 | iso_pu_bacteria | 2513237102 | 2513702503 | 289 |
| 288 | iso_pu_bacteria | 2513237104 | 2513718418 | 289 |
| 289 | iso_pu_bacteria | 2513237137 | 2513856628 | 289 |
| 290 | iso_pu_bacteria | 2513237145 | 2513917228 | 289 |
| 291 | iso_pu_bacteria | 2515154112 | 2515627244 | 289 |
| 292 | iso_pu_bacteria | 2602042107 | 2603860898 | 289 |
| 293 | iso_pu_bacteria | 2643221644 | 2644243916 | 289 |
| 294 | iso_pu_bacteria | 2728368998 | 2728752385 | 289 |
| 295 | iso_pu_bacteria | 2791355197 | 2793069826 | 289 |
| 296 | iso_pu_bacteria | 2824746037 | 2824746471 | 289 |
| 297 | iso_pu_bacteria | 2857509624 | 2857515890 | 289 |
| 298 | iso_pu_bacteria | 2874590934 | 2874598381 | 289 |
| 299 | iso_pu_bacteria | 2874645413 | 2874652564 | 289 |
| 300 | iso_pu_bacteria | 2876771140 | 2876778141 | 289 |
| 301 | iso_pu_bacteria | 2876818435 | 2876825990 | 289 |
| 302 | iso_pu_bacteria | 2879074833 | 2879081935 | 289 |
| 303 | iso_pu_bacteria | 2879127579 | 2879135057 | 289 |
| 304 | iso_pu_bacteria | 2879142872 | 2879149742 | 289 |
| 305 | iso_pu_bacteria | 2881364244 | 2881368490 | 289 |
| 306 | iso_pu_bacteria | 2885374607 | 2885382245 | 289 |
| 307 | iso_pu_bacteria | 2893066018 | 2893069171 | 289 |
| 308 | iso_pu_bacteria | 2904699407 | 2904706809 | 289 |
| 309 | iso_pu_bacteria | 2906660503 | 2906662033 | 289 |
| 310 | iso_pu_bacteria | 2908739725 | 2908740889 | 289 |
| 311 | iso_pu_bacteria | 2922425934 | 2922432146 | 289 |
| 312 | iso_pu_bacteria | 2935630451 | 2935630987 | 289 |
| 313 | iso_pu_bacteria | 2935769743 | 2935771704 | 289 |
| 314 | iso_pu_bacteria | 2935785616 | 2935791198 | 289 |
| 315 | iso_pu_bacteria | 2935793552 | 2935795473 | 289 |
| 316 | iso_pu_bacteria | 2935984226 | 2935987391 | 289 |
| 317 | iso_pu_bacteria | 2941507105 | 2941507639 | 289 |
| 318 | iso_pu_bacteria | 2941515067 | 2941516066 | 289 |
| 319 | iso_pu_bacteria | 2941523033 | 2941523226 | 289 |
| 320 | iso_pu_bacteria | 3005483717 | 3005484634 | 289 |
| 321 | iso_pu_bacteria | 8006933436 | 8006934589 | 289 |
| 322 | iso_pu_bacteria | 8006973647 | 8006974559 | 289 |
| 323 | iso_pu_bacteria | 8016613128 | 8016614785 | 289 |
| 324 | iso_pu_bacteria | 8019547302 | 8019553289 | 289 |
| 325 | iso_pu_bacteria | 8019619141 | 8019628546 | 289 |
| 326 | iso_pu_bacteria | 8019659431 | 8019661969 | 289 |
| 327 | iso_pu_bacteria | 8019668869 | 8019671495 | 289 |
| 328 | iso_pu_bacteria | 8019678201 | 8019684613 | 289 |
| 329 | 3300003215 | JGI25153J46596_10000394 | JGI25153J46596_1000039414 | 290 |
| 330 | 3300003215 | JGI25153J46596_10000515 | JGI25153J46596_1000051513 | 290 |
| 331 | 3300003215 | JGI25153J46596_10003431 | JGI25153J46596_100034318 | 290 |
| 332 | 3300003354 | JGI25160J50197_1000553 | JGI25160J50197_10005539 | 290 |
| 333 | 3300003354 | JGI25160J50197_1003853 | JGI25160J50197_10038536 | 290 |
| 334 | 3300003794 | Ga0055531_10005951 | Ga0055531_100059512 | 290 |
| 335 | 3300005262 | Ga0065165_1001731 | Ga0065165_10017319 | 290 |
| 336 | 3300005262 | Ga0065165_1018035 | Ga0065165_10180353 | 290 |
| 337 | 3300005616 | Ga0068852_100008171 | Ga0068852_1000081716 | 290 |
| 338 | 3300006186 | Ga0075369_10009841 | Ga0075369_100098413 | 290 |
| 339 | 3300009093 | Ga0105240_10129483 | Ga0105240_101294832 | 290 |
| 340 | 3300009098 | Ga0105245_10144368 | Ga0105245_101443682 | 290 |
| 341 | 3300009174 | Ga0105241_10053629 | Ga0105241_100536293 | 290 |
| 342 | 3300009545 | Ga0105237_10006673 | Ga0105237_1000667311 | 290 |
| 343 | 3300010375 | Ga0105239_10091272 | Ga0105239_100912723 | 290 |
| 344 | 3300010375 | Ga0105239_10141182 | Ga0105239_101411823 | 290 |
| 345 | 3300010375 | Ga0105239_10266992 | Ga0105239_102669923 | 290 |
| 346 | 3300025230 | Ga0209563_100899 | Ga0209563_1008994 | 290 |
| 347 | 3300025253 | Ga0209677_102333 | Ga0209677_1023337 | 290 |
| 348 | 3300025295 | Ga0209564_1006369 | Ga0209564_10063694 | 290 |
| 349 | 3300025295 | Ga0209564_1017192 | Ga0209564_10171923 | 290 |
| 350 | 3300025297 | Ga0209758_1000024 | Ga0209758_100002464 | 290 |
| 351 | 3300025297 | Ga0209758_1000068 | Ga0209758_100006822 | 290 |
| 352 | 3300025297 | Ga0209758_1001533 | Ga0209758_100153319 | 290 |
| 353 | 3300025297 | Ga0209758_1036964 | Ga0209758_10369643 | 290 |
| 354 | 3300025299 | Ga0209256_1001900 | Ga0209256_10019005 | 290 |
| 355 | 3300025299 | Ga0209256_1016592 | Ga0209256_10165922 | 290 |
| 356 | 3300025302 | Ga0207426_1000238 | Ga0207426_100023851 | 290 |
| 357 | 3300025304 | Ga0209257_1001149 | Ga0209257_100114919 | 290 |
| 358 | 3300025304 | Ga0209257_1036359 | Ga0209257_10363591 | 290 |
| 359 | 3300025911 | Ga0207654_10049797 | Ga0207654_100497972 | 290 |
| 360 | 3300025913 | Ga0207695_10000008 | Ga0207695_10000008139 | 290 |
| 361 | 3300025914 | Ga0207671_10003142 | Ga0207671_1000314212 | 290 |
| 362 | 3300025924 | Ga0207694_10346915 | Ga0207694_103469151 | 290 |
| 363 | 3300025927 | Ga0207687_10083695 | Ga0207687_100836952 | 290 |
| 364 | 3300025933 | Ga0207706_10100121 | Ga0207706_101001213 | 290 |
| 365 | 3300025981 | Ga0207640_10100356 | Ga0207640_101003562 | 290 |
| 366 | 3300031507 | Ga0307509_10104348 | Ga0307509_101043483 | 290 |
| 367 | 3300037471 | Ga0395905_0044603 | Ga0395905_0044603_2171_3085 | 290 |
| 368 | 3300037471 | Ga0395905_0155856 | Ga0395905_0155856_687_1604 | 290 |
| 369 | 3300042532 | Ga0450893_0014757 | Ga0450893_0014757_286_1206 | 290 |
| 370 | 3300044658 | Ga0466972_0000122 | Ga0466972_0000122_21995_22918 | 290 |
| 371 | 3300044684 | Ga0466966_0000599 | Ga0466966_0000599_4263_5177 | 290 |
| 372 | 3300044693 | Ga0466961_0000038 | Ga0466961_0000038_46266_47180 | 290 |
| 373 | 3300044694 | Ga0466963_0026664 | Ga0466963_0026664_589_1503 | 290 |
| 374 | 3300044719 | Ga0466971_0089726 | Ga0466971_0089726_170_1084 | 290 |
| 375 | 3300044901 | Ga0466960_0029269 | Ga0466960_0029269_29_943 | 290 |
| 376 | 3300045049 | Ga0466959_0000493 | Ga0466959_0000493_16295_17209 | 290 |
| 377 | 3300046454 | Ga0495592_0020984 | Ga0495592_0020984_1036_1950 | 290 |
| 378 | 3300046460 | Ga0495638_0013480 | Ga0495638_0013480_4545_5459 | 290 |
| 379 | 3300046463 | Ga0495653_0058227 | Ga0495653_0058227_1498_2412 | 290 |
| 380 | 3300046471 | Ga0495650_0035553 | Ga0495650_0035553_260_1177 | 290 |
| 381 | 3300046477 | Ga0495664_0058506 | Ga0495664_0058506_574_1488 | 290 |
| 382 | 3300046511 | Ga0495608_0098523 | Ga0495608_0098523_125_1039 | 290 |
| 383 | 3300046516 | Ga0495628_0009719 | Ga0495628_0009719_1956_2870 | 290 |
| 384 | 3300046516 | Ga0495628_0103450 | Ga0495628_0103450_542_1456 | 290 |
| 385 | 3300046529 | Ga0495652_0002605 | Ga0495652_0002605_11339_12253 | 290 |
| 386 | 3300046536 | Ga0495587_0003463 | Ga0495587_0003463_146_1060 | 290 |
| 387 | 3300046543 | Ga0495645_0005537 | Ga0495645_0005537_6718_7632 | 290 |
| 388 | 3300046543 | Ga0495645_0246961 | Ga0495645_0246961_111_1121 | 290 |
| 389 | 3300046642 | Ga0495634_0066175 | Ga0495634_0066175_1399_2316 | 290 |
| 390 | 3300046675 | Ga0495657_0005167 | Ga0495657_0005167_4197_5111 | 290 |
| 391 | 3300046679 | Ga0495623_0006437 | Ga0495623_0006437_1241_2155 | 290 |
| 392 | 3300046690 | Ga0495624_0117150 | Ga0495624_0117150_309_1226 | 290 |
| 393 | 3300046809 | Ga0495600_0002461 | Ga0495600_0002461_3732_4649 | 290 |
| 394 | 3300047317 | Ga0495604_0001823 | Ga0495604_0001823_5929_6846 | 290 |
| 395 | 3300047319 | Ga0495674_0031441 | Ga0495674_0031441_3021_3935 | 290 |
| 396 | 3300047322 | Ga0495680_0001849 | Ga0495680_0001849_904_1818 | 290 |
| 397 | 3300047444 | Ga0495675_0061183 | Ga0495675_0061183_315_1229 | 290 |
| 398 | 3300047472 | Ga0495686_0124365 | Ga0495686_0124365_242_1156 | 290 |
| 399 | 3300048088 | Ga0495602_0007968 | Ga0495602_0007968_6957_7871 | 290 |
| 400 | 3300048921 | Ga0496118_0040296 | Ga0496118_0040296_2266_3180 | 290 |
| 401 | 3300048928 | Ga0496125_0014974 | Ga0496125_0014974_2870_3784 | 290 |
| 402 | 3300049460 | Ga0495682_0026552 | Ga0495682_0026552_377_1291 | 290 |
| 403 | 3300050516 | nmdc:mga0sz30_13929_c1 | nmdc:mga0sz30_13929_c1_816_1730 | 290 |
| 404 | 3300053086 | Ga0500578_0023708 | Ga0500578_0023708_325_1239 | 290 |
| 405 | 3300053086 | Ga0500578_0068019 | Ga0500578_0068019_465_1379 | 290 |
| 406 | 3300053092 | Ga0500583_0051280 | Ga0500583_0051280_203_1120 | 290 |
| 407 | 3300053093 | Ga0500651_0069288 | Ga0500651_0069288_1268_2185 | 290 |
| 408 | 3300053094 | Ga0500566_0000134 | Ga0500566_0000134_14153_15067 | 290 |
| 409 | 3300053098 | Ga0500650_0122758 | Ga0500650_0122758_51_968 | 290 |
| 410 | 3300053103 | Ga0500555_004027 | Ga0500555_004027_1098_2015 | 290 |
| 411 | 3300053109 | Ga0500569_001583 | Ga0500569_001583_870_1787 | 290 |
| 412 | 3300053116 | Ga0500592_004269 | Ga0500592_004269_12_929 | 290 |
| 413 | 3300053123 | Ga0500614_022979 | Ga0500614_022979_453_1367 | 290 |
| 414 | 3300053130 | Ga0500642_0007766 | Ga0500642_0007766_405_1322 | 290 |
| 415 | 3300053139 | Ga0500568_0037549 | Ga0500568_0037549_709_1626 | 290 |
| 416 | 3300053156 | Ga0500622_0011733 | Ga0500622_0011733_1706_2623 | 290 |
| 417 | 3300053158 | Ga0500627_0033816 | Ga0500627_0033816_604_1521 | 290 |
| 418 | 3300053736 | Ga0500599_002692 | Ga0500599_002692_667_1581 | 290 |
| 419 | iso_pu_bacteria | 2508501128 | 2509148393 | 290 |
| 420 | 3300005262 | Ga0065165_1000864 | Ga0065165_100086418 | 291 |
| 421 | 3300006941 | Ga0099825_1027409 | Ga0099825_10274093 | 291 |
| 422 | 3300006942 | Ga0099824_1002281 | Ga0099824_100228117 | 291 |
| 423 | 3300026067 | Ga0207678_10090364 | Ga0207678_100903643 | 291 |
| 424 | 3300031507 | Ga0307509_10149716 | Ga0307509_101497162 | 291 |
| 425 | 3300045051 | Ga0451576_0020692 | Ga0451576_0020692_4629_5633 | 291 |
| 426 | 3300045051 | Ga0451576_0478722 | Ga0451576_0478722_42_968 | 291 |
| 427 | 3300046474 | Ga0495605_0081142 | Ga0495605_0081142_193_1110 | 291 |
| 428 | 3300046507 | Ga0495606_0009544 | Ga0495606_0009544_833_1768 | 291 |
| 429 | 3300046690 | Ga0495624_0130500 | Ga0495624_0130500_191_1108 | 291 |
| 430 | 3300048904 | Ga0496101_0210547 | Ga0496101_0210547_473_1390 | 291 |
| 431 | 3300048905 | Ga0496102_0414190 | Ga0496102_0414190_291_1208 | 291 |
| 432 | 3300048908 | Ga0496105_0138223 | Ga0496105_0138223_799_1716 | 291 |
| 433 | 3300048910 | Ga0496107_0134265 | Ga0496107_0134265_784_1701 | 291 |
| 434 | 3300048913 | Ga0496110_0315309 | Ga0496110_0315309_418_1335 | 291 |
| 435 | 3300048918 | Ga0496115_0185666 | Ga0496115_0185666_207_1124 | 291 |
| 436 | 3300048921 | Ga0496118_0073574 | Ga0496118_0073574_845_1792 | 291 |
| 437 | 3300048924 | Ga0496121_0029753 | Ga0496121_0029753_3786_4703 | 291 |
| 438 | 3300048929 | Ga0496126_0067644 | Ga0496126_0067644_1352_2275 | 291 |
| 439 | 3300053094 | Ga0500566_0000008 | Ga0500566_0000008_82463_83398 | 291 |
| 440 | 3300053095 | Ga0500640_000524 | Ga0500640_000524_2642_3577 | 291 |
| 441 | 3300053111 | Ga0500572_000555 | Ga0500572_000555_3246_4181 | 291 |
| 442 | 3300053123 | Ga0500614_000179 | Ga0500614_000179_3761_4696 | 291 |
| 443 | 3300053136 | Ga0500559_0008637 | Ga0500559_0008637_1829_2764 | 291 |
| 444 | 3300053142 | Ga0500577_0000068 | Ga0500577_0000068_9426_10343 | 291 |
| 445 | 3300053150 | Ga0500603_000033 | Ga0500603_000033_17388_18323 | 291 |
| 446 | 3300053159 | Ga0500630_000238 | Ga0500630_000238_17919_18854 | 291 |
| 447 | 3300053162 | Ga0500638_005827 | Ga0500638_005827_3101_4036 | 291 |
| 448 | 3300053163 | Ga0500639_000010 | Ga0500639_000010_109175_110110 | 291 |
| 449 | 3300053178 | Ga0500637_0040863 | Ga0500637_0040863_1413_2348 | 291 |
| 450 | 3300053735 | Ga0500596_002070 | Ga0500596_002070_256_1191 | 291 |
| 451 | iso_pu_bacteria | 2908756301 | 2908763450 | 291 |
| 452 | 3300003792 | Ga0055540_1000016 | Ga0055540_100001680 | 292 |
| 453 | 3300003794 | Ga0055531_10009059 | Ga0055531_100090594 | 292 |
| 454 | 3300005331 | Ga0070670_100000863 | Ga0070670_10000086314 | 292 |
| 455 | 3300005353 | Ga0070669_100003725 | Ga0070669_1000037257 | 292 |
| 456 | 3300005354 | Ga0070675_100000605 | Ga0070675_10000060515 | 292 |
| 457 | 3300005355 | Ga0070671_100056526 | Ga0070671_1000565262 | 292 |
| 458 | 3300005356 | Ga0070674_100111922 | Ga0070674_1001119222 | 292 |
| 459 | 3300005364 | Ga0070673_100027949 | Ga0070673_1000279492 | 292 |
| 460 | 3300005456 | Ga0070678_100002173 | Ga0070678_1000021734 | 292 |
| 461 | 3300005539 | Ga0068853_100573755 | Ga0068853_1005737551 | 292 |
| 462 | 3300005543 | Ga0070672_100000414 | Ga0070672_1000004142 | 292 |
| 463 | 3300005548 | Ga0070665_100075896 | Ga0070665_1000758964 | 292 |
| 464 | 3300005548 | Ga0070665_100273831 | Ga0070665_1002738312 | 292 |
| 465 | 3300005564 | Ga0070664_100051993 | Ga0070664_1000519934 | 292 |
| 466 | 3300005618 | Ga0068864_100033367 | Ga0068864_1000333672 | 292 |
| 467 | 3300005834 | Ga0068851_10028027 | Ga0068851_100280273 | 292 |
| 468 | 3300005840 | Ga0068870_10091555 | Ga0068870_100915552 | 292 |
| 469 | 3300005842 | Ga0068858_100402305 | Ga0068858_1004023052 | 292 |
| 470 | 3300006042 | Ga0075368_10009249 | Ga0075368_100092494 | 292 |
| 471 | 3300006051 | Ga0075364_10140267 | Ga0075364_101402672 | 292 |
| 472 | 3300006237 | Ga0097621_100102844 | Ga0097621_1001028441 | 292 |
| 473 | 3300006944 | Ga0099823_1064280 | Ga0099823_10642802 | 292 |
| 474 | 3300006944 | Ga0099823_1064406 | Ga0099823_10644062 | 292 |
| 475 | 3300006946 | Ga0079104_1000198 | Ga0079104_100019813 | 292 |
| 476 | 3300009093 | Ga0105240_10207526 | Ga0105240_102075263 | 292 |
| 477 | 3300009174 | Ga0105241_10060458 | Ga0105241_100604583 | 292 |
| 478 | 3300009545 | Ga0105237_10055847 | Ga0105237_100558473 | 292 |
| 479 | 3300009551 | Ga0105238_10077488 | Ga0105238_100774884 | 292 |
| 480 | 3300010375 | Ga0105239_10160420 | Ga0105239_101604202 | 292 |
| 481 | 3300011119 | Ga0105246_10034503 | Ga0105246_100345033 | 292 |
| 482 | 3300014325 | Ga0163163_10132664 | Ga0163163_101326643 | 292 |
| 483 | 3300025254 | Ga0209148_1000500 | Ga0209148_10005006 | 292 |
| 484 | 3300025298 | Ga0209050_1000082 | Ga0209050_1000082125 | 292 |
| 485 | 3300025298 | Ga0209050_1004407 | Ga0209050_10044073 | 292 |
| 486 | 3300025303 | Ga0209051_1000029 | Ga0209051_1000029125 | 292 |
| 487 | 3300025304 | Ga0209257_1000030 | Ga0209257_1000030118 | 292 |
| 488 | 3300025304 | Ga0209257_1011659 | Ga0209257_10116594 | 292 |
| 489 | 3300025315 | Ga0207697_10020544 | Ga0207697_100205442 | 292 |
| 490 | 3300025321 | Ga0207656_10011260 | Ga0207656_100112603 | 292 |
| 491 | 3300025893 | Ga0207682_10011775 | Ga0207682_100117753 | 292 |
| 492 | 3300025904 | Ga0207647_10013481 | Ga0207647_100134814 | 292 |
| 493 | 3300025908 | Ga0207643_10041091 | Ga0207643_100410912 | 292 |
| 494 | 3300025920 | Ga0207649_10414269 | Ga0207649_104142691 | 292 |
| 495 | 3300025923 | Ga0207681_10044971 | Ga0207681_100449712 | 292 |
| 496 | 3300025925 | Ga0207650_10000326 | Ga0207650_1000032614 | 292 |
| 497 | 3300025926 | Ga0207659_10000299 | Ga0207659_1000029920 | 292 |
| 498 | 3300025931 | Ga0207644_10001354 | Ga0207644_100013545 | 292 |
| 499 | 3300025938 | Ga0207704_10008488 | Ga0207704_100084885 | 292 |
| 500 | 3300025940 | Ga0207691_10000049 | Ga0207691_1000004923 | 292 |
| 501 | 3300025941 | Ga0207711_10258226 | Ga0207711_102582262 | 292 |
| 502 | 3300025960 | Ga0207651_10000834 | Ga0207651_100008347 | 292 |
| 503 | 3300025972 | Ga0207668_10025834 | Ga0207668_100258344 | 292 |
| 504 | 3300026023 | Ga0207677_10013354 | Ga0207677_100133543 | 292 |
| 505 | 3300026088 | Ga0207641_10396636 | Ga0207641_103966361 | 292 |
| 506 | 3300026089 | Ga0207648_10002748 | Ga0207648_100027487 | 292 |
| 507 | 3300026095 | Ga0207676_10032058 | Ga0207676_100320584 | 292 |
| 508 | 3300026121 | Ga0207683_10016814 | Ga0207683_100168145 | 292 |
| 509 | 3300027111 | Ga0209281_1000457 | Ga0209281_100045713 | 292 |
| 510 | 3300027296 | Ga0209389_1000040 | Ga0209389_10000405 | 292 |
| 511 | 3300027361 | Ga0209489_120706 | Ga0209489_1207062 | 292 |
| 512 | 3300027361 | Ga0209489_120707 | Ga0209489_1207072 | 292 |
| 513 | 3300027363 | Ga0209700_100005 | Ga0209700_100005294 | 292 |
| 514 | 3300028381 | Ga0268264_10251361 | Ga0268264_102513612 | 292 |
| 515 | 3300031238 | Ga0265332_10007298 | Ga0265332_100072984 | 292 |
| 516 | 3300031824 | Ga0307413_10002493 | Ga0307413_100024934 | 292 |
| 517 | 3300031903 | Ga0307407_10093220 | Ga0307407_100932202 | 292 |
| 518 | 3300031911 | Ga0307412_10004520 | Ga0307412_100045207 | 292 |
| 519 | 3300032004 | Ga0307414_10009478 | Ga0307414_100094781 | 292 |
| 520 | 3300032005 | Ga0307411_10003401 | Ga0307411_100034014 | 292 |
| 521 | 3300032005 | Ga0307411_10165481 | Ga0307411_101654812 | 292 |
| 522 | 3300032126 | Ga0307415_100060832 | Ga0307415_1000608322 | 292 |
| 523 | 3300035086 | Ga0373934_0013228 | Ga0373934_0013228_806_1726 | 292 |
| 524 | 3300035111 | Ga0373923_0143927 | Ga0373923_0143927_89_1009 | 292 |
| 525 | 3300035117 | Ga0373953_0000542 | Ga0373953_0000542_5185_6105 | 292 |
| 526 | 3300035118 | Ga0373954_0000323 | Ga0373954_0000323_7398_8318 | 292 |
| 527 | 3300035119 | Ga0373956_0009107 | Ga0373956_0009107_3045_3965 | 292 |
| 528 | 3300035120 | Ga0373957_0002539 | Ga0373957_0002539_1434_2354 | 292 |
| 529 | 3300035172 | Ga0373955_0003057 | Ga0373955_0003057_3138_4058 | 292 |
| 530 | 3300035410 | Ga0373924_0011712 | Ga0373924_0011712_782_1702 | 292 |
| 531 | 3300035724 | Ga0373933_0001324 | Ga0373933_0001324_10584_11504 | 292 |
| 532 | 3300036401 | Ga0373937_0007329 | Ga0373937_0007329_4204_5124 | 292 |
| 533 | 3300036401 | Ga0373937_0027340 | Ga0373937_0027340_1420_2451 | 292 |
| 534 | 3300037418 | Ga0395900_0001802 | Ga0395900_0001802_11504_12424 | 292 |
| 535 | 3300037466 | Ga0395898_0002995 | Ga0395898_0002995_13867_14787 | 292 |
| 536 | 3300039447 | Ga0436361_0833650 | Ga0436361_0833650_3412_4338 | 292 |
| 537 | 3300042121 | Ga0450919_001148 | Ga0450919_001148_2372_3304 | 292 |
| 538 | 3300042531 | Ga0450918_005595 | Ga0450918_005595_374_1306 | 292 |
| 539 | 3300044765 | Ga0466970_0209385 | Ga0466970_0209385_108_1034 | 292 |
| 540 | 3300046454 | Ga0495592_0002287 | Ga0495592_0002287_1505_2425 | 292 |
| 541 | 3300046459 | Ga0495629_0013834 | Ga0495629_0013834_3797_4717 | 292 |
| 542 | 3300046459 | Ga0495629_0045225 | Ga0495629_0045225_608_1528 | 292 |
| 543 | 3300046459 | Ga0495629_0059855 | Ga0495629_0059855_107_1138 | 292 |
| 544 | 3300046462 | Ga0495651_0134345 | Ga0495651_0134345_210_1130 | 292 |
| 545 | 3300046462 | Ga0495651_0155022 | Ga0495651_0155022_132_1064 | 292 |
| 546 | 3300046463 | Ga0495653_0014349 | Ga0495653_0014349_1340_2260 | 292 |
| 547 | 3300046501 | Ga0495607_0032563 | Ga0495607_0032563_1148_2068 | 292 |
| 548 | 3300046512 | Ga0495610_0030159 | Ga0495610_0030159_1135_2055 | 292 |
| 549 | 3300046513 | Ga0495616_0019159 | Ga0495616_0019159_2602_3522 | 292 |
| 550 | 3300046513 | Ga0495616_0026871 | Ga0495616_0026871_1947_2867 | 292 |
| 551 | 3300046515 | Ga0495620_0077632 | Ga0495620_0077632_16_936 | 292 |
| 552 | 3300046516 | Ga0495628_0023166 | Ga0495628_0023166_1084_2004 | 292 |
| 553 | 3300046516 | Ga0495628_0078071 | Ga0495628_0078071_1528_2559 | 292 |
| 554 | 3300046519 | Ga0495632_0002332 | Ga0495632_0002332_12431_13351 | 292 |
| 555 | 3300046522 | Ga0495643_0000154 | Ga0495643_0000154_110244_111164 | 292 |
| 556 | 3300046529 | Ga0495652_0033439 | Ga0495652_0033439_1643_2563 | 292 |
| 557 | 3300046529 | Ga0495652_0335035 | Ga0495652_0335035_96_1016 | 292 |
| 558 | 3300046533 | Ga0495640_0282585 | Ga0495640_0282585_35_955 | 292 |
| 559 | 3300046536 | Ga0495587_0005573 | Ga0495587_0005573_1771_2691 | 292 |
| 560 | 3300046642 | Ga0495634_0042942 | Ga0495634_0042942_1480_2400 | 292 |
| 561 | 3300046663 | Ga0495635_0006348 | Ga0495635_0006348_3853_4773 | 292 |
| 562 | 3300046663 | Ga0495635_0011988 | Ga0495635_0011988_2404_3324 | 292 |
| 563 | 3300046665 | Ga0495661_0003126 | Ga0495661_0003126_5149_6069 | 292 |
| 564 | 3300046675 | Ga0495657_0015234 | Ga0495657_0015234_2654_3574 | 292 |
| 565 | 3300046675 | Ga0495657_0028025 | Ga0495657_0028025_1010_1930 | 292 |
| 566 | 3300046678 | Ga0495599_0004863 | Ga0495599_0004863_3350_4270 | 292 |
| 567 | 3300046679 | Ga0495623_0005974 | Ga0495623_0005974_4086_5006 | 292 |
| 568 | 3300046681 | Ga0495647_0032237 | Ga0495647_0032237_385_1416 | 292 |
| 569 | 3300046683 | Ga0495658_0175248 | Ga0495658_0175248_149_1069 | 292 |
| 570 | 3300046689 | Ga0495613_0082180 | Ga0495613_0082180_1365_2285 | 292 |
| 571 | 3300046689 | Ga0495613_0095414 | Ga0495613_0095414_1149_2069 | 292 |
| 572 | 3300046690 | Ga0495624_0122366 | Ga0495624_0122366_119_1039 | 292 |
| 573 | 3300046691 | Ga0495670_0042520 | Ga0495670_0042520_264_1205 | 292 |
| 574 | 3300047319 | Ga0495674_0048317 | Ga0495674_0048317_345_1265 | 292 |
| 575 | 3300047443 | Ga0495687_025876 | Ga0495687_025876_872_1792 | 292 |
| 576 | 3300047444 | Ga0495675_0003845 | Ga0495675_0003845_4801_5721 | 292 |
| 577 | 3300047471 | Ga0495684_0005498 | Ga0495684_0005498_2767_3687 | 292 |
| 578 | 3300047673 | Ga0495593_0013232 | Ga0495593_0013232_2634_3554 | 292 |
| 579 | 3300048906 | Ga0496103_0007011 | Ga0496103_0007011_605_1525 | 292 |
| 580 | 3300048911 | Ga0496108_0198992 | Ga0496108_0198992_803_1723 | 292 |
| 581 | 3300048915 | Ga0496112_0054466 | Ga0496112_0054466_2167_3087 | 292 |
| 582 | 3300048915 | Ga0496112_0089508 | Ga0496112_0089508_882_1880 | 292 |
| 583 | 3300048916 | Ga0496113_0227412 | Ga0496113_0227412_83_1003 | 292 |
| 584 | 3300048917 | Ga0496114_0253732 | Ga0496114_0253732_494_1414 | 292 |
| 585 | 3300048918 | Ga0496115_0290106 | Ga0496115_0290106_244_1164 | 292 |
| 586 | 3300048922 | Ga0496119_0104743 | Ga0496119_0104743_442_1362 | 292 |
| 587 | 3300048923 | Ga0496120_0022584 | Ga0496120_0022584_2572_3492 | 292 |
| 588 | 3300048928 | Ga0496125_0053668 | Ga0496125_0053668_1809_2729 | 292 |
| 589 | 3300048928 | Ga0496125_0089835 | Ga0496125_0089835_1053_1976 | 292 |
| 590 | 3300048929 | Ga0496126_0044288 | Ga0496126_0044288_1496_2416 | 292 |
| 591 | 3300049579 | Ga0501043_0000053 | Ga0501043_0000053_55480_56448 | 292 |
| 592 | 3300049580 | Ga0501046_0000018 | Ga0501046_0000018_9841_10809 | 292 |
| 593 | 3300049581 | Ga0501047_0000020 | Ga0501047_0000020_48650_49618 | 292 |
| 594 | 3300049582 | Ga0501048_0000795 | Ga0501048_0000795_10282_11250 | 292 |
| 595 | 3300049824 | Ga0501045_0040544 | Ga0501045_0040544_319_1287 | 292 |
| 596 | 3300050491 | nmdc:mga00v17_23838_c2 | nmdc:mga00v17_23838_c2_24_944 | 292 |
| 597 | 3300050495 | nmdc:mga04h51_16669_c1 | nmdc:mga04h51_16669_c1_166_1086 | 292 |
| 598 | 3300053077 | Ga0495601_0036848 | Ga0495601_0036848_1880_2911 | 292 |
| 599 | 3300053083 | Ga0495655_0041617 | Ga0495655_0041617_94_1038 | 292 |
| 600 | 3300053084 | Ga0495595_0011955 | Ga0495595_0011955_1697_2617 | 292 |
| 601 | 3300053085 | Ga0495619_0010048 | Ga0495619_0010048_3993_4913 | 292 |
| 602 | 3300053090 | Ga0500646_0014801 | Ga0500646_0014801_832_1752 | 292 |
| 603 | 3300053122 | Ga0500608_148689 | Ga0500608_148689_43_963 | 292 |
| 604 | 3300053154 | Ga0500619_059060 | Ga0500619_059060_61_981 | 292 |
| 605 | 3300053156 | Ga0500622_0011913 | Ga0500622_0011913_2729_3670 | 292 |
| 606 | 3300053162 | Ga0500638_026391 | Ga0500638_026391_1804_2724 | 292 |
| 607 | 3300053177 | Ga0500636_0001217 | Ga0500636_0001217_3076_3996 | 292 |
| 608 | 3300053177 | Ga0500636_0093439 | Ga0500636_0093439_452_1372 | 292 |
| 609 | 3300053733 | Ga0500552_011830 | Ga0500552_011830_154_1074 | 292 |
| 610 | 3300053737 | Ga0500601_000029 | Ga0500601_000029_5981_6901 | 292 |
| 611 | 3300003203 | JGI25406J46586_10000427 | JGI25406J46586_100004273 | 293 |
| 612 | 3300003203 | JGI25406J46586_10000721 | JGI25406J46586_100007216 | 293 |
| 613 | 3300003659 | JGI25404J52841_10004199 | JGI25404J52841_100041993 | 293 |
| 614 | 3300005262 | Ga0065165_1000323 | Ga0065165_100032353 | 293 |
| 615 | 3300005336 | Ga0070680_100079923 | Ga0070680_1000799232 | 293 |
| 616 | 3300005366 | Ga0070659_100134462 | Ga0070659_1001344622 | 293 |
| 617 | 3300005366 | Ga0070659_100384295 | Ga0070659_1003842952 | 293 |
| 618 | 3300005434 | Ga0070709_10000424 | Ga0070709_1000042417 | 293 |
| 619 | 3300005434 | Ga0070709_10002985 | Ga0070709_100029854 | 293 |
| 620 | 3300005435 | Ga0070714_100003678 | Ga0070714_10000367812 | 293 |
| 621 | 3300005435 | Ga0070714_100013754 | Ga0070714_1000137543 | 293 |
| 622 | 3300005436 | Ga0070713_100129056 | Ga0070713_1001290562 | 293 |
| 623 | 3300005437 | Ga0070710_10001915 | Ga0070710_100019159 | 293 |
| 624 | 3300005439 | Ga0070711_100001539 | Ga0070711_10000153912 | 293 |
| 625 | 3300005471 | Ga0070698_100406495 | Ga0070698_1004064952 | 293 |
| 626 | 3300005539 | Ga0068853_100130016 | Ga0068853_1001300162 | 293 |
| 627 | 3300005614 | Ga0068856_100400334 | Ga0068856_1004003342 | 293 |
| 628 | 3300005616 | Ga0068852_100211402 | Ga0068852_1002114022 | 293 |
| 629 | 3300005834 | Ga0068851_10159197 | Ga0068851_101591972 | 293 |
| 630 | 3300005834 | Ga0068851_10173127 | Ga0068851_101731271 | 293 |
| 631 | 3300005937 | Ga0081455_10005550 | Ga0081455_100055506 | 293 |
| 632 | 3300005937 | Ga0081455_10045525 | Ga0081455_100455252 | 293 |
| 633 | 3300005983 | Ga0081540_1002952 | Ga0081540_100295212 | 293 |
| 634 | 3300005983 | Ga0081540_1015686 | Ga0081540_10156863 | 293 |
| 635 | 3300005985 | Ga0081539_10000486 | Ga0081539_100004863 | 293 |
| 636 | 3300005985 | Ga0081539_10000748 | Ga0081539_1000074856 | 293 |
| 637 | 3300006028 | Ga0070717_10016495 | Ga0070717_100164953 | 293 |
| 638 | 3300006051 | Ga0075364_10014392 | Ga0075364_100143923 | 293 |
| 639 | 3300006163 | Ga0070715_10001596 | Ga0070715_100015963 | 293 |
| 640 | 3300006163 | Ga0070715_10071826 | Ga0070715_100718262 | 293 |
| 641 | 3300006173 | Ga0070716_100003246 | Ga0070716_1000032464 | 293 |
| 642 | 3300006173 | Ga0070716_100008627 | Ga0070716_1000086275 | 293 |
| 643 | 3300006175 | Ga0070712_100012263 | Ga0070712_1000122631 | 293 |
| 644 | 3300006175 | Ga0070712_100127807 | Ga0070712_1001278072 | 293 |
| 645 | 3300006178 | Ga0075367_10087797 | Ga0075367_100877972 | 293 |
| 646 | 3300006195 | Ga0075366_10159010 | Ga0075366_101590101 | 293 |
| 647 | 3300006871 | Ga0075434_100183497 | Ga0075434_1001834972 | 293 |
| 648 | 3300007265 | Ga0099794_10017152 | Ga0099794_100171524 | 293 |
| 649 | 3300009101 | Ga0105247_10022846 | Ga0105247_100228461 | 293 |
| 650 | 3300009545 | Ga0105237_10443482 | Ga0105237_104434822 | 293 |
| 651 | 3300013104 | Ga0157370_10289190 | Ga0157370_102891902 | 293 |
| 652 | 3300014968 | Ga0157379_10096110 | Ga0157379_100961103 | 293 |
| 653 | 3300021320 | Ga0214544_1000002 | Ga0214544_1000002116 | 293 |
| 654 | 3300021321 | Ga0214542_1000001 | Ga0214542_1000001466 | 293 |
| 655 | 3300021324 | Ga0214545_1000001 | Ga0214545_1000001532 | 293 |
| 656 | 3300021324 | Ga0214545_1026202 | Ga0214545_10262023 | 293 |
| 657 | 3300021327 | Ga0214543_1000001 | Ga0214543_1000001664 | 293 |
| 658 | 3300021384 | Ga0213876_10003361 | Ga0213876_100033618 | 293 |
| 659 | 3300025253 | Ga0209677_100280 | Ga0209677_10028010 | 293 |
| 660 | 3300025254 | Ga0209148_1010747 | Ga0209148_10107472 | 293 |
| 661 | 3300025261 | Ga0209233_1002090 | Ga0209233_10020907 | 293 |
| 662 | 3300025272 | Ga0209455_1001166 | Ga0209455_10011669 | 293 |
| 663 | 3300025273 | Ga0209673_1024009 | Ga0209673_10240092 | 293 |
| 664 | 3300025295 | Ga0209564_1000097 | Ga0209564_1000097108 | 293 |
| 665 | 3300025898 | Ga0207692_10000318 | Ga0207692_100003182 | 293 |
| 666 | 3300025898 | Ga0207692_10000738 | Ga0207692_100007388 | 293 |
| 667 | 3300025905 | Ga0207685_10003083 | Ga0207685_100030834 | 293 |
| 668 | 3300025906 | Ga0207699_10000465 | Ga0207699_100004655 | 293 |
| 669 | 3300025906 | Ga0207699_10067812 | Ga0207699_100678122 | 293 |
| 670 | 3300025915 | Ga0207693_10003071 | Ga0207693_100030719 | 293 |
| 671 | 3300025915 | Ga0207693_10003980 | Ga0207693_100039804 | 293 |
| 672 | 3300025915 | Ga0207693_10022195 | Ga0207693_100221954 | 293 |
| 673 | 3300025916 | Ga0207663_10001512 | Ga0207663_1000151210 | 293 |
| 674 | 3300025928 | Ga0207700_10195137 | Ga0207700_101951372 | 293 |
| 675 | 3300025929 | Ga0207664_10019656 | Ga0207664_100196565 | 293 |
| 676 | 3300025929 | Ga0207664_10089866 | Ga0207664_100898662 | 293 |
| 677 | 3300025932 | Ga0207690_10204413 | Ga0207690_102044132 | 293 |
| 678 | 3300025939 | Ga0207665_10002891 | Ga0207665_1000289113 | 293 |
| 679 | 3300025939 | Ga0207665_10008158 | Ga0207665_100081582 | 293 |
| 680 | 3300025949 | Ga0207667_10068267 | Ga0207667_100682674 | 293 |
| 681 | 3300026041 | Ga0207639_10170525 | Ga0207639_101705252 | 293 |
| 682 | 3300026067 | Ga0207678_10043159 | Ga0207678_100431594 | 293 |
| 683 | 3300026078 | Ga0207702_10021218 | Ga0207702_100212184 | 293 |
| 684 | 3300027866 | Ga0209813_10065105 | Ga0209813_100651051 | 293 |
| 685 | 3300028381 | Ga0268264_10031537 | Ga0268264_100315373 | 293 |
| 686 | 3300028556 | Ga0265337_1001439 | Ga0265337_10014396 | 293 |
| 687 | 3300028558 | Ga0265326_10001380 | Ga0265326_100013805 | 293 |
| 688 | 3300028563 | Ga0265319_1002798 | Ga0265319_10027987 | 293 |
| 689 | 3300028573 | Ga0265334_10005260 | Ga0265334_100052603 | 293 |
| 690 | 3300028577 | Ga0265318_10003474 | Ga0265318_100034745 | 293 |
| 691 | 3300028653 | Ga0265323_10000992 | Ga0265323_100009925 | 293 |
| 692 | 3300028654 | Ga0265322_10002589 | Ga0265322_100025895 | 293 |
| 693 | 3300028666 | Ga0265336_10000063 | Ga0265336_1000006379 | 293 |
| 694 | 3300028786 | Ga0307517_10000085 | Ga0307517_100000856 | 293 |
| 695 | 3300028794 | Ga0307515_10027739 | Ga0307515_100277392 | 293 |
| 696 | 3300028794 | Ga0307515_10094574 | Ga0307515_100945742 | 293 |
| 697 | 3300028794 | Ga0307515_10165545 | Ga0307515_101655452 | 293 |
| 698 | 3300028800 | Ga0265338_10000154 | Ga0265338_1000015415 | 293 |
| 699 | 3300029957 | Ga0265324_10001590 | Ga0265324_100015909 | 293 |
| 700 | 3300031239 | Ga0265328_10037935 | Ga0265328_100379352 | 293 |
| 701 | 3300031241 | Ga0265325_10002402 | Ga0265325_100024026 | 293 |
| 702 | 3300031247 | Ga0265340_10020838 | Ga0265340_100208383 | 293 |
| 703 | 3300031249 | Ga0265339_10025106 | Ga0265339_100251062 | 293 |
| 704 | 3300031250 | Ga0265331_10055199 | Ga0265331_100551992 | 293 |
| 705 | 3300031344 | Ga0265316_10206274 | Ga0265316_102062742 | 293 |
| 706 | 3300031507 | Ga0307509_10139196 | Ga0307509_101391963 | 293 |
| 707 | 3300031616 | Ga0307508_10000282 | Ga0307508_1000028231 | 293 |
| 708 | 3300031616 | Ga0307508_10009668 | Ga0307508_1000966810 | 293 |
| 709 | 3300031616 | Ga0307508_10279793 | Ga0307508_102797931 | 293 |
| 710 | 3300031711 | Ga0265314_10053104 | Ga0265314_100531042 | 293 |
| 711 | 3300031712 | Ga0265342_10023837 | Ga0265342_100238374 | 293 |
| 712 | 3300031712 | Ga0265342_10057119 | Ga0265342_100571193 | 293 |
| 713 | 3300031730 | Ga0307516_10009880 | Ga0307516_100098802 | 293 |
| 714 | 3300031730 | Ga0307516_10052275 | Ga0307516_100522754 | 293 |
| 715 | 3300031730 | Ga0307516_10098215 | Ga0307516_100982152 | 293 |
| 716 | 3300031730 | Ga0307516_10227071 | Ga0307516_102270712 | 293 |
| 717 | 3300031730 | Ga0307516_10345143 | Ga0307516_103451432 | 293 |
| 718 | 3300033179 | Ga0307507_10091082 | Ga0307507_100910823 | 293 |
| 719 | 3300033180 | Ga0307510_10086514 | Ga0307510_100865142 | 293 |
| 720 | 3300035111 | Ga0373923_0036844 | Ga0373923_0036844_1006_1953 | 293 |
| 721 | 3300035117 | Ga0373953_0006315 | Ga0373953_0006315_1778_2725 | 293 |
| 722 | 3300035119 | Ga0373956_0018340 | Ga0373956_0018340_550_1497 | 293 |
| 723 | 3300035120 | Ga0373957_0037806 | Ga0373957_0037806_397_1344 | 293 |
| 724 | 3300035695 | Ga0373927_0010672 | Ga0373927_0010672_368_1291 | 293 |
| 725 | 3300035695 | Ga0373927_0028676 | Ga0373927_0028676_1482_2405 | 293 |
| 726 | 3300035725 | Ga0373947_0030133 | Ga0373947_0030133_174_1097 | 293 |
| 727 | 3300035725 | Ga0373947_0063015 | Ga0373947_0063015_1236_2159 | 293 |
| 728 | 3300036401 | Ga0373937_0049474 | Ga0373937_0049474_2382_3323 | 293 |
| 729 | 3300036401 | Ga0373937_0087326 | Ga0373937_0087326_1178_2125 | 293 |
| 730 | 3300039437 | Ga0436365_0619230 | Ga0436365_0619230_424_1347 | 293 |
| 731 | 3300039437 | Ga0436365_1549030 | Ga0436365_1549030_1570_2499 | 293 |
| 732 | 3300039453 | Ga0436362_1138875 | Ga0436362_1138875_166_1089 | 293 |
| 733 | 3300044684 | Ga0466966_0062349 | Ga0466966_0062349_829_1773 | 293 |
| 734 | 3300044712 | Ga0453684_0037503 | Ga0453684_0037503_4631_5566 | 293 |
| 735 | 3300044712 | Ga0453684_0197961 | Ga0453684_0197961_1101_2033 | 293 |
| 736 | 3300045049 | Ga0466959_0108206 | Ga0466959_0108206_561_1505 | 293 |
| 737 | 3300046457 | Ga0495590_0073441 | Ga0495590_0073441_205_1131 | 293 |
| 738 | 3300046460 | Ga0495638_0017406 | Ga0495638_0017406_3595_4518 | 293 |
| 739 | 3300046460 | Ga0495638_0072038 | Ga0495638_0072038_989_1912 | 293 |
| 740 | 3300046460 | Ga0495638_0130066 | Ga0495638_0130066_508_1443 | 293 |
| 741 | 3300046462 | Ga0495651_0029648 | Ga0495651_0029648_503_1450 | 293 |
| 742 | 3300046477 | Ga0495664_0017512 | Ga0495664_0017512_1151_2074 | 293 |
| 743 | 3300046511 | Ga0495608_0017164 | Ga0495608_0017164_914_1861 | 293 |
| 744 | 3300046512 | Ga0495610_0017485 | Ga0495610_0017485_3105_4028 | 293 |
| 745 | 3300046513 | Ga0495616_0055709 | Ga0495616_0055709_852_1775 | 293 |
| 746 | 3300046514 | Ga0495618_0040481 | Ga0495618_0040481_436_1383 | 293 |
| 747 | 3300046515 | Ga0495620_0039154 | Ga0495620_0039154_823_1746 | 293 |
| 748 | 3300046516 | Ga0495628_0049588 | Ga0495628_0049588_1662_2609 | 293 |
| 749 | 3300046517 | Ga0495630_0064425 | Ga0495630_0064425_247_1194 | 293 |
| 750 | 3300046524 | Ga0495648_0083840 | Ga0495648_0083840_463_1386 | 293 |
| 751 | 3300046530 | Ga0495654_0063349 | Ga0495654_0063349_37_960 | 293 |
| 752 | 3300046543 | Ga0495645_0166188 | Ga0495645_0166188_563_1510 | 293 |
| 753 | 3300046557 | Ga0495622_0076382 | Ga0495622_0076382_253_1176 | 293 |
| 754 | 3300046558 | Ga0495633_0154965 | Ga0495633_0154965_107_1030 | 293 |
| 755 | 3300046660 | Ga0495625_0132418 | Ga0495625_0132418_436_1371 | 293 |
| 756 | 3300046663 | Ga0495635_0101394 | Ga0495635_0101394_505_1452 | 293 |
| 757 | 3300046675 | Ga0495657_0040051 | Ga0495657_0040051_1090_2037 | 293 |
| 758 | 3300046678 | Ga0495599_0015026 | Ga0495599_0015026_2979_3926 | 293 |
| 759 | 3300046679 | Ga0495623_0023347 | Ga0495623_0023347_1025_1972 | 293 |
| 760 | 3300046683 | Ga0495658_0168364 | Ga0495658_0168364_346_1269 | 293 |
| 761 | 3300046689 | Ga0495613_0050119 | Ga0495613_0050119_185_1132 | 293 |
| 762 | 3300046691 | Ga0495670_0069276 | Ga0495670_0069276_697_1620 | 293 |
| 763 | 3300047317 | Ga0495604_0134073 | Ga0495604_0134073_26_997 | 293 |
| 764 | 3300047320 | Ga0495672_0073895 | Ga0495672_0073895_407_1393 | 293 |
| 765 | 3300047322 | Ga0495680_0052683 | Ga0495680_0052683_2013_2960 | 293 |
| 766 | 3300047444 | Ga0495675_0039960 | Ga0495675_0039960_1303_2250 | 293 |
| 767 | 3300047470 | Ga0495681_0029025 | Ga0495681_0029025_1228_2151 | 293 |
| 768 | 3300047472 | Ga0495686_0003011 | Ga0495686_0003011_696_1619 | 293 |
| 769 | 3300047472 | Ga0495686_0063829 | Ga0495686_0063829_361_1284 | 293 |
| 770 | 3300047472 | Ga0495686_0153016 | Ga0495686_0153016_62_985 | 293 |
| 771 | 3300048088 | Ga0495602_0098093 | Ga0495602_0098093_505_1452 | 293 |
| 772 | 3300048091 | Ga0495626_0044465 | Ga0495626_0044465_765_1688 | 293 |
| 773 | 3300048909 | Ga0496106_0019847 | Ga0496106_0019847_1359_2282 | 293 |
| 774 | 3300048913 | Ga0496110_0536894 | Ga0496110_0536894_121_1044 | 293 |
| 775 | 3300048915 | Ga0496112_0000008 | Ga0496112_0000008_83621_84556 | 293 |
| 776 | 3300048915 | Ga0496112_0110949 | Ga0496112_0110949_680_1603 | 293 |
| 777 | 3300048919 | Ga0496116_0005652 | Ga0496116_0005652_6751_7674 | 293 |
| 778 | 3300048920 | Ga0496117_0010555 | Ga0496117_0010555_5023_5946 | 293 |
| 779 | 3300048920 | Ga0496117_0025985 | Ga0496117_0025985_1996_2919 | 293 |
| 780 | 3300048921 | Ga0496118_0004640 | Ga0496118_0004640_2309_3232 | 293 |
| 781 | 3300048921 | Ga0496118_0014868 | Ga0496118_0014868_4725_5648 | 293 |
| 782 | 3300048921 | Ga0496118_0060895 | Ga0496118_0060895_1753_2676 | 293 |
| 783 | 3300048921 | Ga0496118_0140636 | Ga0496118_0140636_356_1279 | 293 |
| 784 | 3300048922 | Ga0496119_0077897 | Ga0496119_0077897_808_1746 | 293 |
| 785 | 3300048923 | Ga0496120_0092531 | Ga0496120_0092531_12_935 | 293 |
| 786 | 3300048924 | Ga0496121_0000089 | Ga0496121_0000089_69992_70915 | 293 |
| 787 | 3300048924 | Ga0496121_0011201 | Ga0496121_0011201_64_987 | 293 |
| 788 | 3300048924 | Ga0496121_0024792 | Ga0496121_0024792_4777_5700 | 293 |
| 789 | 3300048926 | Ga0496123_0101772 | Ga0496123_0101772_697_1620 | 293 |
| 790 | 3300048926 | Ga0496123_0141288 | Ga0496123_0141288_111_1034 | 293 |
| 791 | 3300048927 | Ga0496124_0089884 | Ga0496124_0089884_463_1386 | 293 |
| 792 | 3300048928 | Ga0496125_0000712 | Ga0496125_0000712_5953_6876 | 293 |
| 793 | 3300048928 | Ga0496125_0000998 | Ga0496125_0000998_6429_7352 | 293 |
| 794 | 3300048928 | Ga0496125_0002472 | Ga0496125_0002472_8481_9404 | 293 |
| 795 | 3300048928 | Ga0496125_0070584 | Ga0496125_0070584_1332_2255 | 293 |
| 796 | 3300048929 | Ga0496126_0003551 | Ga0496126_0003551_1204_2127 | 293 |
| 797 | 3300048929 | Ga0496126_0015357 | Ga0496126_0015357_4873_5796 | 293 |
| 798 | 3300048929 | Ga0496126_0235865 | Ga0496126_0235865_487_1410 | 293 |
| 799 | 3300049568 | Ga0501031_0001824 | Ga0501031_0001824_4343_5275 | 293 |
| 800 | 3300050491 | nmdc:mga00v17_27496_c1 | nmdc:mga00v17_27496_c1_2270_3193 | 293 |
| 801 | 3300050512 | nmdc:mga0n895_295120_c1 | nmdc:mga0n895_295120_c1_43_966 | 293 |
| 802 | 3300050516 | nmdc:mga0sz30_4243_c1 | nmdc:mga0sz30_4243_c1_3873_4796 | 293 |
| 803 | 3300053084 | Ga0495595_0029905 | Ga0495595_0029905_629_1576 | 293 |
| 804 | 3300053087 | Ga0500643_015424 | Ga0500643_015424_587_1510 | 293 |
| 805 | 3300053094 | Ga0500566_0001026 | Ga0500566_0001026_12237_13208 | 293 |
| 806 | 3300053096 | Ga0500641_0018888 | Ga0500641_0018888_1303_2226 | 293 |
| 807 | 3300053098 | Ga0500650_0001241 | Ga0500650_0001241_4411_5334 | 293 |
| 808 | 3300053104 | Ga0500556_0000015 | Ga0500556_0000015_198508_199431 | 293 |
| 809 | 3300053109 | Ga0500569_004280 | Ga0500569_004280_2047_2970 | 293 |
| 810 | 3300053118 | Ga0500594_0028887 | Ga0500594_0028887_39_962 | 293 |
| 811 | 3300053119 | Ga0500595_036315 | Ga0500595_036315_180_1103 | 293 |
| 812 | 3300053122 | Ga0500608_013977 | Ga0500608_013977_502_1473 | 293 |
| 813 | 3300053130 | Ga0500642_0000019 | Ga0500642_0000019_120355_121278 | 293 |
| 814 | 3300053131 | Ga0500652_001339 | Ga0500652_001339_1594_2517 | 293 |
| 815 | 3300053134 | Ga0500658_0098688 | Ga0500658_0098688_124_1047 | 293 |
| 816 | 3300053136 | Ga0500559_0000396 | Ga0500559_0000396_27726_28697 | 293 |
| 817 | 3300053139 | Ga0500568_0003619 | Ga0500568_0003619_6393_7316 | 293 |
| 818 | 3300053151 | Ga0500604_0012463 | Ga0500604_0012463_786_1709 | 293 |
| 819 | 3300053153 | Ga0500616_0000041 | Ga0500616_0000041_31825_32748 | 293 |
| 820 | 3300053156 | Ga0500622_0001685 | Ga0500622_0001685_3079_4002 | 293 |
| 821 | 3300053177 | Ga0500636_0000616 | Ga0500636_0000616_17594_18565 | 293 |
| 822 | 3300053177 | Ga0500636_0140182 | Ga0500636_0140182_294_1217 | 293 |
| 823 | 3300053178 | Ga0500637_0035169 | Ga0500637_0035169_588_1559 | 293 |
| 824 | 3300053729 | Ga0500625_044318 | Ga0500625_044318_276_1199 | 293 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7exs-assembly1.cif.gz_A | thermomicrobium roseum sarcosine oxidase mutant - s320r | 0.9699 | 9 | 37 |
| 1sez-assembly1.cif.gz_A | crystal structure of protoporphyrinogen ix oxidase | 0.9651 | 7 | 37 |
| 6j38-assembly1.cif.gz_B-2 | crystal structure of cmis2 | 0.965 | 9 | 37 |
| 3i3l-assembly1.cif.gz_A | crystal structure of cmls, a flavin-dependent halogenase | 0.9615 | 8 | 37 |
| 6aio-assembly2.cif.gz_B | crystal structure of p-nitrophenol 4-monooxygenase pnpa from pseudomonas putida dll-e4 | 0.9613 | 10 | 37 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6E7M3_47_537_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9793 | 10 | 37 | 3.50.50.60 |
| af_Q0D7W4_71_358_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9759 | 8 | 37 | 3.50.50.60 |
| 4hb9A01 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.969 | 9 | 36 | 3.50.50.60 |
| af_B0G160_35_582_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9628 | 10 | 37 | 3.50.50.60 |
| 3i3lA01 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9615 | 8 | 37 | 3.50.50.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A160U471-F1-model_v4 | deleted | 0.9835 | 1 | 172 |
|
| AF-A0A6L7ZVD8-F1-model_v4 | 6-phosphogluconate dehydrogenase | 0.9694 | 8 | 124 |
GO:0050661
|
| AF-A0A4V1TYT9-F1-model_v4 | NAD(P)-dependent oxidoreductase | 0.9627 | 8 | 198 |
GO:0016054
GO:0050661 |
| AF-A0A160U471-F1-model_v4 | deleted | 0.9614 | 1 | 172 |
|
| AF-A0A2X5B268-F1-model_v4 | deleted | 0.9566 | 9 | 187 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar