F482400

General Info

Members Datasets Scaffolds Average Seq Length
824 514 706 299

Family's Representative Sequence

Representative Sequence 3300046543|Ga0495645_0246961|Ga0495645_0246961_111_1121
Length 336
Sequence MATEKSAPTDLRDRSNAPTFAMSTDAASAARQPLRWRVGLIGYGEVGQILAEDLRARGLAVSAYDTKLAQAESASLLTRHAAAHGVRLAASHADAAASADLLISAVTASQTLAAAEATSAGLTPRAFFLDFNSASPGAKIRAAEVVAAGGGRYVEGAVMTSLPPYRIRVPLLLGGSHAAALEPLLAAIGFSARVASETLGIASATKMCRSVMIKGLEAMVIESFTTARAYGVEDAVLASLAETFPGINWEKQGAYFFQRVIEHGRRRSEEVREVAETVREAGLTPWSSQGTADRQGWVADLADEGLFGAKGTPEFARSADWRTEADRILGAIKPGK

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
3 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
4 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
5 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
6 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
7 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
8 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
9 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
10 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
11 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
12 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
13 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
14 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
15 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
16 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
17 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
18 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
19 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
20 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
21 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
22 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
23 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
24 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
25 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
26 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
27 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
28 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
29 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
30 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
31 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
32 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
33 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
34 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
35 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
36 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
37 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
38 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
39 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
40 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
41 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
42 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
43 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
44 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
45 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
46 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
47 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
48 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
49 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
50 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
51 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
52 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
53 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
54 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
55 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
56 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
57 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
58 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
59 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
60 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
61 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
62 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
63 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
64 2904699407
65 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
66 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
67 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
68 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
69 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
70 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
71 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
72 2922368715
73 2922425934
74 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
75 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
76 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
77 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
78 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
79 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
80 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
81 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
82 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
83 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
84 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
85 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
86 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
87 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
88 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
89 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
90 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
91 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
92 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
93 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
94 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
95 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
96 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
97 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
98 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
99 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
100 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
101 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
102 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
103 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
104 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
105 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
106 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
107 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
108 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
109 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
110 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
111 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
112 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
113 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
114 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
115 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
116 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
117 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
118 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
119 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
120 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
121 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
122 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
123 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
124 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
125 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
126 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
127 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
128 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
129 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
130 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
131 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
132 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
133 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
134 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
135 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
136 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
137 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
138 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
139 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
140 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
141 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
142 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
143 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
144 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
145 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
146 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
147 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
148 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
149 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
150 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
151 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
152 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
153 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
154 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
155 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
156 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
157 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
158 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
159 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
160 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
161 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
162 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
163 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
164 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
165 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
166 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
167 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
168 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
169 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
170 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
171 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
172 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
173 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
174 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
175 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
176 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
177 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
178 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
179 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
180 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
181 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
182 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
183 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
184 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
185 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
186 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
187 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
188 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
189 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
190 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
191 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
192 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
193 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
194 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
195 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
196 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
197 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
198 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
199 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
200 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
201 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
202 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
203 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
204 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
205 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
206 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
207 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
208 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
209 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
210 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
211 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
212 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
213 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
263 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
264 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
265 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
266 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
267 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
271 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
272 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
273 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
274 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
275 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
276 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
277 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
278 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
279 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
280 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
281 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
282 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
283 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
284 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
285 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
286 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
287 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
288 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
289 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
290 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
291 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
292 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
293 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
294 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
295 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
296 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
297 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
298 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
299 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
300 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
301 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
302 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
303 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
304 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
305 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
306 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
307 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
308 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
309 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
310 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
311 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
312 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
313 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
314 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
315 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
316 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
317 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
318 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
319 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
320 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
321 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
322 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
323 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
324 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
325 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
326 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
327 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
328 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
329 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
330 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
331 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
332 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
333 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
334 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
335 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
336 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
337 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
338 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
339 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
340 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
341 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
342 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
343 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
344 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
345 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
346 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
347 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
348 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
349 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
350 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
351 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
352 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
353 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
354 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
355 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
356 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
357 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
358 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
359 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
360 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
361 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
362 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
363 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
364 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
365 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
366 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
367 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
368 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
369 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
370 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
371 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
372 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
373 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
374 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
375 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
376 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
377 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
378 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
379 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
380 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
381 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
382 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
383 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
384 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
385 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
386 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
387 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
388 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
389 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
390 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
391 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
392 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
393 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
394 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
395 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
396 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
397 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
398 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
399 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
400 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
401 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
402 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
403 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
404 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
405 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
406 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
407 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
408 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
409 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
410 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
411 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
412 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
413 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
414 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
415 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
416 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
417 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
418 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
419 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
420 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
421 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
422 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
423 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
424 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
425 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
426 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
427 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
428 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
429 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
430 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
431 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
432 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
433 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
434 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
435 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
436 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
437 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
438 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
439 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
440 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
441 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
442 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
443 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
444 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
445 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
446 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
447 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
448 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
449 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
450 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
451 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
452 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
453 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
454 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
455 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
456 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
457 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
458 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
459 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
460 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
461 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
462 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
463 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
464 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
465 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
466 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
467 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
468 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
469 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
470 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
471 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
472 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
473 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
474 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
475 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
476 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
477 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
478 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
479 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
480 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
481 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
482 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
483 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
484 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
485 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
486 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
487 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
488 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
489 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
490 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
491 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
492 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
493 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
494 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
495 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
496 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
497 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
498 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
499 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
500 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
501 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
502 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
503 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
504 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
505 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
506 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
507 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
508 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
509 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
510 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
511 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
512 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
513 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
514 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 85.99
Metatranscriptomes 0
Isolates 14.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.2
Nodule 11.17
Rhizoplane 2.31
Rhizosphere 59.83
Stem 0
Stem Tuber 0
Unclassified 12.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000427 3300003203 Bacteria 19396
2 JGI25406J46586_10000721 3300003203 Bacteria 15439
3 JGI25153J46596_10000394 3300003215 Bacteria 29469
4 JGI25153J46596_10000515 3300003215 Bacteria 24363
5 JGI25153J46596_10003431 3300003215 Bacteria 8876
6 JGI25160J50197_1000553 3300003354 Bacteria 21212
7 JGI25160J50197_1003853 3300003354 Bacteria 6586
8 JGI25404J52841_10004199 3300003659 Bacteria 2899
9 Ga0055540_1000016 3300003792 Bacteria 232942
10 Ga0055531_10005951 3300003794 Bacteria 7011
11 Ga0055531_10009059 3300003794 Bacteria 5139
12 Ga0065165_1000323 3300005262 Bacteria 78079
13 Ga0065165_1000864 3300005262 Bacteria 39604
14 Ga0065165_1001731 3300005262 Bacteria 21826
15 Ga0065165_1002832 3300005262 Bacteria 13534
16 Ga0065165_1018035 3300005262 Bacteria 2575
17 Ga0065707_10084750 3300005295 Bacteria 6818
18 Ga0070670_100000356 3300005331 Bacteria 38360
19 Ga0070670_100000863 3300005331 Bacteria 23798
20 Ga0070680_100079923 3300005336 Bacteria 2696
21 Ga0070689_100420394 3300005340 Bacteria 1133
22 Ga0070668_100102461 3300005347 Bacteria 2270
23 Ga0070668_100108499 3300005347 Bacteria 2208
24 Ga0070669_100003725 3300005353 Bacteria 11006
25 Ga0070669_100276554 3300005353 Bacteria 1344
26 Ga0070675_100000605 3300005354 Bacteria 24695
27 Ga0070675_100005609 3300005354 Bacteria 9608
28 Ga0070675_100014292 3300005354 Bacteria 6258
29 Ga0070671_100056526 3300005355 Bacteria 3264
30 Ga0070671_100146187 3300005355 Bacteria 1995
31 Ga0070671_100371920 3300005355 Bacteria 1221
32 Ga0070674_100111922 3300005356 Bacteria 2006
33 Ga0070673_100027949 3300005364 Bacteria 4189
34 Ga0070673_100399509 3300005364 Bacteria 1229
35 Ga0070688_100071619 3300005365 Bacteria 2219
36 Ga0070659_100134462 3300005366 Bacteria 2010
37 Ga0070659_100384295 3300005366 Bacteria 1183
38 Ga0070709_10000424 3300005434 Bacteria 25604
39 Ga0070709_10002985 3300005434 Bacteria 9106
40 Ga0070714_100003678 3300005435 Bacteria 11483
41 Ga0070714_100013754 3300005435 Bacteria 6490
42 Ga0070713_100030419 3300005436 Bacteria 4288
43 Ga0070713_100129056 3300005436 Bacteria 2227
44 Ga0070710_10001915 3300005437 Bacteria 9853
45 Ga0070711_100001539 3300005439 Bacteria 12700
46 Ga0070678_100002173 3300005456 Bacteria 10652
47 Ga0070678_100084367 3300005456 Bacteria 2418
48 Ga0070678_100140953 3300005456 Bacteria 1929
49 Ga0070662_100217608 3300005457 Bacteria 1522
50 Ga0068867_100020518 3300005459 Bacteria 4709
51 Ga0068867_100142067 3300005459 Bacteria 1877
52 Ga0070685_10255334 3300005466 Bacteria 1163
53 Ga0070707_100276763 3300005468 Bacteria 1631
54 Ga0070698_100216165 3300005471 Bacteria 1851
55 Ga0070698_100406495 3300005471 Bacteria 1295
56 Ga0070697_100196357 3300005536 Bacteria 1714
57 Ga0068853_100130016 3300005539 Bacteria 2253
58 Ga0068853_100573755 3300005539 Bacteria 1070
59 Ga0070672_100000414 3300005543 Bacteria 24728
60 Ga0070695_100401705 3300005545 Bacteria 1039
61 Ga0070665_100075896 3300005548 Bacteria 3368
62 Ga0070665_100273831 3300005548 Bacteria 1690
63 Ga0070665_100518282 3300005548 Bacteria 1204
64 Ga0070704_100041535 3300005549 Bacteria 3175
65 Ga0070664_100051993 3300005564 Bacteria 3469
66 Ga0068856_100400334 3300005614 Bacteria 1393
67 Ga0068852_100008171 3300005616 Bacteria 7686
68 Ga0068852_100211402 3300005616 Bacteria 1840
69 Ga0068864_100008694 3300005618 Bacteria 8378
70 Ga0068864_100033367 3300005618 Bacteria 4376
71 Ga0068864_100047550 3300005618 Bacteria 3686
72 Ga0068864_100136178 3300005618 Bacteria 2211
73 Ga0068864_100176536 3300005618 Bacteria 1951
74 Ga0068861_100061248 3300005719 Bacteria 2887
75 Ga0068861_100095214 3300005719 Bacteria 2358
76 Ga0068851_10028027 3300005834 Bacteria 2780
77 Ga0068851_10159197 3300005834 Bacteria 1239
78 Ga0068851_10173127 3300005834 Bacteria 1192
79 Ga0068870_10085739 3300005840 Bacteria 1751
80 Ga0068870_10091555 3300005840 Bacteria 1701
81 Ga0068863_100003193 3300005841 Bacteria 16207
82 Ga0068863_100082278 3300005841 Bacteria 3050
83 Ga0068863_100350422 3300005841 Bacteria 1438
84 Ga0068858_100402305 3300005842 Bacteria 1316
85 Ga0068860_100000101 3300005843 Bacteria 142856
86 Ga0068860_100116317 3300005843 Bacteria 2558
87 Ga0068860_100362498 3300005843 Bacteria 1428
88 Ga0068862_100032137 3300005844 Bacteria 4434
89 Ga0068862_100172936 3300005844 Bacteria 1934
90 Ga0081455_10005550 3300005937 Bacteria 13809
91 Ga0081455_10045525 3300005937 Bacteria 3817
92 Ga0081455_10055991 3300005937 Bacteria 3351
93 Ga0081540_1002607 3300005983 Bacteria 14656
94 Ga0081540_1002952 3300005983 Bacteria 13657
95 Ga0081540_1015686 3300005983 Bacteria 4783
96 Ga0081539_10000486 3300005985 Bacteria 84009
97 Ga0081539_10000748 3300005985 Bacteria 64594
98 Ga0070717_10016495 3300006028 Bacteria 5727
99 Ga0075368_10009249 3300006042 Bacteria 3541
100 Ga0075364_10014392 3300006051 Bacteria 4887
101 Ga0075364_10140267 3300006051 Bacteria 1625
102 Ga0070715_10001596 3300006163 Bacteria 6680
103 Ga0070715_10071826 3300006163 Bacteria 1548
104 Ga0070716_100003246 3300006173 Bacteria 7637
105 Ga0070716_100008627 3300006173 Bacteria 5065
106 Ga0070712_100012263 3300006175 Bacteria 5448
107 Ga0070712_100127807 3300006175 Bacteria 1922
108 Ga0075367_10087797 3300006178 Bacteria 1889
109 Ga0075369_10009841 3300006186 Bacteria 3727
110 Ga0075366_10045747 3300006195 Bacteria 2593
111 Ga0075366_10159010 3300006195 Bacteria 1369
112 Ga0097621_100102844 3300006237 Bacteria 2406
113 Ga0097621_100344588 3300006237 Bacteria 1324
114 Ga0068871_100084800 3300006358 Bacteria 2629
115 Ga0075428_100014031 3300006844 Bacteria 8916
116 Ga0075428_100218324 3300006844 Bacteria 2059
117 Ga0075430_100133005 3300006846 Bacteria 2073
118 Ga0075431_100005130 3300006847 Bacteria 12882
119 Ga0075434_100183497 3300006871 Bacteria 2113
120 Ga0075429_100022932 3300006880 Bacteria 5412
121 Ga0068865_100325279 3300006881 Bacteria 1238
122 Ga0099825_1027409 3300006941 Bacteria 2900
123 Ga0099824_1002281 3300006942 Bacteria 27988
124 Ga0099823_1064280 3300006944 Bacteria 1807
125 Ga0099823_1064406 3300006944 Bacteria 1801
126 Ga0079104_1000198 3300006946 Bacteria 84522
127 Ga0099794_10017152 3300007265 Bacteria 3223
128 Ga0105240_10129483 3300009093 Bacteria 3029
129 Ga0105240_10207526 3300009093 Bacteria 2292
130 Ga0111539_10079988 3300009094 Bacteria 3845
131 Ga0105245_10144368 3300009098 Bacteria 2245
132 Ga0105247_10022846 3300009101 Bacteria 3768
133 Ga0114129_10029501 3300009147 Bacteria 7770
134 Ga0105241_10053629 3300009174 Bacteria 3084
135 Ga0105241_10060458 3300009174 Bacteria 2915
136 Ga0105237_10006673 3300009545 Bacteria 12756
137 Ga0105237_10055847 3300009545 Bacteria 3954
138 Ga0105237_10443482 3300009545 Bacteria 1304
139 Ga0105238_10077488 3300009551 Bacteria 3315
140 Ga0099796_10029489 3300010159 Bacteria 1771
141 Ga0105239_10037528 3300010375 Bacteria 5309
142 Ga0105239_10091272 3300010375 Bacteria 3361
143 Ga0105239_10141182 3300010375 Bacteria 2684
144 Ga0105239_10160420 3300010375 Bacteria 2512
145 Ga0105239_10266992 3300010375 Bacteria 1924
146 Ga0105246_10034503 3300011119 Bacteria 3373
147 Ga0157370_10289190 3300013104 Bacteria 1514
148 Ga0157378_10001074 3300013297 Bacteria 24973
149 Ga0157378_10433213 3300013297 Bacteria 1302
150 Ga0163162_10015009 3300013306 Bacteria 7566
151 Ga0163162_10732644 3300013306 Bacteria 1109
152 Ga0157375_10020347 3300013308 Bacteria 6060
153 Ga0157375_10556747 3300013308 Bacteria 1308
154 Ga0163163_10016588 3300014325 Bacteria 6850
155 Ga0163163_10022097 3300014325 Bacteria 6017
156 Ga0163163_10054763 3300014325 Bacteria 3941
157 Ga0163163_10132664 3300014325 Bacteria 2531
158 Ga0157380_10032883 3300014326 Bacteria 3991
159 Ga0157380_10148991 3300014326 Bacteria 2020
160 Ga0157380_10323784 3300014326 Bacteria 1430
161 Ga0157379_10096110 3300014968 Bacteria 2659
162 Ga0157379_10231885 3300014968 Bacteria 1673
163 Ga0157379_10587263 3300014968 Bacteria 1039
164 Ga0157376_10039268 3300014969 Bacteria 3859
165 Ga0157376_10136716 3300014969 Bacteria 2194
166 Ga0163161_10039167 3300017792 Bacteria 3401
167 Ga0214544_1000002 3300021320 Bacteria 753857
168 Ga0214542_1000001 3300021321 Bacteria 1018696
169 Ga0214545_1000001 3300021324 Bacteria 1092817
170 Ga0214545_1026202 3300021324 Bacteria 3213
171 Ga0214543_1000001 3300021327 Bacteria 776921
172 Ga0213872_10000001 3300021361 Bacteria 662532
173 Ga0213876_10003361 3300021384 Bacteria 9159
174 Ga0213871_10000559 3300021441 Bacteria 5205
175 Ga0209563_100899 3300025230 Bacteria 8806
176 Ga0209677_100280 3300025253 Bacteria 34034
177 Ga0209677_102333 3300025253 Bacteria 7281
178 Ga0209148_1000500 3300025254 Bacteria 39994
179 Ga0209148_1010747 3300025254 Bacteria 1726
180 Ga0209233_1002090 3300025261 Bacteria 7536
181 Ga0209233_1005160 3300025261 Bacteria 4364
182 Ga0209455_1001166 3300025272 Bacteria 12650
183 Ga0209673_1024009 3300025273 Bacteria 2060
184 Ga0209564_1000097 3300025295 Bacteria 231436
185 Ga0209564_1006369 3300025295 Bacteria 6395
186 Ga0209564_1017192 3300025295 Bacteria 2833
187 Ga0209758_1000024 3300025297 Bacteria 591966
188 Ga0209758_1000068 3300025297 Bacteria 286488
189 Ga0209758_1001533 3300025297 Bacteria 26615
190 Ga0209758_1008784 3300025297 Bacteria 6441
191 Ga0209758_1036964 3300025297 Bacteria 1896
192 Ga0209050_1000082 3300025298 Bacteria 266864
193 Ga0209050_1004407 3300025298 Bacteria 9528
194 Ga0209256_1001900 3300025299 Bacteria 19109
195 Ga0209256_1016592 3300025299 Bacteria 2499
196 Ga0207426_1000238 3300025302 Bacteria 124393
197 Ga0209051_1000029 3300025303 Bacteria 403675
198 Ga0209257_1000030 3300025304 Bacteria 689812
199 Ga0209257_1001149 3300025304 Bacteria 33675
200 Ga0209257_1011659 3300025304 Bacteria 4193
201 Ga0209257_1036359 3300025304 Bacteria 1513
202 Ga0207697_10020544 3300025315 Bacteria 2703
203 Ga0207656_10011260 3300025321 Bacteria 3377
204 Ga0207682_10011775 3300025893 Bacteria 3417
205 Ga0207692_10000318 3300025898 Bacteria 16715
206 Ga0207692_10000738 3300025898 Bacteria 11534
207 Ga0207642_10063039 3300025899 Bacteria 1732
208 Ga0207647_10013481 3300025904 Bacteria 5662
209 Ga0207685_10003083 3300025905 Bacteria 3977
210 Ga0207699_10000465 3300025906 Bacteria 20602
211 Ga0207699_10067812 3300025906 Bacteria 2170
212 Ga0207645_10013062 3300025907 Bacteria 5610
213 Ga0207643_10012934 3300025908 Bacteria 4513
214 Ga0207643_10041091 3300025908 Bacteria 2605
215 Ga0207643_10111752 3300025908 Bacteria 1610
216 Ga0207654_10049797 3300025911 Bacteria 2405
217 Ga0207695_10000008 3300025913 Bacteria 1058268
218 Ga0207671_10003142 3300025914 Bacteria 16765
219 Ga0207693_10003071 3300025915 Bacteria 14397
220 Ga0207693_10003980 3300025915 Bacteria 12554
221 Ga0207693_10022195 3300025915 Bacteria 5045
222 Ga0207663_10001512 3300025916 Bacteria 10861
223 Ga0207662_10069192 3300025918 Bacteria 2133
224 Ga0207649_10414269 3300025920 Bacteria 1011
225 Ga0207646_10304117 3300025922 Bacteria 1441
226 Ga0207681_10044971 3300025923 Bacteria 2961
227 Ga0207681_10119563 3300025923 Bacteria 1930
228 Ga0207694_10346915 3300025924 Bacteria 1228
229 Ga0207650_10000326 3300025925 Bacteria 46321
230 Ga0207650_10000755 3300025925 Bacteria 24847
231 Ga0207650_10038912 3300025925 Bacteria 3475
232 Ga0207659_10000299 3300025926 Bacteria 29997
233 Ga0207659_10003624 3300025926 Bacteria 9300
234 Ga0207687_10083695 3300025927 Bacteria 2310
235 Ga0207700_10195137 3300025928 Bacteria 1703
236 Ga0207664_10019656 3300025929 Bacteria 4997
237 Ga0207664_10089866 3300025929 Bacteria 2516
238 Ga0207644_10001354 3300025931 Bacteria 15752
239 Ga0207644_10343947 3300025931 Bacteria 1210
240 Ga0207690_10204413 3300025932 Bacteria 1502
241 Ga0207706_10033883 3300025933 Bacteria 4546
242 Ga0207706_10100121 3300025933 Bacteria 2550
243 Ga0207670_10054636 3300025936 Bacteria 2695
244 Ga0207670_10118260 3300025936 Bacteria 1922
245 Ga0207704_10008488 3300025938 Bacteria 4918
246 Ga0207704_10018327 3300025938 Bacteria 3652
247 Ga0207665_10002891 3300025939 Bacteria 11523
248 Ga0207665_10008158 3300025939 Bacteria 6912
249 Ga0207691_10000049 3300025940 Bacteria 94813
250 Ga0207691_10000111 3300025940 Bacteria 72961
251 Ga0207711_10209732 3300025941 Bacteria 1779
252 Ga0207711_10258226 3300025941 Bacteria 1601
253 Ga0207667_10068267 3300025949 Bacteria 3702
254 Ga0207651_10000834 3300025960 Bacteria 13379
255 Ga0207651_10018903 3300025960 Bacteria 4115
256 Ga0207651_10149752 3300025960 Bacteria 1815
257 Ga0207651_10372158 3300025960 Bacteria 1209
258 Ga0207668_10025834 3300025972 Bacteria 3806
259 Ga0207668_10037606 3300025972 Bacteria 3241
260 Ga0207668_10070780 3300025972 Bacteria 2489
261 Ga0207640_10100356 3300025981 Bacteria 2028
262 Ga0207658_10287972 3300025986 Bacteria 1411
263 Ga0207677_10013354 3300026023 Bacteria 4756
264 Ga0207703_10490235 3300026035 Bacteria 1152
265 Ga0207639_10170525 3300026041 Bacteria 1843
266 Ga0207678_10043159 3300026067 Bacteria 3903
267 Ga0207678_10090364 3300026067 Bacteria 2617
268 Ga0207702_10021218 3300026078 Bacteria 5376
269 Ga0207641_10009740 3300026088 Bacteria 7915
270 Ga0207641_10112454 3300026088 Bacteria 2416
271 Ga0207641_10138219 3300026088 Bacteria 2195
272 Ga0207641_10161713 3300026088 Bacteria 2036
273 Ga0207641_10396636 3300026088 Bacteria 1324
274 Ga0207641_10416929 3300026088 Bacteria 1292
275 Ga0207648_10002748 3300026089 Bacteria 18702
276 Ga0207648_10016729 3300026089 Bacteria 6692
277 Ga0207648_10098622 3300026089 Bacteria 2558
278 Ga0207676_10032058 3300026095 Bacteria 3957
279 Ga0207676_10130259 3300026095 Bacteria 2137
280 Ga0207676_10252070 3300026095 Bacteria 1589
281 Ga0207676_10319242 3300026095 Bacteria 1425
282 Ga0207674_10081398 3300026116 Bacteria 3240
283 Ga0207675_100037456 3300026118 Bacteria 4524
284 Ga0207675_100089563 3300026118 Bacteria 2892
285 Ga0207683_10016814 3300026121 Bacteria 6225
286 Ga0207683_10173750 3300026121 Bacteria 1952
287 Ga0207683_10294647 3300026121 Bacteria 1484
288 Ga0209281_1000457 3300027111 Bacteria 57515
289 Ga0209389_1000040 3300027296 Bacteria 124256
290 Ga0209489_120706 3300027361 Bacteria 1815
291 Ga0209489_120707 3300027361 Bacteria 1815
292 Ga0209700_100005 3300027363 Bacteria 573969
293 Ga0209813_10065105 3300027866 Bacteria 1173
294 Ga0268266_10482361 3300028379 Bacteria 1182
295 Ga0268265_10083949 3300028380 Bacteria 2524
296 Ga0268264_10000030 3300028381 Bacteria 418542
297 Ga0268264_10031537 3300028381 Bacteria 4344
298 Ga0268264_10210050 3300028381 Bacteria 1786
299 Ga0268264_10251361 3300028381 Bacteria 1642
300 Ga0268264_10332808 3300028381 Bacteria 1440
301 Ga0265337_1001439 3300028556 Bacteria 11715
302 Ga0265326_10001380 3300028558 Bacteria 8553
303 Ga0265319_1002798 3300028563 Bacteria 9365
304 Ga0265334_10005260 3300028573 Bacteria 5665
305 Ga0265318_10003474 3300028577 Bacteria 7906
306 Ga0265323_10000992 3300028653 Bacteria 14760
307 Ga0265322_10002589 3300028654 Bacteria 5560
308 Ga0265336_10000063 3300028666 Bacteria 98413
309 Ga0307517_10000085 3300028786 Bacteria 131200
310 Ga0307517_10043224 3300028786 Bacteria 4806
311 Ga0307515_10000292 3300028794 Bacteria 123160
312 Ga0307515_10000658 3300028794 Bacteria 79766
313 Ga0307515_10006378 3300028794 Bacteria 23616
314 Ga0307515_10027739 3300028794 Bacteria 9660
315 Ga0307515_10094574 3300028794 Bacteria 3690
316 Ga0307515_10165545 3300028794 Bacteria 2231
317 Ga0265338_10000154 3300028800 Bacteria 125708
318 Ga0265324_10001590 3300029957 Bacteria 12642
319 Ga0265332_10007298 3300031238 Bacteria 4999
320 Ga0265328_10037935 3300031239 Bacteria 1779
321 Ga0265325_10002402 3300031241 Bacteria 12664
322 Ga0265340_10020838 3300031247 Bacteria 3363
323 Ga0265339_10025106 3300031249 Bacteria 3425
324 Ga0265331_10055199 3300031250 Bacteria 1890
325 Ga0265316_10206274 3300031344 Bacteria 1455
326 Ga0307509_10104348 3300031507 Bacteria 2859
327 Ga0307509_10139196 3300031507 Bacteria 2366
328 Ga0307509_10149716 3300031507 Bacteria 2252
329 Ga0307508_10000282 3300031616 Bacteria 62510
330 Ga0307508_10009668 3300031616 Bacteria 8854
331 Ga0307508_10014131 3300031616 Bacteria 7284
332 Ga0307508_10092867 3300031616 Bacteria 2607
333 Ga0307508_10188415 3300031616 Bacteria 1664
334 Ga0307508_10279793 3300031616 Bacteria 1262
335 Ga0265314_10053104 3300031711 Bacteria 2812
336 Ga0265342_10023837 3300031712 Bacteria 3867
337 Ga0265342_10057119 3300031712 Bacteria 2311
338 Ga0307516_10009880 3300031730 Bacteria 10581
339 Ga0307516_10052275 3300031730 Bacteria 3999
340 Ga0307516_10098215 3300031730 Bacteria 2747
341 Ga0307516_10227071 3300031730 Bacteria 1573
342 Ga0307516_10345143 3300031730 Bacteria 1155
343 Ga0307405_10008218 3300031731 Bacteria 5278
344 Ga0307413_10002493 3300031824 Bacteria 7503
345 Ga0307407_10093220 3300031903 Bacteria 1851
346 Ga0307412_10004520 3300031911 Bacteria 7750
347 Ga0307414_10009478 3300032004 Bacteria 5596
348 Ga0307411_10003401 3300032005 Bacteria 7374
349 Ga0307411_10165481 3300032005 Bacteria 1662
350 Ga0307415_100060832 3300032126 Bacteria 2612
351 Ga0307507_10091082 3300033179 Bacteria 2613
352 Ga0307507_10155690 3300033179 Bacteria 1704
353 Ga0307510_10086514 3300033180 Bacteria 3006
354 Ga0316215_1000817 3300033544 Bacteria 3121
355 Ga0373934_0013228 3300035086 Bacteria 3118
356 Ga0373923_0008179 3300035111 Bacteria 3716
357 Ga0373923_0036844 3300035111 Bacteria 1999
358 Ga0373923_0143927 3300035111 Bacteria 1079
359 Ga0373936_0001944 3300035113 Bacteria 7639
360 Ga0373953_0000542 3300035117 Bacteria 10471
361 Ga0373953_0006315 3300035117 Bacteria 3899
362 Ga0373953_0110086 3300035117 Bacteria 1164
363 Ga0373954_0000323 3300035118 Bacteria 17518
364 Ga0373956_0009107 3300035119 Bacteria 4026
365 Ga0373956_0018340 3300035119 Bacteria 2962
366 Ga0373957_0002539 3300035120 Bacteria 5230
367 Ga0373957_0037806 3300035120 Bacteria 1804
368 Ga0373943_0005734 3300035170 Bacteria 5571
369 Ga0373955_0003057 3300035172 Bacteria 7328
370 Ga0373955_0078810 3300035172 Bacteria 1857
371 Ga0373924_0011712 3300035410 Bacteria 3262
372 Ga0373935_0005504 3300035692 Bacteria 7459
373 Ga0373927_0001069 3300035695 Bacteria 20955
374 Ga0373927_0010672 3300035695 Bacteria 6119
375 Ga0373927_0028676 3300035695 Bacteria 3631
376 Ga0373933_0001324 3300035724 Bacteria 14581
377 Ga0373947_0007770 3300035725 Bacteria 6196
378 Ga0373947_0030133 3300035725 Bacteria 3187
379 Ga0373947_0063015 3300035725 Bacteria 2258
380 Ga0373937_0007329 3300036401 Bacteria 9549
381 Ga0373937_0027340 3300036401 Bacteria 5158
382 Ga0373937_0049474 3300036401 Bacteria 3849
383 Ga0373937_0087326 3300036401 Bacteria 2886
384 Ga0373925_0003237 3300037068 Bacteria 12714
385 Ga0373925_0004343 3300037068 Bacteria 10729
386 Ga0395900_0001802 3300037418 Bacteria 24563
387 Ga0395898_0002995 3300037466 Bacteria 19169
388 Ga0395898_0211261 3300037466 Bacteria 1851
389 Ga0395905_0044603 3300037471 Bacteria 4161
390 Ga0395905_0098471 3300037471 Bacteria 2746
391 Ga0395905_0155856 3300037471 Bacteria 2148
392 Ga0436365_0263215 3300039437 Bacteria 999
393 Ga0436365_0619230 3300039437 Bacteria 1498
394 Ga0436365_1549030 3300039437 Bacteria 8562
395 Ga0436360_0271985 3300039438 Bacteria 4245
396 Ga0436360_0376160 3300039438 Bacteria 1895
397 Ga0436361_0028664 3300039447 Bacteria 69721
398 Ga0436361_0833650 3300039447 Bacteria 10674
399 Ga0436362_1138875 3300039453 Bacteria 1147
400 Ga0450919_001148 3300042121 Bacteria 3442
401 Ga0450918_005595 3300042531 Bacteria 2254
402 Ga0450893_0014757 3300042532 Bacteria 1313
403 Ga0451577_0226677 3300042876 Bacteria 1689
404 Ga0451577_0302852 3300042876 Bacteria 1448
405 Ga0466972_0000122 3300044658 Bacteria 65679
406 Ga0466966_0000599 3300044684 Bacteria 22829
407 Ga0466966_0009768 3300044684 Bacteria 6359
408 Ga0466966_0062349 3300044684 Bacteria 2351
409 Ga0466961_0000038 3300044693 Bacteria 80721
410 Ga0466963_0026664 3300044694 Bacteria 3696
411 Ga0466963_0144072 3300044694 Bacteria 1652
412 Ga0453684_0037503 3300044712 Bacteria 6651
413 Ga0453684_0197961 3300044712 Bacteria 2344
414 Ga0466971_0089726 3300044719 Bacteria 1407
415 Ga0466970_0209385 3300044765 Bacteria 1086
416 Ga0466960_0029269 3300044901 Bacteria 2527
417 Ga0466959_0000493 3300045049 Bacteria 22980
418 Ga0466959_0108206 3300045049 Bacteria 1986
419 Ga0451576_0020692 3300045051 Bacteria 7160
420 Ga0451576_0317332 3300045051 Bacteria 1630
421 Ga0451576_0478722 3300045051 Bacteria 1308
422 Ga0466958_0010717 3300045836 Bacteria 5141
423 Ga0495592_0002287 3300046454 Bacteria 13506
424 Ga0495592_0019534 3300046454 Bacteria 5154
425 Ga0495592_0020984 3300046454 Bacteria 4968
426 Ga0495603_0000064 3300046455 Bacteria 46716
427 Ga0495603_0031445 3300046455 Bacteria 3195
428 Ga0495603_0072564 3300046455 Bacteria 2022
429 Ga0495590_0073441 3300046457 Bacteria 1202
430 Ga0495629_0001770 3300046459 Bacteria 16944
431 Ga0495629_0013834 3300046459 Bacteria 5822
432 Ga0495629_0045225 3300046459 Bacteria 3089
433 Ga0495629_0059855 3300046459 Bacteria 2662
434 Ga0495638_0013480 3300046460 Bacteria 5564
435 Ga0495638_0017406 3300046460 Bacteria 4791
436 Ga0495638_0072038 3300046460 Bacteria 2112
437 Ga0495638_0130066 3300046460 Bacteria 1480
438 Ga0495641_0004409 3300046461 Bacteria 9961
439 Ga0495651_0029648 3300046462 Bacteria 4266
440 Ga0495651_0134345 3300046462 Bacteria 1802
441 Ga0495651_0155022 3300046462 Bacteria 1647
442 Ga0495653_0014349 3300046463 Bacteria 6463
443 Ga0495653_0058227 3300046463 Bacteria 2938
444 Ga0495653_0296414 3300046463 Bacteria 1056
445 Ga0495650_0035553 3300046471 Bacteria 2192
446 Ga0495580_0002618 3300046472 Bacteria 15620
447 Ga0495582_0000197 3300046473 Bacteria 33437
448 Ga0495605_0081142 3300046474 Bacteria 1517
449 Ga0495639_0001620 3300046475 Bacteria 10038
450 Ga0495639_0057030 3300046475 Bacteria 1784
451 Ga0495662_0012317 3300046476 Bacteria 4174
452 Ga0495664_0011941 3300046477 Bacteria 4907
453 Ga0495664_0017512 3300046477 Bacteria 4098
454 Ga0495664_0058506 3300046477 Bacteria 2293
455 Ga0495594_0004585 3300046499 Bacteria 7112
456 Ga0495607_0032563 3300046501 Bacteria 3180
457 Ga0495606_0009544 3300046507 Bacteria 8193
458 Ga0495608_0017164 3300046511 Bacteria 5010
459 Ga0495608_0098523 3300046511 Bacteria 1886
460 Ga0495610_0017485 3300046512 Bacteria 4086
461 Ga0495610_0030159 3300046512 Bacteria 2846
462 Ga0495616_0019159 3300046513 Bacteria 3738
463 Ga0495616_0026871 3300046513 Bacteria 3057
464 Ga0495616_0055709 3300046513 Bacteria 1956
465 Ga0495618_0040481 3300046514 Bacteria 2933
466 Ga0495620_0039154 3300046515 Bacteria 2098
467 Ga0495620_0077632 3300046515 Bacteria 1348
468 Ga0495628_0009719 3300046516 Bacteria 8205
469 Ga0495628_0023166 3300046516 Bacteria 5099
470 Ga0495628_0049588 3300046516 Bacteria 3324
471 Ga0495628_0078071 3300046516 Bacteria 2575
472 Ga0495628_0103450 3300046516 Bacteria 2196
473 Ga0495630_0005383 3300046517 Bacteria 9031
474 Ga0495630_0064425 3300046517 Bacteria 2754
475 Ga0495632_0002332 3300046519 Bacteria 14575
476 Ga0495643_0000028 3300046522 Bacteria 262886
477 Ga0495643_0000154 3300046522 Bacteria 112250
478 Ga0495648_0000378 3300046524 Bacteria 48799
479 Ga0495648_0083840 3300046524 Bacteria 1805
480 Ga0495666_0069193 3300046526 Bacteria 1680
481 Ga0495652_0002605 3300046529 Bacteria 18448
482 Ga0495652_0033439 3300046529 Bacteria 4489
483 Ga0495652_0040068 3300046529 Bacteria 4049
484 Ga0495652_0335035 3300046529 Bacteria 1089
485 Ga0495654_0063349 3300046530 Bacteria 1770
486 Ga0495665_0000902 3300046531 Bacteria 15623
487 Ga0495640_0001505 3300046533 Bacteria 18356
488 Ga0495640_0282585 3300046533 Bacteria 1033
489 Ga0495587_0003463 3300046536 Bacteria 10519
490 Ga0495587_0005573 3300046536 Bacteria 8216
491 Ga0495587_0095686 3300046536 Bacteria 1714
492 Ga0495645_0005537 3300046543 Bacteria 8684
493 Ga0495645_0166188 3300046543 Bacteria 1521
494 Ga0495645_0246961 3300046543 Bacteria 1188
495 Ga0495622_0001436 3300046557 Bacteria 12023
496 Ga0495622_0076382 3300046557 Bacteria 1543
497 Ga0495633_0154965 3300046558 Bacteria 1058
498 Ga0495667_0027335 3300046559 Bacteria 3845
499 Ga0495668_0000018 3300046616 Bacteria 417480
500 Ga0495634_0010535 3300046642 Bacteria 6768
501 Ga0495634_0042942 3300046642 Bacteria 3065
502 Ga0495634_0066175 3300046642 Bacteria 2393
503 Ga0495625_0011369 3300046660 Bacteria 7264
504 Ga0495625_0132418 3300046660 Bacteria 1688
505 Ga0495635_0000356 3300046663 Bacteria 29094
506 Ga0495635_0006348 3300046663 Bacteria 8242
507 Ga0495635_0011988 3300046663 Bacteria 6074
508 Ga0495635_0101394 3300046663 Bacteria 1967
509 Ga0495661_0003126 3300046665 Bacteria 12410
510 Ga0495588_0000619 3300046674 Bacteria 16696
511 Ga0495657_0005167 3300046675 Bacteria 10338
512 Ga0495657_0015234 3300046675 Bacteria 5628
513 Ga0495657_0028025 3300046675 Bacteria 3966
514 Ga0495657_0040051 3300046675 Bacteria 3216
515 Ga0495599_0004863 3300046678 Bacteria 7993
516 Ga0495599_0015026 3300046678 Bacteria 4799
517 Ga0495623_0005974 3300046679 Bacteria 7930
518 Ga0495623_0006437 3300046679 Bacteria 7639
519 Ga0495623_0023347 3300046679 Bacteria 3992
520 Ga0495623_0216694 3300046679 Bacteria 1093
521 Ga0495647_0032237 3300046681 Bacteria 1952
522 Ga0495658_0003461 3300046683 Bacteria 7799
523 Ga0495658_0168364 3300046683 Bacteria 1355
524 Ga0495658_0175248 3300046683 Bacteria 1329
525 Ga0495613_0004786 3300046689 Bacteria 10156
526 Ga0495613_0050119 3300046689 Bacteria 3080
527 Ga0495613_0082180 3300046689 Bacteria 2340
528 Ga0495613_0095414 3300046689 Bacteria 2151
529 Ga0495624_0001264 3300046690 Bacteria 19934
530 Ga0495624_0117150 3300046690 Bacteria 1637
531 Ga0495624_0122366 3300046690 Bacteria 1597
532 Ga0495624_0130500 3300046690 Bacteria 1541
533 Ga0495670_0042520 3300046691 Bacteria 2267
534 Ga0495670_0069276 3300046691 Bacteria 1783
535 Ga0495649_0004059 3300046694 Bacteria 9640
536 Ga0495649_0110439 3300046694 Bacteria 1458
537 Ga0495649_0165016 3300046694 Bacteria 1161
538 Ga0495600_0002461 3300046809 Bacteria 10629
539 Ga0495600_0219719 3300046809 Bacteria 1215
540 Ga0495581_0002800 3300047315 Bacteria 9952
541 Ga0495604_0001823 3300047317 Bacteria 17347
542 Ga0495604_0134073 3300047317 Bacteria 1777
543 Ga0495674_0006598 3300047319 Bacteria 11129
544 Ga0495674_0031441 3300047319 Bacteria 4822
545 Ga0495674_0048317 3300047319 Bacteria 3766
546 Ga0495672_0000334 3300047320 Bacteria 61678
547 Ga0495672_0073895 3300047320 Bacteria 1921
548 Ga0495676_0021005 3300047321 Bacteria 5714
549 Ga0495680_0001849 3300047322 Bacteria 22313
550 Ga0495680_0052683 3300047322 Bacteria 3171
551 Ga0495687_025876 3300047443 Bacteria 2767
552 Ga0495675_0003845 3300047444 Bacteria 9091
553 Ga0495675_0039960 3300047444 Bacteria 2988
554 Ga0495675_0061183 3300047444 Bacteria 2386
555 Ga0495681_0029025 3300047470 Bacteria 2837
556 Ga0495684_0005498 3300047471 Bacteria 9863
557 Ga0495686_0003011 3300047472 Bacteria 14965
558 Ga0495686_0063829 3300047472 Bacteria 2281
559 Ga0495686_0124365 3300047472 Bacteria 1534
560 Ga0495686_0153016 3300047472 Bacteria 1353
561 Ga0495593_0000053 3300047673 Bacteria 47697
562 Ga0495593_0013232 3300047673 Bacteria 4709
563 Ga0495602_0007968 3300048088 Bacteria 11068
564 Ga0495602_0098093 3300048088 Bacteria 2412
565 Ga0495626_0044465 3300048091 Bacteria 2078
566 Ga0496101_0210547 3300048904 Bacteria 1506
567 Ga0496102_0414190 3300048905 Bacteria 1266
568 Ga0496103_0007011 3300048906 Bacteria 6725
569 Ga0496105_0138223 3300048908 Bacteria 2006
570 Ga0496106_0019847 3300048909 Bacteria 4983
571 Ga0496107_0134265 3300048910 Bacteria 1828
572 Ga0496108_0198992 3300048911 Bacteria 1738
573 Ga0496110_0315309 3300048913 Bacteria 1424
574 Ga0496110_0536894 3300048913 Bacteria 1063
575 Ga0496112_0000008 3300048915 Bacteria 310323
576 Ga0496112_0054466 3300048915 Bacteria 3930
577 Ga0496112_0089508 3300048915 Bacteria 3046
578 Ga0496112_0110949 3300048915 Bacteria 2713
579 Ga0496113_0227412 3300048916 Bacteria 1487
580 Ga0496114_0253732 3300048917 Bacteria 1548
581 Ga0496115_0058173 3300048918 Bacteria 3110
582 Ga0496115_0185666 3300048918 Bacteria 1718
583 Ga0496115_0290106 3300048918 Bacteria 1342
584 Ga0496116_0005652 3300048919 Bacteria 11511
585 Ga0496117_0010555 3300048920 Bacteria 8399
586 Ga0496117_0025985 3300048920 Bacteria 4591
587 Ga0496118_0004640 3300048921 Bacteria 16123
588 Ga0496118_0014868 3300048921 Bacteria 7250
589 Ga0496118_0040296 3300048921 Bacteria 3716
590 Ga0496118_0060895 3300048921 Bacteria 2799
591 Ga0496118_0073574 3300048921 Bacteria 2447
592 Ga0496118_0140636 3300048921 Bacteria 1530
593 Ga0496119_0077897 3300048922 Bacteria 1919
594 Ga0496119_0104743 3300048922 Bacteria 1581
595 Ga0496120_0022584 3300048923 Bacteria 3956
596 Ga0496120_0092531 3300048923 Bacteria 1612
597 Ga0496121_0000089 3300048924 Bacteria 219007
598 Ga0496121_0011201 3300048924 Bacteria 9994
599 Ga0496121_0024792 3300048924 Bacteria 5721
600 Ga0496121_0029753 3300048924 Bacteria 5037
601 Ga0496121_0115615 3300048924 Bacteria 2036
602 Ga0496121_0332555 3300048924 Bacteria 1018
603 Ga0496123_0101772 3300048926 Bacteria 1669
604 Ga0496123_0141288 3300048926 Bacteria 1316
605 Ga0496124_0089884 3300048927 Bacteria 2506
606 Ga0496125_0000712 3300048928 Bacteria 54983
607 Ga0496125_0000998 3300048928 Bacteria 44135
608 Ga0496125_0002472 3300048928 Bacteria 23972
609 Ga0496125_0014974 3300048928 Bacteria 7530
610 Ga0496125_0053668 3300048928 Bacteria 3302
611 Ga0496125_0070584 3300048928 Bacteria 2734
612 Ga0496125_0089835 3300048928 Bacteria 2308
613 Ga0496126_0003551 3300048929 Bacteria 19610
614 Ga0496126_0015357 3300048929 Bacteria 7703
615 Ga0496126_0044288 3300048929 Bacteria 4099
616 Ga0496126_0067644 3300048929 Bacteria 3192
617 Ga0496126_0235865 3300048929 Bacteria 1530
618 Ga0495678_001099 3300049459 Bacteria 22809
619 Ga0495682_0026552 3300049460 Bacteria 2149
620 Ga0501031_0001824 3300049568 Bacteria 13399
621 Ga0501043_0000053 3300049579 Bacteria 106085
622 Ga0501046_0000018 3300049580 Bacteria 220589
623 Ga0501047_0000020 3300049581 Bacteria 259377
624 Ga0501048_0000795 3300049582 Bacteria 23148
625 Ga0501045_0040544 3300049824 Bacteria 3387
626 nmdc:mga00v17_23838_c2 3300050491 Bacteria 1115
627 nmdc:mga00v17_27496_c1 3300050491 Bacteria 3321
628 nmdc:mga0k408_143779_c1 3300050493 Bacteria 1419
629 nmdc:mga04h51_16669_c1 3300050495 Bacteria 2136
630 nmdc:mga05p37_483940_c1 3300050507 Bacteria 1425
631 nmdc:mga09592_23749_c1 3300050508 Bacteria 5065
632 nmdc:mga06r32_36396_c1 3300050510 Bacteria 4650
633 nmdc:mga08y16_360566_c1 3300050511 Bacteria 1492
634 nmdc:mga0n895_295120_c1 3300050512 Bacteria 1643
635 nmdc:mga0sz30_13929_c1 3300050516 Bacteria 3157
636 nmdc:mga0sz30_4243_c1 3300050516 Bacteria 5170
637 Ga0495601_0036848 3300053077 Bacteria 3057
638 Ga0500635_0001318 3300053080 Bacteria 5936
639 Ga0495655_0041617 3300053083 Bacteria 1176
640 Ga0495595_0011955 3300053084 Bacteria 3640
641 Ga0495595_0029905 3300053084 Bacteria 2440
642 Ga0495619_0010048 3300053085 Bacteria 5957
643 Ga0495619_0154638 3300053085 Bacteria 1582
644 Ga0500578_0023708 3300053086 Bacteria 3939
645 Ga0500578_0068019 3300053086 Bacteria 2271
646 Ga0500643_000035 3300053087 Bacteria 184794
647 Ga0500643_015424 3300053087 Bacteria 2622
648 Ga0500644_0007939 3300053088 Bacteria 2782
649 Ga0500646_0014801 3300053090 Bacteria 2027
650 Ga0500646_0015845 3300053090 Bacteria 1965
651 Ga0500583_0051280 3300053092 Bacteria 1916
652 Ga0500651_0069288 3300053093 Bacteria 2196
653 Ga0500566_0000008 3300053094 Bacteria 143641
654 Ga0500566_0000134 3300053094 Bacteria 37799
655 Ga0500566_0001026 3300053094 Bacteria 16124
656 Ga0500640_000524 3300053095 Bacteria 9654
657 Ga0500641_0018888 3300053096 Bacteria 2599
658 Ga0500650_0001241 3300053098 Bacteria 7511
659 Ga0500650_0122758 3300053098 Bacteria 1210
660 Ga0500555_004027 3300053103 Bacteria 4175
661 Ga0500556_0000015 3300053104 Bacteria 202598
662 Ga0500569_001583 3300053109 Bacteria 4316
663 Ga0500569_004280 3300053109 Bacteria 2991
664 Ga0500572_000555 3300053111 Bacteria 12715
665 Ga0500592_004269 3300053116 Bacteria 2281
666 Ga0500594_0028887 3300053118 Bacteria 1446
667 Ga0500595_036315 3300053119 Bacteria 1615
668 Ga0500608_013977 3300053122 Bacteria 3571
669 Ga0500608_148689 3300053122 Bacteria 1029
670 Ga0500614_000179 3300053123 Bacteria 16305
671 Ga0500614_022979 3300053123 Bacteria 1461
672 Ga0500642_0000019 3300053130 Bacteria 159944
673 Ga0500642_0007766 3300053130 Bacteria 3624
674 Ga0500652_001339 3300053131 Bacteria 7709
675 Ga0500658_0098688 3300053134 Bacteria 1272
676 Ga0500559_0000396 3300053136 Bacteria 31631
677 Ga0500559_0008637 3300053136 Bacteria 4454
678 Ga0500568_0003619 3300053139 Bacteria 8534
679 Ga0500568_0037549 3300053139 Bacteria 1964
680 Ga0500577_0000068 3300053142 Bacteria 23514
681 Ga0500603_000033 3300053150 Bacteria 33766
682 Ga0500603_002208 3300053150 Bacteria 4292
683 Ga0500604_0012463 3300053151 Bacteria 2295
684 Ga0500616_0000041 3300053153 Bacteria 359328
685 Ga0500619_059060 3300053154 Bacteria 1258
686 Ga0500622_0001685 3300053156 Bacteria 17214
687 Ga0500622_0011733 3300053156 Bacteria 4762
688 Ga0500622_0011913 3300053156 Bacteria 4728
689 Ga0500627_0033816 3300053158 Bacteria 2163
690 Ga0500630_000238 3300053159 Bacteria 21843
691 Ga0500638_005827 3300053162 Bacteria 4968
692 Ga0500638_026391 3300053162 Bacteria 2783
693 Ga0500639_000010 3300053163 Bacteria 136747
694 Ga0500636_0000616 3300053177 Bacteria 19257
695 Ga0500636_0001217 3300053177 Bacteria 13893
696 Ga0500636_0093439 3300053177 Bacteria 1720
697 Ga0500636_0140182 3300053177 Bacteria 1338
698 Ga0500637_0035169 3300053178 Bacteria 2807
699 Ga0500637_0040863 3300053178 Bacteria 2620
700 Ga0500625_044318 3300053729 Bacteria 2081
701 Ga0500645_007452 3300053730 Bacteria 3808
702 Ga0500552_011830 3300053733 Bacteria 1104
703 Ga0500596_002070 3300053735 Bacteria 3997
704 Ga0500599_002692 3300053736 Bacteria 2142
705 Ga0500601_000029 3300053737 Bacteria 32037
706 Ga0466962_0091600 3300061719 Bacteria 1457

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046679 Ga0495623_0216694 Ga0495623_0216694_27_803 238
2 3300042876 Ga0451577_0302852 Ga0451577_0302852_71_985 253
3 3300028379 Ga0268266_10482361 Ga0268266_104823612 255
4 3300050493 nmdc:mga0k408_143779_c1 nmdc:mga0k408_143779_c1_222_1118 257
5 iso_pu_bacteria 2524023228 2524539203 259
6 3300046524 Ga0495648_0000378 Ga0495648_0000378_22585_23508 261
7 iso_pu_bacteria 8019530166 8019534233 261
8 3300028794 Ga0307515_10000292 Ga0307515_100002927 262
9 3300006844 Ga0075428_100014031 Ga0075428_1000140312 263
10 3300006846 Ga0075430_100133005 Ga0075430_1001330053 263
11 3300006847 Ga0075431_100005130 Ga0075431_10000513010 263
12 3300006880 Ga0075429_100022932 Ga0075429_1000229324 263
13 3300009147 Ga0114129_10029501 Ga0114129_100295018 263
14 3300050507 nmdc:mga05p37_483940_c1 nmdc:mga05p37_483940_c1_385_1308 263
15 3300050508 nmdc:mga09592_23749_c1 nmdc:mga09592_23749_c1_2723_3646 263
16 3300050510 nmdc:mga06r32_36396_c1 nmdc:mga06r32_36396_c1_2397_3320 263
17 3300013297 Ga0157378_10001074 Ga0157378_100010747 264
18 3300005340 Ga0070689_100420394 Ga0070689_1004203942 265
19 3300026116 Ga0207674_10081398 Ga0207674_100813983 265
20 iso_pu_bacteria 2847939898 2847946902 266
21 3300010159 Ga0099796_10029489 Ga0099796_100294892 267
22 3300046536 Ga0495587_0095686 Ga0495587_0095686_22_873 268
23 3300053087 Ga0500643_000035 Ga0500643_000035_171009_171926 269
24 3300005436 Ga0070713_100030419 Ga0070713_1000304192 270
25 3300046694 Ga0495649_0110439 Ga0495649_0110439_591_1445 270
26 3300005844 Ga0068862_100032137 Ga0068862_1000321374 271
27 3300009094 Ga0111539_10079988 Ga0111539_100799883 271
28 3300025936 Ga0207670_10118260 Ga0207670_101182602 271
29 3300025960 Ga0207651_10372158 Ga0207651_103721581 271
30 3300028794 Ga0307515_10006378 Ga0307515_1000637810 271
31 3300033179 Ga0307507_10155690 Ga0307507_101556902 271
32 3300046694 Ga0495649_0165016 Ga0495649_0165016_100_1038 271
33 3300050511 nmdc:mga08y16_360566_c1 nmdc:mga08y16_360566_c1_548_1435 271
34 3300005262 Ga0065165_1002832 Ga0065165_10028326 272
35 3300005937 Ga0081455_10055991 Ga0081455_100559913 272
36 3300037466 Ga0395898_0211261 Ga0395898_0211261_378_1238 272
37 3300037471 Ga0395905_0098471 Ga0395905_0098471_1419_2279 272
38 3300045051 Ga0451576_0317332 Ga0451576_0317332_468_1361 272
39 3300053088 Ga0500644_0007939 Ga0500644_0007939_31_930 272
40 3300053730 Ga0500645_007452 Ga0500645_007452_2094_2993 272
41 iso_pu_bacteria 2511231002 2511243183 272
42 3300005983 Ga0081540_1002607 Ga0081540_10026077 273
43 3300014968 Ga0157379_10231885 Ga0157379_102318852 273
44 3300028381 Ga0268264_10210050 Ga0268264_102100502 273
45 3300048924 Ga0496121_0115615 Ga0496121_0115615_306_1229 273
46 iso_pu_bacteria 2513237094 2513640555 273
47 3300026035 Ga0207703_10490235 Ga0207703_104902352 274
48 3300005841 Ga0068863_100350422 Ga0068863_1003504222 276
49 3300005843 Ga0068860_100000101 Ga0068860_10000010167 276
50 3300028380 Ga0268265_10083949 Ga0268265_100839492 276
51 3300028381 Ga0268264_10000030 Ga0268264_10000030163 276
52 3300044684 Ga0466966_0009768 Ga0466966_0009768_1015_1887 276
53 3300046616 Ga0495668_0000018 Ga0495668_0000018_172369_173292 276
54 3300046809 Ga0495600_0219719 Ga0495600_0219719_292_1179 276
55 3300061719 Ga0466962_0091600 Ga0466962_0091600_335_1207 276
56 3300005456 Ga0070678_100140953 Ga0070678_1001409532 277
57 3300026121 Ga0207683_10173750 Ga0207683_101737502 277
58 3300031731 Ga0307405_10008218 Ga0307405_100082182 277
59 3300026088 Ga0207641_10416929 Ga0207641_104169292 278
60 3300053090 Ga0500646_0015845 Ga0500646_0015845_304_1224 279
61 3300048918 Ga0496115_0058173 Ga0496115_0058173_75_1007 280
62 3300044694 Ga0466963_0144072 Ga0466963_0144072_340_1254 281
63 3300046455 Ga0495603_0072564 Ga0495603_0072564_139_1074 281
64 3300053080 Ga0500635_0001318 Ga0500635_0001318_3916_4851 281
65 3300053150 Ga0500603_002208 Ga0500603_002208_793_1728 281
66 3300028786 Ga0307517_10043224 Ga0307517_100432245 282
67 3300033544 Ga0316215_1000817 Ga0316215_10008172 282
68 3300028794 Ga0307515_10000658 Ga0307515_1000065856 284
69 3300045836 Ga0466958_0010717 Ga0466958_0010717_896_1792 284
70 3300010375 Ga0105239_10037528 Ga0105239_100375285 285
71 3300014326 Ga0157380_10323784 Ga0157380_103237842 285
72 3300035111 Ga0373923_0008179 Ga0373923_0008179_2481_3410 285
73 3300035113 Ga0373936_0001944 Ga0373936_0001944_219_1148 285
74 3300035117 Ga0373953_0110086 Ga0373953_0110086_170_1099 285
75 3300035170 Ga0373943_0005734 Ga0373943_0005734_4142_5071 285
76 3300035172 Ga0373955_0078810 Ga0373955_0078810_471_1400 285
77 3300035692 Ga0373935_0005504 Ga0373935_0005504_29_958 285
78 3300035695 Ga0373927_0001069 Ga0373927_0001069_14961_15890 285
79 3300035725 Ga0373947_0007770 Ga0373947_0007770_3567_4496 285
80 3300037068 Ga0373925_0003237 Ga0373925_0003237_3345_4274 285
81 3300037068 Ga0373925_0004343 Ga0373925_0004343_6679_7587 285
82 3300046454 Ga0495592_0019534 Ga0495592_0019534_2583_3512 285
83 3300046455 Ga0495603_0000064 Ga0495603_0000064_40516_41445 285
84 3300046459 Ga0495629_0001770 Ga0495629_0001770_9200_10129 285
85 3300046461 Ga0495641_0004409 Ga0495641_0004409_1267_2196 285
86 3300046463 Ga0495653_0296414 Ga0495653_0296414_24_953 285
87 3300046472 Ga0495580_0002618 Ga0495580_0002618_9137_10066 285
88 3300046473 Ga0495582_0000197 Ga0495582_0000197_8725_9654 285
89 3300046475 Ga0495639_0001620 Ga0495639_0001620_4129_5058 285
90 3300046476 Ga0495662_0012317 Ga0495662_0012317_1374_2303 285
91 3300046477 Ga0495664_0011941 Ga0495664_0011941_295_1224 285
92 3300046499 Ga0495594_0004585 Ga0495594_0004585_1221_2150 285
93 3300046517 Ga0495630_0005383 Ga0495630_0005383_6142_7071 285
94 3300046526 Ga0495666_0069193 Ga0495666_0069193_724_1653 285
95 3300046529 Ga0495652_0040068 Ga0495652_0040068_2088_3017 285
96 3300046531 Ga0495665_0000902 Ga0495665_0000902_7788_8717 285
97 3300046533 Ga0495640_0001505 Ga0495640_0001505_7090_8019 285
98 3300046557 Ga0495622_0001436 Ga0495622_0001436_1137_2066 285
99 3300046559 Ga0495667_0027335 Ga0495667_0027335_2373_3302 285
100 3300046663 Ga0495635_0000356 Ga0495635_0000356_7519_8448 285
101 3300046674 Ga0495588_0000619 Ga0495588_0000619_11500_12429 285
102 3300046683 Ga0495658_0003461 Ga0495658_0003461_6106_7035 285
103 3300046689 Ga0495613_0004786 Ga0495613_0004786_4161_5090 285
104 3300046690 Ga0495624_0001264 Ga0495624_0001264_5553_6482 285
105 3300047315 Ga0495581_0002800 Ga0495581_0002800_5534_6463 285
106 3300047319 Ga0495674_0006598 Ga0495674_0006598_787_1716 285
107 3300047321 Ga0495676_0021005 Ga0495676_0021005_4223_5152 285
108 3300047673 Ga0495593_0000053 Ga0495593_0000053_40386_41315 285
109 3300053085 Ga0495619_0154638 Ga0495619_0154638_313_1242 285
110 3300005295 Ga0065707_10084750 Ga0065707_100847505 286
111 3300021361 Ga0213872_10000001 Ga0213872_10000001214 286
112 3300039447 Ga0436361_0028664 Ga0436361_0028664_59510_60427 286
113 iso_pu_bacteria 2513237139 2513873111 286
114 iso_pu_bacteria 2513237161 2514016548 286
115 iso_pu_bacteria 2617270735 2617347023 286
116 iso_pu_bacteria 2791355196 2793062622 286
117 iso_pu_bacteria 2802429603 2805914990 286
118 iso_pu_bacteria 2824671348 2824672012 286
119 iso_pu_bacteria 2824687955 2824688611 286
120 iso_pu_bacteria 2824696289 2824697150 286
121 iso_pu_bacteria 2824704595 2824705279 286
122 iso_pu_bacteria 2824753945 2824754347 286
123 iso_pu_bacteria 2824763712 2824767846 286
124 iso_pu_bacteria 2824773399 2824775276 286
125 iso_pu_bacteria 2838122688 2838123378 286
126 iso_pu_bacteria 2841941048 2841946671 286
127 iso_pu_bacteria 2841949485 2841954095 286
128 iso_pu_bacteria 2841966195 2841969473 286
129 iso_pu_bacteria 2841974524 2841974644 286
130 iso_pu_bacteria 2841983080 2841983798 286
131 iso_pu_bacteria 2844315083 2844319386 286
132 iso_pu_bacteria 2874620515 2874626382 286
133 iso_pu_bacteria 2885366525 2885369237 286
134 iso_pu_bacteria 2885409591 2885413340 286
135 iso_pu_bacteria 2903727486 2903734327 286
136 iso_pu_bacteria 2904666416 2904671721 286
137 iso_pu_bacteria 2904711408 2904715070 286
138 iso_pu_bacteria 2906602504 2906605572 286
139 iso_pu_bacteria 3005506211 3005510647 286
140 iso_pu_bacteria 3005594810 3005599582 286
141 iso_pu_bacteria 3005710791 3005715240 286
142 iso_pu_bacteria 3005718088 3005722624 286
143 iso_pu_bacteria 8019648815 8019658899 286
144 iso_pu_bacteria 8056967851 8056968376 286
145 3300005353 Ga0070669_100276554 Ga0070669_1002765542 287
146 3300005354 Ga0070675_100014292 Ga0070675_1000142924 287
147 3300006195 Ga0075366_10045747 Ga0075366_100457472 287
148 3300006844 Ga0075428_100218324 Ga0075428_1002183241 287
149 3300013306 Ga0163162_10015009 Ga0163162_100150096 287
150 3300013308 Ga0157375_10020347 Ga0157375_100203476 287
151 3300014325 Ga0163163_10054763 Ga0163163_100547632 287
152 3300014326 Ga0157380_10148991 Ga0157380_101489912 287
153 3300025297 Ga0209758_1008784 Ga0209758_10087845 287
154 3300025923 Ga0207681_10119563 Ga0207681_101195632 287
155 3300025972 Ga0207668_10070780 Ga0207668_100707802 287
156 3300042876 Ga0451577_0226677 Ga0451577_0226677_348_1256 287
157 3300046642 Ga0495634_0010535 Ga0495634_0010535_5533_6468 287
158 iso_pu_bacteria 2879099564 2879108323 287
159 iso_pu_bacteria 2922368715 2922374864 287
160 iso_pu_bacteria 2929615660 2929621910 287
161 iso_pu_bacteria 2929624759 2929629783 287
162 iso_pu_bacteria 2932818245 2932819156 287
163 iso_pu_bacteria 2933577622 2933583814 287
164 iso_pu_bacteria 2935675223 2935675868 287
165 iso_pu_bacteria 2935684952 2935685865 287
166 iso_pu_bacteria 2935713505 2935714417 287
167 iso_pu_bacteria 2935722832 2935725036 287
168 iso_pu_bacteria 2935732158 2935732605 287
169 iso_pu_bacteria 2935741537 2935741984 287
170 iso_pu_bacteria 2935750917 2935751830 287
171 iso_pu_bacteria 2935760218 2935765087 287
172 iso_pu_bacteria 2940556831 2940557367 287
173 iso_pu_bacteria 8016539877 8016547693 287
174 iso_pu_bacteria 8016548790 8016554444 287
175 iso_pu_bacteria 8016566248 8016572812 287
176 iso_pu_bacteria 8016575299 8016576971 287
177 iso_pu_bacteria 8016595262 8016600592 287
178 iso_pu_bacteria 8055742211 8055745924 287
179 3300005549 Ga0070704_100041535 Ga0070704_1000415353 288
180 3300025261 Ga0209233_1005160 Ga0209233_10051602 288
181 3300039438 Ga0436360_0376160 Ga0436360_0376160_122_1036 288
182 3300048924 Ga0496121_0332555 Ga0496121_0332555_36_950 288
183 iso_pu_bacteria 2524023205 2524437711 288
184 iso_pu_bacteria 2816332527 2818239695 288
185 iso_pu_bacteria 2824626560 2824626756 288
186 iso_pu_bacteria 2824635225 2824636609 288
187 iso_pu_bacteria 2824644064 2824645143 288
188 iso_pu_bacteria 2824714736 2824715696 288
189 iso_pu_bacteria 2824723954 2824725179 288
190 iso_pu_bacteria 2847930680 2847936556 288
191 iso_pu_bacteria 2876761206 2876764933 288
192 iso_pu_bacteria 2879083081 2879089535 288
193 iso_pu_bacteria 2906626472 2906633651 288
194 iso_pu_bacteria 2906643746 2906646557 288
195 iso_pu_bacteria 2941531003 2941533158 288
196 iso_pu_bacteria 8016583857 8016593235 288
197 3300005331 Ga0070670_100000356 Ga0070670_10000035644 289
198 3300005347 Ga0070668_100102461 Ga0070668_1001024613 289
199 3300005347 Ga0070668_100108499 Ga0070668_1001084992 289
200 3300005354 Ga0070675_100005609 Ga0070675_1000056092 289
201 3300005355 Ga0070671_100146187 Ga0070671_1001461872 289
202 3300005355 Ga0070671_100371920 Ga0070671_1003719202 289
203 3300005364 Ga0070673_100399509 Ga0070673_1003995092 289
204 3300005365 Ga0070688_100071619 Ga0070688_1000716192 289
205 3300005456 Ga0070678_100084367 Ga0070678_1000843671 289
206 3300005457 Ga0070662_100217608 Ga0070662_1002176082 289
207 3300005459 Ga0068867_100020518 Ga0068867_1000205184 289
208 3300005459 Ga0068867_100142067 Ga0068867_1001420672 289
209 3300005466 Ga0070685_10255334 Ga0070685_102553341 289
210 3300005468 Ga0070707_100276763 Ga0070707_1002767632 289
211 3300005471 Ga0070698_100216165 Ga0070698_1002161652 289
212 3300005536 Ga0070697_100196357 Ga0070697_1001963571 289
213 3300005545 Ga0070695_100401705 Ga0070695_1004017051 289
214 3300005548 Ga0070665_100518282 Ga0070665_1005182822 289
215 3300005618 Ga0068864_100008694 Ga0068864_1000086944 289
216 3300005618 Ga0068864_100047550 Ga0068864_1000475502 289
217 3300005618 Ga0068864_100136178 Ga0068864_1001361782 289
218 3300005618 Ga0068864_100176536 Ga0068864_1001765362 289
219 3300005719 Ga0068861_100061248 Ga0068861_1000612482 289
220 3300005719 Ga0068861_100095214 Ga0068861_1000952143 289
221 3300005840 Ga0068870_10085739 Ga0068870_100857392 289
222 3300005841 Ga0068863_100003193 Ga0068863_10000319311 289
223 3300005841 Ga0068863_100082278 Ga0068863_1000822782 289
224 3300005843 Ga0068860_100116317 Ga0068860_1001163172 289
225 3300005843 Ga0068860_100362498 Ga0068860_1003624981 289
226 3300005844 Ga0068862_100172936 Ga0068862_1001729362 289
227 3300006237 Ga0097621_100344588 Ga0097621_1003445882 289
228 3300006358 Ga0068871_100084800 Ga0068871_1000848002 289
229 3300006881 Ga0068865_100325279 Ga0068865_1003252792 289
230 3300013297 Ga0157378_10433213 Ga0157378_104332132 289
231 3300013306 Ga0163162_10732644 Ga0163162_107326441 289
232 3300013308 Ga0157375_10556747 Ga0157375_105567472 289
233 3300014325 Ga0163163_10016588 Ga0163163_100165882 289
234 3300014325 Ga0163163_10022097 Ga0163163_100220975 289
235 3300014326 Ga0157380_10032883 Ga0157380_100328832 289
236 3300014968 Ga0157379_10587263 Ga0157379_105872631 289
237 3300014969 Ga0157376_10039268 Ga0157376_100392685 289
238 3300014969 Ga0157376_10136716 Ga0157376_101367162 289
239 3300017792 Ga0163161_10039167 Ga0163161_100391673 289
240 3300021441 Ga0213871_10000559 Ga0213871_100005593 289
241 3300025899 Ga0207642_10063039 Ga0207642_100630392 289
242 3300025907 Ga0207645_10013062 Ga0207645_100130621 289
243 3300025908 Ga0207643_10012934 Ga0207643_100129342 289
244 3300025908 Ga0207643_10111752 Ga0207643_101117522 289
245 3300025918 Ga0207662_10069192 Ga0207662_100691923 289
246 3300025922 Ga0207646_10304117 Ga0207646_103041171 289
247 3300025925 Ga0207650_10000755 Ga0207650_100007556 289
248 3300025925 Ga0207650_10038912 Ga0207650_100389125 289
249 3300025926 Ga0207659_10003624 Ga0207659_1000362410 289
250 3300025931 Ga0207644_10343947 Ga0207644_103439472 289
251 3300025933 Ga0207706_10033883 Ga0207706_100338834 289
252 3300025936 Ga0207670_10054636 Ga0207670_100546363 289
253 3300025938 Ga0207704_10018327 Ga0207704_100183272 289
254 3300025940 Ga0207691_10000111 Ga0207691_1000011117 289
255 3300025941 Ga0207711_10209732 Ga0207711_102097322 289
256 3300025960 Ga0207651_10018903 Ga0207651_100189034 289
257 3300025960 Ga0207651_10149752 Ga0207651_101497522 289
258 3300025972 Ga0207668_10037606 Ga0207668_100376063 289
259 3300025986 Ga0207658_10287972 Ga0207658_102879722 289
260 3300026088 Ga0207641_10009740 Ga0207641_100097408 289
261 3300026088 Ga0207641_10112454 Ga0207641_101124542 289
262 3300026088 Ga0207641_10138219 Ga0207641_101382191 289
263 3300026088 Ga0207641_10161713 Ga0207641_101617132 289
264 3300026089 Ga0207648_10016729 Ga0207648_100167295 289
265 3300026089 Ga0207648_10098622 Ga0207648_100986223 289
266 3300026095 Ga0207676_10130259 Ga0207676_101302592 289
267 3300026095 Ga0207676_10252070 Ga0207676_102520702 289
268 3300026095 Ga0207676_10319242 Ga0207676_103192422 289
269 3300026118 Ga0207675_100037456 Ga0207675_1000374565 289
270 3300026118 Ga0207675_100089563 Ga0207675_1000895633 289
271 3300026121 Ga0207683_10294647 Ga0207683_102946472 289
272 3300028381 Ga0268264_10332808 Ga0268264_103328082 289
273 3300031616 Ga0307508_10014131 Ga0307508_100141313 289
274 3300031616 Ga0307508_10092867 Ga0307508_100928672 289
275 3300031616 Ga0307508_10188415 Ga0307508_101884152 289
276 3300039437 Ga0436365_0263215 Ga0436365_0263215_32_946 289
277 3300039438 Ga0436360_0271985 Ga0436360_0271985_1049_1984 289
278 3300046455 Ga0495603_0031445 Ga0495603_0031445_854_1777 289
279 3300046475 Ga0495639_0057030 Ga0495639_0057030_639_1562 289
280 3300046522 Ga0495643_0000028 Ga0495643_0000028_257733_258653 289
281 3300046660 Ga0495625_0011369 Ga0495625_0011369_954_1874 289
282 3300046694 Ga0495649_0004059 Ga0495649_0004059_7517_8437 289
283 3300047320 Ga0495672_0000334 Ga0495672_0000334_11918_12838 289
284 3300049459 Ga0495678_001099 Ga0495678_001099_1141_2061 289
285 iso_pu_bacteria 2507262055 2507508249 289
286 iso_pu_bacteria 2513237096 2513655859 289
287 iso_pu_bacteria 2513237102 2513702503 289
288 iso_pu_bacteria 2513237104 2513718418 289
289 iso_pu_bacteria 2513237137 2513856628 289
290 iso_pu_bacteria 2513237145 2513917228 289
291 iso_pu_bacteria 2515154112 2515627244 289
292 iso_pu_bacteria 2602042107 2603860898 289
293 iso_pu_bacteria 2643221644 2644243916 289
294 iso_pu_bacteria 2728368998 2728752385 289
295 iso_pu_bacteria 2791355197 2793069826 289
296 iso_pu_bacteria 2824746037 2824746471 289
297 iso_pu_bacteria 2857509624 2857515890 289
298 iso_pu_bacteria 2874590934 2874598381 289
299 iso_pu_bacteria 2874645413 2874652564 289
300 iso_pu_bacteria 2876771140 2876778141 289
301 iso_pu_bacteria 2876818435 2876825990 289
302 iso_pu_bacteria 2879074833 2879081935 289
303 iso_pu_bacteria 2879127579 2879135057 289
304 iso_pu_bacteria 2879142872 2879149742 289
305 iso_pu_bacteria 2881364244 2881368490 289
306 iso_pu_bacteria 2885374607 2885382245 289
307 iso_pu_bacteria 2893066018 2893069171 289
308 iso_pu_bacteria 2904699407 2904706809 289
309 iso_pu_bacteria 2906660503 2906662033 289
310 iso_pu_bacteria 2908739725 2908740889 289
311 iso_pu_bacteria 2922425934 2922432146 289
312 iso_pu_bacteria 2935630451 2935630987 289
313 iso_pu_bacteria 2935769743 2935771704 289
314 iso_pu_bacteria 2935785616 2935791198 289
315 iso_pu_bacteria 2935793552 2935795473 289
316 iso_pu_bacteria 2935984226 2935987391 289
317 iso_pu_bacteria 2941507105 2941507639 289
318 iso_pu_bacteria 2941515067 2941516066 289
319 iso_pu_bacteria 2941523033 2941523226 289
320 iso_pu_bacteria 3005483717 3005484634 289
321 iso_pu_bacteria 8006933436 8006934589 289
322 iso_pu_bacteria 8006973647 8006974559 289
323 iso_pu_bacteria 8016613128 8016614785 289
324 iso_pu_bacteria 8019547302 8019553289 289
325 iso_pu_bacteria 8019619141 8019628546 289
326 iso_pu_bacteria 8019659431 8019661969 289
327 iso_pu_bacteria 8019668869 8019671495 289
328 iso_pu_bacteria 8019678201 8019684613 289
329 3300003215 JGI25153J46596_10000394 JGI25153J46596_1000039414 290
330 3300003215 JGI25153J46596_10000515 JGI25153J46596_1000051513 290
331 3300003215 JGI25153J46596_10003431 JGI25153J46596_100034318 290
332 3300003354 JGI25160J50197_1000553 JGI25160J50197_10005539 290
333 3300003354 JGI25160J50197_1003853 JGI25160J50197_10038536 290
334 3300003794 Ga0055531_10005951 Ga0055531_100059512 290
335 3300005262 Ga0065165_1001731 Ga0065165_10017319 290
336 3300005262 Ga0065165_1018035 Ga0065165_10180353 290
337 3300005616 Ga0068852_100008171 Ga0068852_1000081716 290
338 3300006186 Ga0075369_10009841 Ga0075369_100098413 290
339 3300009093 Ga0105240_10129483 Ga0105240_101294832 290
340 3300009098 Ga0105245_10144368 Ga0105245_101443682 290
341 3300009174 Ga0105241_10053629 Ga0105241_100536293 290
342 3300009545 Ga0105237_10006673 Ga0105237_1000667311 290
343 3300010375 Ga0105239_10091272 Ga0105239_100912723 290
344 3300010375 Ga0105239_10141182 Ga0105239_101411823 290
345 3300010375 Ga0105239_10266992 Ga0105239_102669923 290
346 3300025230 Ga0209563_100899 Ga0209563_1008994 290
347 3300025253 Ga0209677_102333 Ga0209677_1023337 290
348 3300025295 Ga0209564_1006369 Ga0209564_10063694 290
349 3300025295 Ga0209564_1017192 Ga0209564_10171923 290
350 3300025297 Ga0209758_1000024 Ga0209758_100002464 290
351 3300025297 Ga0209758_1000068 Ga0209758_100006822 290
352 3300025297 Ga0209758_1001533 Ga0209758_100153319 290
353 3300025297 Ga0209758_1036964 Ga0209758_10369643 290
354 3300025299 Ga0209256_1001900 Ga0209256_10019005 290
355 3300025299 Ga0209256_1016592 Ga0209256_10165922 290
356 3300025302 Ga0207426_1000238 Ga0207426_100023851 290
357 3300025304 Ga0209257_1001149 Ga0209257_100114919 290
358 3300025304 Ga0209257_1036359 Ga0209257_10363591 290
359 3300025911 Ga0207654_10049797 Ga0207654_100497972 290
360 3300025913 Ga0207695_10000008 Ga0207695_10000008139 290
361 3300025914 Ga0207671_10003142 Ga0207671_1000314212 290
362 3300025924 Ga0207694_10346915 Ga0207694_103469151 290
363 3300025927 Ga0207687_10083695 Ga0207687_100836952 290
364 3300025933 Ga0207706_10100121 Ga0207706_101001213 290
365 3300025981 Ga0207640_10100356 Ga0207640_101003562 290
366 3300031507 Ga0307509_10104348 Ga0307509_101043483 290
367 3300037471 Ga0395905_0044603 Ga0395905_0044603_2171_3085 290
368 3300037471 Ga0395905_0155856 Ga0395905_0155856_687_1604 290
369 3300042532 Ga0450893_0014757 Ga0450893_0014757_286_1206 290
370 3300044658 Ga0466972_0000122 Ga0466972_0000122_21995_22918 290
371 3300044684 Ga0466966_0000599 Ga0466966_0000599_4263_5177 290
372 3300044693 Ga0466961_0000038 Ga0466961_0000038_46266_47180 290
373 3300044694 Ga0466963_0026664 Ga0466963_0026664_589_1503 290
374 3300044719 Ga0466971_0089726 Ga0466971_0089726_170_1084 290
375 3300044901 Ga0466960_0029269 Ga0466960_0029269_29_943 290
376 3300045049 Ga0466959_0000493 Ga0466959_0000493_16295_17209 290
377 3300046454 Ga0495592_0020984 Ga0495592_0020984_1036_1950 290
378 3300046460 Ga0495638_0013480 Ga0495638_0013480_4545_5459 290
379 3300046463 Ga0495653_0058227 Ga0495653_0058227_1498_2412 290
380 3300046471 Ga0495650_0035553 Ga0495650_0035553_260_1177 290
381 3300046477 Ga0495664_0058506 Ga0495664_0058506_574_1488 290
382 3300046511 Ga0495608_0098523 Ga0495608_0098523_125_1039 290
383 3300046516 Ga0495628_0009719 Ga0495628_0009719_1956_2870 290
384 3300046516 Ga0495628_0103450 Ga0495628_0103450_542_1456 290
385 3300046529 Ga0495652_0002605 Ga0495652_0002605_11339_12253 290
386 3300046536 Ga0495587_0003463 Ga0495587_0003463_146_1060 290
387 3300046543 Ga0495645_0005537 Ga0495645_0005537_6718_7632 290
388 3300046543 Ga0495645_0246961 Ga0495645_0246961_111_1121 290
389 3300046642 Ga0495634_0066175 Ga0495634_0066175_1399_2316 290
390 3300046675 Ga0495657_0005167 Ga0495657_0005167_4197_5111 290
391 3300046679 Ga0495623_0006437 Ga0495623_0006437_1241_2155 290
392 3300046690 Ga0495624_0117150 Ga0495624_0117150_309_1226 290
393 3300046809 Ga0495600_0002461 Ga0495600_0002461_3732_4649 290
394 3300047317 Ga0495604_0001823 Ga0495604_0001823_5929_6846 290
395 3300047319 Ga0495674_0031441 Ga0495674_0031441_3021_3935 290
396 3300047322 Ga0495680_0001849 Ga0495680_0001849_904_1818 290
397 3300047444 Ga0495675_0061183 Ga0495675_0061183_315_1229 290
398 3300047472 Ga0495686_0124365 Ga0495686_0124365_242_1156 290
399 3300048088 Ga0495602_0007968 Ga0495602_0007968_6957_7871 290
400 3300048921 Ga0496118_0040296 Ga0496118_0040296_2266_3180 290
401 3300048928 Ga0496125_0014974 Ga0496125_0014974_2870_3784 290
402 3300049460 Ga0495682_0026552 Ga0495682_0026552_377_1291 290
403 3300050516 nmdc:mga0sz30_13929_c1 nmdc:mga0sz30_13929_c1_816_1730 290
404 3300053086 Ga0500578_0023708 Ga0500578_0023708_325_1239 290
405 3300053086 Ga0500578_0068019 Ga0500578_0068019_465_1379 290
406 3300053092 Ga0500583_0051280 Ga0500583_0051280_203_1120 290
407 3300053093 Ga0500651_0069288 Ga0500651_0069288_1268_2185 290
408 3300053094 Ga0500566_0000134 Ga0500566_0000134_14153_15067 290
409 3300053098 Ga0500650_0122758 Ga0500650_0122758_51_968 290
410 3300053103 Ga0500555_004027 Ga0500555_004027_1098_2015 290
411 3300053109 Ga0500569_001583 Ga0500569_001583_870_1787 290
412 3300053116 Ga0500592_004269 Ga0500592_004269_12_929 290
413 3300053123 Ga0500614_022979 Ga0500614_022979_453_1367 290
414 3300053130 Ga0500642_0007766 Ga0500642_0007766_405_1322 290
415 3300053139 Ga0500568_0037549 Ga0500568_0037549_709_1626 290
416 3300053156 Ga0500622_0011733 Ga0500622_0011733_1706_2623 290
417 3300053158 Ga0500627_0033816 Ga0500627_0033816_604_1521 290
418 3300053736 Ga0500599_002692 Ga0500599_002692_667_1581 290
419 iso_pu_bacteria 2508501128 2509148393 290
420 3300005262 Ga0065165_1000864 Ga0065165_100086418 291
421 3300006941 Ga0099825_1027409 Ga0099825_10274093 291
422 3300006942 Ga0099824_1002281 Ga0099824_100228117 291
423 3300026067 Ga0207678_10090364 Ga0207678_100903643 291
424 3300031507 Ga0307509_10149716 Ga0307509_101497162 291
425 3300045051 Ga0451576_0020692 Ga0451576_0020692_4629_5633 291
426 3300045051 Ga0451576_0478722 Ga0451576_0478722_42_968 291
427 3300046474 Ga0495605_0081142 Ga0495605_0081142_193_1110 291
428 3300046507 Ga0495606_0009544 Ga0495606_0009544_833_1768 291
429 3300046690 Ga0495624_0130500 Ga0495624_0130500_191_1108 291
430 3300048904 Ga0496101_0210547 Ga0496101_0210547_473_1390 291
431 3300048905 Ga0496102_0414190 Ga0496102_0414190_291_1208 291
432 3300048908 Ga0496105_0138223 Ga0496105_0138223_799_1716 291
433 3300048910 Ga0496107_0134265 Ga0496107_0134265_784_1701 291
434 3300048913 Ga0496110_0315309 Ga0496110_0315309_418_1335 291
435 3300048918 Ga0496115_0185666 Ga0496115_0185666_207_1124 291
436 3300048921 Ga0496118_0073574 Ga0496118_0073574_845_1792 291
437 3300048924 Ga0496121_0029753 Ga0496121_0029753_3786_4703 291
438 3300048929 Ga0496126_0067644 Ga0496126_0067644_1352_2275 291
439 3300053094 Ga0500566_0000008 Ga0500566_0000008_82463_83398 291
440 3300053095 Ga0500640_000524 Ga0500640_000524_2642_3577 291
441 3300053111 Ga0500572_000555 Ga0500572_000555_3246_4181 291
442 3300053123 Ga0500614_000179 Ga0500614_000179_3761_4696 291
443 3300053136 Ga0500559_0008637 Ga0500559_0008637_1829_2764 291
444 3300053142 Ga0500577_0000068 Ga0500577_0000068_9426_10343 291
445 3300053150 Ga0500603_000033 Ga0500603_000033_17388_18323 291
446 3300053159 Ga0500630_000238 Ga0500630_000238_17919_18854 291
447 3300053162 Ga0500638_005827 Ga0500638_005827_3101_4036 291
448 3300053163 Ga0500639_000010 Ga0500639_000010_109175_110110 291
449 3300053178 Ga0500637_0040863 Ga0500637_0040863_1413_2348 291
450 3300053735 Ga0500596_002070 Ga0500596_002070_256_1191 291
451 iso_pu_bacteria 2908756301 2908763450 291
452 3300003792 Ga0055540_1000016 Ga0055540_100001680 292
453 3300003794 Ga0055531_10009059 Ga0055531_100090594 292
454 3300005331 Ga0070670_100000863 Ga0070670_10000086314 292
455 3300005353 Ga0070669_100003725 Ga0070669_1000037257 292
456 3300005354 Ga0070675_100000605 Ga0070675_10000060515 292
457 3300005355 Ga0070671_100056526 Ga0070671_1000565262 292
458 3300005356 Ga0070674_100111922 Ga0070674_1001119222 292
459 3300005364 Ga0070673_100027949 Ga0070673_1000279492 292
460 3300005456 Ga0070678_100002173 Ga0070678_1000021734 292
461 3300005539 Ga0068853_100573755 Ga0068853_1005737551 292
462 3300005543 Ga0070672_100000414 Ga0070672_1000004142 292
463 3300005548 Ga0070665_100075896 Ga0070665_1000758964 292
464 3300005548 Ga0070665_100273831 Ga0070665_1002738312 292
465 3300005564 Ga0070664_100051993 Ga0070664_1000519934 292
466 3300005618 Ga0068864_100033367 Ga0068864_1000333672 292
467 3300005834 Ga0068851_10028027 Ga0068851_100280273 292
468 3300005840 Ga0068870_10091555 Ga0068870_100915552 292
469 3300005842 Ga0068858_100402305 Ga0068858_1004023052 292
470 3300006042 Ga0075368_10009249 Ga0075368_100092494 292
471 3300006051 Ga0075364_10140267 Ga0075364_101402672 292
472 3300006237 Ga0097621_100102844 Ga0097621_1001028441 292
473 3300006944 Ga0099823_1064280 Ga0099823_10642802 292
474 3300006944 Ga0099823_1064406 Ga0099823_10644062 292
475 3300006946 Ga0079104_1000198 Ga0079104_100019813 292
476 3300009093 Ga0105240_10207526 Ga0105240_102075263 292
477 3300009174 Ga0105241_10060458 Ga0105241_100604583 292
478 3300009545 Ga0105237_10055847 Ga0105237_100558473 292
479 3300009551 Ga0105238_10077488 Ga0105238_100774884 292
480 3300010375 Ga0105239_10160420 Ga0105239_101604202 292
481 3300011119 Ga0105246_10034503 Ga0105246_100345033 292
482 3300014325 Ga0163163_10132664 Ga0163163_101326643 292
483 3300025254 Ga0209148_1000500 Ga0209148_10005006 292
484 3300025298 Ga0209050_1000082 Ga0209050_1000082125 292
485 3300025298 Ga0209050_1004407 Ga0209050_10044073 292
486 3300025303 Ga0209051_1000029 Ga0209051_1000029125 292
487 3300025304 Ga0209257_1000030 Ga0209257_1000030118 292
488 3300025304 Ga0209257_1011659 Ga0209257_10116594 292
489 3300025315 Ga0207697_10020544 Ga0207697_100205442 292
490 3300025321 Ga0207656_10011260 Ga0207656_100112603 292
491 3300025893 Ga0207682_10011775 Ga0207682_100117753 292
492 3300025904 Ga0207647_10013481 Ga0207647_100134814 292
493 3300025908 Ga0207643_10041091 Ga0207643_100410912 292
494 3300025920 Ga0207649_10414269 Ga0207649_104142691 292
495 3300025923 Ga0207681_10044971 Ga0207681_100449712 292
496 3300025925 Ga0207650_10000326 Ga0207650_1000032614 292
497 3300025926 Ga0207659_10000299 Ga0207659_1000029920 292
498 3300025931 Ga0207644_10001354 Ga0207644_100013545 292
499 3300025938 Ga0207704_10008488 Ga0207704_100084885 292
500 3300025940 Ga0207691_10000049 Ga0207691_1000004923 292
501 3300025941 Ga0207711_10258226 Ga0207711_102582262 292
502 3300025960 Ga0207651_10000834 Ga0207651_100008347 292
503 3300025972 Ga0207668_10025834 Ga0207668_100258344 292
504 3300026023 Ga0207677_10013354 Ga0207677_100133543 292
505 3300026088 Ga0207641_10396636 Ga0207641_103966361 292
506 3300026089 Ga0207648_10002748 Ga0207648_100027487 292
507 3300026095 Ga0207676_10032058 Ga0207676_100320584 292
508 3300026121 Ga0207683_10016814 Ga0207683_100168145 292
509 3300027111 Ga0209281_1000457 Ga0209281_100045713 292
510 3300027296 Ga0209389_1000040 Ga0209389_10000405 292
511 3300027361 Ga0209489_120706 Ga0209489_1207062 292
512 3300027361 Ga0209489_120707 Ga0209489_1207072 292
513 3300027363 Ga0209700_100005 Ga0209700_100005294 292
514 3300028381 Ga0268264_10251361 Ga0268264_102513612 292
515 3300031238 Ga0265332_10007298 Ga0265332_100072984 292
516 3300031824 Ga0307413_10002493 Ga0307413_100024934 292
517 3300031903 Ga0307407_10093220 Ga0307407_100932202 292
518 3300031911 Ga0307412_10004520 Ga0307412_100045207 292
519 3300032004 Ga0307414_10009478 Ga0307414_100094781 292
520 3300032005 Ga0307411_10003401 Ga0307411_100034014 292
521 3300032005 Ga0307411_10165481 Ga0307411_101654812 292
522 3300032126 Ga0307415_100060832 Ga0307415_1000608322 292
523 3300035086 Ga0373934_0013228 Ga0373934_0013228_806_1726 292
524 3300035111 Ga0373923_0143927 Ga0373923_0143927_89_1009 292
525 3300035117 Ga0373953_0000542 Ga0373953_0000542_5185_6105 292
526 3300035118 Ga0373954_0000323 Ga0373954_0000323_7398_8318 292
527 3300035119 Ga0373956_0009107 Ga0373956_0009107_3045_3965 292
528 3300035120 Ga0373957_0002539 Ga0373957_0002539_1434_2354 292
529 3300035172 Ga0373955_0003057 Ga0373955_0003057_3138_4058 292
530 3300035410 Ga0373924_0011712 Ga0373924_0011712_782_1702 292
531 3300035724 Ga0373933_0001324 Ga0373933_0001324_10584_11504 292
532 3300036401 Ga0373937_0007329 Ga0373937_0007329_4204_5124 292
533 3300036401 Ga0373937_0027340 Ga0373937_0027340_1420_2451 292
534 3300037418 Ga0395900_0001802 Ga0395900_0001802_11504_12424 292
535 3300037466 Ga0395898_0002995 Ga0395898_0002995_13867_14787 292
536 3300039447 Ga0436361_0833650 Ga0436361_0833650_3412_4338 292
537 3300042121 Ga0450919_001148 Ga0450919_001148_2372_3304 292
538 3300042531 Ga0450918_005595 Ga0450918_005595_374_1306 292
539 3300044765 Ga0466970_0209385 Ga0466970_0209385_108_1034 292
540 3300046454 Ga0495592_0002287 Ga0495592_0002287_1505_2425 292
541 3300046459 Ga0495629_0013834 Ga0495629_0013834_3797_4717 292
542 3300046459 Ga0495629_0045225 Ga0495629_0045225_608_1528 292
543 3300046459 Ga0495629_0059855 Ga0495629_0059855_107_1138 292
544 3300046462 Ga0495651_0134345 Ga0495651_0134345_210_1130 292
545 3300046462 Ga0495651_0155022 Ga0495651_0155022_132_1064 292
546 3300046463 Ga0495653_0014349 Ga0495653_0014349_1340_2260 292
547 3300046501 Ga0495607_0032563 Ga0495607_0032563_1148_2068 292
548 3300046512 Ga0495610_0030159 Ga0495610_0030159_1135_2055 292
549 3300046513 Ga0495616_0019159 Ga0495616_0019159_2602_3522 292
550 3300046513 Ga0495616_0026871 Ga0495616_0026871_1947_2867 292
551 3300046515 Ga0495620_0077632 Ga0495620_0077632_16_936 292
552 3300046516 Ga0495628_0023166 Ga0495628_0023166_1084_2004 292
553 3300046516 Ga0495628_0078071 Ga0495628_0078071_1528_2559 292
554 3300046519 Ga0495632_0002332 Ga0495632_0002332_12431_13351 292
555 3300046522 Ga0495643_0000154 Ga0495643_0000154_110244_111164 292
556 3300046529 Ga0495652_0033439 Ga0495652_0033439_1643_2563 292
557 3300046529 Ga0495652_0335035 Ga0495652_0335035_96_1016 292
558 3300046533 Ga0495640_0282585 Ga0495640_0282585_35_955 292
559 3300046536 Ga0495587_0005573 Ga0495587_0005573_1771_2691 292
560 3300046642 Ga0495634_0042942 Ga0495634_0042942_1480_2400 292
561 3300046663 Ga0495635_0006348 Ga0495635_0006348_3853_4773 292
562 3300046663 Ga0495635_0011988 Ga0495635_0011988_2404_3324 292
563 3300046665 Ga0495661_0003126 Ga0495661_0003126_5149_6069 292
564 3300046675 Ga0495657_0015234 Ga0495657_0015234_2654_3574 292
565 3300046675 Ga0495657_0028025 Ga0495657_0028025_1010_1930 292
566 3300046678 Ga0495599_0004863 Ga0495599_0004863_3350_4270 292
567 3300046679 Ga0495623_0005974 Ga0495623_0005974_4086_5006 292
568 3300046681 Ga0495647_0032237 Ga0495647_0032237_385_1416 292
569 3300046683 Ga0495658_0175248 Ga0495658_0175248_149_1069 292
570 3300046689 Ga0495613_0082180 Ga0495613_0082180_1365_2285 292
571 3300046689 Ga0495613_0095414 Ga0495613_0095414_1149_2069 292
572 3300046690 Ga0495624_0122366 Ga0495624_0122366_119_1039 292
573 3300046691 Ga0495670_0042520 Ga0495670_0042520_264_1205 292
574 3300047319 Ga0495674_0048317 Ga0495674_0048317_345_1265 292
575 3300047443 Ga0495687_025876 Ga0495687_025876_872_1792 292
576 3300047444 Ga0495675_0003845 Ga0495675_0003845_4801_5721 292
577 3300047471 Ga0495684_0005498 Ga0495684_0005498_2767_3687 292
578 3300047673 Ga0495593_0013232 Ga0495593_0013232_2634_3554 292
579 3300048906 Ga0496103_0007011 Ga0496103_0007011_605_1525 292
580 3300048911 Ga0496108_0198992 Ga0496108_0198992_803_1723 292
581 3300048915 Ga0496112_0054466 Ga0496112_0054466_2167_3087 292
582 3300048915 Ga0496112_0089508 Ga0496112_0089508_882_1880 292
583 3300048916 Ga0496113_0227412 Ga0496113_0227412_83_1003 292
584 3300048917 Ga0496114_0253732 Ga0496114_0253732_494_1414 292
585 3300048918 Ga0496115_0290106 Ga0496115_0290106_244_1164 292
586 3300048922 Ga0496119_0104743 Ga0496119_0104743_442_1362 292
587 3300048923 Ga0496120_0022584 Ga0496120_0022584_2572_3492 292
588 3300048928 Ga0496125_0053668 Ga0496125_0053668_1809_2729 292
589 3300048928 Ga0496125_0089835 Ga0496125_0089835_1053_1976 292
590 3300048929 Ga0496126_0044288 Ga0496126_0044288_1496_2416 292
591 3300049579 Ga0501043_0000053 Ga0501043_0000053_55480_56448 292
592 3300049580 Ga0501046_0000018 Ga0501046_0000018_9841_10809 292
593 3300049581 Ga0501047_0000020 Ga0501047_0000020_48650_49618 292
594 3300049582 Ga0501048_0000795 Ga0501048_0000795_10282_11250 292
595 3300049824 Ga0501045_0040544 Ga0501045_0040544_319_1287 292
596 3300050491 nmdc:mga00v17_23838_c2 nmdc:mga00v17_23838_c2_24_944 292
597 3300050495 nmdc:mga04h51_16669_c1 nmdc:mga04h51_16669_c1_166_1086 292
598 3300053077 Ga0495601_0036848 Ga0495601_0036848_1880_2911 292
599 3300053083 Ga0495655_0041617 Ga0495655_0041617_94_1038 292
600 3300053084 Ga0495595_0011955 Ga0495595_0011955_1697_2617 292
601 3300053085 Ga0495619_0010048 Ga0495619_0010048_3993_4913 292
602 3300053090 Ga0500646_0014801 Ga0500646_0014801_832_1752 292
603 3300053122 Ga0500608_148689 Ga0500608_148689_43_963 292
604 3300053154 Ga0500619_059060 Ga0500619_059060_61_981 292
605 3300053156 Ga0500622_0011913 Ga0500622_0011913_2729_3670 292
606 3300053162 Ga0500638_026391 Ga0500638_026391_1804_2724 292
607 3300053177 Ga0500636_0001217 Ga0500636_0001217_3076_3996 292
608 3300053177 Ga0500636_0093439 Ga0500636_0093439_452_1372 292
609 3300053733 Ga0500552_011830 Ga0500552_011830_154_1074 292
610 3300053737 Ga0500601_000029 Ga0500601_000029_5981_6901 292
611 3300003203 JGI25406J46586_10000427 JGI25406J46586_100004273 293
612 3300003203 JGI25406J46586_10000721 JGI25406J46586_100007216 293
613 3300003659 JGI25404J52841_10004199 JGI25404J52841_100041993 293
614 3300005262 Ga0065165_1000323 Ga0065165_100032353 293
615 3300005336 Ga0070680_100079923 Ga0070680_1000799232 293
616 3300005366 Ga0070659_100134462 Ga0070659_1001344622 293
617 3300005366 Ga0070659_100384295 Ga0070659_1003842952 293
618 3300005434 Ga0070709_10000424 Ga0070709_1000042417 293
619 3300005434 Ga0070709_10002985 Ga0070709_100029854 293
620 3300005435 Ga0070714_100003678 Ga0070714_10000367812 293
621 3300005435 Ga0070714_100013754 Ga0070714_1000137543 293
622 3300005436 Ga0070713_100129056 Ga0070713_1001290562 293
623 3300005437 Ga0070710_10001915 Ga0070710_100019159 293
624 3300005439 Ga0070711_100001539 Ga0070711_10000153912 293
625 3300005471 Ga0070698_100406495 Ga0070698_1004064952 293
626 3300005539 Ga0068853_100130016 Ga0068853_1001300162 293
627 3300005614 Ga0068856_100400334 Ga0068856_1004003342 293
628 3300005616 Ga0068852_100211402 Ga0068852_1002114022 293
629 3300005834 Ga0068851_10159197 Ga0068851_101591972 293
630 3300005834 Ga0068851_10173127 Ga0068851_101731271 293
631 3300005937 Ga0081455_10005550 Ga0081455_100055506 293
632 3300005937 Ga0081455_10045525 Ga0081455_100455252 293
633 3300005983 Ga0081540_1002952 Ga0081540_100295212 293
634 3300005983 Ga0081540_1015686 Ga0081540_10156863 293
635 3300005985 Ga0081539_10000486 Ga0081539_100004863 293
636 3300005985 Ga0081539_10000748 Ga0081539_1000074856 293
637 3300006028 Ga0070717_10016495 Ga0070717_100164953 293
638 3300006051 Ga0075364_10014392 Ga0075364_100143923 293
639 3300006163 Ga0070715_10001596 Ga0070715_100015963 293
640 3300006163 Ga0070715_10071826 Ga0070715_100718262 293
641 3300006173 Ga0070716_100003246 Ga0070716_1000032464 293
642 3300006173 Ga0070716_100008627 Ga0070716_1000086275 293
643 3300006175 Ga0070712_100012263 Ga0070712_1000122631 293
644 3300006175 Ga0070712_100127807 Ga0070712_1001278072 293
645 3300006178 Ga0075367_10087797 Ga0075367_100877972 293
646 3300006195 Ga0075366_10159010 Ga0075366_101590101 293
647 3300006871 Ga0075434_100183497 Ga0075434_1001834972 293
648 3300007265 Ga0099794_10017152 Ga0099794_100171524 293
649 3300009101 Ga0105247_10022846 Ga0105247_100228461 293
650 3300009545 Ga0105237_10443482 Ga0105237_104434822 293
651 3300013104 Ga0157370_10289190 Ga0157370_102891902 293
652 3300014968 Ga0157379_10096110 Ga0157379_100961103 293
653 3300021320 Ga0214544_1000002 Ga0214544_1000002116 293
654 3300021321 Ga0214542_1000001 Ga0214542_1000001466 293
655 3300021324 Ga0214545_1000001 Ga0214545_1000001532 293
656 3300021324 Ga0214545_1026202 Ga0214545_10262023 293
657 3300021327 Ga0214543_1000001 Ga0214543_1000001664 293
658 3300021384 Ga0213876_10003361 Ga0213876_100033618 293
659 3300025253 Ga0209677_100280 Ga0209677_10028010 293
660 3300025254 Ga0209148_1010747 Ga0209148_10107472 293
661 3300025261 Ga0209233_1002090 Ga0209233_10020907 293
662 3300025272 Ga0209455_1001166 Ga0209455_10011669 293
663 3300025273 Ga0209673_1024009 Ga0209673_10240092 293
664 3300025295 Ga0209564_1000097 Ga0209564_1000097108 293
665 3300025898 Ga0207692_10000318 Ga0207692_100003182 293
666 3300025898 Ga0207692_10000738 Ga0207692_100007388 293
667 3300025905 Ga0207685_10003083 Ga0207685_100030834 293
668 3300025906 Ga0207699_10000465 Ga0207699_100004655 293
669 3300025906 Ga0207699_10067812 Ga0207699_100678122 293
670 3300025915 Ga0207693_10003071 Ga0207693_100030719 293
671 3300025915 Ga0207693_10003980 Ga0207693_100039804 293
672 3300025915 Ga0207693_10022195 Ga0207693_100221954 293
673 3300025916 Ga0207663_10001512 Ga0207663_1000151210 293
674 3300025928 Ga0207700_10195137 Ga0207700_101951372 293
675 3300025929 Ga0207664_10019656 Ga0207664_100196565 293
676 3300025929 Ga0207664_10089866 Ga0207664_100898662 293
677 3300025932 Ga0207690_10204413 Ga0207690_102044132 293
678 3300025939 Ga0207665_10002891 Ga0207665_1000289113 293
679 3300025939 Ga0207665_10008158 Ga0207665_100081582 293
680 3300025949 Ga0207667_10068267 Ga0207667_100682674 293
681 3300026041 Ga0207639_10170525 Ga0207639_101705252 293
682 3300026067 Ga0207678_10043159 Ga0207678_100431594 293
683 3300026078 Ga0207702_10021218 Ga0207702_100212184 293
684 3300027866 Ga0209813_10065105 Ga0209813_100651051 293
685 3300028381 Ga0268264_10031537 Ga0268264_100315373 293
686 3300028556 Ga0265337_1001439 Ga0265337_10014396 293
687 3300028558 Ga0265326_10001380 Ga0265326_100013805 293
688 3300028563 Ga0265319_1002798 Ga0265319_10027987 293
689 3300028573 Ga0265334_10005260 Ga0265334_100052603 293
690 3300028577 Ga0265318_10003474 Ga0265318_100034745 293
691 3300028653 Ga0265323_10000992 Ga0265323_100009925 293
692 3300028654 Ga0265322_10002589 Ga0265322_100025895 293
693 3300028666 Ga0265336_10000063 Ga0265336_1000006379 293
694 3300028786 Ga0307517_10000085 Ga0307517_100000856 293
695 3300028794 Ga0307515_10027739 Ga0307515_100277392 293
696 3300028794 Ga0307515_10094574 Ga0307515_100945742 293
697 3300028794 Ga0307515_10165545 Ga0307515_101655452 293
698 3300028800 Ga0265338_10000154 Ga0265338_1000015415 293
699 3300029957 Ga0265324_10001590 Ga0265324_100015909 293
700 3300031239 Ga0265328_10037935 Ga0265328_100379352 293
701 3300031241 Ga0265325_10002402 Ga0265325_100024026 293
702 3300031247 Ga0265340_10020838 Ga0265340_100208383 293
703 3300031249 Ga0265339_10025106 Ga0265339_100251062 293
704 3300031250 Ga0265331_10055199 Ga0265331_100551992 293
705 3300031344 Ga0265316_10206274 Ga0265316_102062742 293
706 3300031507 Ga0307509_10139196 Ga0307509_101391963 293
707 3300031616 Ga0307508_10000282 Ga0307508_1000028231 293
708 3300031616 Ga0307508_10009668 Ga0307508_1000966810 293
709 3300031616 Ga0307508_10279793 Ga0307508_102797931 293
710 3300031711 Ga0265314_10053104 Ga0265314_100531042 293
711 3300031712 Ga0265342_10023837 Ga0265342_100238374 293
712 3300031712 Ga0265342_10057119 Ga0265342_100571193 293
713 3300031730 Ga0307516_10009880 Ga0307516_100098802 293
714 3300031730 Ga0307516_10052275 Ga0307516_100522754 293
715 3300031730 Ga0307516_10098215 Ga0307516_100982152 293
716 3300031730 Ga0307516_10227071 Ga0307516_102270712 293
717 3300031730 Ga0307516_10345143 Ga0307516_103451432 293
718 3300033179 Ga0307507_10091082 Ga0307507_100910823 293
719 3300033180 Ga0307510_10086514 Ga0307510_100865142 293
720 3300035111 Ga0373923_0036844 Ga0373923_0036844_1006_1953 293
721 3300035117 Ga0373953_0006315 Ga0373953_0006315_1778_2725 293
722 3300035119 Ga0373956_0018340 Ga0373956_0018340_550_1497 293
723 3300035120 Ga0373957_0037806 Ga0373957_0037806_397_1344 293
724 3300035695 Ga0373927_0010672 Ga0373927_0010672_368_1291 293
725 3300035695 Ga0373927_0028676 Ga0373927_0028676_1482_2405 293
726 3300035725 Ga0373947_0030133 Ga0373947_0030133_174_1097 293
727 3300035725 Ga0373947_0063015 Ga0373947_0063015_1236_2159 293
728 3300036401 Ga0373937_0049474 Ga0373937_0049474_2382_3323 293
729 3300036401 Ga0373937_0087326 Ga0373937_0087326_1178_2125 293
730 3300039437 Ga0436365_0619230 Ga0436365_0619230_424_1347 293
731 3300039437 Ga0436365_1549030 Ga0436365_1549030_1570_2499 293
732 3300039453 Ga0436362_1138875 Ga0436362_1138875_166_1089 293
733 3300044684 Ga0466966_0062349 Ga0466966_0062349_829_1773 293
734 3300044712 Ga0453684_0037503 Ga0453684_0037503_4631_5566 293
735 3300044712 Ga0453684_0197961 Ga0453684_0197961_1101_2033 293
736 3300045049 Ga0466959_0108206 Ga0466959_0108206_561_1505 293
737 3300046457 Ga0495590_0073441 Ga0495590_0073441_205_1131 293
738 3300046460 Ga0495638_0017406 Ga0495638_0017406_3595_4518 293
739 3300046460 Ga0495638_0072038 Ga0495638_0072038_989_1912 293
740 3300046460 Ga0495638_0130066 Ga0495638_0130066_508_1443 293
741 3300046462 Ga0495651_0029648 Ga0495651_0029648_503_1450 293
742 3300046477 Ga0495664_0017512 Ga0495664_0017512_1151_2074 293
743 3300046511 Ga0495608_0017164 Ga0495608_0017164_914_1861 293
744 3300046512 Ga0495610_0017485 Ga0495610_0017485_3105_4028 293
745 3300046513 Ga0495616_0055709 Ga0495616_0055709_852_1775 293
746 3300046514 Ga0495618_0040481 Ga0495618_0040481_436_1383 293
747 3300046515 Ga0495620_0039154 Ga0495620_0039154_823_1746 293
748 3300046516 Ga0495628_0049588 Ga0495628_0049588_1662_2609 293
749 3300046517 Ga0495630_0064425 Ga0495630_0064425_247_1194 293
750 3300046524 Ga0495648_0083840 Ga0495648_0083840_463_1386 293
751 3300046530 Ga0495654_0063349 Ga0495654_0063349_37_960 293
752 3300046543 Ga0495645_0166188 Ga0495645_0166188_563_1510 293
753 3300046557 Ga0495622_0076382 Ga0495622_0076382_253_1176 293
754 3300046558 Ga0495633_0154965 Ga0495633_0154965_107_1030 293
755 3300046660 Ga0495625_0132418 Ga0495625_0132418_436_1371 293
756 3300046663 Ga0495635_0101394 Ga0495635_0101394_505_1452 293
757 3300046675 Ga0495657_0040051 Ga0495657_0040051_1090_2037 293
758 3300046678 Ga0495599_0015026 Ga0495599_0015026_2979_3926 293
759 3300046679 Ga0495623_0023347 Ga0495623_0023347_1025_1972 293
760 3300046683 Ga0495658_0168364 Ga0495658_0168364_346_1269 293
761 3300046689 Ga0495613_0050119 Ga0495613_0050119_185_1132 293
762 3300046691 Ga0495670_0069276 Ga0495670_0069276_697_1620 293
763 3300047317 Ga0495604_0134073 Ga0495604_0134073_26_997 293
764 3300047320 Ga0495672_0073895 Ga0495672_0073895_407_1393 293
765 3300047322 Ga0495680_0052683 Ga0495680_0052683_2013_2960 293
766 3300047444 Ga0495675_0039960 Ga0495675_0039960_1303_2250 293
767 3300047470 Ga0495681_0029025 Ga0495681_0029025_1228_2151 293
768 3300047472 Ga0495686_0003011 Ga0495686_0003011_696_1619 293
769 3300047472 Ga0495686_0063829 Ga0495686_0063829_361_1284 293
770 3300047472 Ga0495686_0153016 Ga0495686_0153016_62_985 293
771 3300048088 Ga0495602_0098093 Ga0495602_0098093_505_1452 293
772 3300048091 Ga0495626_0044465 Ga0495626_0044465_765_1688 293
773 3300048909 Ga0496106_0019847 Ga0496106_0019847_1359_2282 293
774 3300048913 Ga0496110_0536894 Ga0496110_0536894_121_1044 293
775 3300048915 Ga0496112_0000008 Ga0496112_0000008_83621_84556 293
776 3300048915 Ga0496112_0110949 Ga0496112_0110949_680_1603 293
777 3300048919 Ga0496116_0005652 Ga0496116_0005652_6751_7674 293
778 3300048920 Ga0496117_0010555 Ga0496117_0010555_5023_5946 293
779 3300048920 Ga0496117_0025985 Ga0496117_0025985_1996_2919 293
780 3300048921 Ga0496118_0004640 Ga0496118_0004640_2309_3232 293
781 3300048921 Ga0496118_0014868 Ga0496118_0014868_4725_5648 293
782 3300048921 Ga0496118_0060895 Ga0496118_0060895_1753_2676 293
783 3300048921 Ga0496118_0140636 Ga0496118_0140636_356_1279 293
784 3300048922 Ga0496119_0077897 Ga0496119_0077897_808_1746 293
785 3300048923 Ga0496120_0092531 Ga0496120_0092531_12_935 293
786 3300048924 Ga0496121_0000089 Ga0496121_0000089_69992_70915 293
787 3300048924 Ga0496121_0011201 Ga0496121_0011201_64_987 293
788 3300048924 Ga0496121_0024792 Ga0496121_0024792_4777_5700 293
789 3300048926 Ga0496123_0101772 Ga0496123_0101772_697_1620 293
790 3300048926 Ga0496123_0141288 Ga0496123_0141288_111_1034 293
791 3300048927 Ga0496124_0089884 Ga0496124_0089884_463_1386 293
792 3300048928 Ga0496125_0000712 Ga0496125_0000712_5953_6876 293
793 3300048928 Ga0496125_0000998 Ga0496125_0000998_6429_7352 293
794 3300048928 Ga0496125_0002472 Ga0496125_0002472_8481_9404 293
795 3300048928 Ga0496125_0070584 Ga0496125_0070584_1332_2255 293
796 3300048929 Ga0496126_0003551 Ga0496126_0003551_1204_2127 293
797 3300048929 Ga0496126_0015357 Ga0496126_0015357_4873_5796 293
798 3300048929 Ga0496126_0235865 Ga0496126_0235865_487_1410 293
799 3300049568 Ga0501031_0001824 Ga0501031_0001824_4343_5275 293
800 3300050491 nmdc:mga00v17_27496_c1 nmdc:mga00v17_27496_c1_2270_3193 293
801 3300050512 nmdc:mga0n895_295120_c1 nmdc:mga0n895_295120_c1_43_966 293
802 3300050516 nmdc:mga0sz30_4243_c1 nmdc:mga0sz30_4243_c1_3873_4796 293
803 3300053084 Ga0495595_0029905 Ga0495595_0029905_629_1576 293
804 3300053087 Ga0500643_015424 Ga0500643_015424_587_1510 293
805 3300053094 Ga0500566_0001026 Ga0500566_0001026_12237_13208 293
806 3300053096 Ga0500641_0018888 Ga0500641_0018888_1303_2226 293
807 3300053098 Ga0500650_0001241 Ga0500650_0001241_4411_5334 293
808 3300053104 Ga0500556_0000015 Ga0500556_0000015_198508_199431 293
809 3300053109 Ga0500569_004280 Ga0500569_004280_2047_2970 293
810 3300053118 Ga0500594_0028887 Ga0500594_0028887_39_962 293
811 3300053119 Ga0500595_036315 Ga0500595_036315_180_1103 293
812 3300053122 Ga0500608_013977 Ga0500608_013977_502_1473 293
813 3300053130 Ga0500642_0000019 Ga0500642_0000019_120355_121278 293
814 3300053131 Ga0500652_001339 Ga0500652_001339_1594_2517 293
815 3300053134 Ga0500658_0098688 Ga0500658_0098688_124_1047 293
816 3300053136 Ga0500559_0000396 Ga0500559_0000396_27726_28697 293
817 3300053139 Ga0500568_0003619 Ga0500568_0003619_6393_7316 293
818 3300053151 Ga0500604_0012463 Ga0500604_0012463_786_1709 293
819 3300053153 Ga0500616_0000041 Ga0500616_0000041_31825_32748 293
820 3300053156 Ga0500622_0001685 Ga0500622_0001685_3079_4002 293
821 3300053177 Ga0500636_0000616 Ga0500636_0000616_17594_18565 293
822 3300053177 Ga0500636_0140182 Ga0500636_0140182_294_1217 293
823 3300053178 Ga0500637_0035169 Ga0500637_0035169_588_1559 293
824 3300053729 Ga0500625_044318 Ga0500625_044318_276_1199 293

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09130

DUF1932

Domain of unknown function (DUF1932)

227

298

0.97

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

37

131

0.9

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

37

195

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
7exs-assembly1.cif.gz_A thermomicrobium roseum sarcosine oxidase mutant - s320r 0.9699 9 37
1sez-assembly1.cif.gz_A crystal structure of protoporphyrinogen ix oxidase 0.9651 7 37
6j38-assembly1.cif.gz_B-2 crystal structure of cmis2 0.965 9 37
3i3l-assembly1.cif.gz_A crystal structure of cmls, a flavin-dependent halogenase 0.9615 8 37
6aio-assembly2.cif.gz_B crystal structure of p-nitrophenol 4-monooxygenase pnpa from pseudomonas putida dll-e4 0.9613 10 37
ID Description Score Start End Superfamily
af_A0A1D6E7M3_47_537_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9793 10 37 3.50.50.60
af_Q0D7W4_71_358_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9759 8 37 3.50.50.60
4hb9A01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.969 9 36 3.50.50.60
af_B0G160_35_582_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9628 10 37 3.50.50.60
3i3lA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9615 8 37 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A160U471-F1-model_v4 deleted 0.9835 1 172
AF-A0A6L7ZVD8-F1-model_v4 6-phosphogluconate dehydrogenase 0.9694 8 124 GO:0050661
AF-A0A4V1TYT9-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9627 8 198 GO:0016054
GO:0050661
AF-A0A160U471-F1-model_v4 deleted 0.9614 1 172
AF-A0A2X5B268-F1-model_v4 deleted 0.9566 9 187

Feature Viewer

pLDDT pTM Quality
91.55 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map