F482154
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 818 | 374 | 774 | 286 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2887375801|2887376945 |
| Length | 281 |
| Sequence | RYGPPGEEVPAALDSRDVVRDLSSVCDDITPETLSPQALDRLRAIDLSALPALPAGGRFGVPVRGVSKFIGIGLNYRDHAEEAGMEIPSEPVIFMKTPTSLCGASDNIVQPPHSTKLDYEVELGVVIGTKASHVPEERALDYVAGYCVVNDVSERAFQFQSPSWDKGKGCDTFGPAGPWLVTTDEIADPQQLAMWLDVNGERRQSSDTRNMIFTVQHLVAYCSRYMTLLPGDIIATGTPAGVALGMQSADPWLKVGDRVSLSIAGLGTQSQQVVAWQHPAD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 3 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 4 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 5 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 6 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 7 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 8 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 9 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 10 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 11 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 12 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 13 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 14 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 15 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 16 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 17 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 18 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 19 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 20 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 21 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 22 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 23 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 24 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 25 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 26 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 27 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 28 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 29 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 30 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 31 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 32 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 33 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 34 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 35 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 36 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 37 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 38 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 39 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 40 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 41 | 2941479691 | |||
| 42 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 43 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 44 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 45 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 46 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 47 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 48 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 49 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 50 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 51 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 52 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 53 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 54 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 55 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 56 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 57 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 58 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 59 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 60 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 61 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 62 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 63 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 64 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 65 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 68 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 71 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 73 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 75 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 88 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 91 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 93 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 95 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 96 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 97 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 98 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 99 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 100 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 101 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 102 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 103 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 104 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 105 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 106 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 107 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 108 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 109 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 111 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 112 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 113 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 115 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 116 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 125 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 132 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 136 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 137 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 138 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 142 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 145 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 146 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 150 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 153 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 208 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 209 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 210 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 211 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 212 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 213 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 214 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 215 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 216 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 217 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 218 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 219 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 220 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 221 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 222 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 223 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 224 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 225 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 226 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 227 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 228 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 229 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 230 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 231 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 232 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 233 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 234 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 235 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 236 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 237 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 238 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 239 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 240 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 241 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 242 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 243 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 244 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 245 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 246 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 247 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 248 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 249 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 250 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 251 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 252 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 253 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 254 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 255 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 256 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 257 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 258 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 259 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 260 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 261 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 262 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 263 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 264 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 327 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 328 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 329 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 330 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 331 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 332 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 333 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 334 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 335 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 336 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 337 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 338 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 339 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 340 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 341 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 342 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 343 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 344 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 345 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 346 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 347 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 350 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 357 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 360 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 361 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 362 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 363 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 364 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 365 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 366 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 367 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 368 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 369 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 370 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 371 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 372 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
| 373 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 374 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.25 |
| Metatranscriptomes | 0.37 |
| Isolates | 5.38 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.43 |
| Nodule | 0.12 |
| Rhizoplane | 2.2 |
| Rhizosphere | 72.74 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.51 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3045014 | 2162886007 | Bacteria | 3108 |
| 2 | JGI25158J39367_1000072 | 3300002739 | Bacteria | 23033 |
| 3 | JGI25152J39213_1000002 | 3300002773 | Bacteria | 219237 |
| 4 | JGI25152J39213_1002551 | 3300002773 | Bacteria | 6857 |
| 5 | JGI25150J39212_1000038 | 3300002774 | Bacteria | 88070 |
| 6 | JGI25150J39212_1004440 | 3300002774 | Bacteria | 3121 |
| 7 | JGI25150J39212_1014009 | 3300002774 | Bacteria | 1373 |
| 8 | JGI25159J45721_1000185 | 3300002987 | Bacteria | 28695 |
| 9 | JGI25159J45721_1000254 | 3300002987 | Bacteria | 25167 |
| 10 | JGI25153J46596_10002426 | 3300003215 | Bacteria | 10751 |
| 11 | JGI25160J50197_1010928 | 3300003354 | Bacteria | 3253 |
| 12 | JGI25161J50226_1000062 | 3300003374 | Bacteria | 99783 |
| 13 | JGI25161J50226_1001608 | 3300003374 | Bacteria | 6584 |
| 14 | Ga0007417J51691_1037902 | 3300003544 | Bacteria | 1184 |
| 15 | Ga0007416J51690_1048530 | 3300003577 | Bacteria | 2369 |
| 16 | Ga0032354_1067082 | 3300003693 | Bacteria | 1262 |
| 17 | Ga0055525_1000047 | 3300003759 | Bacteria | 261507 |
| 18 | Ga0055529_1000330 | 3300003763 | Bacteria | 53265 |
| 19 | Ga0055526_1000358 | 3300003771 | Bacteria | 37034 |
| 20 | Ga0055526_1000632 | 3300003771 | Bacteria | 27319 |
| 21 | Ga0055537_1010324 | 3300003773 | Bacteria | 1977 |
| 22 | Ga0055524_1000105 | 3300003775 | Bacteria | 104121 |
| 23 | Ga0055524_1000462 | 3300003775 | Bacteria | 32912 |
| 24 | Ga0055534_1006004 | 3300003784 | Bacteria | 3140 |
| 25 | Ga0055530_10000078 | 3300003791 | Bacteria | 83740 |
| 26 | Ga0055530_10006780 | 3300003791 | Bacteria | 4993 |
| 27 | Ga0055530_10015724 | 3300003791 | Bacteria | 2454 |
| 28 | Ga0055531_10001856 | 3300003794 | Bacteria | 14853 |
| 29 | Ga0055531_10007148 | 3300003794 | Bacteria | 6156 |
| 30 | Ga0055531_10014463 | 3300003794 | Bacteria | 3550 |
| 31 | Ga0055543_1000121 | 3300004625 | Bacteria | 66082 |
| 32 | Ga0055543_1018635 | 3300004625 | Bacteria | 1293 |
| 33 | Ga0065165_1000261 | 3300005262 | Bacteria | 90816 |
| 34 | Ga0065165_1018238 | 3300005262 | Bacteria | 2550 |
| 35 | Ga0065165_1022086 | 3300005262 | Bacteria | 2191 |
| 36 | Ga0065704_10075819 | 3300005289 | Bacteria | 5401 |
| 37 | Ga0065707_10087177 | 3300005295 | Bacteria | 5129 |
| 38 | Ga0070658_10090392 | 3300005327 | Bacteria | 2522 |
| 39 | Ga0070658_10147892 | 3300005327 | Bacteria | 1965 |
| 40 | Ga0070676_10128148 | 3300005328 | Bacteria | 1602 |
| 41 | Ga0070690_100040624 | 3300005330 | Bacteria | 2942 |
| 42 | Ga0070670_100394202 | 3300005331 | Bacteria | 1221 |
| 43 | Ga0070677_10061668 | 3300005333 | Bacteria | 1548 |
| 44 | Ga0068869_100014797 | 3300005334 | Bacteria | 5219 |
| 45 | Ga0070666_10001793 | 3300005335 | Bacteria | 13078 |
| 46 | Ga0070666_10117478 | 3300005335 | Bacteria | 1842 |
| 47 | Ga0068868_100000185 | 3300005338 | Bacteria | 41542 |
| 48 | Ga0068868_100039078 | 3300005338 | Bacteria | 3685 |
| 49 | Ga0070660_100005946 | 3300005339 | Bacteria | 8437 |
| 50 | Ga0070660_100057569 | 3300005339 | Bacteria | 3011 |
| 51 | Ga0070689_100010833 | 3300005340 | Bacteria | 6516 |
| 52 | Ga0070661_100062889 | 3300005344 | Bacteria | 2725 |
| 53 | Ga0070661_100116935 | 3300005344 | Bacteria | 1995 |
| 54 | Ga0070668_100088387 | 3300005347 | Bacteria | 2439 |
| 55 | Ga0070675_100001427 | 3300005354 | Bacteria | 17552 |
| 56 | Ga0070671_100015468 | 3300005355 | Bacteria | 6165 |
| 57 | Ga0070671_100032748 | 3300005355 | Bacteria | 4295 |
| 58 | Ga0070671_100065906 | 3300005355 | Bacteria | 3017 |
| 59 | Ga0070674_100013873 | 3300005356 | Bacteria | 4993 |
| 60 | Ga0070673_100002536 | 3300005364 | Bacteria | 11150 |
| 61 | Ga0070659_100460885 | 3300005366 | Bacteria | 1079 |
| 62 | Ga0070667_100004052 | 3300005367 | Bacteria | 12388 |
| 63 | Ga0070667_100020821 | 3300005367 | Bacteria | 5447 |
| 64 | Ga0070667_100102348 | 3300005367 | Bacteria | 2475 |
| 65 | Ga0070713_100017602 | 3300005436 | Bacteria | 5409 |
| 66 | Ga0070713_100127463 | 3300005436 | Bacteria | 2241 |
| 67 | Ga0070713_100428249 | 3300005436 | Bacteria | 1240 |
| 68 | Ga0070663_100003487 | 3300005455 | Bacteria | 9072 |
| 69 | Ga0070678_100007438 | 3300005456 | Bacteria | 6499 |
| 70 | Ga0070678_100031159 | 3300005456 | Bacteria | 3675 |
| 71 | Ga0070662_100023588 | 3300005457 | Bacteria | 4228 |
| 72 | Ga0070662_100073159 | 3300005457 | Bacteria | 2532 |
| 73 | Ga0068867_100000091 | 3300005459 | Bacteria | 57689 |
| 74 | Ga0068867_100000575 | 3300005459 | Bacteria | 24349 |
| 75 | Ga0068867_100030151 | 3300005459 | Bacteria | 3912 |
| 76 | Ga0070706_100053808 | 3300005467 | Bacteria | 3715 |
| 77 | Ga0070707_100037519 | 3300005468 | Bacteria | 4626 |
| 78 | Ga0070707_100053914 | 3300005468 | Bacteria | 3855 |
| 79 | Ga0068853_100450510 | 3300005539 | Bacteria | 1210 |
| 80 | Ga0070665_100067489 | 3300005548 | Bacteria | 3586 |
| 81 | Ga0068855_100007936 | 3300005563 | Bacteria | 12827 |
| 82 | Ga0068855_100028111 | 3300005563 | Bacteria | 6726 |
| 83 | Ga0068855_100243636 | 3300005563 | Bacteria | 2008 |
| 84 | Ga0068855_100732488 | 3300005563 | Bacteria | 1056 |
| 85 | Ga0070664_100044628 | 3300005564 | Bacteria | 3742 |
| 86 | Ga0070664_100045657 | 3300005564 | Bacteria | 3700 |
| 87 | Ga0068857_100072314 | 3300005577 | Bacteria | 3073 |
| 88 | Ga0068854_100038548 | 3300005578 | Bacteria | 3362 |
| 89 | Ga0068852_100002707 | 3300005616 | Bacteria | 12247 |
| 90 | Ga0068852_100039543 | 3300005616 | Bacteria | 3972 |
| 91 | Ga0068852_100527833 | 3300005616 | Bacteria | 1178 |
| 92 | Ga0068859_100001283 | 3300005617 | Bacteria | 25657 |
| 93 | Ga0068859_100003193 | 3300005617 | Bacteria | 16684 |
| 94 | Ga0068859_100470370 | 3300005617 | Bacteria | 1353 |
| 95 | Ga0068864_100001050 | 3300005618 | Bacteria | 23192 |
| 96 | Ga0068864_100012823 | 3300005618 | Bacteria | 6931 |
| 97 | Ga0068864_100079789 | 3300005618 | Bacteria | 2866 |
| 98 | Ga0068866_10009221 | 3300005718 | Bacteria | 4184 |
| 99 | Ga0068863_100004913 | 3300005841 | Bacteria | 13173 |
| 100 | Ga0068863_100052600 | 3300005841 | Bacteria | 3859 |
| 101 | Ga0068858_100000885 | 3300005842 | Bacteria | 31082 |
| 102 | Ga0068858_100039812 | 3300005842 | Bacteria | 4357 |
| 103 | Ga0081455_10191201 | 3300005937 | Bacteria | 1541 |
| 104 | Ga0075368_10034434 | 3300006042 | Bacteria | 1974 |
| 105 | Ga0075363_100065833 | 3300006048 | Bacteria | 1960 |
| 106 | Ga0075362_10039556 | 3300006177 | Bacteria | 2074 |
| 107 | Ga0075367_10007260 | 3300006178 | Bacteria | 5664 |
| 108 | Ga0075367_10035029 | 3300006178 | Bacteria | 2903 |
| 109 | Ga0075367_10044514 | 3300006178 | Bacteria | 2602 |
| 110 | Ga0075369_10014572 | 3300006186 | Bacteria | 3144 |
| 111 | Ga0075366_10001538 | 3300006195 | Bacteria | 11541 |
| 112 | Ga0075366_10028470 | 3300006195 | Bacteria | 3279 |
| 113 | Ga0075366_10038701 | 3300006195 | Bacteria | 2817 |
| 114 | Ga0075366_10166616 | 3300006195 | Bacteria | 1336 |
| 115 | Ga0075366_10174630 | 3300006195 | Bacteria | 1304 |
| 116 | Ga0075366_10208723 | 3300006195 | Bacteria | 1188 |
| 117 | Ga0097621_100032688 | 3300006237 | Bacteria | 4137 |
| 118 | Ga0075370_10001906 | 3300006353 | Bacteria | 9384 |
| 119 | Ga0075370_10026207 | 3300006353 | Bacteria | 3228 |
| 120 | Ga0075370_10097513 | 3300006353 | Bacteria | 1700 |
| 121 | Ga0075370_10147990 | 3300006353 | Bacteria | 1375 |
| 122 | Ga0075430_100349794 | 3300006846 | Bacteria | 1221 |
| 123 | Ga0068865_100027990 | 3300006881 | Bacteria | 3729 |
| 124 | Ga0097620_100001283 | 3300006931 | Bacteria | 25657 |
| 125 | Ga0097620_100003193 | 3300006931 | Bacteria | 16684 |
| 126 | Ga0097620_100470364 | 3300006931 | Bacteria | 1353 |
| 127 | Ga0097620_100521135 | 3300006931 | Bacteria | 1284 |
| 128 | Ga0099794_10102458 | 3300007265 | Bacteria | 1430 |
| 129 | Ga0099795_10000365 | 3300007788 | Bacteria | 8128 |
| 130 | Ga0105240_10033580 | 3300009093 | Bacteria | 6625 |
| 131 | Ga0105240_10285404 | 3300009093 | Bacteria | 1895 |
| 132 | Ga0105240_10347248 | 3300009093 | Bacteria | 1684 |
| 133 | Ga0111539_10534465 | 3300009094 | Bacteria | 1366 |
| 134 | Ga0105243_10002148 | 3300009148 | Bacteria | 16656 |
| 135 | Ga0105243_10004977 | 3300009148 | Bacteria | 10415 |
| 136 | Ga0105243_10300929 | 3300009148 | Bacteria | 1453 |
| 137 | Ga0105241_10041921 | 3300009174 | Bacteria | 3460 |
| 138 | Ga0105248_10015738 | 3300009177 | Bacteria | 8337 |
| 139 | Ga0105248_10029339 | 3300009177 | Bacteria | 6137 |
| 140 | Ga0105248_10133406 | 3300009177 | Bacteria | 2802 |
| 141 | Ga0105237_10006766 | 3300009545 | Bacteria | 12649 |
| 142 | Ga0105237_10007760 | 3300009545 | Bacteria | 11705 |
| 143 | Ga0105237_10008094 | 3300009545 | Bacteria | 11423 |
| 144 | Ga0105237_10023051 | 3300009545 | Bacteria | 6383 |
| 145 | Ga0105237_10038836 | 3300009545 | Bacteria | 4808 |
| 146 | Ga0105237_10119406 | 3300009545 | Bacteria | 2630 |
| 147 | Ga0105237_10515995 | 3300009545 | Bacteria | 1202 |
| 148 | Ga0105238_10010968 | 3300009551 | Bacteria | 9113 |
| 149 | Ga0105238_10537803 | 3300009551 | Bacteria | 1172 |
| 150 | Ga0105249_10003126 | 3300009553 | Bacteria | 14312 |
| 151 | Ga0099796_10004703 | 3300010159 | Bacteria | 3332 |
| 152 | Ga0105239_10000663 | 3300010375 | Bacteria | 49003 |
| 153 | Ga0105239_10004145 | 3300010375 | Bacteria | 17402 |
| 154 | Ga0105239_10021983 | 3300010375 | Bacteria | 7031 |
| 155 | Ga0105239_10150048 | 3300010375 | Bacteria | 2601 |
| 156 | Ga0157370_10008953 | 3300013104 | Bacteria | 10750 |
| 157 | Ga0157370_10099698 | 3300013104 | Bacteria | 2722 |
| 158 | Ga0157374_10021504 | 3300013296 | Bacteria | 5742 |
| 159 | Ga0163162_10009476 | 3300013306 | Bacteria | 9467 |
| 160 | Ga0163162_10044850 | 3300013306 | Bacteria | 4429 |
| 161 | Ga0163162_10141381 | 3300013306 | Bacteria | 2521 |
| 162 | Ga0157372_10139423 | 3300013307 | Bacteria | 2793 |
| 163 | Ga0157375_10053711 | 3300013308 | Bacteria | 3965 |
| 164 | Ga0182008_10000190 | 3300014497 | Bacteria | 48677 |
| 165 | Ga0182008_10000949 | 3300014497 | Bacteria | 20195 |
| 166 | Ga0157377_10000036 | 3300014745 | Bacteria | 116358 |
| 167 | Ga0157377_10000107 | 3300014745 | Bacteria | 57351 |
| 168 | Ga0157379_10002653 | 3300014968 | Bacteria | 15057 |
| 169 | Ga0157379_10045551 | 3300014968 | Bacteria | 3914 |
| 170 | Ga0157379_10214056 | 3300014968 | Bacteria | 1745 |
| 171 | Ga0157376_10652482 | 3300014969 | Bacteria | 1053 |
| 172 | Ga0157376_10731186 | 3300014969 | Bacteria | 997 |
| 173 | Ga0182006_1000004 | 3300015261 | Bacteria | 622190 |
| 174 | Ga0182007_10000018 | 3300015262 | Bacteria | 198916 |
| 175 | Ga0182007_10001150 | 3300015262 | Bacteria | 14339 |
| 176 | Ga0182005_1000011 | 3300015265 | Bacteria | 420605 |
| 177 | Ga0209436_100005 | 3300025208 | Bacteria | 151087 |
| 178 | Ga0209436_100153 | 3300025208 | Bacteria | 33091 |
| 179 | Ga0209563_100003 | 3300025230 | Bacteria | 1932942 |
| 180 | Ga0207425_1000001 | 3300025245 | Bacteria | 2525432 |
| 181 | Ga0207425_1000033 | 3300025245 | Bacteria | 245540 |
| 182 | Ga0207425_1000430 | 3300025245 | Bacteria | 27743 |
| 183 | Ga0207425_1000883 | 3300025245 | Bacteria | 14568 |
| 184 | Ga0209646_1000106 | 3300025246 | Bacteria | 163422 |
| 185 | Ga0209677_101295 | 3300025253 | Bacteria | 11132 |
| 186 | Ga0209148_1000871 | 3300025254 | Bacteria | 21034 |
| 187 | Ga0209129_1000001 | 3300025258 | Bacteria | 1452436 |
| 188 | Ga0209129_1000841 | 3300025258 | Bacteria | 19262 |
| 189 | Ga0209129_1010442 | 3300025258 | Bacteria | 2315 |
| 190 | Ga0209565_1001351 | 3300025263 | Bacteria | 11117 |
| 191 | Ga0209565_1006156 | 3300025263 | Bacteria | 3398 |
| 192 | Ga0209565_1006380 | 3300025263 | Bacteria | 3314 |
| 193 | Ga0209565_1013441 | 3300025263 | Bacteria | 1916 |
| 194 | Ga0209565_1020588 | 3300025263 | Bacteria | 1390 |
| 195 | Ga0207666_1004244 | 3300025271 | Bacteria | 1790 |
| 196 | Ga0209455_1000033 | 3300025272 | Bacteria | 504606 |
| 197 | Ga0209130_1000055 | 3300025284 | Bacteria | 211696 |
| 198 | Ga0209130_1000592 | 3300025284 | Bacteria | 35299 |
| 199 | Ga0209675_1005505 | 3300025291 | Bacteria | 5286 |
| 200 | Ga0209676_1000136 | 3300025292 | Bacteria | 181860 |
| 201 | Ga0209676_1004568 | 3300025292 | Bacteria | 7660 |
| 202 | Ga0209025_1016139 | 3300025294 | Bacteria | 4439 |
| 203 | Ga0209564_1000124 | 3300025295 | Bacteria | 202046 |
| 204 | Ga0209564_1000162 | 3300025295 | Bacteria | 162265 |
| 205 | Ga0209564_1006907 | 3300025295 | Bacteria | 5976 |
| 206 | Ga0209758_1000020 | 3300025297 | Bacteria | 734220 |
| 207 | Ga0209758_1000152 | 3300025297 | Bacteria | 162418 |
| 208 | Ga0209758_1003711 | 3300025297 | Bacteria | 13539 |
| 209 | Ga0209050_1000011 | 3300025298 | Bacteria | 914037 |
| 210 | Ga0209050_1000238 | 3300025298 | Bacteria | 119729 |
| 211 | Ga0209050_1000313 | 3300025298 | Bacteria | 98580 |
| 212 | Ga0209256_1000028 | 3300025299 | Bacteria | 420213 |
| 213 | Ga0209256_1001270 | 3300025299 | Bacteria | 27521 |
| 214 | Ga0209256_1011459 | 3300025299 | Bacteria | 3541 |
| 215 | Ga0209256_1026092 | 3300025299 | Bacteria | 1690 |
| 216 | Ga0207426_1000818 | 3300025302 | Bacteria | 33399 |
| 217 | Ga0209051_1002074 | 3300025303 | Bacteria | 15151 |
| 218 | Ga0209051_1068898 | 3300025303 | Bacteria | 1074 |
| 219 | Ga0209257_1000003 | 3300025304 | Bacteria | 1702593 |
| 220 | Ga0209257_1000142 | 3300025304 | Bacteria | 200756 |
| 221 | Ga0209257_1000710 | 3300025304 | Bacteria | 51515 |
| 222 | Ga0209257_1003802 | 3300025304 | Bacteria | 12422 |
| 223 | Ga0209257_1016214 | 3300025304 | Bacteria | 3032 |
| 224 | Ga0207655_1017922 | 3300025728 | Bacteria | 3791 |
| 225 | Ga0207642_10002078 | 3300025899 | Bacteria | 6189 |
| 226 | Ga0207680_10000931 | 3300025903 | Bacteria | 13816 |
| 227 | Ga0207645_10134585 | 3300025907 | Bacteria | 1609 |
| 228 | Ga0207645_10217032 | 3300025907 | Bacteria | 1260 |
| 229 | Ga0207705_10000481 | 3300025909 | Bacteria | 34247 |
| 230 | Ga0207705_10008110 | 3300025909 | Bacteria | 7695 |
| 231 | Ga0207705_10105830 | 3300025909 | Bacteria | 2074 |
| 232 | Ga0207705_10267695 | 3300025909 | Bacteria | 1306 |
| 233 | Ga0207684_10011762 | 3300025910 | Bacteria | 7633 |
| 234 | Ga0207684_10045998 | 3300025910 | Bacteria | 3703 |
| 235 | Ga0207654_10032395 | 3300025911 | Bacteria | 2888 |
| 236 | Ga0207695_10006045 | 3300025913 | Bacteria | 15798 |
| 237 | Ga0207695_10015843 | 3300025913 | Bacteria | 8855 |
| 238 | Ga0207695_10022800 | 3300025913 | Bacteria | 7093 |
| 239 | Ga0207695_10153996 | 3300025913 | Bacteria | 2235 |
| 240 | Ga0207695_10305994 | 3300025913 | Bacteria | 1480 |
| 241 | Ga0207671_10006346 | 3300025914 | Bacteria | 10548 |
| 242 | Ga0207671_10007479 | 3300025914 | Bacteria | 9474 |
| 243 | Ga0207671_10016293 | 3300025914 | Bacteria | 5781 |
| 244 | Ga0207671_10037912 | 3300025914 | Bacteria | 3573 |
| 245 | Ga0207657_10001383 | 3300025919 | Bacteria | 25890 |
| 246 | Ga0207657_10003004 | 3300025919 | Bacteria | 18072 |
| 247 | Ga0207657_10051608 | 3300025919 | Bacteria | 3575 |
| 248 | Ga0207649_10017322 | 3300025920 | Bacteria | 4083 |
| 249 | Ga0207649_10281189 | 3300025920 | Bacteria | 1210 |
| 250 | Ga0207652_10012965 | 3300025921 | Bacteria | 6745 |
| 251 | Ga0207652_10026937 | 3300025921 | Bacteria | 4790 |
| 252 | Ga0207681_10004760 | 3300025923 | Bacteria | 8353 |
| 253 | Ga0207681_10124342 | 3300025923 | Bacteria | 1897 |
| 254 | Ga0207694_10005550 | 3300025924 | Bacteria | 9668 |
| 255 | Ga0207694_10306244 | 3300025924 | Bacteria | 1309 |
| 256 | Ga0207659_10007353 | 3300025926 | Bacteria | 6770 |
| 257 | Ga0207687_10136900 | 3300025927 | Bacteria | 1853 |
| 258 | Ga0207700_10063851 | 3300025928 | Bacteria | 2802 |
| 259 | Ga0207700_10238989 | 3300025928 | Bacteria | 1547 |
| 260 | Ga0207644_10000635 | 3300025931 | Bacteria | 22259 |
| 261 | Ga0207644_10073826 | 3300025931 | Bacteria | 2502 |
| 262 | Ga0207644_10213875 | 3300025931 | Bacteria | 1525 |
| 263 | Ga0207690_10115771 | 3300025932 | Bacteria | 1938 |
| 264 | Ga0207690_10150778 | 3300025932 | Bacteria | 1723 |
| 265 | Ga0207706_10002765 | 3300025933 | Bacteria | 17065 |
| 266 | Ga0207706_10091551 | 3300025933 | Bacteria | 2673 |
| 267 | Ga0207706_10194269 | 3300025933 | Bacteria | 1781 |
| 268 | Ga0207706_10272887 | 3300025933 | Bacteria | 1476 |
| 269 | Ga0207709_10002921 | 3300025935 | Bacteria | 10435 |
| 270 | Ga0207709_10014308 | 3300025935 | Bacteria | 4380 |
| 271 | Ga0207709_10076157 | 3300025935 | Bacteria | 2147 |
| 272 | Ga0207709_10111399 | 3300025935 | Bacteria | 1831 |
| 273 | Ga0207709_10399284 | 3300025935 | Bacteria | 1051 |
| 274 | Ga0207669_10489982 | 3300025937 | Bacteria | 981 |
| 275 | Ga0207704_10015573 | 3300025938 | Bacteria | 3880 |
| 276 | Ga0207704_10537849 | 3300025938 | Bacteria | 947 |
| 277 | Ga0207711_10007617 | 3300025941 | Bacteria | 9056 |
| 278 | Ga0207689_10050185 | 3300025942 | Bacteria | 3441 |
| 279 | Ga0207689_10083483 | 3300025942 | Bacteria | 2626 |
| 280 | Ga0207661_10529876 | 3300025944 | Bacteria | 1078 |
| 281 | Ga0207679_10021508 | 3300025945 | Bacteria | 4375 |
| 282 | Ga0207667_10001977 | 3300025949 | Bacteria | 25684 |
| 283 | Ga0207667_10003039 | 3300025949 | Bacteria | 20823 |
| 284 | Ga0207667_10006345 | 3300025949 | Bacteria | 14335 |
| 285 | Ga0207667_10306085 | 3300025949 | Bacteria | 1623 |
| 286 | Ga0207712_10001798 | 3300025961 | Bacteria | 14217 |
| 287 | Ga0207712_10002005 | 3300025961 | Bacteria | 13376 |
| 288 | Ga0207668_10430596 | 3300025972 | Bacteria | 1122 |
| 289 | Ga0207640_10069116 | 3300025981 | Bacteria | 2370 |
| 290 | Ga0207658_10005671 | 3300025986 | Bacteria | 8539 |
| 291 | Ga0207677_10002592 | 3300026023 | Bacteria | 9508 |
| 292 | Ga0207677_10053176 | 3300026023 | Bacteria | 2755 |
| 293 | Ga0207703_10001221 | 3300026035 | Bacteria | 24024 |
| 294 | Ga0207703_10312239 | 3300026035 | Bacteria | 1437 |
| 295 | Ga0207678_10008575 | 3300026067 | Bacteria | 9006 |
| 296 | Ga0207641_10025598 | 3300026088 | Bacteria | 4864 |
| 297 | Ga0207641_10027564 | 3300026088 | Bacteria | 4692 |
| 298 | Ga0207641_10052325 | 3300026088 | Bacteria | 3458 |
| 299 | Ga0207648_10000037 | 3300026089 | Bacteria | 120856 |
| 300 | Ga0207648_10000227 | 3300026089 | Bacteria | 60175 |
| 301 | Ga0207676_10001143 | 3300026095 | Bacteria | 19992 |
| 302 | Ga0207676_10038637 | 3300026095 | Bacteria | 3645 |
| 303 | Ga0207676_10746276 | 3300026095 | Bacteria | 951 |
| 304 | Ga0207674_10018123 | 3300026116 | Bacteria | 7660 |
| 305 | Ga0207674_10139145 | 3300026116 | Bacteria | 2388 |
| 306 | Ga0207674_10144764 | 3300026116 | Bacteria | 2335 |
| 307 | Ga0207674_10193829 | 3300026116 | Bacteria | 1982 |
| 308 | Ga0207674_10325891 | 3300026116 | Bacteria | 1485 |
| 309 | Ga0207675_100008494 | 3300026118 | Bacteria | 9669 |
| 310 | Ga0207683_10006411 | 3300026121 | Bacteria | 10076 |
| 311 | Ga0207683_10017139 | 3300026121 | Bacteria | 6167 |
| 312 | Ga0207698_10002142 | 3300026142 | Bacteria | 11658 |
| 313 | Ga0209179_1004020 | 3300027512 | Bacteria | 2183 |
| 314 | Ga0209813_10022180 | 3300027866 | Bacteria | 1793 |
| 315 | Ga0209974_10003999 | 3300027876 | Bacteria | 5273 |
| 316 | Ga0209974_10051954 | 3300027876 | Bacteria | 1379 |
| 317 | Ga0268266_10014233 | 3300028379 | Bacteria | 6842 |
| 318 | Ga0268266_10195998 | 3300028379 | Bacteria | 1846 |
| 319 | Ga0268266_10347295 | 3300028379 | Bacteria | 1394 |
| 320 | Ga0268265_10051838 | 3300028380 | Bacteria | 3099 |
| 321 | Ga0268265_10091944 | 3300028380 | Bacteria | 2427 |
| 322 | Ga0268264_10005954 | 3300028381 | Bacteria | 10319 |
| 323 | Ga0265337_1026696 | 3300028556 | Bacteria | 1747 |
| 324 | Ga0307517_10002278 | 3300028786 | Bacteria | 30957 |
| 325 | Ga0307515_10000525 | 3300028794 | Bacteria | 91297 |
| 326 | Ga0307515_10016038 | 3300028794 | Bacteria | 13751 |
| 327 | Ga0307515_10018830 | 3300028794 | Bacteria | 12464 |
| 328 | Ga0307515_10086362 | 3300028794 | Bacteria | 4000 |
| 329 | Ga0307515_10091070 | 3300028794 | Bacteria | 3815 |
| 330 | Ga0307515_10149059 | 3300028794 | Bacteria | 2457 |
| 331 | Ga0307515_10157370 | 3300028794 | Bacteria | 2337 |
| 332 | Ga0316177_1033553 | 3300030731 | Bacteria | 1343 |
| 333 | Ga0316177_1163442 | 3300030731 | Bacteria | 1310 |
| 334 | Ga0316182_1128715 | 3300030745 | Bacteria | 2269 |
| 335 | Ga0265320_10017913 | 3300031240 | Bacteria | 3916 |
| 336 | Ga0265339_10006224 | 3300031249 | Bacteria | 7857 |
| 337 | Ga0265327_10106312 | 3300031251 | Bacteria | 1347 |
| 338 | Ga0307513_10104938 | 3300031456 | Bacteria | 2837 |
| 339 | Ga0307513_10217135 | 3300031456 | Bacteria | 1737 |
| 340 | Ga0307513_10329004 | 3300031456 | Bacteria | 1283 |
| 341 | Ga0307509_10000157 | 3300031507 | Bacteria | 106022 |
| 342 | Ga0307509_10005739 | 3300031507 | Bacteria | 17088 |
| 343 | Ga0307509_10030138 | 3300031507 | Bacteria | 6005 |
| 344 | Ga0307509_10034314 | 3300031507 | Bacteria | 5574 |
| 345 | Ga0307509_10206077 | 3300031507 | Bacteria | 1797 |
| 346 | Ga0307509_10356449 | 3300031507 | Bacteria | 1184 |
| 347 | Ga0307408_100000022 | 3300031548 | Bacteria | 310242 |
| 348 | Ga0307408_100000046 | 3300031548 | Bacteria | 167686 |
| 349 | Ga0307408_100001037 | 3300031548 | Bacteria | 21346 |
| 350 | Ga0307408_100001365 | 3300031548 | Bacteria | 18206 |
| 351 | Ga0307408_100003010 | 3300031548 | Bacteria | 11653 |
| 352 | Ga0307408_100084007 | 3300031548 | Bacteria | 2387 |
| 353 | Ga0307408_100090754 | 3300031548 | Bacteria | 2306 |
| 354 | Ga0307408_100227833 | 3300031548 | Bacteria | 1524 |
| 355 | Ga0307508_10000048 | 3300031616 | Bacteria | 137587 |
| 356 | Ga0307508_10045664 | 3300031616 | Bacteria | 3913 |
| 357 | Ga0307508_10071542 | 3300031616 | Bacteria | 3042 |
| 358 | Ga0307508_10086959 | 3300031616 | Bacteria | 2710 |
| 359 | Ga0307514_10028808 | 3300031649 | Bacteria | 4475 |
| 360 | Ga0307514_10053972 | 3300031649 | Bacteria | 3099 |
| 361 | Ga0265314_10089759 | 3300031711 | Bacteria | 2004 |
| 362 | Ga0307405_10283079 | 3300031731 | Bacteria | 1249 |
| 363 | Ga0307407_10339071 | 3300031903 | Bacteria | 1061 |
| 364 | Ga0307412_10029815 | 3300031911 | Bacteria | 3428 |
| 365 | Ga0307412_10071852 | 3300031911 | Bacteria | 2363 |
| 366 | Ga0307416_100360100 | 3300032002 | Bacteria | 1476 |
| 367 | Ga0307416_100551542 | 3300032002 | Bacteria | 1226 |
| 368 | Ga0307414_10222409 | 3300032004 | Bacteria | 1551 |
| 369 | Ga0307414_10233689 | 3300032004 | Bacteria | 1517 |
| 370 | Ga0307510_10000883 | 3300033180 | Bacteria | 31532 |
| 371 | Ga0307510_10010444 | 3300033180 | Bacteria | 11029 |
| 372 | Ga0373939_0037803 | 3300035114 | Bacteria | 1436 |
| 373 | Ga0373943_0092010 | 3300035170 | Bacteria | 1572 |
| 374 | Ga0373931_0035876 | 3300035691 | Bacteria | 2581 |
| 375 | Ga0373947_0049489 | 3300035725 | Bacteria | 2524 |
| 376 | Ga0373937_0005178 | 3300036401 | Bacteria | 11125 |
| 377 | Ga0373925_0017299 | 3300037068 | Bacteria | 5224 |
| 378 | Ga0373925_0190579 | 3300037068 | Bacteria | 1627 |
| 379 | Ga0373925_0260437 | 3300037068 | Bacteria | 1393 |
| 380 | Ga0395899_0001092 | 3300037312 | Bacteria | 24358 |
| 381 | Ga0395899_0002955 | 3300037312 | Bacteria | 13605 |
| 382 | Ga0395899_0005351 | 3300037312 | Bacteria | 9972 |
| 383 | Ga0395899_0014220 | 3300037312 | Bacteria | 6074 |
| 384 | Ga0395899_0022519 | 3300037312 | Bacteria | 4775 |
| 385 | Ga0395899_0044223 | 3300037312 | Bacteria | 3320 |
| 386 | Ga0395899_0094703 | 3300037312 | Bacteria | 2160 |
| 387 | Ga0395900_0000081 | 3300037418 | Bacteria | 174128 |
| 388 | Ga0395900_0000148 | 3300037418 | Bacteria | 117889 |
| 389 | Ga0395900_0001208 | 3300037418 | Bacteria | 31966 |
| 390 | Ga0395900_0003059 | 3300037418 | Bacteria | 18210 |
| 391 | Ga0395900_0036687 | 3300037418 | Bacteria | 5054 |
| 392 | Ga0395900_0057623 | 3300037418 | Bacteria | 3999 |
| 393 | Ga0395900_0136768 | 3300037418 | Bacteria | 2510 |
| 394 | Ga0395898_0000201 | 3300037466 | Bacteria | 153821 |
| 395 | Ga0395898_0119308 | 3300037466 | Bacteria | 2526 |
| 396 | Ga0395898_0241195 | 3300037466 | Bacteria | 1724 |
| 397 | Ga0395905_0009494 | 3300037471 | Bacteria | 9509 |
| 398 | Ga0395905_0017108 | 3300037471 | Bacteria | 6886 |
| 399 | Ga0395905_0127464 | 3300037471 | Bacteria | 2393 |
| 400 | Ga0395905_0307363 | 3300037471 | Bacteria | 1474 |
| 401 | Ga0436364_0407173 | 3300037853 | Bacteria | 1714 |
| 402 | Ga0395901_0000237 | 3300038443 | Bacteria | 69208 |
| 403 | Ga0395901_0090868 | 3300038443 | Bacteria | 3196 |
| 404 | Ga0395901_0172932 | 3300038443 | Bacteria | 2266 |
| 405 | Ga0395901_0308767 | 3300038443 | Bacteria | 1638 |
| 406 | Ga0436360_0544857 | 3300039438 | Bacteria | 2684 |
| 407 | Ga0436362_0381357 | 3300039453 | Bacteria | 2175 |
| 408 | Ga0439465_0053030 | 3300041413 | Bacteria | 1332 |
| 409 | Ga0451853_2845666 | 3300041512 | Bacteria | 1395 |
| 410 | Ga0439431_0006250 | 3300041997 | Bacteria | 2629 |
| 411 | Ga0439448_0000555 | 3300042005 | Bacteria | 8742 |
| 412 | Ga0439449_0021002 | 3300042007 | Bacteria | 2446 |
| 413 | Ga0450898_006057 | 3300042134 | Bacteria | 1846 |
| 414 | Ga0451577_0051628 | 3300042876 | Bacteria | 3671 |
| 415 | Ga0451577_0094783 | 3300042876 | Bacteria | 2665 |
| 416 | Ga0466969_0000232 | 3300044656 | Bacteria | 30397 |
| 417 | Ga0466969_0006699 | 3300044656 | Bacteria | 6125 |
| 418 | Ga0466969_0014607 | 3300044656 | Bacteria | 4128 |
| 419 | Ga0466969_0035390 | 3300044656 | Bacteria | 2525 |
| 420 | Ga0466972_0000383 | 3300044658 | Bacteria | 23678 |
| 421 | Ga0466972_0000568 | 3300044658 | Bacteria | 18002 |
| 422 | Ga0466972_0006200 | 3300044658 | Bacteria | 6009 |
| 423 | Ga0466972_0036061 | 3300044658 | Bacteria | 2420 |
| 424 | Ga0466965_0000082 | 3300044683 | Bacteria | 27799 |
| 425 | Ga0466965_0001230 | 3300044683 | Bacteria | 10128 |
| 426 | Ga0466965_0005218 | 3300044683 | Bacteria | 5839 |
| 427 | Ga0466965_0085184 | 3300044683 | Bacteria | 1602 |
| 428 | Ga0466966_0000428 | 3300044684 | Bacteria | 27011 |
| 429 | Ga0466966_0002106 | 3300044684 | Bacteria | 12927 |
| 430 | Ga0466966_0004513 | 3300044684 | Bacteria | 9186 |
| 431 | Ga0466966_0005887 | 3300044684 | Bacteria | 8086 |
| 432 | Ga0466966_0009166 | 3300044684 | Bacteria | 6552 |
| 433 | Ga0466966_0023505 | 3300044684 | Bacteria | 4034 |
| 434 | Ga0466966_0032955 | 3300044684 | Bacteria | 3354 |
| 435 | Ga0466966_0072487 | 3300044684 | Bacteria | 2156 |
| 436 | Ga0466966_0254042 | 3300044684 | Bacteria | 1059 |
| 437 | Ga0466961_0000229 | 3300044693 | Bacteria | 37957 |
| 438 | Ga0466961_0006081 | 3300044693 | Bacteria | 7655 |
| 439 | Ga0466961_0019174 | 3300044693 | Bacteria | 4402 |
| 440 | Ga0466961_0151018 | 3300044693 | Bacteria | 1450 |
| 441 | Ga0466961_0203342 | 3300044693 | Bacteria | 1224 |
| 442 | Ga0466963_0005033 | 3300044694 | Bacteria | 7722 |
| 443 | Ga0466963_0069977 | 3300044694 | Bacteria | 2360 |
| 444 | Ga0466964_0000492 | 3300044706 | Bacteria | 12242 |
| 445 | Ga0466964_0002109 | 3300044706 | Bacteria | 7004 |
| 446 | Ga0466964_0013400 | 3300044706 | Bacteria | 3111 |
| 447 | Ga0466971_0035615 | 3300044719 | Bacteria | 2232 |
| 448 | Ga0466968_0000879 | 3300044735 | Bacteria | 10556 |
| 449 | Ga0466968_0013820 | 3300044735 | Bacteria | 3179 |
| 450 | Ga0466970_0008945 | 3300044765 | Bacteria | 5050 |
| 451 | Ga0466970_0040109 | 3300044765 | Bacteria | 2486 |
| 452 | Ga0466970_0054294 | 3300044765 | Bacteria | 2140 |
| 453 | Ga0466970_0087732 | 3300044765 | Bacteria | 1687 |
| 454 | Ga0466957_0000337 | 3300044842 | Bacteria | 22931 |
| 455 | Ga0466957_0005060 | 3300044842 | Bacteria | 7379 |
| 456 | Ga0466957_0010664 | 3300044842 | Bacteria | 5282 |
| 457 | Ga0466960_0061170 | 3300044901 | Bacteria | 1848 |
| 458 | Ga0466959_0013955 | 3300045049 | Bacteria | 5832 |
| 459 | Ga0466959_0018046 | 3300045049 | Bacteria | 5177 |
| 460 | Ga0466959_0076778 | 3300045049 | Bacteria | 2411 |
| 461 | Ga0466959_0113022 | 3300045049 | Bacteria | 1936 |
| 462 | Ga0451576_0089607 | 3300045051 | Bacteria | 3199 |
| 463 | Ga0466958_0005517 | 3300045836 | Bacteria | 6820 |
| 464 | Ga0466958_0021614 | 3300045836 | Bacteria | 3763 |
| 465 | Ga0466958_0148404 | 3300045836 | Bacteria | 1478 |
| 466 | Ga0466967_0693098 | 3300045976 | Bacteria | 1009 |
| 467 | Ga0495592_0000058 | 3300046454 | Bacteria | 101492 |
| 468 | Ga0495590_0000016 | 3300046457 | Bacteria | 225874 |
| 469 | Ga0495590_0044047 | 3300046457 | Bacteria | 1556 |
| 470 | Ga0495638_0000057 | 3300046460 | Bacteria | 193690 |
| 471 | Ga0495653_0003297 | 3300046463 | Bacteria | 12950 |
| 472 | Ga0495650_0002031 | 3300046471 | Bacteria | 17703 |
| 473 | Ga0495580_0019602 | 3300046472 | Bacteria | 5025 |
| 474 | Ga0495580_0242368 | 3300046472 | Bacteria | 1236 |
| 475 | Ga0495605_0000684 | 3300046474 | Bacteria | 25383 |
| 476 | Ga0495605_0003913 | 3300046474 | Bacteria | 8818 |
| 477 | Ga0495605_0064763 | 3300046474 | Bacteria | 1740 |
| 478 | Ga0495639_0009356 | 3300046475 | Bacteria | 4203 |
| 479 | Ga0495584_0000915 | 3300046491 | Bacteria | 18831 |
| 480 | Ga0495584_0002336 | 3300046491 | Bacteria | 10810 |
| 481 | Ga0495584_0003323 | 3300046491 | Bacteria | 8900 |
| 482 | Ga0495584_0011193 | 3300046491 | Bacteria | 4597 |
| 483 | Ga0495585_0000005 | 3300046492 | Bacteria | 328103 |
| 484 | Ga0495585_0000162 | 3300046492 | Bacteria | 71606 |
| 485 | Ga0495585_0007241 | 3300046492 | Bacteria | 6813 |
| 486 | Ga0495585_0009385 | 3300046492 | Bacteria | 5868 |
| 487 | Ga0495585_0036768 | 3300046492 | Bacteria | 2759 |
| 488 | Ga0495585_0041772 | 3300046492 | Bacteria | 2571 |
| 489 | Ga0495585_0071056 | 3300046492 | Bacteria | 1897 |
| 490 | Ga0495585_0130399 | 3300046492 | Bacteria | 1323 |
| 491 | Ga0495596_0000013 | 3300046500 | Bacteria | 125228 |
| 492 | Ga0495596_0000833 | 3300046500 | Bacteria | 18653 |
| 493 | Ga0495596_0000901 | 3300046500 | Bacteria | 17803 |
| 494 | Ga0495596_0003244 | 3300046500 | Bacteria | 8321 |
| 495 | Ga0495607_0000316 | 3300046501 | Bacteria | 50215 |
| 496 | Ga0495607_0001702 | 3300046501 | Bacteria | 18913 |
| 497 | Ga0495607_0003182 | 3300046501 | Bacteria | 12691 |
| 498 | Ga0495607_0003268 | 3300046501 | Bacteria | 12466 |
| 499 | Ga0495607_0021859 | 3300046501 | Bacteria | 4023 |
| 500 | Ga0495583_0000189 | 3300046506 | Bacteria | 103518 |
| 501 | Ga0495583_0000655 | 3300046506 | Bacteria | 45614 |
| 502 | Ga0495583_0000688 | 3300046506 | Bacteria | 43737 |
| 503 | Ga0495583_0002721 | 3300046506 | Bacteria | 14634 |
| 504 | Ga0495583_0013411 | 3300046506 | Bacteria | 4571 |
| 505 | Ga0495583_0041851 | 3300046506 | Bacteria | 2143 |
| 506 | Ga0495583_0090147 | 3300046506 | Bacteria | 1321 |
| 507 | Ga0495606_0000070 | 3300046507 | Bacteria | 177343 |
| 508 | Ga0495606_0003081 | 3300046507 | Bacteria | 18174 |
| 509 | Ga0495606_0052909 | 3300046507 | Bacteria | 2637 |
| 510 | Ga0495606_0054698 | 3300046507 | Bacteria | 2584 |
| 511 | Ga0495606_0229514 | 3300046507 | Bacteria | 1041 |
| 512 | Ga0495610_0004252 | 3300046512 | Bacteria | 10662 |
| 513 | Ga0495610_0026614 | 3300046512 | Bacteria | 3087 |
| 514 | Ga0495616_0000646 | 3300046513 | Bacteria | 25901 |
| 515 | Ga0495616_0000799 | 3300046513 | Bacteria | 23070 |
| 516 | Ga0495616_0001668 | 3300046513 | Bacteria | 15169 |
| 517 | Ga0495616_0019559 | 3300046513 | Bacteria | 3693 |
| 518 | Ga0495616_0040554 | 3300046513 | Bacteria | 2378 |
| 519 | Ga0495616_0046894 | 3300046513 | Bacteria | 2179 |
| 520 | Ga0495616_0084619 | 3300046513 | Bacteria | 1511 |
| 521 | Ga0495620_0001634 | 3300046515 | Bacteria | 13278 |
| 522 | Ga0495628_0000109 | 3300046516 | Bacteria | 67425 |
| 523 | Ga0495631_0004026 | 3300046518 | Bacteria | 7909 |
| 524 | Ga0495631_0010136 | 3300046518 | Bacteria | 4677 |
| 525 | Ga0495631_0028238 | 3300046518 | Bacteria | 2560 |
| 526 | Ga0495631_0039780 | 3300046518 | Bacteria | 2084 |
| 527 | Ga0495632_0000118 | 3300046519 | Bacteria | 81183 |
| 528 | Ga0495632_0000321 | 3300046519 | Bacteria | 46253 |
| 529 | Ga0495632_0001878 | 3300046519 | Bacteria | 16853 |
| 530 | Ga0495632_0006806 | 3300046519 | Bacteria | 7295 |
| 531 | Ga0495632_0014187 | 3300046519 | Bacteria | 4518 |
| 532 | Ga0495632_0038404 | 3300046519 | Bacteria | 2424 |
| 533 | Ga0495637_0023384 | 3300046520 | Bacteria | 2810 |
| 534 | Ga0495637_0075744 | 3300046520 | Bacteria | 1349 |
| 535 | Ga0495643_0000236 | 3300046522 | Bacteria | 83225 |
| 536 | Ga0495643_0002480 | 3300046522 | Bacteria | 14537 |
| 537 | Ga0495643_0050575 | 3300046522 | Bacteria | 2238 |
| 538 | Ga0495643_0066689 | 3300046522 | Bacteria | 1898 |
| 539 | Ga0495644_0001385 | 3300046523 | Bacteria | 9910 |
| 540 | Ga0495644_0027680 | 3300046523 | Bacteria | 2147 |
| 541 | Ga0495648_0000002 | 3300046524 | Bacteria | 593972 |
| 542 | Ga0495648_0000033 | 3300046524 | Bacteria | 199184 |
| 543 | Ga0495648_0007546 | 3300046524 | Bacteria | 8693 |
| 544 | Ga0495648_0043992 | 3300046524 | Bacteria | 2792 |
| 545 | Ga0495663_0001760 | 3300046525 | Bacteria | 6719 |
| 546 | Ga0495663_0067745 | 3300046525 | Bacteria | 1132 |
| 547 | Ga0495642_0000673 | 3300046528 | Bacteria | 17015 |
| 548 | Ga0495642_0005081 | 3300046528 | Bacteria | 5067 |
| 549 | Ga0495642_0008493 | 3300046528 | Bacteria | 3928 |
| 550 | Ga0495652_0082260 | 3300046529 | Bacteria | 2654 |
| 551 | Ga0495652_0123081 | 3300046529 | Bacteria | 2065 |
| 552 | Ga0495654_0014733 | 3300046530 | Bacteria | 4157 |
| 553 | Ga0495654_0050233 | 3300046530 | Bacteria | 2039 |
| 554 | Ga0495640_0140977 | 3300046533 | Bacteria | 1554 |
| 555 | Ga0495609_0000001 | 3300046538 | Bacteria | 1060094 |
| 556 | Ga0495609_0000084 | 3300046538 | Bacteria | 113497 |
| 557 | Ga0495609_0059233 | 3300046538 | Bacteria | 1693 |
| 558 | Ga0495621_0008835 | 3300046539 | Bacteria | 3036 |
| 559 | Ga0495597_0000028 | 3300046542 | Bacteria | 137215 |
| 560 | Ga0495597_0000080 | 3300046542 | Bacteria | 84504 |
| 561 | Ga0495597_0005046 | 3300046542 | Bacteria | 7065 |
| 562 | Ga0495597_0021109 | 3300046542 | Bacteria | 3028 |
| 563 | Ga0495597_0023629 | 3300046542 | Bacteria | 2843 |
| 564 | Ga0495597_0036901 | 3300046542 | Bacteria | 2198 |
| 565 | Ga0495645_0096352 | 3300046543 | Bacteria | 2108 |
| 566 | Ga0495622_0000483 | 3300046557 | Bacteria | 25083 |
| 567 | Ga0495622_0029884 | 3300046557 | Bacteria | 2545 |
| 568 | Ga0495633_0000204 | 3300046558 | Bacteria | 75182 |
| 569 | Ga0495633_0000399 | 3300046558 | Bacteria | 45392 |
| 570 | Ga0495633_0009652 | 3300046558 | Bacteria | 5312 |
| 571 | Ga0495633_0019359 | 3300046558 | Bacteria | 3444 |
| 572 | Ga0495633_0052919 | 3300046558 | Bacteria | 1911 |
| 573 | Ga0495656_0007073 | 3300046615 | Bacteria | 3957 |
| 574 | Ga0495656_0028866 | 3300046615 | Bacteria | 2228 |
| 575 | Ga0495656_0075010 | 3300046615 | Bacteria | 1512 |
| 576 | Ga0495668_0000006 | 3300046616 | Bacteria | 553404 |
| 577 | Ga0495668_0000132 | 3300046616 | Bacteria | 112674 |
| 578 | Ga0495668_0003093 | 3300046616 | Bacteria | 12858 |
| 579 | Ga0495668_0009077 | 3300046616 | Bacteria | 6136 |
| 580 | Ga0495668_0010419 | 3300046616 | Bacteria | 5624 |
| 581 | Ga0495668_0013502 | 3300046616 | Bacteria | 4814 |
| 582 | Ga0495668_0064593 | 3300046616 | Bacteria | 2014 |
| 583 | Ga0495611_0001712 | 3300046648 | Bacteria | 10645 |
| 584 | Ga0495611_0010146 | 3300046648 | Bacteria | 3984 |
| 585 | Ga0495611_0016943 | 3300046648 | Bacteria | 3115 |
| 586 | Ga0495625_0000143 | 3300046660 | Bacteria | 110121 |
| 587 | Ga0495625_0000177 | 3300046660 | Bacteria | 98918 |
| 588 | Ga0495625_0001203 | 3300046660 | Bacteria | 32899 |
| 589 | Ga0495625_0010429 | 3300046660 | Bacteria | 7690 |
| 590 | Ga0495625_0042302 | 3300046660 | Bacteria | 3312 |
| 591 | Ga0495625_0065650 | 3300046660 | Bacteria | 2558 |
| 592 | Ga0495625_0134454 | 3300046660 | Bacteria | 1673 |
| 593 | Ga0495659_0000185 | 3300046664 | Bacteria | 27168 |
| 594 | Ga0495659_0024668 | 3300046664 | Bacteria | 2052 |
| 595 | Ga0495661_0000053 | 3300046665 | Bacteria | 140234 |
| 596 | Ga0495661_0000170 | 3300046665 | Bacteria | 77754 |
| 597 | Ga0495661_0006188 | 3300046665 | Bacteria | 8425 |
| 598 | Ga0495661_0010366 | 3300046665 | Bacteria | 6360 |
| 599 | Ga0495661_0011327 | 3300046665 | Bacteria | 6051 |
| 600 | Ga0495661_0037821 | 3300046665 | Bacteria | 3010 |
| 601 | Ga0495661_0079702 | 3300046665 | Bacteria | 1891 |
| 602 | Ga0495661_0105990 | 3300046665 | Bacteria | 1573 |
| 603 | Ga0495588_0000062 | 3300046674 | Bacteria | 253674 |
| 604 | Ga0495588_0051070 | 3300046674 | Bacteria | 2129 |
| 605 | Ga0495599_0069794 | 3300046678 | Bacteria | 2193 |
| 606 | Ga0495669_0001281 | 3300046684 | Bacteria | 10407 |
| 607 | Ga0495669_0005080 | 3300046684 | Bacteria | 5475 |
| 608 | Ga0495624_0018331 | 3300046690 | Bacteria | 4682 |
| 609 | Ga0495624_0071891 | 3300046690 | Bacteria | 2152 |
| 610 | Ga0495670_0001661 | 3300046691 | Bacteria | 10911 |
| 611 | Ga0495670_0002325 | 3300046691 | Bacteria | 9387 |
| 612 | Ga0495670_0013246 | 3300046691 | Bacteria | 4056 |
| 613 | Ga0495671_0000088 | 3300046692 | Bacteria | 87282 |
| 614 | Ga0495671_0009586 | 3300046692 | Bacteria | 5406 |
| 615 | Ga0495671_0084406 | 3300046692 | Bacteria | 1556 |
| 616 | Ga0495649_0001312 | 3300046694 | Bacteria | 18988 |
| 617 | Ga0495649_0012827 | 3300046694 | Bacteria | 4859 |
| 618 | Ga0495649_0039555 | 3300046694 | Bacteria | 2585 |
| 619 | Ga0495649_0213616 | 3300046694 | Bacteria | 999 |
| 620 | Ga0495589_0000103 | 3300046794 | Bacteria | 81696 |
| 621 | Ga0495589_0001144 | 3300046794 | Bacteria | 15770 |
| 622 | Ga0495589_0024179 | 3300046794 | Bacteria | 3088 |
| 623 | Ga0495589_0024226 | 3300046794 | Bacteria | 3085 |
| 624 | Ga0495589_0040034 | 3300046794 | Bacteria | 2341 |
| 625 | Ga0495660_0000057 | 3300046810 | Bacteria | 133310 |
| 626 | Ga0495660_0000208 | 3300046810 | Bacteria | 60381 |
| 627 | Ga0495660_0001806 | 3300046810 | Bacteria | 14089 |
| 628 | Ga0495660_0024071 | 3300046810 | Bacteria | 3470 |
| 629 | Ga0495660_0048056 | 3300046810 | Bacteria | 2334 |
| 630 | Ga0495660_0093189 | 3300046810 | Bacteria | 1562 |
| 631 | Ga0495636_0000716 | 3300047318 | Bacteria | 12143 |
| 632 | Ga0495636_0028191 | 3300047318 | Bacteria | 2288 |
| 633 | Ga0495672_0000132 | 3300047320 | Bacteria | 111537 |
| 634 | Ga0495672_0000262 | 3300047320 | Bacteria | 73028 |
| 635 | Ga0495672_0029883 | 3300047320 | Bacteria | 3426 |
| 636 | Ga0495680_0011827 | 3300047322 | Bacteria | 7707 |
| 637 | Ga0495683_0000072 | 3300047323 | Bacteria | 104027 |
| 638 | Ga0495683_0007433 | 3300047323 | Bacteria | 5923 |
| 639 | Ga0495683_0033348 | 3300047323 | Bacteria | 2620 |
| 640 | Ga0495683_0039010 | 3300047323 | Bacteria | 2401 |
| 641 | Ga0495687_000019 | 3300047443 | Bacteria | 341756 |
| 642 | Ga0495687_000722 | 3300047443 | Bacteria | 36591 |
| 643 | Ga0495687_000740 | 3300047443 | Bacteria | 35582 |
| 644 | Ga0495687_001604 | 3300047443 | Bacteria | 20397 |
| 645 | Ga0495687_003773 | 3300047443 | Bacteria | 10707 |
| 646 | Ga0495687_020008 | 3300047443 | Bacteria | 3271 |
| 647 | Ga0495677_0000009 | 3300047445 | Bacteria | 170927 |
| 648 | Ga0495677_0000217 | 3300047445 | Bacteria | 26216 |
| 649 | Ga0495677_0000873 | 3300047445 | Bacteria | 12174 |
| 650 | Ga0495677_0001907 | 3300047445 | Bacteria | 8336 |
| 651 | Ga0495677_0002104 | 3300047445 | Bacteria | 7919 |
| 652 | Ga0495677_0002684 | 3300047445 | Bacteria | 6948 |
| 653 | Ga0495677_0003892 | 3300047445 | Bacteria | 5773 |
| 654 | Ga0495677_0004159 | 3300047445 | Bacteria | 5584 |
| 655 | Ga0495677_0005946 | 3300047445 | Bacteria | 4621 |
| 656 | Ga0495677_0008922 | 3300047445 | Bacteria | 3709 |
| 657 | Ga0495679_005033 | 3300047446 | Bacteria | 5943 |
| 658 | Ga0495681_0000907 | 3300047470 | Bacteria | 22863 |
| 659 | Ga0495681_0002551 | 3300047470 | Bacteria | 12977 |
| 660 | Ga0495681_0007002 | 3300047470 | Bacteria | 7286 |
| 661 | Ga0495681_0008872 | 3300047470 | Bacteria | 6249 |
| 662 | Ga0495681_0037694 | 3300047470 | Bacteria | 2378 |
| 663 | Ga0495681_0043194 | 3300047470 | Bacteria | 2175 |
| 664 | Ga0495686_0000627 | 3300047472 | Bacteria | 48600 |
| 665 | Ga0495686_0003319 | 3300047472 | Bacteria | 14049 |
| 666 | Ga0495686_0038635 | 3300047472 | Bacteria | 3052 |
| 667 | Ga0495686_0121925 | 3300047472 | Bacteria | 1553 |
| 668 | Ga0495686_0181227 | 3300047472 | Bacteria | 1220 |
| 669 | Ga0495602_0050698 | 3300048088 | Bacteria | 3706 |
| 670 | Ga0495615_0000170 | 3300048090 | Bacteria | 16086 |
| 671 | Ga0495626_0000011 | 3300048091 | Bacteria | 260928 |
| 672 | Ga0495626_0000290 | 3300048091 | Bacteria | 54140 |
| 673 | Ga0495626_0011297 | 3300048091 | Bacteria | 4728 |
| 674 | Ga0495626_0011964 | 3300048091 | Bacteria | 4567 |
| 675 | Ga0495626_0020550 | 3300048091 | Bacteria | 3288 |
| 676 | Ga0495626_0094246 | 3300048091 | Bacteria | 1313 |
| 677 | Ga0496101_0138280 | 3300048904 | Bacteria | 1855 |
| 678 | Ga0496101_0156154 | 3300048904 | Bacteria | 1748 |
| 679 | Ga0496102_0060133 | 3300048905 | Bacteria | 3476 |
| 680 | Ga0496102_0244086 | 3300048905 | Bacteria | 1693 |
| 681 | Ga0496103_0049655 | 3300048906 | Bacteria | 2594 |
| 682 | Ga0496104_0073802 | 3300048907 | Bacteria | 3246 |
| 683 | Ga0496106_0012017 | 3300048909 | Bacteria | 6389 |
| 684 | Ga0496106_0061377 | 3300048909 | Bacteria | 2852 |
| 685 | Ga0496107_0037314 | 3300048910 | Bacteria | 3487 |
| 686 | Ga0496107_0040886 | 3300048910 | Bacteria | 3329 |
| 687 | Ga0496108_0607873 | 3300048911 | Bacteria | 952 |
| 688 | Ga0496111_0016619 | 3300048914 | Bacteria | 5074 |
| 689 | Ga0496113_0014394 | 3300048916 | Bacteria | 5395 |
| 690 | Ga0496114_0214596 | 3300048917 | Bacteria | 1688 |
| 691 | Ga0496114_0355574 | 3300048917 | Bacteria | 1296 |
| 692 | Ga0496116_0031617 | 3300048919 | Bacteria | 3785 |
| 693 | Ga0496116_0048918 | 3300048919 | Bacteria | 2832 |
| 694 | Ga0496117_0000011 | 3300048920 | Bacteria | 610930 |
| 695 | Ga0496118_0000010 | 3300048921 | Bacteria | 610930 |
| 696 | Ga0496118_0076880 | 3300048921 | Bacteria | 2370 |
| 697 | Ga0496119_0002111 | 3300048922 | Bacteria | 22397 |
| 698 | Ga0496119_0011802 | 3300048922 | Bacteria | 7177 |
| 699 | Ga0496119_0012354 | 3300048922 | Bacteria | 6944 |
| 700 | Ga0496120_0025916 | 3300048923 | Bacteria | 3631 |
| 701 | Ga0496120_0106982 | 3300048923 | Bacteria | 1468 |
| 702 | Ga0496121_0000490 | 3300048924 | Bacteria | 75983 |
| 703 | Ga0496121_0002266 | 3300048924 | Bacteria | 29939 |
| 704 | Ga0496121_0004661 | 3300048924 | Bacteria | 18211 |
| 705 | Ga0496121_0088627 | 3300048924 | Bacteria | 2425 |
| 706 | Ga0496122_0000821 | 3300048925 | Bacteria | 59417 |
| 707 | Ga0496122_0001042 | 3300048925 | Bacteria | 48555 |
| 708 | Ga0496122_0005095 | 3300048925 | Bacteria | 15854 |
| 709 | Ga0496122_0023924 | 3300048925 | Bacteria | 5364 |
| 710 | Ga0496122_0069721 | 3300048925 | Bacteria | 2516 |
| 711 | Ga0496123_0000872 | 3300048926 | Bacteria | 47911 |
| 712 | Ga0496123_0001273 | 3300048926 | Bacteria | 36130 |
| 713 | Ga0496123_0003879 | 3300048926 | Bacteria | 16268 |
| 714 | Ga0496123_0030777 | 3300048926 | Bacteria | 3921 |
| 715 | Ga0496123_0057754 | 3300048926 | Bacteria | 2523 |
| 716 | Ga0496124_0017647 | 3300048927 | Bacteria | 6720 |
| 717 | Ga0496124_0018875 | 3300048927 | Bacteria | 6440 |
| 718 | Ga0496124_0233659 | 3300048927 | Bacteria | 1372 |
| 719 | Ga0496125_0000884 | 3300048928 | Bacteria | 47543 |
| 720 | Ga0496125_0034167 | 3300048928 | Bacteria | 4486 |
| 721 | Ga0496125_0046007 | 3300048928 | Bacteria | 3666 |
| 722 | Ga0496125_0116580 | 3300048928 | Bacteria | 1918 |
| 723 | Ga0496125_0148245 | 3300048928 | Bacteria | 1617 |
| 724 | Ga0496126_0001786 | 3300048929 | Bacteria | 31736 |
| 725 | Ga0496126_0043152 | 3300048929 | Bacteria | 4162 |
| 726 | Ga0496126_0088424 | 3300048929 | Bacteria | 2729 |
| 727 | Ga0495678_007026 | 3300049459 | Bacteria | 5900 |
| 728 | Ga0495678_053681 | 3300049459 | Bacteria | 1546 |
| 729 | Ga0495678_070702 | 3300049459 | Bacteria | 1280 |
| 730 | Ga0495682_0003951 | 3300049460 | Bacteria | 6467 |
| 731 | Ga0495682_0016442 | 3300049460 | Bacteria | 2801 |
| 732 | Ga0501292_003979 | 3300049515 | Bacteria | 2001 |
| 733 | Ga0501033_0000186 | 3300049570 | Bacteria | 59624 |
| 734 | Ga0501033_0029154 | 3300049570 | Bacteria | 4147 |
| 735 | Ga0501037_0269359 | 3300049573 | Bacteria | 1189 |
| 736 | Ga0501047_0008047 | 3300049581 | Bacteria | 9948 |
| 737 | Ga0501067_0221256 | 3300049583 | Bacteria | 1054 |
| 738 | Ga0501076_0215169 | 3300049592 | Bacteria | 1571 |
| 739 | Ga0501079_0103835 | 3300049741 | Bacteria | 2205 |
| 740 | Ga0501269_000203 | 3300049766 | Bacteria | 17659 |
| 741 | Ga0501035_0000292 | 3300049822 | Bacteria | 59353 |
| 742 | Ga0501035_0001063 | 3300049822 | Bacteria | 28793 |
| 743 | Ga0501035_0028835 | 3300049822 | Bacteria | 5064 |
| 744 | Ga0501044_0005038 | 3300049823 | Bacteria | 14756 |
| 745 | Ga0501044_0118140 | 3300049823 | Bacteria | 2655 |
| 746 | Ga0501044_0171576 | 3300049823 | Bacteria | 2140 |
| 747 | nmdc:mga0k408_1383_c1 | 3300050493 | Bacteria | 13098 |
| 748 | nmdc:mga0k408_189728_c1 | 3300050493 | Bacteria | 1226 |
| 749 | nmdc:mga0k408_34927_c1 | 3300050493 | Bacteria | 2881 |
| 750 | nmdc:mga0k408_48393_c1 | 3300050493 | Bacteria | 2459 |
| 751 | nmdc:mga0k408_53133_c1 | 3300050493 | Bacteria | 2348 |
| 752 | nmdc:mga0k408_6516_c1 | 3300050493 | Bacteria | 6220 |
| 753 | nmdc:mga06z11_52034_c1 | 3300050494 | Bacteria | 2099 |
| 754 | nmdc:mga06z11_8396_c1 | 3300050494 | Bacteria | 4304 |
| 755 | nmdc:mga07m45_100192_c1 | 3300050496 | Bacteria | 1664 |
| 756 | nmdc:mga07m45_3676_c1 | 3300050496 | Bacteria | 7416 |
| 757 | nmdc:mga07m45_4791_c2 | 3300050496 | Bacteria | 6001 |
| 758 | nmdc:mga07m45_6783_c1 | 3300050496 | Bacteria | 5817 |
| 759 | nmdc:mga07m45_88556_c1 | 3300050496 | Bacteria | 1772 |
| 760 | nmdc:mga0sz30_4699_c1 | 3300050516 | Bacteria | 4957 |
| 761 | nmdc:mga0sz30_5171_c1 | 3300050516 | Bacteria | 4138 |
| 762 | Ga0500578_0000028 | 3300053086 | Bacteria | 144081 |
| 763 | Ga0500572_000038 | 3300053111 | Bacteria | 42226 |
| 764 | Ga0500658_0013184 | 3300053134 | Bacteria | 3052 |
| 765 | Ga0500559_0000326 | 3300053136 | Bacteria | 35945 |
| 766 | Ga0500559_0002516 | 3300053136 | Bacteria | 9415 |
| 767 | Ga0500568_0011765 | 3300053139 | Bacteria | 4044 |
| 768 | Ga0500590_024655 | 3300053148 | Bacteria | 3122 |
| 769 | Ga0500622_0003342 | 3300053156 | Bacteria | 10813 |
| 770 | Ga0500645_006464 | 3300053730 | Bacteria | 4179 |
| 771 | Ga0466962_0017319 | 3300061719 | Bacteria | 3469 |
| 772 | Ga0466962_0019076 | 3300061719 | Bacteria | 3294 |
| 773 | Ga0466962_0046904 | 3300061719 | Bacteria | 2065 |
| 774 | Ga0466962_0093047 | 3300061719 | Bacteria | 1445 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046513 | Ga0495616_0000799 | Ga0495616_0000799_14704_15540 | 251 |
| 2 | 3300046665 | Ga0495661_0011327 | Ga0495661_0011327_3301_4137 | 251 |
| 3 | 3300047445 | Ga0495677_0001907 | Ga0495677_0001907_6767_7603 | 251 |
| 4 | 3300037471 | Ga0395905_0307363 | Ga0395905_0307363_353_1219 | 266 |
| 5 | 3300046506 | Ga0495583_0013411 | Ga0495583_0013411_3655_4521 | 266 |
| 6 | 3300046694 | Ga0495649_0213616 | Ga0495649_0213616_11_877 | 266 |
| 7 | 3300028794 | Ga0307515_10016038 | Ga0307515_100160386 | 267 |
| 8 | 3300032004 | Ga0307414_10233689 | Ga0307414_102336892 | 267 |
| 9 | 3300046500 | Ga0495596_0000833 | Ga0495596_0000833_9165_10031 | 267 |
| 10 | 3300046507 | Ga0495606_0003081 | Ga0495606_0003081_7281_8147 | 267 |
| 11 | 3300046513 | Ga0495616_0084619 | Ga0495616_0084619_344_1207 | 267 |
| 12 | 3300046518 | Ga0495631_0028238 | Ga0495631_0028238_487_1353 | 267 |
| 13 | 3300046520 | Ga0495637_0075744 | Ga0495637_0075744_341_1204 | 267 |
| 14 | 3300046794 | Ga0495589_0024226 | Ga0495589_0024226_2165_3031 | 267 |
| 15 | 3300047323 | Ga0495683_0007433 | Ga0495683_0007433_1453_2319 | 267 |
| 16 | 3300047470 | Ga0495681_0000907 | Ga0495681_0000907_9674_10540 | 267 |
| 17 | 3300047472 | Ga0495686_0000627 | Ga0495686_0000627_448_1311 | 267 |
| 18 | 3300050493 | nmdc:mga0k408_189728_c1 | nmdc:mga0k408_189728_c1_297_1160 | 267 |
| 19 | 3300053136 | Ga0500559_0002516 | Ga0500559_0002516_8329_9192 | 267 |
| 20 | 3300003794 | Ga0055531_10014463 | Ga0055531_100144634 | 268 |
| 21 | 3300025304 | Ga0209257_1000710 | Ga0209257_100071050 | 268 |
| 22 | 3300046660 | Ga0495625_0000143 | Ga0495625_0000143_36841_37704 | 268 |
| 23 | 3300046616 | Ga0495668_0000006 | Ga0495668_0000006_479358_480224 | 269 |
| 24 | 3300049766 | Ga0501269_000203 | Ga0501269_000203_7019_7885 | 269 |
| 25 | 3300003771 | Ga0055526_1000358 | Ga0055526_100035826 | 270 |
| 26 | 3300003775 | Ga0055524_1000462 | Ga0055524_10004624 | 270 |
| 27 | 3300003791 | Ga0055530_10000078 | Ga0055530_1000007815 | 270 |
| 28 | 3300005331 | Ga0070670_100394202 | Ga0070670_1003942021 | 270 |
| 29 | 3300025263 | Ga0209565_1001351 | Ga0209565_10013513 | 270 |
| 30 | 3300025263 | Ga0209565_1020588 | Ga0209565_10205881 | 270 |
| 31 | 3300025295 | Ga0209564_1000124 | Ga0209564_100012489 | 270 |
| 32 | 3300025298 | Ga0209050_1000313 | Ga0209050_100031315 | 270 |
| 33 | 3300025299 | Ga0209256_1001270 | Ga0209256_100127019 | 270 |
| 34 | 3300025913 | Ga0207695_10006045 | Ga0207695_1000604514 | 270 |
| 35 | 3300025914 | Ga0207671_10016293 | Ga0207671_100162934 | 270 |
| 36 | 3300025949 | Ga0207667_10001977 | Ga0207667_1000197716 | 270 |
| 37 | 3300028379 | Ga0268266_10195998 | Ga0268266_101959982 | 270 |
| 38 | 3300030731 | Ga0316177_1033553 | Ga0316177_10335532 | 270 |
| 39 | 3300031548 | Ga0307408_100000022 | Ga0307408_10000002285 | 270 |
| 40 | 3300046539 | Ga0495621_0008835 | Ga0495621_0008835_2071_2925 | 270 |
| 41 | iso_pu_bacteria | 2599185359 | 2600225879 | 270 |
| 42 | iso_pu_bacteria | 2928526807 | 2928529346 | 270 |
| 43 | 3300025933 | Ga0207706_10272887 | Ga0207706_102728871 | 271 |
| 44 | 3300044684 | Ga0466966_0072487 | Ga0466966_0072487_1036_1902 | 271 |
| 45 | 3300044694 | Ga0466963_0069977 | Ga0466963_0069977_1016_1882 | 271 |
| 46 | 3300045049 | Ga0466959_0018046 | Ga0466959_0018046_1778_2644 | 271 |
| 47 | 3300046491 | Ga0495584_0003323 | Ga0495584_0003323_7332_8198 | 271 |
| 48 | 3300046501 | Ga0495607_0000316 | Ga0495607_0000316_31982_32848 | 271 |
| 49 | 3300046513 | Ga0495616_0001668 | Ga0495616_0001668_11101_11967 | 271 |
| 50 | 3300046513 | Ga0495616_0040554 | Ga0495616_0040554_82_948 | 271 |
| 51 | 3300046538 | Ga0495609_0000001 | Ga0495609_0000001_77806_78672 | 271 |
| 52 | 3300046615 | Ga0495656_0007073 | Ga0495656_0007073_2497_3363 | 271 |
| 53 | 3300046615 | Ga0495656_0075010 | Ga0495656_0075010_51_917 | 271 |
| 54 | 3300046665 | Ga0495661_0000053 | Ga0495661_0000053_75298_76164 | 271 |
| 55 | 3300046794 | Ga0495589_0000103 | Ga0495589_0000103_77806_78672 | 271 |
| 56 | 3300047443 | Ga0495687_000019 | Ga0495687_000019_77806_78672 | 271 |
| 57 | 3300047445 | Ga0495677_0000009 | Ga0495677_0000009_92256_93122 | 271 |
| 58 | 3300048091 | Ga0495626_0000290 | Ga0495626_0000290_25699_26565 | 271 |
| 59 | 3300048924 | Ga0496121_0002266 | Ga0496121_0002266_13228_14094 | 271 |
| 60 | 3300003544 | Ga0007417J51691_1037902 | Ga0007417J51691_10379021 | 272 |
| 61 | 3300003577 | Ga0007416J51690_1048530 | Ga0007416J51690_10485302 | 272 |
| 62 | 3300003693 | Ga0032354_1067082 | Ga0032354_10670821 | 272 |
| 63 | 3300003759 | Ga0055525_1000047 | Ga0055525_1000047186 | 272 |
| 64 | 3300005339 | Ga0070660_100057569 | Ga0070660_1000575692 | 272 |
| 65 | 3300005366 | Ga0070659_100460885 | Ga0070659_1004608851 | 272 |
| 66 | 3300025230 | Ga0209563_100003 | Ga0209563_100003717 | 272 |
| 67 | 3300025253 | Ga0209677_101295 | Ga0209677_1012952 | 272 |
| 68 | 3300025254 | Ga0209148_1000871 | Ga0209148_10008719 | 272 |
| 69 | 3300025909 | Ga0207705_10105830 | Ga0207705_101058302 | 272 |
| 70 | 3300025919 | Ga0207657_10001383 | Ga0207657_1000138319 | 272 |
| 71 | 3300025932 | Ga0207690_10150778 | Ga0207690_101507782 | 272 |
| 72 | 3300028794 | Ga0307515_10091070 | Ga0307515_100910704 | 272 |
| 73 | 3300031507 | Ga0307509_10005739 | Ga0307509_100057399 | 272 |
| 74 | 3300031507 | Ga0307509_10030138 | Ga0307509_100301385 | 272 |
| 75 | 3300031616 | Ga0307508_10000048 | Ga0307508_10000048129 | 272 |
| 76 | 3300037312 | Ga0395899_0094703 | Ga0395899_0094703_64_930 | 272 |
| 77 | 3300037418 | Ga0395900_0000148 | Ga0395900_0000148_20450_21316 | 272 |
| 78 | 3300042134 | Ga0450898_006057 | Ga0450898_006057_446_1312 | 272 |
| 79 | 3300044658 | Ga0466972_0000568 | Ga0466972_0000568_13160_14026 | 272 |
| 80 | 3300044683 | Ga0466965_0005218 | Ga0466965_0005218_1671_2537 | 272 |
| 81 | 3300044706 | Ga0466964_0000492 | Ga0466964_0000492_7120_7986 | 272 |
| 82 | 3300044735 | Ga0466968_0000879 | Ga0466968_0000879_1101_1967 | 272 |
| 83 | 3300046660 | Ga0495625_0134454 | Ga0495625_0134454_403_1269 | 272 |
| 84 | 3300046674 | Ga0495588_0000062 | Ga0495588_0000062_216626_217492 | 272 |
| 85 | 3300047320 | Ga0495672_0000132 | Ga0495672_0000132_52539_53405 | 272 |
| 86 | 3300048905 | Ga0496102_0244086 | Ga0496102_0244086_224_1090 | 272 |
| 87 | 3300048910 | Ga0496107_0037314 | Ga0496107_0037314_570_1436 | 272 |
| 88 | 3300048916 | Ga0496113_0014394 | Ga0496113_0014394_4208_5074 | 272 |
| 89 | 3300048925 | Ga0496122_0001042 | Ga0496122_0001042_24904_25770 | 272 |
| 90 | 3300048927 | Ga0496124_0018875 | Ga0496124_0018875_4159_5025 | 272 |
| 91 | 3300048928 | Ga0496125_0034167 | Ga0496125_0034167_3166_4032 | 272 |
| 92 | 3300031251 | Ga0265327_10106312 | Ga0265327_101063122 | 273 |
| 93 | 3300005339 | Ga0070660_100005946 | Ga0070660_1000059463 | 274 |
| 94 | 3300005344 | Ga0070661_100116935 | Ga0070661_1001169352 | 274 |
| 95 | 3300005564 | Ga0070664_100044628 | Ga0070664_1000446283 | 274 |
| 96 | 3300009148 | Ga0105243_10300929 | Ga0105243_103009292 | 274 |
| 97 | 3300009545 | Ga0105237_10008094 | Ga0105237_100080944 | 274 |
| 98 | 3300025909 | Ga0207705_10008110 | Ga0207705_100081107 | 274 |
| 99 | 3300025919 | Ga0207657_10003004 | Ga0207657_1000300419 | 274 |
| 100 | 3300025920 | Ga0207649_10017322 | Ga0207649_100173223 | 274 |
| 101 | 3300025933 | Ga0207706_10194269 | Ga0207706_101942692 | 274 |
| 102 | 3300025935 | Ga0207709_10399284 | Ga0207709_103992841 | 274 |
| 103 | 3300025945 | Ga0207679_10021508 | Ga0207679_100215082 | 274 |
| 104 | 3300026116 | Ga0207674_10139145 | Ga0207674_101391452 | 274 |
| 105 | 3300026116 | Ga0207674_10193829 | Ga0207674_101938293 | 274 |
| 106 | 3300037312 | Ga0395899_0005351 | Ga0395899_0005351_4772_5638 | 274 |
| 107 | 3300037418 | Ga0395900_0001208 | Ga0395900_0001208_24834_25700 | 274 |
| 108 | 3300037471 | Ga0395905_0017108 | Ga0395905_0017108_645_1511 | 274 |
| 109 | 3300041413 | Ga0439465_0053030 | Ga0439465_0053030_171_1037 | 274 |
| 110 | 3300042005 | Ga0439448_0000555 | Ga0439448_0000555_239_1105 | 274 |
| 111 | 3300042007 | Ga0439449_0021002 | Ga0439449_0021002_1403_2269 | 274 |
| 112 | 3300044693 | Ga0466961_0203342 | Ga0466961_0203342_164_1030 | 274 |
| 113 | 3300044706 | Ga0466964_0002109 | Ga0466964_0002109_5610_6476 | 274 |
| 114 | 3300046543 | Ga0495645_0096352 | Ga0495645_0096352_124_990 | 274 |
| 115 | 3300048927 | Ga0496124_0017647 | Ga0496124_0017647_1604_2455 | 274 |
| 116 | 3300048929 | Ga0496126_0001786 | Ga0496126_0001786_28014_28871 | 274 |
| 117 | iso_pu_bacteria | 2588253510 | 2588291951 | 274 |
| 118 | iso_pu_bacteria | 2887375801 | 2887376945 | 274 |
| 119 | 3300025938 | Ga0207704_10537849 | Ga0207704_105378491 | 275 |
| 120 | iso_pu_bacteria | 2521172590 | 2521557198 | 275 |
| 121 | iso_pu_bacteria | 2524023205 | 2524441154 | 275 |
| 122 | iso_pu_bacteria | 2582581866 | 2585395586 | 275 |
| 123 | iso_pu_bacteria | 2599185292 | 2599907671 | 275 |
| 124 | iso_pu_bacteria | 2600255292 | 2601669511 | 275 |
| 125 | iso_pu_bacteria | 2643221554 | 2643791702 | 275 |
| 126 | iso_pu_bacteria | 2643221556 | 2643798796 | 275 |
| 127 | iso_pu_bacteria | 2643221569 | 2643858729 | 275 |
| 128 | iso_pu_bacteria | 2643221585 | 2643935169 | 275 |
| 129 | iso_pu_bacteria | 2643221594 | 2643982111 | 275 |
| 130 | iso_pu_bacteria | 2643221621 | 2644120501 | 275 |
| 131 | iso_pu_bacteria | 2643221645 | 2644253122 | 275 |
| 132 | iso_pu_bacteria | 2643221654 | 2644303811 | 275 |
| 133 | iso_pu_bacteria | 2643221656 | 2644314933 | 275 |
| 134 | iso_pu_bacteria | 2643221664 | 2644354982 | 275 |
| 135 | iso_pu_bacteria | 2643221684 | 2644471109 | 275 |
| 136 | iso_pu_bacteria | 2738541280 | 2738741760 | 275 |
| 137 | iso_pu_bacteria | 2738541300 | 2738843920 | 275 |
| 138 | iso_pu_bacteria | 2738543018 | 2739274519 | 275 |
| 139 | iso_pu_bacteria | 2738543030 | 2739343563 | 275 |
| 140 | iso_pu_bacteria | 2808606395 | 2809034215 | 275 |
| 141 | iso_pu_bacteria | 2842711865 | 2842712542 | 275 |
| 142 | iso_pu_bacteria | 2857504554 | 2857506541 | 275 |
| 143 | iso_pu_bacteria | 2857537821 | 2857540163 | 275 |
| 144 | iso_pu_bacteria | 2858950400 | 2858954130 | 275 |
| 145 | iso_pu_bacteria | 2904424332 | 2904430445 | 275 |
| 146 | iso_pu_bacteria | 2932410948 | 2932414780 | 275 |
| 147 | iso_pu_bacteria | 2932416698 | 2932420700 | 275 |
| 148 | iso_pu_bacteria | 2941479691 | 2941480008 | 275 |
| 149 | iso_pu_bacteria | 2974320154 | 2974323399 | 275 |
| 150 | iso_pu_bacteria | 8002869464 | 8002870213 | 275 |
| 151 | iso_pu_bacteria | 8047673197 | 8047678355 | 275 |
| 152 | 3300035170 | Ga0373943_0092010 | Ga0373943_0092010_95_952 | 276 |
| 153 | 3300037312 | Ga0395899_0014220 | Ga0395899_0014220_4251_5108 | 276 |
| 154 | 3300046472 | Ga0495580_0242368 | Ga0495580_0242368_205_1062 | 276 |
| 155 | iso_pu_bacteria | 2808606361 | 2808855184 | 276 |
| 156 | iso_pu_bacteria | 2808606376 | 2808922906 | 276 |
| 157 | iso_pu_bacteria | 2808606378 | 2808935240 | 276 |
| 158 | iso_pu_bacteria | 2808606380 | 2808945219 | 276 |
| 159 | iso_pu_bacteria | 2808606383 | 2808963689 | 276 |
| 160 | iso_pu_bacteria | 2808606389 | 2808998577 | 276 |
| 161 | iso_pu_bacteria | 2919125081 | 2919128191 | 276 |
| 162 | iso_pu_bacteria | 8019769354 | 8019775346 | 276 |
| 163 | 3300005617 | Ga0068859_100003193 | Ga0068859_1000031939 | 278 |
| 164 | 3300006931 | Ga0097620_100003193 | Ga0097620_1000031939 | 278 |
| 165 | 3300009094 | Ga0111539_10534465 | Ga0111539_105344651 | 278 |
| 166 | 3300025299 | Ga0209256_1026092 | Ga0209256_10260922 | 278 |
| 167 | 3300028794 | Ga0307515_10000525 | Ga0307515_1000052581 | 278 |
| 168 | 3300031456 | Ga0307513_10329004 | Ga0307513_103290042 | 278 |
| 169 | 3300031507 | Ga0307509_10206077 | Ga0307509_102060772 | 278 |
| 170 | 3300031548 | Ga0307408_100227833 | Ga0307408_1002278331 | 278 |
| 171 | 3300031731 | Ga0307405_10283079 | Ga0307405_102830791 | 278 |
| 172 | 3300031911 | Ga0307412_10029815 | Ga0307412_100298152 | 278 |
| 173 | 3300032002 | Ga0307416_100360100 | Ga0307416_1003601002 | 278 |
| 174 | 3300046519 | Ga0495632_0038404 | Ga0495632_0038404_756_1619 | 278 |
| 175 | 3300049515 | Ga0501292_003979 | Ga0501292_003979_278_1138 | 278 |
| 176 | 3300053086 | Ga0500578_0000028 | Ga0500578_0000028_80697_81560 | 278 |
| 177 | 3300053148 | Ga0500590_024655 | Ga0500590_024655_991_1854 | 278 |
| 178 | 3300002739 | JGI25158J39367_1000072 | JGI25158J39367_100007214 | 279 |
| 179 | 3300002773 | JGI25152J39213_1000002 | JGI25152J39213_100000254 | 279 |
| 180 | 3300002773 | JGI25152J39213_1002551 | JGI25152J39213_10025512 | 279 |
| 181 | 3300002774 | JGI25150J39212_1000038 | JGI25150J39212_100003826 | 279 |
| 182 | 3300002774 | JGI25150J39212_1004440 | JGI25150J39212_10044402 | 279 |
| 183 | 3300002774 | JGI25150J39212_1014009 | JGI25150J39212_10140092 | 279 |
| 184 | 3300002987 | JGI25159J45721_1000185 | JGI25159J45721_10001858 | 279 |
| 185 | 3300002987 | JGI25159J45721_1000254 | JGI25159J45721_100025412 | 279 |
| 186 | 3300003215 | JGI25153J46596_10002426 | JGI25153J46596_100024268 | 279 |
| 187 | 3300003354 | JGI25160J50197_1010928 | JGI25160J50197_10109283 | 279 |
| 188 | 3300003374 | JGI25161J50226_1000062 | JGI25161J50226_100006235 | 279 |
| 189 | 3300003374 | JGI25161J50226_1001608 | JGI25161J50226_10016082 | 279 |
| 190 | 3300003763 | Ga0055529_1000330 | Ga0055529_10003308 | 279 |
| 191 | 3300003771 | Ga0055526_1000632 | Ga0055526_100063218 | 279 |
| 192 | 3300003773 | Ga0055537_1010324 | Ga0055537_10103242 | 279 |
| 193 | 3300003775 | Ga0055524_1000105 | Ga0055524_100010523 | 279 |
| 194 | 3300003784 | Ga0055534_1006004 | Ga0055534_10060042 | 279 |
| 195 | 3300003791 | Ga0055530_10006780 | Ga0055530_100067802 | 279 |
| 196 | 3300003791 | Ga0055530_10015724 | Ga0055530_100157243 | 279 |
| 197 | 3300003794 | Ga0055531_10001856 | Ga0055531_1000185613 | 279 |
| 198 | 3300003794 | Ga0055531_10007148 | Ga0055531_100071482 | 279 |
| 199 | 3300004625 | Ga0055543_1000121 | Ga0055543_100012120 | 279 |
| 200 | 3300004625 | Ga0055543_1018635 | Ga0055543_10186352 | 279 |
| 201 | 3300005262 | Ga0065165_1000261 | Ga0065165_100026148 | 279 |
| 202 | 3300005262 | Ga0065165_1018238 | Ga0065165_10182382 | 279 |
| 203 | 3300005262 | Ga0065165_1022086 | Ga0065165_10220862 | 279 |
| 204 | 3300005295 | Ga0065707_10087177 | Ga0065707_100871772 | 279 |
| 205 | 3300005327 | Ga0070658_10090392 | Ga0070658_100903922 | 279 |
| 206 | 3300005327 | Ga0070658_10147892 | Ga0070658_101478922 | 279 |
| 207 | 3300005328 | Ga0070676_10128148 | Ga0070676_101281482 | 279 |
| 208 | 3300005330 | Ga0070690_100040624 | Ga0070690_1000406242 | 279 |
| 209 | 3300005333 | Ga0070677_10061668 | Ga0070677_100616682 | 279 |
| 210 | 3300005334 | Ga0068869_100014797 | Ga0068869_1000147972 | 279 |
| 211 | 3300005335 | Ga0070666_10001793 | Ga0070666_100017935 | 279 |
| 212 | 3300005335 | Ga0070666_10117478 | Ga0070666_101174782 | 279 |
| 213 | 3300005338 | Ga0068868_100000185 | Ga0068868_1000001854 | 279 |
| 214 | 3300005338 | Ga0068868_100039078 | Ga0068868_1000390783 | 279 |
| 215 | 3300005340 | Ga0070689_100010833 | Ga0070689_1000108332 | 279 |
| 216 | 3300005344 | Ga0070661_100062889 | Ga0070661_1000628892 | 279 |
| 217 | 3300005347 | Ga0070668_100088387 | Ga0070668_1000883872 | 279 |
| 218 | 3300005354 | Ga0070675_100001427 | Ga0070675_1000014272 | 279 |
| 219 | 3300005355 | Ga0070671_100015468 | Ga0070671_1000154682 | 279 |
| 220 | 3300005355 | Ga0070671_100032748 | Ga0070671_1000327482 | 279 |
| 221 | 3300005355 | Ga0070671_100065906 | Ga0070671_1000659063 | 279 |
| 222 | 3300005356 | Ga0070674_100013873 | Ga0070674_1000138731 | 279 |
| 223 | 3300005364 | Ga0070673_100002536 | Ga0070673_1000025363 | 279 |
| 224 | 3300005367 | Ga0070667_100004052 | Ga0070667_10000405211 | 279 |
| 225 | 3300005367 | Ga0070667_100020821 | Ga0070667_1000208213 | 279 |
| 226 | 3300005367 | Ga0070667_100102348 | Ga0070667_1001023482 | 279 |
| 227 | 3300005436 | Ga0070713_100017602 | Ga0070713_1000176023 | 279 |
| 228 | 3300005436 | Ga0070713_100127463 | Ga0070713_1001274632 | 279 |
| 229 | 3300005436 | Ga0070713_100428249 | Ga0070713_1004282491 | 279 |
| 230 | 3300005455 | Ga0070663_100003487 | Ga0070663_1000034876 | 279 |
| 231 | 3300005456 | Ga0070678_100007438 | Ga0070678_1000074382 | 279 |
| 232 | 3300005457 | Ga0070662_100023588 | Ga0070662_1000235883 | 279 |
| 233 | 3300005457 | Ga0070662_100073159 | Ga0070662_1000731593 | 279 |
| 234 | 3300005459 | Ga0068867_100000091 | Ga0068867_10000009135 | 279 |
| 235 | 3300005459 | Ga0068867_100000575 | Ga0068867_1000005753 | 279 |
| 236 | 3300005459 | Ga0068867_100030151 | Ga0068867_1000301512 | 279 |
| 237 | 3300005467 | Ga0070706_100053808 | Ga0070706_1000538083 | 279 |
| 238 | 3300005468 | Ga0070707_100037519 | Ga0070707_1000375193 | 279 |
| 239 | 3300005539 | Ga0068853_100450510 | Ga0068853_1004505101 | 279 |
| 240 | 3300005548 | Ga0070665_100067489 | Ga0070665_1000674892 | 279 |
| 241 | 3300005563 | Ga0068855_100028111 | Ga0068855_1000281115 | 279 |
| 242 | 3300005563 | Ga0068855_100243636 | Ga0068855_1002436362 | 279 |
| 243 | 3300005563 | Ga0068855_100732488 | Ga0068855_1007324881 | 279 |
| 244 | 3300005564 | Ga0070664_100045657 | Ga0070664_1000456574 | 279 |
| 245 | 3300005577 | Ga0068857_100072314 | Ga0068857_1000723142 | 279 |
| 246 | 3300005578 | Ga0068854_100038548 | Ga0068854_1000385482 | 279 |
| 247 | 3300005616 | Ga0068852_100002707 | Ga0068852_1000027074 | 279 |
| 248 | 3300005616 | Ga0068852_100039543 | Ga0068852_1000395433 | 279 |
| 249 | 3300005616 | Ga0068852_100527833 | Ga0068852_1005278331 | 279 |
| 250 | 3300005617 | Ga0068859_100001283 | Ga0068859_1000012837 | 279 |
| 251 | 3300005617 | Ga0068859_100470370 | Ga0068859_1004703702 | 279 |
| 252 | 3300005618 | Ga0068864_100001050 | Ga0068864_1000010508 | 279 |
| 253 | 3300005618 | Ga0068864_100012823 | Ga0068864_1000128232 | 279 |
| 254 | 3300005618 | Ga0068864_100079789 | Ga0068864_1000797892 | 279 |
| 255 | 3300005718 | Ga0068866_10009221 | Ga0068866_100092214 | 279 |
| 256 | 3300005841 | Ga0068863_100004913 | Ga0068863_1000049134 | 279 |
| 257 | 3300005841 | Ga0068863_100052600 | Ga0068863_1000526004 | 279 |
| 258 | 3300005842 | Ga0068858_100000885 | Ga0068858_10000088518 | 279 |
| 259 | 3300005842 | Ga0068858_100039812 | Ga0068858_1000398123 | 279 |
| 260 | 3300005937 | Ga0081455_10191201 | Ga0081455_101912012 | 279 |
| 261 | 3300006042 | Ga0075368_10034434 | Ga0075368_100344342 | 279 |
| 262 | 3300006048 | Ga0075363_100065833 | Ga0075363_1000658331 | 279 |
| 263 | 3300006177 | Ga0075362_10039556 | Ga0075362_100395562 | 279 |
| 264 | 3300006178 | Ga0075367_10007260 | Ga0075367_100072602 | 279 |
| 265 | 3300006178 | Ga0075367_10035029 | Ga0075367_100350292 | 279 |
| 266 | 3300006178 | Ga0075367_10044514 | Ga0075367_100445141 | 279 |
| 267 | 3300006186 | Ga0075369_10014572 | Ga0075369_100145722 | 279 |
| 268 | 3300006195 | Ga0075366_10028470 | Ga0075366_100284702 | 279 |
| 269 | 3300006195 | Ga0075366_10038701 | Ga0075366_100387011 | 279 |
| 270 | 3300006195 | Ga0075366_10166616 | Ga0075366_101666162 | 279 |
| 271 | 3300006195 | Ga0075366_10174630 | Ga0075366_101746302 | 279 |
| 272 | 3300006195 | Ga0075366_10208723 | Ga0075366_102087232 | 279 |
| 273 | 3300006237 | Ga0097621_100032688 | Ga0097621_1000326882 | 279 |
| 274 | 3300006353 | Ga0075370_10001906 | Ga0075370_1000190610 | 279 |
| 275 | 3300006353 | Ga0075370_10026207 | Ga0075370_100262074 | 279 |
| 276 | 3300006353 | Ga0075370_10097513 | Ga0075370_100975132 | 279 |
| 277 | 3300006353 | Ga0075370_10147990 | Ga0075370_101479901 | 279 |
| 278 | 3300006846 | Ga0075430_100349794 | Ga0075430_1003497942 | 279 |
| 279 | 3300006881 | Ga0068865_100027990 | Ga0068865_1000279902 | 279 |
| 280 | 3300006931 | Ga0097620_100001283 | Ga0097620_1000012837 | 279 |
| 281 | 3300006931 | Ga0097620_100470364 | Ga0097620_1004703642 | 279 |
| 282 | 3300006931 | Ga0097620_100521135 | Ga0097620_1005211352 | 279 |
| 283 | 3300007265 | Ga0099794_10102458 | Ga0099794_101024581 | 279 |
| 284 | 3300007788 | Ga0099795_10000365 | Ga0099795_100003653 | 279 |
| 285 | 3300009093 | Ga0105240_10285404 | Ga0105240_102854042 | 279 |
| 286 | 3300009093 | Ga0105240_10347248 | Ga0105240_103472482 | 279 |
| 287 | 3300009148 | Ga0105243_10002148 | Ga0105243_100021487 | 279 |
| 288 | 3300009148 | Ga0105243_10004977 | Ga0105243_100049775 | 279 |
| 289 | 3300009174 | Ga0105241_10041921 | Ga0105241_100419214 | 279 |
| 290 | 3300009177 | Ga0105248_10015738 | Ga0105248_100157384 | 279 |
| 291 | 3300009177 | Ga0105248_10029339 | Ga0105248_100293396 | 279 |
| 292 | 3300009177 | Ga0105248_10133406 | Ga0105248_101334062 | 279 |
| 293 | 3300009545 | Ga0105237_10023051 | Ga0105237_100230515 | 279 |
| 294 | 3300009545 | Ga0105237_10119406 | Ga0105237_101194062 | 279 |
| 295 | 3300009545 | Ga0105237_10515995 | Ga0105237_105159952 | 279 |
| 296 | 3300009551 | Ga0105238_10537803 | Ga0105238_105378031 | 279 |
| 297 | 3300010159 | Ga0099796_10004703 | Ga0099796_100047032 | 279 |
| 298 | 3300010375 | Ga0105239_10021983 | Ga0105239_100219837 | 279 |
| 299 | 3300010375 | Ga0105239_10150048 | Ga0105239_101500482 | 279 |
| 300 | 3300013104 | Ga0157370_10099698 | Ga0157370_100996981 | 279 |
| 301 | 3300013296 | Ga0157374_10021504 | Ga0157374_100215046 | 279 |
| 302 | 3300013306 | Ga0163162_10009476 | Ga0163162_100094764 | 279 |
| 303 | 3300013306 | Ga0163162_10044850 | Ga0163162_100448502 | 279 |
| 304 | 3300013306 | Ga0163162_10141381 | Ga0163162_101413813 | 279 |
| 305 | 3300013307 | Ga0157372_10139423 | Ga0157372_101394232 | 279 |
| 306 | 3300013308 | Ga0157375_10053711 | Ga0157375_100537112 | 279 |
| 307 | 3300014497 | Ga0182008_10000190 | Ga0182008_1000019041 | 279 |
| 308 | 3300014497 | Ga0182008_10000949 | Ga0182008_1000094918 | 279 |
| 309 | 3300014745 | Ga0157377_10000036 | Ga0157377_1000003612 | 279 |
| 310 | 3300014745 | Ga0157377_10000107 | Ga0157377_1000010735 | 279 |
| 311 | 3300014968 | Ga0157379_10002653 | Ga0157379_100026533 | 279 |
| 312 | 3300014968 | Ga0157379_10045551 | Ga0157379_100455514 | 279 |
| 313 | 3300014968 | Ga0157379_10214056 | Ga0157379_102140562 | 279 |
| 314 | 3300014969 | Ga0157376_10652482 | Ga0157376_106524822 | 279 |
| 315 | 3300014969 | Ga0157376_10731186 | Ga0157376_107311861 | 279 |
| 316 | 3300015261 | Ga0182006_1000004 | Ga0182006_1000004347 | 279 |
| 317 | 3300015262 | Ga0182007_10000018 | Ga0182007_1000001824 | 279 |
| 318 | 3300015262 | Ga0182007_10001150 | Ga0182007_100011506 | 279 |
| 319 | 3300015265 | Ga0182005_1000011 | Ga0182005_100001134 | 279 |
| 320 | 3300025208 | Ga0209436_100005 | Ga0209436_10000583 | 279 |
| 321 | 3300025208 | Ga0209436_100153 | Ga0209436_10015317 | 279 |
| 322 | 3300025245 | Ga0207425_1000001 | Ga0207425_10000011227 | 279 |
| 323 | 3300025245 | Ga0207425_1000033 | Ga0207425_100003382 | 279 |
| 324 | 3300025245 | Ga0207425_1000430 | Ga0207425_10004303 | 279 |
| 325 | 3300025245 | Ga0207425_1000883 | Ga0207425_100088312 | 279 |
| 326 | 3300025246 | Ga0209646_1000106 | Ga0209646_100010622 | 279 |
| 327 | 3300025258 | Ga0209129_1000001 | Ga0209129_1000001404 | 279 |
| 328 | 3300025258 | Ga0209129_1000841 | Ga0209129_10008413 | 279 |
| 329 | 3300025258 | Ga0209129_1010442 | Ga0209129_10104422 | 279 |
| 330 | 3300025263 | Ga0209565_1006156 | Ga0209565_10061563 | 279 |
| 331 | 3300025263 | Ga0209565_1006380 | Ga0209565_10063803 | 279 |
| 332 | 3300025263 | Ga0209565_1013441 | Ga0209565_10134412 | 279 |
| 333 | 3300025271 | Ga0207666_1004244 | Ga0207666_10042442 | 279 |
| 334 | 3300025272 | Ga0209455_1000033 | Ga0209455_100003344 | 279 |
| 335 | 3300025284 | Ga0209130_1000055 | Ga0209130_1000055133 | 279 |
| 336 | 3300025284 | Ga0209130_1000592 | Ga0209130_100059214 | 279 |
| 337 | 3300025291 | Ga0209675_1005505 | Ga0209675_10055054 | 279 |
| 338 | 3300025292 | Ga0209676_1000136 | Ga0209676_1000136101 | 279 |
| 339 | 3300025292 | Ga0209676_1004568 | Ga0209676_10045682 | 279 |
| 340 | 3300025294 | Ga0209025_1016139 | Ga0209025_10161395 | 279 |
| 341 | 3300025295 | Ga0209564_1000162 | Ga0209564_100016256 | 279 |
| 342 | 3300025295 | Ga0209564_1006907 | Ga0209564_10069073 | 279 |
| 343 | 3300025297 | Ga0209758_1000020 | Ga0209758_100002049 | 279 |
| 344 | 3300025297 | Ga0209758_1000152 | Ga0209758_100015298 | 279 |
| 345 | 3300025297 | Ga0209758_1003711 | Ga0209758_100371111 | 279 |
| 346 | 3300025298 | Ga0209050_1000011 | Ga0209050_1000011402 | 279 |
| 347 | 3300025298 | Ga0209050_1000238 | Ga0209050_100023848 | 279 |
| 348 | 3300025299 | Ga0209256_1000028 | Ga0209256_100002823 | 279 |
| 349 | 3300025299 | Ga0209256_1011459 | Ga0209256_10114592 | 279 |
| 350 | 3300025302 | Ga0207426_1000818 | Ga0207426_100081818 | 279 |
| 351 | 3300025304 | Ga0209257_1000003 | Ga0209257_10000031174 | 279 |
| 352 | 3300025304 | Ga0209257_1000142 | Ga0209257_1000142101 | 279 |
| 353 | 3300025304 | Ga0209257_1003802 | Ga0209257_100380212 | 279 |
| 354 | 3300025304 | Ga0209257_1016214 | Ga0209257_10162142 | 279 |
| 355 | 3300025728 | Ga0207655_1017922 | Ga0207655_10179223 | 279 |
| 356 | 3300025899 | Ga0207642_10002078 | Ga0207642_100020786 | 279 |
| 357 | 3300025903 | Ga0207680_10000931 | Ga0207680_1000093110 | 279 |
| 358 | 3300025907 | Ga0207645_10134585 | Ga0207645_101345851 | 279 |
| 359 | 3300025907 | Ga0207645_10217032 | Ga0207645_102170322 | 279 |
| 360 | 3300025909 | Ga0207705_10267695 | Ga0207705_102676952 | 279 |
| 361 | 3300025910 | Ga0207684_10045998 | Ga0207684_100459983 | 279 |
| 362 | 3300025911 | Ga0207654_10032395 | Ga0207654_100323951 | 279 |
| 363 | 3300025913 | Ga0207695_10153996 | Ga0207695_101539962 | 279 |
| 364 | 3300025919 | Ga0207657_10051608 | Ga0207657_100516081 | 279 |
| 365 | 3300025920 | Ga0207649_10281189 | Ga0207649_102811892 | 279 |
| 366 | 3300025921 | Ga0207652_10012965 | Ga0207652_100129653 | 279 |
| 367 | 3300025921 | Ga0207652_10026937 | Ga0207652_100269376 | 279 |
| 368 | 3300025923 | Ga0207681_10004760 | Ga0207681_100047601 | 279 |
| 369 | 3300025923 | Ga0207681_10124342 | Ga0207681_101243422 | 279 |
| 370 | 3300025924 | Ga0207694_10306244 | Ga0207694_103062442 | 279 |
| 371 | 3300025926 | Ga0207659_10007353 | Ga0207659_100073537 | 279 |
| 372 | 3300025927 | Ga0207687_10136900 | Ga0207687_101369002 | 279 |
| 373 | 3300025928 | Ga0207700_10063851 | Ga0207700_100638512 | 279 |
| 374 | 3300025928 | Ga0207700_10238989 | Ga0207700_102389892 | 279 |
| 375 | 3300025931 | Ga0207644_10000635 | Ga0207644_100006355 | 279 |
| 376 | 3300025931 | Ga0207644_10073826 | Ga0207644_100738263 | 279 |
| 377 | 3300025931 | Ga0207644_10213875 | Ga0207644_102138752 | 279 |
| 378 | 3300025932 | Ga0207690_10115771 | Ga0207690_101157712 | 279 |
| 379 | 3300025933 | Ga0207706_10002765 | Ga0207706_100027657 | 279 |
| 380 | 3300025933 | Ga0207706_10091551 | Ga0207706_100915512 | 279 |
| 381 | 3300025935 | Ga0207709_10002921 | Ga0207709_100029214 | 279 |
| 382 | 3300025935 | Ga0207709_10014308 | Ga0207709_100143084 | 279 |
| 383 | 3300025935 | Ga0207709_10076157 | Ga0207709_100761572 | 279 |
| 384 | 3300025935 | Ga0207709_10111399 | Ga0207709_101113992 | 279 |
| 385 | 3300025937 | Ga0207669_10489982 | Ga0207669_104899821 | 279 |
| 386 | 3300025938 | Ga0207704_10015573 | Ga0207704_100155731 | 279 |
| 387 | 3300025941 | Ga0207711_10007617 | Ga0207711_100076173 | 279 |
| 388 | 3300025942 | Ga0207689_10050185 | Ga0207689_100501853 | 279 |
| 389 | 3300025942 | Ga0207689_10083483 | Ga0207689_100834832 | 279 |
| 390 | 3300025944 | Ga0207661_10529876 | Ga0207661_105298761 | 279 |
| 391 | 3300025949 | Ga0207667_10003039 | Ga0207667_100030397 | 279 |
| 392 | 3300025949 | Ga0207667_10306085 | Ga0207667_103060852 | 279 |
| 393 | 3300025961 | Ga0207712_10001798 | Ga0207712_100017986 | 279 |
| 394 | 3300025972 | Ga0207668_10430596 | Ga0207668_104305961 | 279 |
| 395 | 3300025981 | Ga0207640_10069116 | Ga0207640_100691161 | 279 |
| 396 | 3300025986 | Ga0207658_10005671 | Ga0207658_100056719 | 279 |
| 397 | 3300026023 | Ga0207677_10002592 | Ga0207677_100025924 | 279 |
| 398 | 3300026023 | Ga0207677_10053176 | Ga0207677_100531762 | 279 |
| 399 | 3300026035 | Ga0207703_10001221 | Ga0207703_100012217 | 279 |
| 400 | 3300026035 | Ga0207703_10312239 | Ga0207703_103122391 | 279 |
| 401 | 3300026067 | Ga0207678_10008575 | Ga0207678_100085756 | 279 |
| 402 | 3300026088 | Ga0207641_10025598 | Ga0207641_100255983 | 279 |
| 403 | 3300026088 | Ga0207641_10027564 | Ga0207641_100275645 | 279 |
| 404 | 3300026088 | Ga0207641_10052325 | Ga0207641_100523252 | 279 |
| 405 | 3300026089 | Ga0207648_10000037 | Ga0207648_1000003776 | 279 |
| 406 | 3300026089 | Ga0207648_10000227 | Ga0207648_1000022737 | 279 |
| 407 | 3300026095 | Ga0207676_10001143 | Ga0207676_1000114314 | 279 |
| 408 | 3300026095 | Ga0207676_10038637 | Ga0207676_100386372 | 279 |
| 409 | 3300026095 | Ga0207676_10746276 | Ga0207676_107462761 | 279 |
| 410 | 3300026116 | Ga0207674_10018123 | Ga0207674_100181238 | 279 |
| 411 | 3300026116 | Ga0207674_10144764 | Ga0207674_101447642 | 279 |
| 412 | 3300026116 | Ga0207674_10325891 | Ga0207674_103258912 | 279 |
| 413 | 3300026118 | Ga0207675_100008494 | Ga0207675_1000084944 | 279 |
| 414 | 3300026121 | Ga0207683_10006411 | Ga0207683_1000641112 | 279 |
| 415 | 3300026142 | Ga0207698_10002142 | Ga0207698_100021429 | 279 |
| 416 | 3300027512 | Ga0209179_1004020 | Ga0209179_10040202 | 279 |
| 417 | 3300027866 | Ga0209813_10022180 | Ga0209813_100221802 | 279 |
| 418 | 3300027876 | Ga0209974_10003999 | Ga0209974_100039995 | 279 |
| 419 | 3300028379 | Ga0268266_10014233 | Ga0268266_100142337 | 279 |
| 420 | 3300028379 | Ga0268266_10347295 | Ga0268266_103472952 | 279 |
| 421 | 3300028380 | Ga0268265_10051838 | Ga0268265_100518381 | 279 |
| 422 | 3300028380 | Ga0268265_10091944 | Ga0268265_100919442 | 279 |
| 423 | 3300028381 | Ga0268264_10005954 | Ga0268264_100059544 | 279 |
| 424 | 3300028556 | Ga0265337_1026696 | Ga0265337_10266962 | 279 |
| 425 | 3300028786 | Ga0307517_10002278 | Ga0307517_100022787 | 279 |
| 426 | 3300028794 | Ga0307515_10018830 | Ga0307515_1001883017 | 279 |
| 427 | 3300028794 | Ga0307515_10086362 | Ga0307515_100863624 | 279 |
| 428 | 3300028794 | Ga0307515_10149059 | Ga0307515_101490593 | 279 |
| 429 | 3300028794 | Ga0307515_10157370 | Ga0307515_101573703 | 279 |
| 430 | 3300030731 | Ga0316177_1163442 | Ga0316177_11634421 | 279 |
| 431 | 3300030745 | Ga0316182_1128715 | Ga0316182_11287152 | 279 |
| 432 | 3300031240 | Ga0265320_10017913 | Ga0265320_100179134 | 279 |
| 433 | 3300031249 | Ga0265339_10006224 | Ga0265339_100062245 | 279 |
| 434 | 3300031456 | Ga0307513_10104938 | Ga0307513_101049382 | 279 |
| 435 | 3300031456 | Ga0307513_10217135 | Ga0307513_102171352 | 279 |
| 436 | 3300031507 | Ga0307509_10000157 | Ga0307509_1000015776 | 279 |
| 437 | 3300031507 | Ga0307509_10034314 | Ga0307509_100343146 | 279 |
| 438 | 3300031507 | Ga0307509_10356449 | Ga0307509_103564492 | 279 |
| 439 | 3300031548 | Ga0307408_100000046 | Ga0307408_100000046104 | 279 |
| 440 | 3300031548 | Ga0307408_100001037 | Ga0307408_1000010377 | 279 |
| 441 | 3300031548 | Ga0307408_100001365 | Ga0307408_10000136511 | 279 |
| 442 | 3300031548 | Ga0307408_100003010 | Ga0307408_1000030102 | 279 |
| 443 | 3300031548 | Ga0307408_100084007 | Ga0307408_1000840072 | 279 |
| 444 | 3300031548 | Ga0307408_100090754 | Ga0307408_1000907542 | 279 |
| 445 | 3300031616 | Ga0307508_10045664 | Ga0307508_100456643 | 279 |
| 446 | 3300031616 | Ga0307508_10071542 | Ga0307508_100715422 | 279 |
| 447 | 3300031616 | Ga0307508_10086959 | Ga0307508_100869593 | 279 |
| 448 | 3300031649 | Ga0307514_10028808 | Ga0307514_100288082 | 279 |
| 449 | 3300031649 | Ga0307514_10053972 | Ga0307514_100539722 | 279 |
| 450 | 3300031711 | Ga0265314_10089759 | Ga0265314_100897592 | 279 |
| 451 | 3300031911 | Ga0307412_10071852 | Ga0307412_100718522 | 279 |
| 452 | 3300032004 | Ga0307414_10222409 | Ga0307414_102224092 | 279 |
| 453 | 3300033180 | Ga0307510_10000883 | Ga0307510_100008833 | 279 |
| 454 | 3300033180 | Ga0307510_10010444 | Ga0307510_100104442 | 279 |
| 455 | 3300035114 | Ga0373939_0037803 | Ga0373939_0037803_414_1280 | 279 |
| 456 | 3300035691 | Ga0373931_0035876 | Ga0373931_0035876_441_1307 | 279 |
| 457 | 3300035725 | Ga0373947_0049489 | Ga0373947_0049489_829_1674 | 279 |
| 458 | 3300036401 | Ga0373937_0005178 | Ga0373937_0005178_4833_5678 | 279 |
| 459 | 3300037068 | Ga0373925_0017299 | Ga0373925_0017299_3587_4432 | 279 |
| 460 | 3300037068 | Ga0373925_0190579 | Ga0373925_0190579_748_1593 | 279 |
| 461 | 3300037068 | Ga0373925_0260437 | Ga0373925_0260437_344_1189 | 279 |
| 462 | 3300037312 | Ga0395899_0001092 | Ga0395899_0001092_14618_15484 | 279 |
| 463 | 3300037312 | Ga0395899_0002955 | Ga0395899_0002955_1279_2145 | 279 |
| 464 | 3300037312 | Ga0395899_0022519 | Ga0395899_0022519_1631_2497 | 279 |
| 465 | 3300037312 | Ga0395899_0044223 | Ga0395899_0044223_948_1802 | 279 |
| 466 | 3300037418 | Ga0395900_0000081 | Ga0395900_0000081_61606_62472 | 279 |
| 467 | 3300037418 | Ga0395900_0003059 | Ga0395900_0003059_16686_17552 | 279 |
| 468 | 3300037418 | Ga0395900_0036687 | Ga0395900_0036687_205_1059 | 279 |
| 469 | 3300037418 | Ga0395900_0057623 | Ga0395900_0057623_2199_3065 | 279 |
| 470 | 3300037418 | Ga0395900_0136768 | Ga0395900_0136768_697_1563 | 279 |
| 471 | 3300037466 | Ga0395898_0119308 | Ga0395898_0119308_769_1635 | 279 |
| 472 | 3300037471 | Ga0395905_0009494 | Ga0395905_0009494_4544_5410 | 279 |
| 473 | 3300037471 | Ga0395905_0127464 | Ga0395905_0127464_667_1533 | 279 |
| 474 | 3300037853 | Ga0436364_0407173 | Ga0436364_0407173_80_925 | 279 |
| 475 | 3300038443 | Ga0395901_0000237 | Ga0395901_0000237_29412_30278 | 279 |
| 476 | 3300038443 | Ga0395901_0090868 | Ga0395901_0090868_2139_3005 | 279 |
| 477 | 3300038443 | Ga0395901_0172932 | Ga0395901_0172932_1366_2220 | 279 |
| 478 | 3300038443 | Ga0395901_0308767 | Ga0395901_0308767_324_1190 | 279 |
| 479 | 3300039438 | Ga0436360_0544857 | Ga0436360_0544857_750_1595 | 279 |
| 480 | 3300039453 | Ga0436362_0381357 | Ga0436362_0381357_285_1130 | 279 |
| 481 | 3300041512 | Ga0451853_2845666 | Ga0451853_2845666_302_1144 | 279 |
| 482 | 3300041997 | Ga0439431_0006250 | Ga0439431_0006250_1132_1998 | 279 |
| 483 | 3300042876 | Ga0451577_0051628 | Ga0451577_0051628_677_1543 | 279 |
| 484 | 3300042876 | Ga0451577_0094783 | Ga0451577_0094783_1230_2093 | 279 |
| 485 | 3300044656 | Ga0466969_0006699 | Ga0466969_0006699_1911_2756 | 279 |
| 486 | 3300044656 | Ga0466969_0014607 | Ga0466969_0014607_1562_2428 | 279 |
| 487 | 3300044656 | Ga0466969_0035390 | Ga0466969_0035390_479_1345 | 279 |
| 488 | 3300044658 | Ga0466972_0000383 | Ga0466972_0000383_5099_5965 | 279 |
| 489 | 3300044658 | Ga0466972_0006200 | Ga0466972_0006200_4470_5318 | 279 |
| 490 | 3300044658 | Ga0466972_0036061 | Ga0466972_0036061_1067_1933 | 279 |
| 491 | 3300044683 | Ga0466965_0001230 | Ga0466965_0001230_8846_9712 | 279 |
| 492 | 3300044683 | Ga0466965_0085184 | Ga0466965_0085184_280_1146 | 279 |
| 493 | 3300044684 | Ga0466966_0000428 | Ga0466966_0000428_17557_18402 | 279 |
| 494 | 3300044684 | Ga0466966_0002106 | Ga0466966_0002106_7668_8534 | 279 |
| 495 | 3300044684 | Ga0466966_0005887 | Ga0466966_0005887_189_1055 | 279 |
| 496 | 3300044684 | Ga0466966_0009166 | Ga0466966_0009166_4192_5058 | 279 |
| 497 | 3300044684 | Ga0466966_0023505 | Ga0466966_0023505_2550_3416 | 279 |
| 498 | 3300044684 | Ga0466966_0032955 | Ga0466966_0032955_837_1703 | 279 |
| 499 | 3300044684 | Ga0466966_0254042 | Ga0466966_0254042_22_888 | 279 |
| 500 | 3300044693 | Ga0466961_0019174 | Ga0466961_0019174_3304_4170 | 279 |
| 501 | 3300044693 | Ga0466961_0151018 | Ga0466961_0151018_391_1257 | 279 |
| 502 | 3300044706 | Ga0466964_0013400 | Ga0466964_0013400_1770_2636 | 279 |
| 503 | 3300044719 | Ga0466971_0035615 | Ga0466971_0035615_1189_2034 | 279 |
| 504 | 3300044735 | Ga0466968_0013820 | Ga0466968_0013820_725_1591 | 279 |
| 505 | 3300044765 | Ga0466970_0008945 | Ga0466970_0008945_377_1222 | 279 |
| 506 | 3300044765 | Ga0466970_0054294 | Ga0466970_0054294_21_887 | 279 |
| 507 | 3300044842 | Ga0466957_0000337 | Ga0466957_0000337_4796_5662 | 279 |
| 508 | 3300044842 | Ga0466957_0010664 | Ga0466957_0010664_3006_3851 | 279 |
| 509 | 3300044901 | Ga0466960_0061170 | Ga0466960_0061170_599_1465 | 279 |
| 510 | 3300045049 | Ga0466959_0076778 | Ga0466959_0076778_357_1223 | 279 |
| 511 | 3300045049 | Ga0466959_0113022 | Ga0466959_0113022_442_1308 | 279 |
| 512 | 3300045051 | Ga0451576_0089607 | Ga0451576_0089607_2057_2974 | 279 |
| 513 | 3300045836 | Ga0466958_0021614 | Ga0466958_0021614_844_1710 | 279 |
| 514 | 3300045836 | Ga0466958_0148404 | Ga0466958_0148404_384_1229 | 279 |
| 515 | 3300046454 | Ga0495592_0000058 | Ga0495592_0000058_71579_72445 | 279 |
| 516 | 3300046457 | Ga0495590_0000016 | Ga0495590_0000016_124955_125821 | 279 |
| 517 | 3300046457 | Ga0495590_0044047 | Ga0495590_0044047_587_1453 | 279 |
| 518 | 3300046460 | Ga0495638_0000057 | Ga0495638_0000057_69391_70257 | 279 |
| 519 | 3300046463 | Ga0495653_0003297 | Ga0495653_0003297_7355_8221 | 279 |
| 520 | 3300046471 | Ga0495650_0002031 | Ga0495650_0002031_5773_6639 | 279 |
| 521 | 3300046474 | Ga0495605_0000684 | Ga0495605_0000684_1780_2646 | 279 |
| 522 | 3300046474 | Ga0495605_0003913 | Ga0495605_0003913_6583_7449 | 279 |
| 523 | 3300046474 | Ga0495605_0064763 | Ga0495605_0064763_851_1717 | 279 |
| 524 | 3300046475 | Ga0495639_0009356 | Ga0495639_0009356_1346_2212 | 279 |
| 525 | 3300046491 | Ga0495584_0000915 | Ga0495584_0000915_5098_5949 | 279 |
| 526 | 3300046491 | Ga0495584_0002336 | Ga0495584_0002336_6387_7253 | 279 |
| 527 | 3300046491 | Ga0495584_0011193 | Ga0495584_0011193_2068_2934 | 279 |
| 528 | 3300046492 | Ga0495585_0000005 | Ga0495585_0000005_219039_219905 | 279 |
| 529 | 3300046492 | Ga0495585_0000162 | Ga0495585_0000162_66371_67237 | 279 |
| 530 | 3300046492 | Ga0495585_0007241 | Ga0495585_0007241_5425_6291 | 279 |
| 531 | 3300046492 | Ga0495585_0009385 | Ga0495585_0009385_4734_5585 | 279 |
| 532 | 3300046492 | Ga0495585_0036768 | Ga0495585_0036768_885_1751 | 279 |
| 533 | 3300046492 | Ga0495585_0041772 | Ga0495585_0041772_329_1195 | 279 |
| 534 | 3300046492 | Ga0495585_0071056 | Ga0495585_0071056_461_1327 | 279 |
| 535 | 3300046492 | Ga0495585_0130399 | Ga0495585_0130399_361_1227 | 279 |
| 536 | 3300046500 | Ga0495596_0000013 | Ga0495596_0000013_58650_59516 | 279 |
| 537 | 3300046500 | Ga0495596_0000901 | Ga0495596_0000901_16653_17519 | 279 |
| 538 | 3300046500 | Ga0495596_0003244 | Ga0495596_0003244_94_960 | 279 |
| 539 | 3300046501 | Ga0495607_0001702 | Ga0495607_0001702_9924_10790 | 279 |
| 540 | 3300046501 | Ga0495607_0003182 | Ga0495607_0003182_5150_6016 | 279 |
| 541 | 3300046501 | Ga0495607_0003268 | Ga0495607_0003268_4765_5631 | 279 |
| 542 | 3300046501 | Ga0495607_0021859 | Ga0495607_0021859_2358_3224 | 279 |
| 543 | 3300046506 | Ga0495583_0000189 | Ga0495583_0000189_94254_95120 | 279 |
| 544 | 3300046506 | Ga0495583_0000655 | Ga0495583_0000655_9237_10103 | 279 |
| 545 | 3300046506 | Ga0495583_0000688 | Ga0495583_0000688_17868_18734 | 279 |
| 546 | 3300046506 | Ga0495583_0002721 | Ga0495583_0002721_11453_12319 | 279 |
| 547 | 3300046506 | Ga0495583_0041851 | Ga0495583_0041851_1107_1973 | 279 |
| 548 | 3300046506 | Ga0495583_0090147 | Ga0495583_0090147_140_1006 | 279 |
| 549 | 3300046507 | Ga0495606_0000070 | Ga0495606_0000070_169705_170571 | 279 |
| 550 | 3300046507 | Ga0495606_0052909 | Ga0495606_0052909_1706_2572 | 279 |
| 551 | 3300046507 | Ga0495606_0054698 | Ga0495606_0054698_1485_2351 | 279 |
| 552 | 3300046507 | Ga0495606_0229514 | Ga0495606_0229514_77_943 | 279 |
| 553 | 3300046512 | Ga0495610_0004252 | Ga0495610_0004252_3162_4007 | 279 |
| 554 | 3300046512 | Ga0495610_0026614 | Ga0495610_0026614_49_915 | 279 |
| 555 | 3300046513 | Ga0495616_0000646 | Ga0495616_0000646_5451_6317 | 279 |
| 556 | 3300046513 | Ga0495616_0019559 | Ga0495616_0019559_1045_1911 | 279 |
| 557 | 3300046513 | Ga0495616_0046894 | Ga0495616_0046894_1048_1914 | 279 |
| 558 | 3300046515 | Ga0495620_0001634 | Ga0495620_0001634_3342_4187 | 279 |
| 559 | 3300046516 | Ga0495628_0000109 | Ga0495628_0000109_13931_14797 | 279 |
| 560 | 3300046518 | Ga0495631_0004026 | Ga0495631_0004026_2149_3015 | 279 |
| 561 | 3300046518 | Ga0495631_0010136 | Ga0495631_0010136_1446_2297 | 279 |
| 562 | 3300046518 | Ga0495631_0039780 | Ga0495631_0039780_1056_1922 | 279 |
| 563 | 3300046519 | Ga0495632_0000118 | Ga0495632_0000118_45902_46768 | 279 |
| 564 | 3300046519 | Ga0495632_0000321 | Ga0495632_0000321_42681_43547 | 279 |
| 565 | 3300046519 | Ga0495632_0001878 | Ga0495632_0001878_8649_9515 | 279 |
| 566 | 3300046519 | Ga0495632_0006806 | Ga0495632_0006806_3665_4531 | 279 |
| 567 | 3300046519 | Ga0495632_0014187 | Ga0495632_0014187_2549_3415 | 279 |
| 568 | 3300046520 | Ga0495637_0023384 | Ga0495637_0023384_879_1745 | 279 |
| 569 | 3300046522 | Ga0495643_0000236 | Ga0495643_0000236_41286_42152 | 279 |
| 570 | 3300046522 | Ga0495643_0002480 | Ga0495643_0002480_9536_10402 | 279 |
| 571 | 3300046522 | Ga0495643_0050575 | Ga0495643_0050575_148_1014 | 279 |
| 572 | 3300046522 | Ga0495643_0066689 | Ga0495643_0066689_10_876 | 279 |
| 573 | 3300046523 | Ga0495644_0001385 | Ga0495644_0001385_356_1222 | 279 |
| 574 | 3300046523 | Ga0495644_0027680 | Ga0495644_0027680_484_1350 | 279 |
| 575 | 3300046524 | Ga0495648_0000002 | Ga0495648_0000002_466580_467446 | 279 |
| 576 | 3300046524 | Ga0495648_0000033 | Ga0495648_0000033_90124_90990 | 279 |
| 577 | 3300046524 | Ga0495648_0007546 | Ga0495648_0007546_4089_4955 | 279 |
| 578 | 3300046525 | Ga0495663_0001760 | Ga0495663_0001760_5812_6678 | 279 |
| 579 | 3300046525 | Ga0495663_0067745 | Ga0495663_0067745_203_1069 | 279 |
| 580 | 3300046528 | Ga0495642_0000673 | Ga0495642_0000673_4825_5691 | 279 |
| 581 | 3300046528 | Ga0495642_0005081 | Ga0495642_0005081_3554_4420 | 279 |
| 582 | 3300046528 | Ga0495642_0008493 | Ga0495642_0008493_1947_2813 | 279 |
| 583 | 3300046529 | Ga0495652_0082260 | Ga0495652_0082260_528_1394 | 279 |
| 584 | 3300046529 | Ga0495652_0123081 | Ga0495652_0123081_653_1498 | 279 |
| 585 | 3300046530 | Ga0495654_0014733 | Ga0495654_0014733_698_1564 | 279 |
| 586 | 3300046530 | Ga0495654_0050233 | Ga0495654_0050233_1096_1941 | 279 |
| 587 | 3300046533 | Ga0495640_0140977 | Ga0495640_0140977_169_1014 | 279 |
| 588 | 3300046538 | Ga0495609_0000084 | Ga0495609_0000084_32321_33187 | 279 |
| 589 | 3300046538 | Ga0495609_0059233 | Ga0495609_0059233_441_1307 | 279 |
| 590 | 3300046542 | Ga0495597_0000028 | Ga0495597_0000028_111159_112004 | 279 |
| 591 | 3300046542 | Ga0495597_0000080 | Ga0495597_0000080_69996_70862 | 279 |
| 592 | 3300046542 | Ga0495597_0005046 | Ga0495597_0005046_2415_3281 | 279 |
| 593 | 3300046542 | Ga0495597_0021109 | Ga0495597_0021109_267_1133 | 279 |
| 594 | 3300046542 | Ga0495597_0023629 | Ga0495597_0023629_1428_2294 | 279 |
| 595 | 3300046542 | Ga0495597_0036901 | Ga0495597_0036901_1316_2167 | 279 |
| 596 | 3300046557 | Ga0495622_0000483 | Ga0495622_0000483_17251_18117 | 279 |
| 597 | 3300046557 | Ga0495622_0029884 | Ga0495622_0029884_247_1113 | 279 |
| 598 | 3300046558 | Ga0495633_0000204 | Ga0495633_0000204_7125_7991 | 279 |
| 599 | 3300046558 | Ga0495633_0000399 | Ga0495633_0000399_26836_27702 | 279 |
| 600 | 3300046558 | Ga0495633_0009652 | Ga0495633_0009652_1343_2194 | 279 |
| 601 | 3300046558 | Ga0495633_0019359 | Ga0495633_0019359_671_1537 | 279 |
| 602 | 3300046558 | Ga0495633_0052919 | Ga0495633_0052919_213_1079 | 279 |
| 603 | 3300046615 | Ga0495656_0028866 | Ga0495656_0028866_333_1199 | 279 |
| 604 | 3300046616 | Ga0495668_0000132 | Ga0495668_0000132_67717_68583 | 279 |
| 605 | 3300046616 | Ga0495668_0003093 | Ga0495668_0003093_5099_5965 | 279 |
| 606 | 3300046616 | Ga0495668_0009077 | Ga0495668_0009077_4104_4970 | 279 |
| 607 | 3300046616 | Ga0495668_0010419 | Ga0495668_0010419_374_1240 | 279 |
| 608 | 3300046616 | Ga0495668_0013502 | Ga0495668_0013502_2755_3621 | 279 |
| 609 | 3300046616 | Ga0495668_0064593 | Ga0495668_0064593_750_1616 | 279 |
| 610 | 3300046648 | Ga0495611_0001712 | Ga0495611_0001712_3652_4503 | 279 |
| 611 | 3300046648 | Ga0495611_0010146 | Ga0495611_0010146_94_960 | 279 |
| 612 | 3300046648 | Ga0495611_0016943 | Ga0495611_0016943_59_925 | 279 |
| 613 | 3300046660 | Ga0495625_0000177 | Ga0495625_0000177_26722_27588 | 279 |
| 614 | 3300046660 | Ga0495625_0001203 | Ga0495625_0001203_30110_30976 | 279 |
| 615 | 3300046660 | Ga0495625_0010429 | Ga0495625_0010429_4083_4949 | 279 |
| 616 | 3300046660 | Ga0495625_0042302 | Ga0495625_0042302_988_1854 | 279 |
| 617 | 3300046664 | Ga0495659_0000185 | Ga0495659_0000185_21720_22586 | 279 |
| 618 | 3300046664 | Ga0495659_0024668 | Ga0495659_0024668_913_1779 | 279 |
| 619 | 3300046665 | Ga0495661_0000170 | Ga0495661_0000170_52481_53347 | 279 |
| 620 | 3300046665 | Ga0495661_0006188 | Ga0495661_0006188_3482_4348 | 279 |
| 621 | 3300046665 | Ga0495661_0010366 | Ga0495661_0010366_57_923 | 279 |
| 622 | 3300046665 | Ga0495661_0037821 | Ga0495661_0037821_729_1595 | 279 |
| 623 | 3300046665 | Ga0495661_0079702 | Ga0495661_0079702_163_1029 | 279 |
| 624 | 3300046665 | Ga0495661_0105990 | Ga0495661_0105990_238_1104 | 279 |
| 625 | 3300046674 | Ga0495588_0051070 | Ga0495588_0051070_157_1023 | 279 |
| 626 | 3300046678 | Ga0495599_0069794 | Ga0495599_0069794_713_1558 | 279 |
| 627 | 3300046684 | Ga0495669_0001281 | Ga0495669_0001281_702_1568 | 279 |
| 628 | 3300046684 | Ga0495669_0005080 | Ga0495669_0005080_866_1732 | 279 |
| 629 | 3300046690 | Ga0495624_0018331 | Ga0495624_0018331_974_1840 | 279 |
| 630 | 3300046690 | Ga0495624_0071891 | Ga0495624_0071891_843_1709 | 279 |
| 631 | 3300046691 | Ga0495670_0001661 | Ga0495670_0001661_8143_8994 | 279 |
| 632 | 3300046691 | Ga0495670_0002325 | Ga0495670_0002325_6172_7038 | 279 |
| 633 | 3300046691 | Ga0495670_0013246 | Ga0495670_0013246_1885_2751 | 279 |
| 634 | 3300046692 | Ga0495671_0000088 | Ga0495671_0000088_51903_52769 | 279 |
| 635 | 3300046692 | Ga0495671_0009586 | Ga0495671_0009586_84_950 | 279 |
| 636 | 3300046692 | Ga0495671_0084406 | Ga0495671_0084406_504_1370 | 279 |
| 637 | 3300046694 | Ga0495649_0001312 | Ga0495649_0001312_14391_15257 | 279 |
| 638 | 3300046694 | Ga0495649_0012827 | Ga0495649_0012827_3071_3937 | 279 |
| 639 | 3300046694 | Ga0495649_0039555 | Ga0495649_0039555_682_1548 | 279 |
| 640 | 3300046794 | Ga0495589_0001144 | Ga0495589_0001144_13064_13930 | 279 |
| 641 | 3300046794 | Ga0495589_0024179 | Ga0495589_0024179_749_1615 | 279 |
| 642 | 3300046794 | Ga0495589_0040034 | Ga0495589_0040034_818_1684 | 279 |
| 643 | 3300046810 | Ga0495660_0000057 | Ga0495660_0000057_26686_27552 | 279 |
| 644 | 3300046810 | Ga0495660_0000208 | Ga0495660_0000208_20662_21528 | 279 |
| 645 | 3300046810 | Ga0495660_0001806 | Ga0495660_0001806_1424_2290 | 279 |
| 646 | 3300046810 | Ga0495660_0024071 | Ga0495660_0024071_1043_1909 | 279 |
| 647 | 3300046810 | Ga0495660_0048056 | Ga0495660_0048056_955_1821 | 279 |
| 648 | 3300046810 | Ga0495660_0093189 | Ga0495660_0093189_25_891 | 279 |
| 649 | 3300047318 | Ga0495636_0000716 | Ga0495636_0000716_4318_5169 | 279 |
| 650 | 3300047318 | Ga0495636_0028191 | Ga0495636_0028191_1079_1945 | 279 |
| 651 | 3300047320 | Ga0495672_0000262 | Ga0495672_0000262_64296_65162 | 279 |
| 652 | 3300047320 | Ga0495672_0029883 | Ga0495672_0029883_1236_2102 | 279 |
| 653 | 3300047322 | Ga0495680_0011827 | Ga0495680_0011827_3419_4264 | 279 |
| 654 | 3300047323 | Ga0495683_0000072 | Ga0495683_0000072_33947_34813 | 279 |
| 655 | 3300047323 | Ga0495683_0033348 | Ga0495683_0033348_1456_2322 | 279 |
| 656 | 3300047323 | Ga0495683_0039010 | Ga0495683_0039010_322_1188 | 279 |
| 657 | 3300047443 | Ga0495687_000722 | Ga0495687_000722_10543_11409 | 279 |
| 658 | 3300047443 | Ga0495687_000740 | Ga0495687_000740_31731_32597 | 279 |
| 659 | 3300047443 | Ga0495687_001604 | Ga0495687_001604_9450_10316 | 279 |
| 660 | 3300047443 | Ga0495687_003773 | Ga0495687_003773_6576_7442 | 279 |
| 661 | 3300047443 | Ga0495687_020008 | Ga0495687_020008_881_1747 | 279 |
| 662 | 3300047445 | Ga0495677_0000217 | Ga0495677_0000217_7718_8584 | 279 |
| 663 | 3300047445 | Ga0495677_0000873 | Ga0495677_0000873_3137_4003 | 279 |
| 664 | 3300047445 | Ga0495677_0002104 | Ga0495677_0002104_4876_5742 | 279 |
| 665 | 3300047445 | Ga0495677_0002684 | Ga0495677_0002684_957_1823 | 279 |
| 666 | 3300047445 | Ga0495677_0003892 | Ga0495677_0003892_3693_4559 | 279 |
| 667 | 3300047445 | Ga0495677_0004159 | Ga0495677_0004159_2531_3397 | 279 |
| 668 | 3300047445 | Ga0495677_0005946 | Ga0495677_0005946_2027_2893 | 279 |
| 669 | 3300047445 | Ga0495677_0008922 | Ga0495677_0008922_576_1427 | 279 |
| 670 | 3300047446 | Ga0495679_005033 | Ga0495679_005033_4064_4930 | 279 |
| 671 | 3300047470 | Ga0495681_0002551 | Ga0495681_0002551_9087_9932 | 279 |
| 672 | 3300047470 | Ga0495681_0007002 | Ga0495681_0007002_6174_7040 | 279 |
| 673 | 3300047470 | Ga0495681_0008872 | Ga0495681_0008872_2673_3539 | 279 |
| 674 | 3300047470 | Ga0495681_0037694 | Ga0495681_0037694_1369_2235 | 279 |
| 675 | 3300047470 | Ga0495681_0043194 | Ga0495681_0043194_1243_2109 | 279 |
| 676 | 3300047472 | Ga0495686_0003319 | Ga0495686_0003319_9007_9849 | 279 |
| 677 | 3300047472 | Ga0495686_0038635 | Ga0495686_0038635_1797_2663 | 279 |
| 678 | 3300047472 | Ga0495686_0121925 | Ga0495686_0121925_586_1452 | 279 |
| 679 | 3300047472 | Ga0495686_0181227 | Ga0495686_0181227_229_1095 | 279 |
| 680 | 3300048088 | Ga0495602_0050698 | Ga0495602_0050698_608_1474 | 279 |
| 681 | 3300048091 | Ga0495626_0000011 | Ga0495626_0000011_251981_252847 | 279 |
| 682 | 3300048091 | Ga0495626_0011297 | Ga0495626_0011297_1353_2219 | 279 |
| 683 | 3300048091 | Ga0495626_0011964 | Ga0495626_0011964_244_1110 | 279 |
| 684 | 3300048091 | Ga0495626_0020550 | Ga0495626_0020550_1336_2202 | 279 |
| 685 | 3300048091 | Ga0495626_0094246 | Ga0495626_0094246_70_936 | 279 |
| 686 | 3300048904 | Ga0496101_0138280 | Ga0496101_0138280_469_1335 | 279 |
| 687 | 3300048904 | Ga0496101_0156154 | Ga0496101_0156154_540_1406 | 279 |
| 688 | 3300048905 | Ga0496102_0060133 | Ga0496102_0060133_917_1783 | 279 |
| 689 | 3300048906 | Ga0496103_0049655 | Ga0496103_0049655_191_1057 | 279 |
| 690 | 3300048907 | Ga0496104_0073802 | Ga0496104_0073802_1165_2031 | 279 |
| 691 | 3300048909 | Ga0496106_0012017 | Ga0496106_0012017_4746_5612 | 279 |
| 692 | 3300048909 | Ga0496106_0061377 | Ga0496106_0061377_503_1369 | 279 |
| 693 | 3300048910 | Ga0496107_0040886 | Ga0496107_0040886_370_1236 | 279 |
| 694 | 3300048911 | Ga0496108_0607873 | Ga0496108_0607873_63_929 | 279 |
| 695 | 3300048914 | Ga0496111_0016619 | Ga0496111_0016619_568_1434 | 279 |
| 696 | 3300048917 | Ga0496114_0214596 | Ga0496114_0214596_520_1386 | 279 |
| 697 | 3300048919 | Ga0496116_0031617 | Ga0496116_0031617_1757_2623 | 279 |
| 698 | 3300048919 | Ga0496116_0048918 | Ga0496116_0048918_808_1674 | 279 |
| 699 | 3300048920 | Ga0496117_0000011 | Ga0496117_0000011_387764_388630 | 279 |
| 700 | 3300048921 | Ga0496118_0000010 | Ga0496118_0000010_222301_223167 | 279 |
| 701 | 3300048921 | Ga0496118_0076880 | Ga0496118_0076880_1398_2264 | 279 |
| 702 | 3300048922 | Ga0496119_0011802 | Ga0496119_0011802_5894_6739 | 279 |
| 703 | 3300048922 | Ga0496119_0012354 | Ga0496119_0012354_2010_2876 | 279 |
| 704 | 3300048923 | Ga0496120_0025916 | Ga0496120_0025916_2567_3433 | 279 |
| 705 | 3300048923 | Ga0496120_0106982 | Ga0496120_0106982_306_1151 | 279 |
| 706 | 3300048924 | Ga0496121_0000490 | Ga0496121_0000490_2123_2989 | 279 |
| 707 | 3300048924 | Ga0496121_0004661 | Ga0496121_0004661_4830_5696 | 279 |
| 708 | 3300048924 | Ga0496121_0088627 | Ga0496121_0088627_1544_2392 | 279 |
| 709 | 3300048925 | Ga0496122_0000821 | Ga0496122_0000821_18405_19271 | 279 |
| 710 | 3300048925 | Ga0496122_0023924 | Ga0496122_0023924_229_1095 | 279 |
| 711 | 3300048925 | Ga0496122_0069721 | Ga0496122_0069721_1138_2004 | 279 |
| 712 | 3300048926 | Ga0496123_0000872 | Ga0496123_0000872_36011_36877 | 279 |
| 713 | 3300048926 | Ga0496123_0001273 | Ga0496123_0001273_25333_26199 | 279 |
| 714 | 3300048926 | Ga0496123_0030777 | Ga0496123_0030777_1784_2650 | 279 |
| 715 | 3300048926 | Ga0496123_0057754 | Ga0496123_0057754_1428_2294 | 279 |
| 716 | 3300048927 | Ga0496124_0233659 | Ga0496124_0233659_138_1004 | 279 |
| 717 | 3300048928 | Ga0496125_0000884 | Ga0496125_0000884_30885_31751 | 279 |
| 718 | 3300048928 | Ga0496125_0116580 | Ga0496125_0116580_999_1865 | 279 |
| 719 | 3300048929 | Ga0496126_0043152 | Ga0496126_0043152_1766_2632 | 279 |
| 720 | 3300048929 | Ga0496126_0088424 | Ga0496126_0088424_1314_2180 | 279 |
| 721 | 3300049459 | Ga0495678_007026 | Ga0495678_007026_3073_3939 | 279 |
| 722 | 3300049459 | Ga0495678_053681 | Ga0495678_053681_389_1255 | 279 |
| 723 | 3300049459 | Ga0495678_070702 | Ga0495678_070702_386_1252 | 279 |
| 724 | 3300049460 | Ga0495682_0003951 | Ga0495682_0003951_4629_5495 | 279 |
| 725 | 3300049460 | Ga0495682_0016442 | Ga0495682_0016442_1778_2644 | 279 |
| 726 | 3300049570 | Ga0501033_0000186 | Ga0501033_0000186_7569_8417 | 279 |
| 727 | 3300049570 | Ga0501033_0029154 | Ga0501033_0029154_1717_2580 | 279 |
| 728 | 3300049581 | Ga0501047_0008047 | Ga0501047_0008047_2425_3288 | 279 |
| 729 | 3300049592 | Ga0501076_0215169 | Ga0501076_0215169_431_1276 | 279 |
| 730 | 3300049822 | Ga0501035_0000292 | Ga0501035_0000292_12023_12889 | 279 |
| 731 | 3300049822 | Ga0501035_0001063 | Ga0501035_0001063_22057_22905 | 279 |
| 732 | 3300049822 | Ga0501035_0028835 | Ga0501035_0028835_2378_3241 | 279 |
| 733 | 3300049823 | Ga0501044_0005038 | Ga0501044_0005038_2609_3472 | 279 |
| 734 | 3300049823 | Ga0501044_0171576 | Ga0501044_0171576_64_930 | 279 |
| 735 | 3300050493 | nmdc:mga0k408_1383_c1 | nmdc:mga0k408_1383_c1_10106_10972 | 279 |
| 736 | 3300050493 | nmdc:mga0k408_34927_c1 | nmdc:mga0k408_34927_c1_1909_2775 | 279 |
| 737 | 3300050493 | nmdc:mga0k408_53133_c1 | nmdc:mga0k408_53133_c1_950_1816 | 279 |
| 738 | 3300050494 | nmdc:mga06z11_52034_c1 | nmdc:mga06z11_52034_c1_1105_1971 | 279 |
| 739 | 3300050494 | nmdc:mga06z11_8396_c1 | nmdc:mga06z11_8396_c1_1311_2177 | 279 |
| 740 | 3300050496 | nmdc:mga07m45_100192_c1 | nmdc:mga07m45_100192_c1_446_1312 | 279 |
| 741 | 3300050496 | nmdc:mga07m45_3676_c1 | nmdc:mga07m45_3676_c1_3561_4427 | 279 |
| 742 | 3300050496 | nmdc:mga07m45_6783_c1 | nmdc:mga07m45_6783_c1_4769_5635 | 279 |
| 743 | 3300050496 | nmdc:mga07m45_88556_c1 | nmdc:mga07m45_88556_c1_64_930 | 279 |
| 744 | 3300050516 | nmdc:mga0sz30_4699_c1 | nmdc:mga0sz30_4699_c1_3674_4540 | 279 |
| 745 | 3300050516 | nmdc:mga0sz30_5171_c1 | nmdc:mga0sz30_5171_c1_1332_2198 | 279 |
| 746 | 3300053111 | Ga0500572_000038 | Ga0500572_000038_10535_11386 | 279 |
| 747 | 3300053134 | Ga0500658_0013184 | Ga0500658_0013184_1800_2666 | 279 |
| 748 | 3300053136 | Ga0500559_0000326 | Ga0500559_0000326_26823_27689 | 279 |
| 749 | 3300053139 | Ga0500568_0011765 | Ga0500568_0011765_2003_2869 | 279 |
| 750 | 3300053156 | Ga0500622_0003342 | Ga0500622_0003342_1777_2643 | 279 |
| 751 | 3300053730 | Ga0500645_006464 | Ga0500645_006464_2059_2925 | 279 |
| 752 | 3300061719 | Ga0466962_0019076 | Ga0466962_0019076_515_1360 | 279 |
| 753 | 3300061719 | Ga0466962_0046904 | Ga0466962_0046904_201_1067 | 279 |
| 754 | 3300061719 | Ga0466962_0093047 | Ga0466962_0093047_397_1263 | 279 |
| 755 | 2162886007 | SwRhRL2b_contig_3045014 | SwRhRL2b_0237.00006530 | 280 |
| 756 | 3300005289 | Ga0065704_10075819 | Ga0065704_100758194 | 280 |
| 757 | 3300005456 | Ga0070678_100031159 | Ga0070678_1000311593 | 280 |
| 758 | 3300005468 | Ga0070707_100053914 | Ga0070707_1000539142 | 280 |
| 759 | 3300005563 | Ga0068855_100007936 | Ga0068855_1000079362 | 280 |
| 760 | 3300006195 | Ga0075366_10001538 | Ga0075366_100015388 | 280 |
| 761 | 3300009093 | Ga0105240_10033580 | Ga0105240_100335803 | 280 |
| 762 | 3300009545 | Ga0105237_10006766 | Ga0105237_100067667 | 280 |
| 763 | 3300009545 | Ga0105237_10007760 | Ga0105237_100077607 | 280 |
| 764 | 3300009545 | Ga0105237_10038836 | Ga0105237_100388365 | 280 |
| 765 | 3300009551 | Ga0105238_10010968 | Ga0105238_100109683 | 280 |
| 766 | 3300009553 | Ga0105249_10003126 | Ga0105249_100031268 | 280 |
| 767 | 3300010375 | Ga0105239_10000663 | Ga0105239_100006632 | 280 |
| 768 | 3300010375 | Ga0105239_10004145 | Ga0105239_1000414512 | 280 |
| 769 | 3300013104 | Ga0157370_10008953 | Ga0157370_100089538 | 280 |
| 770 | 3300025303 | Ga0209051_1002074 | Ga0209051_100207412 | 280 |
| 771 | 3300025303 | Ga0209051_1068898 | Ga0209051_10688981 | 280 |
| 772 | 3300025909 | Ga0207705_10000481 | Ga0207705_1000048121 | 280 |
| 773 | 3300025910 | Ga0207684_10011762 | Ga0207684_100117624 | 280 |
| 774 | 3300025913 | Ga0207695_10015843 | Ga0207695_100158437 | 280 |
| 775 | 3300025913 | Ga0207695_10022800 | Ga0207695_100228007 | 280 |
| 776 | 3300025913 | Ga0207695_10305994 | Ga0207695_103059942 | 280 |
| 777 | 3300025914 | Ga0207671_10006346 | Ga0207671_100063466 | 280 |
| 778 | 3300025914 | Ga0207671_10007479 | Ga0207671_100074793 | 280 |
| 779 | 3300025914 | Ga0207671_10037912 | Ga0207671_100379122 | 280 |
| 780 | 3300025924 | Ga0207694_10005550 | Ga0207694_100055509 | 280 |
| 781 | 3300025949 | Ga0207667_10006345 | Ga0207667_100063456 | 280 |
| 782 | 3300025961 | Ga0207712_10002005 | Ga0207712_100020057 | 280 |
| 783 | 3300026121 | Ga0207683_10017139 | Ga0207683_100171394 | 280 |
| 784 | 3300027876 | Ga0209974_10051954 | Ga0209974_100519542 | 280 |
| 785 | 3300031903 | Ga0307407_10339071 | Ga0307407_103390711 | 280 |
| 786 | 3300032002 | Ga0307416_100551542 | Ga0307416_1005515421 | 280 |
| 787 | 3300037466 | Ga0395898_0000201 | Ga0395898_0000201_139587_140453 | 280 |
| 788 | 3300037466 | Ga0395898_0241195 | Ga0395898_0241195_765_1613 | 280 |
| 789 | 3300044656 | Ga0466969_0000232 | Ga0466969_0000232_8063_8926 | 280 |
| 790 | 3300044683 | Ga0466965_0000082 | Ga0466965_0000082_20076_20939 | 280 |
| 791 | 3300044684 | Ga0466966_0004513 | Ga0466966_0004513_6318_7181 | 280 |
| 792 | 3300044693 | Ga0466961_0000229 | Ga0466961_0000229_29032_29895 | 280 |
| 793 | 3300044693 | Ga0466961_0006081 | Ga0466961_0006081_3672_4535 | 280 |
| 794 | 3300044694 | Ga0466963_0005033 | Ga0466963_0005033_2968_3831 | 280 |
| 795 | 3300044765 | Ga0466970_0040109 | Ga0466970_0040109_67_930 | 280 |
| 796 | 3300044765 | Ga0466970_0087732 | Ga0466970_0087732_618_1481 | 280 |
| 797 | 3300044842 | Ga0466957_0005060 | Ga0466957_0005060_4947_5810 | 280 |
| 798 | 3300045049 | Ga0466959_0013955 | Ga0466959_0013955_3567_4430 | 280 |
| 799 | 3300045836 | Ga0466958_0005517 | Ga0466958_0005517_5293_6156 | 280 |
| 800 | 3300045976 | Ga0466967_0693098 | Ga0466967_0693098_66_914 | 280 |
| 801 | 3300046472 | Ga0495580_0019602 | Ga0495580_0019602_2619_3479 | 280 |
| 802 | 3300046524 | Ga0495648_0043992 | Ga0495648_0043992_1092_1952 | 280 |
| 803 | 3300046660 | Ga0495625_0065650 | Ga0495625_0065650_1278_2120 | 280 |
| 804 | 3300048090 | Ga0495615_0000170 | Ga0495615_0000170_10259_11104 | 280 |
| 805 | 3300048917 | Ga0496114_0355574 | Ga0496114_0355574_333_1181 | 280 |
| 806 | 3300048922 | Ga0496119_0002111 | Ga0496119_0002111_10245_11090 | 280 |
| 807 | 3300048925 | Ga0496122_0005095 | Ga0496122_0005095_10770_11615 | 280 |
| 808 | 3300048926 | Ga0496123_0003879 | Ga0496123_0003879_10973_11818 | 280 |
| 809 | 3300048928 | Ga0496125_0046007 | Ga0496125_0046007_1349_2194 | 280 |
| 810 | 3300048928 | Ga0496125_0148245 | Ga0496125_0148245_752_1603 | 280 |
| 811 | 3300049573 | Ga0501037_0269359 | Ga0501037_0269359_295_1143 | 280 |
| 812 | 3300049583 | Ga0501067_0221256 | Ga0501067_0221256_124_972 | 280 |
| 813 | 3300049741 | Ga0501079_0103835 | Ga0501079_0103835_63_911 | 280 |
| 814 | 3300049823 | Ga0501044_0118140 | Ga0501044_0118140_1107_1955 | 280 |
| 815 | 3300050493 | nmdc:mga0k408_48393_c1 | nmdc:mga0k408_48393_c1_1357_2211 | 280 |
| 816 | 3300050493 | nmdc:mga0k408_6516_c1 | nmdc:mga0k408_6516_c1_4111_4971 | 280 |
| 817 | 3300050496 | nmdc:mga07m45_4791_c2 | nmdc:mga07m45_4791_c2_4405_5265 | 280 |
| 818 | 3300061719 | Ga0466962_0017319 | Ga0466962_0017319_2465_3328 | 280 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8gst-assembly2.cif.gz_D | crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (pyruvate bound-form) | 0.9689 | 1 | 280 |
| 8gst-assembly2.cif.gz_D | crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (pyruvate bound-form) | 0.9553 | 1 | 280 |
| 6fog-assembly4.cif.gz_D | x-ray structure of homo sapiens fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate at 1.94a resolution. | 0.9443 | 71 | 280 |
| 6sbi-assembly2.cif.gz_C | x-ray structure of murine fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate | 0.9292 | 71 | 279 |
| 1wzo-assembly1.cif.gz_C | crystal structure of the hpce from thermus thermophilus hb8 | 0.9291 | 1 | 279 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9VU50_128_337_3.90.850.10 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.9788 | 68 | 280 | 3.90.850.10 |
| af_A0A1D8PI10_75_291_3.90.850.10 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.9767 | 69 | 277 | 3.90.850.10 |
| af_Q9VU50_128_337_3.90.850.10 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.965 | 68 | 280 | 3.90.850.10 |
| af_Q96GK7_51_314_3.90.850.10 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.9625 | 27 | 277 | 3.90.850.10 |
| af_Q2FZT4_90_300_3.90.850.10 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.9613 | 70 | 277 | 3.90.850.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V1SP07-F1-model_v4 | FAA hydrolase family protein | 0.9942 | 75 | 280 |
GO:0016787
GO:0044281 |
| AF-A0A7C7BQ93-F1-model_v4 | deleted | 0.994 | 102 | 279 |
|
| AF-A0A6J5CQM4-F1-model_v4 | 2-keto-4-pentenoate hydratase (EC 4.2.1.80) | 0.9939 | 1 | 280 |
GO:0008684
GO:0044281 |
| AF-A0A0Q4TVS1-F1-model_v4 | 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase | 0.9938 | 1 | 278 |
GO:0016853
GO:0044281 |
| AF-A0A1M5XN10-F1-model_v4 | 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase (Catechol pathway) | 0.9935 | 1 | 280 |
GO:0003824
GO:0044281 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar