F482154

General Info

Members Datasets Scaffolds Average Seq Length
818 374 774 286

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2887375801|2887376945
Length 281
Sequence RYGPPGEEVPAALDSRDVVRDLSSVCDDITPETLSPQALDRLRAIDLSALPALPAGGRFGVPVRGVSKFIGIGLNYRDHAEEAGMEIPSEPVIFMKTPTSLCGASDNIVQPPHSTKLDYEVELGVVIGTKASHVPEERALDYVAGYCVVNDVSERAFQFQSPSWDKGKGCDTFGPAGPWLVTTDEIADPQQLAMWLDVNGERRQSSDTRNMIFTVQHLVAYCSRYMTLLPGDIIATGTPAGVALGMQSADPWLKVGDRVSLSIAGLGTQSQQVVAWQHPAD

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
3 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
4 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
5 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
6 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
7 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
8 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
9 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
10 2643221556 Massilia sp. Root1485 Isolate Unclassified
11 2643221569 Achromobacter sp. Root565 Isolate Unclassified
12 2643221585 Pelomonas sp. Root662 Isolate Unclassified
13 2643221594 Achromobacter sp. Root170 Isolate Unclassified
14 2643221621 Achromobacter sp. Root83 Isolate Unclassified
15 2643221645 Massilia sp. Root351 Isolate Unclassified
16 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
17 2643221656 Pelomonas sp. Root405 Isolate Unclassified
18 2643221664 Massilia sp. Root418 Isolate Unclassified
19 2643221684 Massilia sp. Root133 Isolate Unclassified
20 2738541280 Massilia sp. GV090 Isolate Unclassified
21 2738541300 Massilia sp. GV016 Isolate Unclassified
22 2738543018 Massilia sp. GV045 Isolate Unclassified
23 2738543030 Massilia sp. GV097 Isolate Unclassified
24 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
25 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
26 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
27 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
28 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
29 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
30 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
31 2842711865 Duganella sp. R-73148 Isolate Unclassified
32 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
33 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
34 2858950400 Achromobacter sp. K91 Isolate Unclassified
35 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
36 2904424332 Duganella sp. 1411 Isolate Rhizosphere
37 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
38 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
39 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
40 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
41 2941479691
42 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
43 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
44 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
45 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
46 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
47 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
48 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
49 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
50 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
51 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
52 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
53 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
54 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
55 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
56 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
57 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
58 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
59 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
60 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
61 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
62 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
63 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
64 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
65 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
66 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
67 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
68 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
69 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
70 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
71 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
72 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
73 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
74 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
75 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
76 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
77 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
78 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
79 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
80 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
81 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
82 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
83 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
84 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
85 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
86 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
87 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
88 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
89 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
90 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
91 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
92 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
93 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
94 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
95 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
96 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
97 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
98 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
99 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
100 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
101 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
102 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
103 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
104 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
105 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
106 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
107 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
108 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
109 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
111 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
112 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
113 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
114 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
115 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
116 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
117 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
118 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
119 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
120 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
121 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
122 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
123 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
124 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
125 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
126 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
127 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
128 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
129 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
130 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
131 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
132 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
133 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
134 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
135 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
136 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
137 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
138 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
139 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
141 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
142 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
145 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
149 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
150 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
152 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
153 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
154 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
157 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
203 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
208 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
209 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
210 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
211 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
212 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
213 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
214 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
215 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
216 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
217 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
218 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
219 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
220 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
221 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
222 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
223 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
224 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
225 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
226 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
227 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
228 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
229 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
230 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
231 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
232 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
233 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
234 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
235 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
236 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
237 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
238 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
239 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
240 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
241 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
242 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
243 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
244 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
245 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
246 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
247 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
248 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
249 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
250 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
251 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
252 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
253 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
254 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
255 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
256 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
257 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
258 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
259 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
260 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
261 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
262 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
263 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
264 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
265 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
266 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
267 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
268 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
269 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
270 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
271 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
272 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
273 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
274 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
275 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
276 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
277 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
278 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
279 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
280 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
281 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
282 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
283 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
284 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
285 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
286 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
287 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
288 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
289 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
290 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
291 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
292 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
293 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
294 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
295 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
296 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
297 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
298 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
299 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
300 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
301 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
302 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
303 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
304 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
305 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
306 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
307 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
308 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
309 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
310 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
311 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
312 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
313 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
314 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
315 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
316 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
317 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
318 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
319 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
320 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
321 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
322 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
323 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
324 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
325 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
326 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
327 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
328 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
329 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
330 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
331 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
332 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
333 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
334 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
335 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
336 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
337 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
338 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
339 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
340 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
341 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
342 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
343 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
344 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
345 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
346 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
347 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
348 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
349 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
350 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
351 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
354 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
355 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
356 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
357 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
359 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
360 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
361 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
362 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
363 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
364 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
365 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
366 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
367 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
368 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
369 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
370 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
371 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
372 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
373 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
374 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.25
Metatranscriptomes 0.37
Isolates 5.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.43
Nodule 0.12
Rhizoplane 2.2
Rhizosphere 72.74
Stem 0
Stem Tuber 0
Unclassified 10.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3045014 2162886007 Bacteria 3108
2 JGI25158J39367_1000072 3300002739 Bacteria 23033
3 JGI25152J39213_1000002 3300002773 Bacteria 219237
4 JGI25152J39213_1002551 3300002773 Bacteria 6857
5 JGI25150J39212_1000038 3300002774 Bacteria 88070
6 JGI25150J39212_1004440 3300002774 Bacteria 3121
7 JGI25150J39212_1014009 3300002774 Bacteria 1373
8 JGI25159J45721_1000185 3300002987 Bacteria 28695
9 JGI25159J45721_1000254 3300002987 Bacteria 25167
10 JGI25153J46596_10002426 3300003215 Bacteria 10751
11 JGI25160J50197_1010928 3300003354 Bacteria 3253
12 JGI25161J50226_1000062 3300003374 Bacteria 99783
13 JGI25161J50226_1001608 3300003374 Bacteria 6584
14 Ga0007417J51691_1037902 3300003544 Bacteria 1184
15 Ga0007416J51690_1048530 3300003577 Bacteria 2369
16 Ga0032354_1067082 3300003693 Bacteria 1262
17 Ga0055525_1000047 3300003759 Bacteria 261507
18 Ga0055529_1000330 3300003763 Bacteria 53265
19 Ga0055526_1000358 3300003771 Bacteria 37034
20 Ga0055526_1000632 3300003771 Bacteria 27319
21 Ga0055537_1010324 3300003773 Bacteria 1977
22 Ga0055524_1000105 3300003775 Bacteria 104121
23 Ga0055524_1000462 3300003775 Bacteria 32912
24 Ga0055534_1006004 3300003784 Bacteria 3140
25 Ga0055530_10000078 3300003791 Bacteria 83740
26 Ga0055530_10006780 3300003791 Bacteria 4993
27 Ga0055530_10015724 3300003791 Bacteria 2454
28 Ga0055531_10001856 3300003794 Bacteria 14853
29 Ga0055531_10007148 3300003794 Bacteria 6156
30 Ga0055531_10014463 3300003794 Bacteria 3550
31 Ga0055543_1000121 3300004625 Bacteria 66082
32 Ga0055543_1018635 3300004625 Bacteria 1293
33 Ga0065165_1000261 3300005262 Bacteria 90816
34 Ga0065165_1018238 3300005262 Bacteria 2550
35 Ga0065165_1022086 3300005262 Bacteria 2191
36 Ga0065704_10075819 3300005289 Bacteria 5401
37 Ga0065707_10087177 3300005295 Bacteria 5129
38 Ga0070658_10090392 3300005327 Bacteria 2522
39 Ga0070658_10147892 3300005327 Bacteria 1965
40 Ga0070676_10128148 3300005328 Bacteria 1602
41 Ga0070690_100040624 3300005330 Bacteria 2942
42 Ga0070670_100394202 3300005331 Bacteria 1221
43 Ga0070677_10061668 3300005333 Bacteria 1548
44 Ga0068869_100014797 3300005334 Bacteria 5219
45 Ga0070666_10001793 3300005335 Bacteria 13078
46 Ga0070666_10117478 3300005335 Bacteria 1842
47 Ga0068868_100000185 3300005338 Bacteria 41542
48 Ga0068868_100039078 3300005338 Bacteria 3685
49 Ga0070660_100005946 3300005339 Bacteria 8437
50 Ga0070660_100057569 3300005339 Bacteria 3011
51 Ga0070689_100010833 3300005340 Bacteria 6516
52 Ga0070661_100062889 3300005344 Bacteria 2725
53 Ga0070661_100116935 3300005344 Bacteria 1995
54 Ga0070668_100088387 3300005347 Bacteria 2439
55 Ga0070675_100001427 3300005354 Bacteria 17552
56 Ga0070671_100015468 3300005355 Bacteria 6165
57 Ga0070671_100032748 3300005355 Bacteria 4295
58 Ga0070671_100065906 3300005355 Bacteria 3017
59 Ga0070674_100013873 3300005356 Bacteria 4993
60 Ga0070673_100002536 3300005364 Bacteria 11150
61 Ga0070659_100460885 3300005366 Bacteria 1079
62 Ga0070667_100004052 3300005367 Bacteria 12388
63 Ga0070667_100020821 3300005367 Bacteria 5447
64 Ga0070667_100102348 3300005367 Bacteria 2475
65 Ga0070713_100017602 3300005436 Bacteria 5409
66 Ga0070713_100127463 3300005436 Bacteria 2241
67 Ga0070713_100428249 3300005436 Bacteria 1240
68 Ga0070663_100003487 3300005455 Bacteria 9072
69 Ga0070678_100007438 3300005456 Bacteria 6499
70 Ga0070678_100031159 3300005456 Bacteria 3675
71 Ga0070662_100023588 3300005457 Bacteria 4228
72 Ga0070662_100073159 3300005457 Bacteria 2532
73 Ga0068867_100000091 3300005459 Bacteria 57689
74 Ga0068867_100000575 3300005459 Bacteria 24349
75 Ga0068867_100030151 3300005459 Bacteria 3912
76 Ga0070706_100053808 3300005467 Bacteria 3715
77 Ga0070707_100037519 3300005468 Bacteria 4626
78 Ga0070707_100053914 3300005468 Bacteria 3855
79 Ga0068853_100450510 3300005539 Bacteria 1210
80 Ga0070665_100067489 3300005548 Bacteria 3586
81 Ga0068855_100007936 3300005563 Bacteria 12827
82 Ga0068855_100028111 3300005563 Bacteria 6726
83 Ga0068855_100243636 3300005563 Bacteria 2008
84 Ga0068855_100732488 3300005563 Bacteria 1056
85 Ga0070664_100044628 3300005564 Bacteria 3742
86 Ga0070664_100045657 3300005564 Bacteria 3700
87 Ga0068857_100072314 3300005577 Bacteria 3073
88 Ga0068854_100038548 3300005578 Bacteria 3362
89 Ga0068852_100002707 3300005616 Bacteria 12247
90 Ga0068852_100039543 3300005616 Bacteria 3972
91 Ga0068852_100527833 3300005616 Bacteria 1178
92 Ga0068859_100001283 3300005617 Bacteria 25657
93 Ga0068859_100003193 3300005617 Bacteria 16684
94 Ga0068859_100470370 3300005617 Bacteria 1353
95 Ga0068864_100001050 3300005618 Bacteria 23192
96 Ga0068864_100012823 3300005618 Bacteria 6931
97 Ga0068864_100079789 3300005618 Bacteria 2866
98 Ga0068866_10009221 3300005718 Bacteria 4184
99 Ga0068863_100004913 3300005841 Bacteria 13173
100 Ga0068863_100052600 3300005841 Bacteria 3859
101 Ga0068858_100000885 3300005842 Bacteria 31082
102 Ga0068858_100039812 3300005842 Bacteria 4357
103 Ga0081455_10191201 3300005937 Bacteria 1541
104 Ga0075368_10034434 3300006042 Bacteria 1974
105 Ga0075363_100065833 3300006048 Bacteria 1960
106 Ga0075362_10039556 3300006177 Bacteria 2074
107 Ga0075367_10007260 3300006178 Bacteria 5664
108 Ga0075367_10035029 3300006178 Bacteria 2903
109 Ga0075367_10044514 3300006178 Bacteria 2602
110 Ga0075369_10014572 3300006186 Bacteria 3144
111 Ga0075366_10001538 3300006195 Bacteria 11541
112 Ga0075366_10028470 3300006195 Bacteria 3279
113 Ga0075366_10038701 3300006195 Bacteria 2817
114 Ga0075366_10166616 3300006195 Bacteria 1336
115 Ga0075366_10174630 3300006195 Bacteria 1304
116 Ga0075366_10208723 3300006195 Bacteria 1188
117 Ga0097621_100032688 3300006237 Bacteria 4137
118 Ga0075370_10001906 3300006353 Bacteria 9384
119 Ga0075370_10026207 3300006353 Bacteria 3228
120 Ga0075370_10097513 3300006353 Bacteria 1700
121 Ga0075370_10147990 3300006353 Bacteria 1375
122 Ga0075430_100349794 3300006846 Bacteria 1221
123 Ga0068865_100027990 3300006881 Bacteria 3729
124 Ga0097620_100001283 3300006931 Bacteria 25657
125 Ga0097620_100003193 3300006931 Bacteria 16684
126 Ga0097620_100470364 3300006931 Bacteria 1353
127 Ga0097620_100521135 3300006931 Bacteria 1284
128 Ga0099794_10102458 3300007265 Bacteria 1430
129 Ga0099795_10000365 3300007788 Bacteria 8128
130 Ga0105240_10033580 3300009093 Bacteria 6625
131 Ga0105240_10285404 3300009093 Bacteria 1895
132 Ga0105240_10347248 3300009093 Bacteria 1684
133 Ga0111539_10534465 3300009094 Bacteria 1366
134 Ga0105243_10002148 3300009148 Bacteria 16656
135 Ga0105243_10004977 3300009148 Bacteria 10415
136 Ga0105243_10300929 3300009148 Bacteria 1453
137 Ga0105241_10041921 3300009174 Bacteria 3460
138 Ga0105248_10015738 3300009177 Bacteria 8337
139 Ga0105248_10029339 3300009177 Bacteria 6137
140 Ga0105248_10133406 3300009177 Bacteria 2802
141 Ga0105237_10006766 3300009545 Bacteria 12649
142 Ga0105237_10007760 3300009545 Bacteria 11705
143 Ga0105237_10008094 3300009545 Bacteria 11423
144 Ga0105237_10023051 3300009545 Bacteria 6383
145 Ga0105237_10038836 3300009545 Bacteria 4808
146 Ga0105237_10119406 3300009545 Bacteria 2630
147 Ga0105237_10515995 3300009545 Bacteria 1202
148 Ga0105238_10010968 3300009551 Bacteria 9113
149 Ga0105238_10537803 3300009551 Bacteria 1172
150 Ga0105249_10003126 3300009553 Bacteria 14312
151 Ga0099796_10004703 3300010159 Bacteria 3332
152 Ga0105239_10000663 3300010375 Bacteria 49003
153 Ga0105239_10004145 3300010375 Bacteria 17402
154 Ga0105239_10021983 3300010375 Bacteria 7031
155 Ga0105239_10150048 3300010375 Bacteria 2601
156 Ga0157370_10008953 3300013104 Bacteria 10750
157 Ga0157370_10099698 3300013104 Bacteria 2722
158 Ga0157374_10021504 3300013296 Bacteria 5742
159 Ga0163162_10009476 3300013306 Bacteria 9467
160 Ga0163162_10044850 3300013306 Bacteria 4429
161 Ga0163162_10141381 3300013306 Bacteria 2521
162 Ga0157372_10139423 3300013307 Bacteria 2793
163 Ga0157375_10053711 3300013308 Bacteria 3965
164 Ga0182008_10000190 3300014497 Bacteria 48677
165 Ga0182008_10000949 3300014497 Bacteria 20195
166 Ga0157377_10000036 3300014745 Bacteria 116358
167 Ga0157377_10000107 3300014745 Bacteria 57351
168 Ga0157379_10002653 3300014968 Bacteria 15057
169 Ga0157379_10045551 3300014968 Bacteria 3914
170 Ga0157379_10214056 3300014968 Bacteria 1745
171 Ga0157376_10652482 3300014969 Bacteria 1053
172 Ga0157376_10731186 3300014969 Bacteria 997
173 Ga0182006_1000004 3300015261 Bacteria 622190
174 Ga0182007_10000018 3300015262 Bacteria 198916
175 Ga0182007_10001150 3300015262 Bacteria 14339
176 Ga0182005_1000011 3300015265 Bacteria 420605
177 Ga0209436_100005 3300025208 Bacteria 151087
178 Ga0209436_100153 3300025208 Bacteria 33091
179 Ga0209563_100003 3300025230 Bacteria 1932942
180 Ga0207425_1000001 3300025245 Bacteria 2525432
181 Ga0207425_1000033 3300025245 Bacteria 245540
182 Ga0207425_1000430 3300025245 Bacteria 27743
183 Ga0207425_1000883 3300025245 Bacteria 14568
184 Ga0209646_1000106 3300025246 Bacteria 163422
185 Ga0209677_101295 3300025253 Bacteria 11132
186 Ga0209148_1000871 3300025254 Bacteria 21034
187 Ga0209129_1000001 3300025258 Bacteria 1452436
188 Ga0209129_1000841 3300025258 Bacteria 19262
189 Ga0209129_1010442 3300025258 Bacteria 2315
190 Ga0209565_1001351 3300025263 Bacteria 11117
191 Ga0209565_1006156 3300025263 Bacteria 3398
192 Ga0209565_1006380 3300025263 Bacteria 3314
193 Ga0209565_1013441 3300025263 Bacteria 1916
194 Ga0209565_1020588 3300025263 Bacteria 1390
195 Ga0207666_1004244 3300025271 Bacteria 1790
196 Ga0209455_1000033 3300025272 Bacteria 504606
197 Ga0209130_1000055 3300025284 Bacteria 211696
198 Ga0209130_1000592 3300025284 Bacteria 35299
199 Ga0209675_1005505 3300025291 Bacteria 5286
200 Ga0209676_1000136 3300025292 Bacteria 181860
201 Ga0209676_1004568 3300025292 Bacteria 7660
202 Ga0209025_1016139 3300025294 Bacteria 4439
203 Ga0209564_1000124 3300025295 Bacteria 202046
204 Ga0209564_1000162 3300025295 Bacteria 162265
205 Ga0209564_1006907 3300025295 Bacteria 5976
206 Ga0209758_1000020 3300025297 Bacteria 734220
207 Ga0209758_1000152 3300025297 Bacteria 162418
208 Ga0209758_1003711 3300025297 Bacteria 13539
209 Ga0209050_1000011 3300025298 Bacteria 914037
210 Ga0209050_1000238 3300025298 Bacteria 119729
211 Ga0209050_1000313 3300025298 Bacteria 98580
212 Ga0209256_1000028 3300025299 Bacteria 420213
213 Ga0209256_1001270 3300025299 Bacteria 27521
214 Ga0209256_1011459 3300025299 Bacteria 3541
215 Ga0209256_1026092 3300025299 Bacteria 1690
216 Ga0207426_1000818 3300025302 Bacteria 33399
217 Ga0209051_1002074 3300025303 Bacteria 15151
218 Ga0209051_1068898 3300025303 Bacteria 1074
219 Ga0209257_1000003 3300025304 Bacteria 1702593
220 Ga0209257_1000142 3300025304 Bacteria 200756
221 Ga0209257_1000710 3300025304 Bacteria 51515
222 Ga0209257_1003802 3300025304 Bacteria 12422
223 Ga0209257_1016214 3300025304 Bacteria 3032
224 Ga0207655_1017922 3300025728 Bacteria 3791
225 Ga0207642_10002078 3300025899 Bacteria 6189
226 Ga0207680_10000931 3300025903 Bacteria 13816
227 Ga0207645_10134585 3300025907 Bacteria 1609
228 Ga0207645_10217032 3300025907 Bacteria 1260
229 Ga0207705_10000481 3300025909 Bacteria 34247
230 Ga0207705_10008110 3300025909 Bacteria 7695
231 Ga0207705_10105830 3300025909 Bacteria 2074
232 Ga0207705_10267695 3300025909 Bacteria 1306
233 Ga0207684_10011762 3300025910 Bacteria 7633
234 Ga0207684_10045998 3300025910 Bacteria 3703
235 Ga0207654_10032395 3300025911 Bacteria 2888
236 Ga0207695_10006045 3300025913 Bacteria 15798
237 Ga0207695_10015843 3300025913 Bacteria 8855
238 Ga0207695_10022800 3300025913 Bacteria 7093
239 Ga0207695_10153996 3300025913 Bacteria 2235
240 Ga0207695_10305994 3300025913 Bacteria 1480
241 Ga0207671_10006346 3300025914 Bacteria 10548
242 Ga0207671_10007479 3300025914 Bacteria 9474
243 Ga0207671_10016293 3300025914 Bacteria 5781
244 Ga0207671_10037912 3300025914 Bacteria 3573
245 Ga0207657_10001383 3300025919 Bacteria 25890
246 Ga0207657_10003004 3300025919 Bacteria 18072
247 Ga0207657_10051608 3300025919 Bacteria 3575
248 Ga0207649_10017322 3300025920 Bacteria 4083
249 Ga0207649_10281189 3300025920 Bacteria 1210
250 Ga0207652_10012965 3300025921 Bacteria 6745
251 Ga0207652_10026937 3300025921 Bacteria 4790
252 Ga0207681_10004760 3300025923 Bacteria 8353
253 Ga0207681_10124342 3300025923 Bacteria 1897
254 Ga0207694_10005550 3300025924 Bacteria 9668
255 Ga0207694_10306244 3300025924 Bacteria 1309
256 Ga0207659_10007353 3300025926 Bacteria 6770
257 Ga0207687_10136900 3300025927 Bacteria 1853
258 Ga0207700_10063851 3300025928 Bacteria 2802
259 Ga0207700_10238989 3300025928 Bacteria 1547
260 Ga0207644_10000635 3300025931 Bacteria 22259
261 Ga0207644_10073826 3300025931 Bacteria 2502
262 Ga0207644_10213875 3300025931 Bacteria 1525
263 Ga0207690_10115771 3300025932 Bacteria 1938
264 Ga0207690_10150778 3300025932 Bacteria 1723
265 Ga0207706_10002765 3300025933 Bacteria 17065
266 Ga0207706_10091551 3300025933 Bacteria 2673
267 Ga0207706_10194269 3300025933 Bacteria 1781
268 Ga0207706_10272887 3300025933 Bacteria 1476
269 Ga0207709_10002921 3300025935 Bacteria 10435
270 Ga0207709_10014308 3300025935 Bacteria 4380
271 Ga0207709_10076157 3300025935 Bacteria 2147
272 Ga0207709_10111399 3300025935 Bacteria 1831
273 Ga0207709_10399284 3300025935 Bacteria 1051
274 Ga0207669_10489982 3300025937 Bacteria 981
275 Ga0207704_10015573 3300025938 Bacteria 3880
276 Ga0207704_10537849 3300025938 Bacteria 947
277 Ga0207711_10007617 3300025941 Bacteria 9056
278 Ga0207689_10050185 3300025942 Bacteria 3441
279 Ga0207689_10083483 3300025942 Bacteria 2626
280 Ga0207661_10529876 3300025944 Bacteria 1078
281 Ga0207679_10021508 3300025945 Bacteria 4375
282 Ga0207667_10001977 3300025949 Bacteria 25684
283 Ga0207667_10003039 3300025949 Bacteria 20823
284 Ga0207667_10006345 3300025949 Bacteria 14335
285 Ga0207667_10306085 3300025949 Bacteria 1623
286 Ga0207712_10001798 3300025961 Bacteria 14217
287 Ga0207712_10002005 3300025961 Bacteria 13376
288 Ga0207668_10430596 3300025972 Bacteria 1122
289 Ga0207640_10069116 3300025981 Bacteria 2370
290 Ga0207658_10005671 3300025986 Bacteria 8539
291 Ga0207677_10002592 3300026023 Bacteria 9508
292 Ga0207677_10053176 3300026023 Bacteria 2755
293 Ga0207703_10001221 3300026035 Bacteria 24024
294 Ga0207703_10312239 3300026035 Bacteria 1437
295 Ga0207678_10008575 3300026067 Bacteria 9006
296 Ga0207641_10025598 3300026088 Bacteria 4864
297 Ga0207641_10027564 3300026088 Bacteria 4692
298 Ga0207641_10052325 3300026088 Bacteria 3458
299 Ga0207648_10000037 3300026089 Bacteria 120856
300 Ga0207648_10000227 3300026089 Bacteria 60175
301 Ga0207676_10001143 3300026095 Bacteria 19992
302 Ga0207676_10038637 3300026095 Bacteria 3645
303 Ga0207676_10746276 3300026095 Bacteria 951
304 Ga0207674_10018123 3300026116 Bacteria 7660
305 Ga0207674_10139145 3300026116 Bacteria 2388
306 Ga0207674_10144764 3300026116 Bacteria 2335
307 Ga0207674_10193829 3300026116 Bacteria 1982
308 Ga0207674_10325891 3300026116 Bacteria 1485
309 Ga0207675_100008494 3300026118 Bacteria 9669
310 Ga0207683_10006411 3300026121 Bacteria 10076
311 Ga0207683_10017139 3300026121 Bacteria 6167
312 Ga0207698_10002142 3300026142 Bacteria 11658
313 Ga0209179_1004020 3300027512 Bacteria 2183
314 Ga0209813_10022180 3300027866 Bacteria 1793
315 Ga0209974_10003999 3300027876 Bacteria 5273
316 Ga0209974_10051954 3300027876 Bacteria 1379
317 Ga0268266_10014233 3300028379 Bacteria 6842
318 Ga0268266_10195998 3300028379 Bacteria 1846
319 Ga0268266_10347295 3300028379 Bacteria 1394
320 Ga0268265_10051838 3300028380 Bacteria 3099
321 Ga0268265_10091944 3300028380 Bacteria 2427
322 Ga0268264_10005954 3300028381 Bacteria 10319
323 Ga0265337_1026696 3300028556 Bacteria 1747
324 Ga0307517_10002278 3300028786 Bacteria 30957
325 Ga0307515_10000525 3300028794 Bacteria 91297
326 Ga0307515_10016038 3300028794 Bacteria 13751
327 Ga0307515_10018830 3300028794 Bacteria 12464
328 Ga0307515_10086362 3300028794 Bacteria 4000
329 Ga0307515_10091070 3300028794 Bacteria 3815
330 Ga0307515_10149059 3300028794 Bacteria 2457
331 Ga0307515_10157370 3300028794 Bacteria 2337
332 Ga0316177_1033553 3300030731 Bacteria 1343
333 Ga0316177_1163442 3300030731 Bacteria 1310
334 Ga0316182_1128715 3300030745 Bacteria 2269
335 Ga0265320_10017913 3300031240 Bacteria 3916
336 Ga0265339_10006224 3300031249 Bacteria 7857
337 Ga0265327_10106312 3300031251 Bacteria 1347
338 Ga0307513_10104938 3300031456 Bacteria 2837
339 Ga0307513_10217135 3300031456 Bacteria 1737
340 Ga0307513_10329004 3300031456 Bacteria 1283
341 Ga0307509_10000157 3300031507 Bacteria 106022
342 Ga0307509_10005739 3300031507 Bacteria 17088
343 Ga0307509_10030138 3300031507 Bacteria 6005
344 Ga0307509_10034314 3300031507 Bacteria 5574
345 Ga0307509_10206077 3300031507 Bacteria 1797
346 Ga0307509_10356449 3300031507 Bacteria 1184
347 Ga0307408_100000022 3300031548 Bacteria 310242
348 Ga0307408_100000046 3300031548 Bacteria 167686
349 Ga0307408_100001037 3300031548 Bacteria 21346
350 Ga0307408_100001365 3300031548 Bacteria 18206
351 Ga0307408_100003010 3300031548 Bacteria 11653
352 Ga0307408_100084007 3300031548 Bacteria 2387
353 Ga0307408_100090754 3300031548 Bacteria 2306
354 Ga0307408_100227833 3300031548 Bacteria 1524
355 Ga0307508_10000048 3300031616 Bacteria 137587
356 Ga0307508_10045664 3300031616 Bacteria 3913
357 Ga0307508_10071542 3300031616 Bacteria 3042
358 Ga0307508_10086959 3300031616 Bacteria 2710
359 Ga0307514_10028808 3300031649 Bacteria 4475
360 Ga0307514_10053972 3300031649 Bacteria 3099
361 Ga0265314_10089759 3300031711 Bacteria 2004
362 Ga0307405_10283079 3300031731 Bacteria 1249
363 Ga0307407_10339071 3300031903 Bacteria 1061
364 Ga0307412_10029815 3300031911 Bacteria 3428
365 Ga0307412_10071852 3300031911 Bacteria 2363
366 Ga0307416_100360100 3300032002 Bacteria 1476
367 Ga0307416_100551542 3300032002 Bacteria 1226
368 Ga0307414_10222409 3300032004 Bacteria 1551
369 Ga0307414_10233689 3300032004 Bacteria 1517
370 Ga0307510_10000883 3300033180 Bacteria 31532
371 Ga0307510_10010444 3300033180 Bacteria 11029
372 Ga0373939_0037803 3300035114 Bacteria 1436
373 Ga0373943_0092010 3300035170 Bacteria 1572
374 Ga0373931_0035876 3300035691 Bacteria 2581
375 Ga0373947_0049489 3300035725 Bacteria 2524
376 Ga0373937_0005178 3300036401 Bacteria 11125
377 Ga0373925_0017299 3300037068 Bacteria 5224
378 Ga0373925_0190579 3300037068 Bacteria 1627
379 Ga0373925_0260437 3300037068 Bacteria 1393
380 Ga0395899_0001092 3300037312 Bacteria 24358
381 Ga0395899_0002955 3300037312 Bacteria 13605
382 Ga0395899_0005351 3300037312 Bacteria 9972
383 Ga0395899_0014220 3300037312 Bacteria 6074
384 Ga0395899_0022519 3300037312 Bacteria 4775
385 Ga0395899_0044223 3300037312 Bacteria 3320
386 Ga0395899_0094703 3300037312 Bacteria 2160
387 Ga0395900_0000081 3300037418 Bacteria 174128
388 Ga0395900_0000148 3300037418 Bacteria 117889
389 Ga0395900_0001208 3300037418 Bacteria 31966
390 Ga0395900_0003059 3300037418 Bacteria 18210
391 Ga0395900_0036687 3300037418 Bacteria 5054
392 Ga0395900_0057623 3300037418 Bacteria 3999
393 Ga0395900_0136768 3300037418 Bacteria 2510
394 Ga0395898_0000201 3300037466 Bacteria 153821
395 Ga0395898_0119308 3300037466 Bacteria 2526
396 Ga0395898_0241195 3300037466 Bacteria 1724
397 Ga0395905_0009494 3300037471 Bacteria 9509
398 Ga0395905_0017108 3300037471 Bacteria 6886
399 Ga0395905_0127464 3300037471 Bacteria 2393
400 Ga0395905_0307363 3300037471 Bacteria 1474
401 Ga0436364_0407173 3300037853 Bacteria 1714
402 Ga0395901_0000237 3300038443 Bacteria 69208
403 Ga0395901_0090868 3300038443 Bacteria 3196
404 Ga0395901_0172932 3300038443 Bacteria 2266
405 Ga0395901_0308767 3300038443 Bacteria 1638
406 Ga0436360_0544857 3300039438 Bacteria 2684
407 Ga0436362_0381357 3300039453 Bacteria 2175
408 Ga0439465_0053030 3300041413 Bacteria 1332
409 Ga0451853_2845666 3300041512 Bacteria 1395
410 Ga0439431_0006250 3300041997 Bacteria 2629
411 Ga0439448_0000555 3300042005 Bacteria 8742
412 Ga0439449_0021002 3300042007 Bacteria 2446
413 Ga0450898_006057 3300042134 Bacteria 1846
414 Ga0451577_0051628 3300042876 Bacteria 3671
415 Ga0451577_0094783 3300042876 Bacteria 2665
416 Ga0466969_0000232 3300044656 Bacteria 30397
417 Ga0466969_0006699 3300044656 Bacteria 6125
418 Ga0466969_0014607 3300044656 Bacteria 4128
419 Ga0466969_0035390 3300044656 Bacteria 2525
420 Ga0466972_0000383 3300044658 Bacteria 23678
421 Ga0466972_0000568 3300044658 Bacteria 18002
422 Ga0466972_0006200 3300044658 Bacteria 6009
423 Ga0466972_0036061 3300044658 Bacteria 2420
424 Ga0466965_0000082 3300044683 Bacteria 27799
425 Ga0466965_0001230 3300044683 Bacteria 10128
426 Ga0466965_0005218 3300044683 Bacteria 5839
427 Ga0466965_0085184 3300044683 Bacteria 1602
428 Ga0466966_0000428 3300044684 Bacteria 27011
429 Ga0466966_0002106 3300044684 Bacteria 12927
430 Ga0466966_0004513 3300044684 Bacteria 9186
431 Ga0466966_0005887 3300044684 Bacteria 8086
432 Ga0466966_0009166 3300044684 Bacteria 6552
433 Ga0466966_0023505 3300044684 Bacteria 4034
434 Ga0466966_0032955 3300044684 Bacteria 3354
435 Ga0466966_0072487 3300044684 Bacteria 2156
436 Ga0466966_0254042 3300044684 Bacteria 1059
437 Ga0466961_0000229 3300044693 Bacteria 37957
438 Ga0466961_0006081 3300044693 Bacteria 7655
439 Ga0466961_0019174 3300044693 Bacteria 4402
440 Ga0466961_0151018 3300044693 Bacteria 1450
441 Ga0466961_0203342 3300044693 Bacteria 1224
442 Ga0466963_0005033 3300044694 Bacteria 7722
443 Ga0466963_0069977 3300044694 Bacteria 2360
444 Ga0466964_0000492 3300044706 Bacteria 12242
445 Ga0466964_0002109 3300044706 Bacteria 7004
446 Ga0466964_0013400 3300044706 Bacteria 3111
447 Ga0466971_0035615 3300044719 Bacteria 2232
448 Ga0466968_0000879 3300044735 Bacteria 10556
449 Ga0466968_0013820 3300044735 Bacteria 3179
450 Ga0466970_0008945 3300044765 Bacteria 5050
451 Ga0466970_0040109 3300044765 Bacteria 2486
452 Ga0466970_0054294 3300044765 Bacteria 2140
453 Ga0466970_0087732 3300044765 Bacteria 1687
454 Ga0466957_0000337 3300044842 Bacteria 22931
455 Ga0466957_0005060 3300044842 Bacteria 7379
456 Ga0466957_0010664 3300044842 Bacteria 5282
457 Ga0466960_0061170 3300044901 Bacteria 1848
458 Ga0466959_0013955 3300045049 Bacteria 5832
459 Ga0466959_0018046 3300045049 Bacteria 5177
460 Ga0466959_0076778 3300045049 Bacteria 2411
461 Ga0466959_0113022 3300045049 Bacteria 1936
462 Ga0451576_0089607 3300045051 Bacteria 3199
463 Ga0466958_0005517 3300045836 Bacteria 6820
464 Ga0466958_0021614 3300045836 Bacteria 3763
465 Ga0466958_0148404 3300045836 Bacteria 1478
466 Ga0466967_0693098 3300045976 Bacteria 1009
467 Ga0495592_0000058 3300046454 Bacteria 101492
468 Ga0495590_0000016 3300046457 Bacteria 225874
469 Ga0495590_0044047 3300046457 Bacteria 1556
470 Ga0495638_0000057 3300046460 Bacteria 193690
471 Ga0495653_0003297 3300046463 Bacteria 12950
472 Ga0495650_0002031 3300046471 Bacteria 17703
473 Ga0495580_0019602 3300046472 Bacteria 5025
474 Ga0495580_0242368 3300046472 Bacteria 1236
475 Ga0495605_0000684 3300046474 Bacteria 25383
476 Ga0495605_0003913 3300046474 Bacteria 8818
477 Ga0495605_0064763 3300046474 Bacteria 1740
478 Ga0495639_0009356 3300046475 Bacteria 4203
479 Ga0495584_0000915 3300046491 Bacteria 18831
480 Ga0495584_0002336 3300046491 Bacteria 10810
481 Ga0495584_0003323 3300046491 Bacteria 8900
482 Ga0495584_0011193 3300046491 Bacteria 4597
483 Ga0495585_0000005 3300046492 Bacteria 328103
484 Ga0495585_0000162 3300046492 Bacteria 71606
485 Ga0495585_0007241 3300046492 Bacteria 6813
486 Ga0495585_0009385 3300046492 Bacteria 5868
487 Ga0495585_0036768 3300046492 Bacteria 2759
488 Ga0495585_0041772 3300046492 Bacteria 2571
489 Ga0495585_0071056 3300046492 Bacteria 1897
490 Ga0495585_0130399 3300046492 Bacteria 1323
491 Ga0495596_0000013 3300046500 Bacteria 125228
492 Ga0495596_0000833 3300046500 Bacteria 18653
493 Ga0495596_0000901 3300046500 Bacteria 17803
494 Ga0495596_0003244 3300046500 Bacteria 8321
495 Ga0495607_0000316 3300046501 Bacteria 50215
496 Ga0495607_0001702 3300046501 Bacteria 18913
497 Ga0495607_0003182 3300046501 Bacteria 12691
498 Ga0495607_0003268 3300046501 Bacteria 12466
499 Ga0495607_0021859 3300046501 Bacteria 4023
500 Ga0495583_0000189 3300046506 Bacteria 103518
501 Ga0495583_0000655 3300046506 Bacteria 45614
502 Ga0495583_0000688 3300046506 Bacteria 43737
503 Ga0495583_0002721 3300046506 Bacteria 14634
504 Ga0495583_0013411 3300046506 Bacteria 4571
505 Ga0495583_0041851 3300046506 Bacteria 2143
506 Ga0495583_0090147 3300046506 Bacteria 1321
507 Ga0495606_0000070 3300046507 Bacteria 177343
508 Ga0495606_0003081 3300046507 Bacteria 18174
509 Ga0495606_0052909 3300046507 Bacteria 2637
510 Ga0495606_0054698 3300046507 Bacteria 2584
511 Ga0495606_0229514 3300046507 Bacteria 1041
512 Ga0495610_0004252 3300046512 Bacteria 10662
513 Ga0495610_0026614 3300046512 Bacteria 3087
514 Ga0495616_0000646 3300046513 Bacteria 25901
515 Ga0495616_0000799 3300046513 Bacteria 23070
516 Ga0495616_0001668 3300046513 Bacteria 15169
517 Ga0495616_0019559 3300046513 Bacteria 3693
518 Ga0495616_0040554 3300046513 Bacteria 2378
519 Ga0495616_0046894 3300046513 Bacteria 2179
520 Ga0495616_0084619 3300046513 Bacteria 1511
521 Ga0495620_0001634 3300046515 Bacteria 13278
522 Ga0495628_0000109 3300046516 Bacteria 67425
523 Ga0495631_0004026 3300046518 Bacteria 7909
524 Ga0495631_0010136 3300046518 Bacteria 4677
525 Ga0495631_0028238 3300046518 Bacteria 2560
526 Ga0495631_0039780 3300046518 Bacteria 2084
527 Ga0495632_0000118 3300046519 Bacteria 81183
528 Ga0495632_0000321 3300046519 Bacteria 46253
529 Ga0495632_0001878 3300046519 Bacteria 16853
530 Ga0495632_0006806 3300046519 Bacteria 7295
531 Ga0495632_0014187 3300046519 Bacteria 4518
532 Ga0495632_0038404 3300046519 Bacteria 2424
533 Ga0495637_0023384 3300046520 Bacteria 2810
534 Ga0495637_0075744 3300046520 Bacteria 1349
535 Ga0495643_0000236 3300046522 Bacteria 83225
536 Ga0495643_0002480 3300046522 Bacteria 14537
537 Ga0495643_0050575 3300046522 Bacteria 2238
538 Ga0495643_0066689 3300046522 Bacteria 1898
539 Ga0495644_0001385 3300046523 Bacteria 9910
540 Ga0495644_0027680 3300046523 Bacteria 2147
541 Ga0495648_0000002 3300046524 Bacteria 593972
542 Ga0495648_0000033 3300046524 Bacteria 199184
543 Ga0495648_0007546 3300046524 Bacteria 8693
544 Ga0495648_0043992 3300046524 Bacteria 2792
545 Ga0495663_0001760 3300046525 Bacteria 6719
546 Ga0495663_0067745 3300046525 Bacteria 1132
547 Ga0495642_0000673 3300046528 Bacteria 17015
548 Ga0495642_0005081 3300046528 Bacteria 5067
549 Ga0495642_0008493 3300046528 Bacteria 3928
550 Ga0495652_0082260 3300046529 Bacteria 2654
551 Ga0495652_0123081 3300046529 Bacteria 2065
552 Ga0495654_0014733 3300046530 Bacteria 4157
553 Ga0495654_0050233 3300046530 Bacteria 2039
554 Ga0495640_0140977 3300046533 Bacteria 1554
555 Ga0495609_0000001 3300046538 Bacteria 1060094
556 Ga0495609_0000084 3300046538 Bacteria 113497
557 Ga0495609_0059233 3300046538 Bacteria 1693
558 Ga0495621_0008835 3300046539 Bacteria 3036
559 Ga0495597_0000028 3300046542 Bacteria 137215
560 Ga0495597_0000080 3300046542 Bacteria 84504
561 Ga0495597_0005046 3300046542 Bacteria 7065
562 Ga0495597_0021109 3300046542 Bacteria 3028
563 Ga0495597_0023629 3300046542 Bacteria 2843
564 Ga0495597_0036901 3300046542 Bacteria 2198
565 Ga0495645_0096352 3300046543 Bacteria 2108
566 Ga0495622_0000483 3300046557 Bacteria 25083
567 Ga0495622_0029884 3300046557 Bacteria 2545
568 Ga0495633_0000204 3300046558 Bacteria 75182
569 Ga0495633_0000399 3300046558 Bacteria 45392
570 Ga0495633_0009652 3300046558 Bacteria 5312
571 Ga0495633_0019359 3300046558 Bacteria 3444
572 Ga0495633_0052919 3300046558 Bacteria 1911
573 Ga0495656_0007073 3300046615 Bacteria 3957
574 Ga0495656_0028866 3300046615 Bacteria 2228
575 Ga0495656_0075010 3300046615 Bacteria 1512
576 Ga0495668_0000006 3300046616 Bacteria 553404
577 Ga0495668_0000132 3300046616 Bacteria 112674
578 Ga0495668_0003093 3300046616 Bacteria 12858
579 Ga0495668_0009077 3300046616 Bacteria 6136
580 Ga0495668_0010419 3300046616 Bacteria 5624
581 Ga0495668_0013502 3300046616 Bacteria 4814
582 Ga0495668_0064593 3300046616 Bacteria 2014
583 Ga0495611_0001712 3300046648 Bacteria 10645
584 Ga0495611_0010146 3300046648 Bacteria 3984
585 Ga0495611_0016943 3300046648 Bacteria 3115
586 Ga0495625_0000143 3300046660 Bacteria 110121
587 Ga0495625_0000177 3300046660 Bacteria 98918
588 Ga0495625_0001203 3300046660 Bacteria 32899
589 Ga0495625_0010429 3300046660 Bacteria 7690
590 Ga0495625_0042302 3300046660 Bacteria 3312
591 Ga0495625_0065650 3300046660 Bacteria 2558
592 Ga0495625_0134454 3300046660 Bacteria 1673
593 Ga0495659_0000185 3300046664 Bacteria 27168
594 Ga0495659_0024668 3300046664 Bacteria 2052
595 Ga0495661_0000053 3300046665 Bacteria 140234
596 Ga0495661_0000170 3300046665 Bacteria 77754
597 Ga0495661_0006188 3300046665 Bacteria 8425
598 Ga0495661_0010366 3300046665 Bacteria 6360
599 Ga0495661_0011327 3300046665 Bacteria 6051
600 Ga0495661_0037821 3300046665 Bacteria 3010
601 Ga0495661_0079702 3300046665 Bacteria 1891
602 Ga0495661_0105990 3300046665 Bacteria 1573
603 Ga0495588_0000062 3300046674 Bacteria 253674
604 Ga0495588_0051070 3300046674 Bacteria 2129
605 Ga0495599_0069794 3300046678 Bacteria 2193
606 Ga0495669_0001281 3300046684 Bacteria 10407
607 Ga0495669_0005080 3300046684 Bacteria 5475
608 Ga0495624_0018331 3300046690 Bacteria 4682
609 Ga0495624_0071891 3300046690 Bacteria 2152
610 Ga0495670_0001661 3300046691 Bacteria 10911
611 Ga0495670_0002325 3300046691 Bacteria 9387
612 Ga0495670_0013246 3300046691 Bacteria 4056
613 Ga0495671_0000088 3300046692 Bacteria 87282
614 Ga0495671_0009586 3300046692 Bacteria 5406
615 Ga0495671_0084406 3300046692 Bacteria 1556
616 Ga0495649_0001312 3300046694 Bacteria 18988
617 Ga0495649_0012827 3300046694 Bacteria 4859
618 Ga0495649_0039555 3300046694 Bacteria 2585
619 Ga0495649_0213616 3300046694 Bacteria 999
620 Ga0495589_0000103 3300046794 Bacteria 81696
621 Ga0495589_0001144 3300046794 Bacteria 15770
622 Ga0495589_0024179 3300046794 Bacteria 3088
623 Ga0495589_0024226 3300046794 Bacteria 3085
624 Ga0495589_0040034 3300046794 Bacteria 2341
625 Ga0495660_0000057 3300046810 Bacteria 133310
626 Ga0495660_0000208 3300046810 Bacteria 60381
627 Ga0495660_0001806 3300046810 Bacteria 14089
628 Ga0495660_0024071 3300046810 Bacteria 3470
629 Ga0495660_0048056 3300046810 Bacteria 2334
630 Ga0495660_0093189 3300046810 Bacteria 1562
631 Ga0495636_0000716 3300047318 Bacteria 12143
632 Ga0495636_0028191 3300047318 Bacteria 2288
633 Ga0495672_0000132 3300047320 Bacteria 111537
634 Ga0495672_0000262 3300047320 Bacteria 73028
635 Ga0495672_0029883 3300047320 Bacteria 3426
636 Ga0495680_0011827 3300047322 Bacteria 7707
637 Ga0495683_0000072 3300047323 Bacteria 104027
638 Ga0495683_0007433 3300047323 Bacteria 5923
639 Ga0495683_0033348 3300047323 Bacteria 2620
640 Ga0495683_0039010 3300047323 Bacteria 2401
641 Ga0495687_000019 3300047443 Bacteria 341756
642 Ga0495687_000722 3300047443 Bacteria 36591
643 Ga0495687_000740 3300047443 Bacteria 35582
644 Ga0495687_001604 3300047443 Bacteria 20397
645 Ga0495687_003773 3300047443 Bacteria 10707
646 Ga0495687_020008 3300047443 Bacteria 3271
647 Ga0495677_0000009 3300047445 Bacteria 170927
648 Ga0495677_0000217 3300047445 Bacteria 26216
649 Ga0495677_0000873 3300047445 Bacteria 12174
650 Ga0495677_0001907 3300047445 Bacteria 8336
651 Ga0495677_0002104 3300047445 Bacteria 7919
652 Ga0495677_0002684 3300047445 Bacteria 6948
653 Ga0495677_0003892 3300047445 Bacteria 5773
654 Ga0495677_0004159 3300047445 Bacteria 5584
655 Ga0495677_0005946 3300047445 Bacteria 4621
656 Ga0495677_0008922 3300047445 Bacteria 3709
657 Ga0495679_005033 3300047446 Bacteria 5943
658 Ga0495681_0000907 3300047470 Bacteria 22863
659 Ga0495681_0002551 3300047470 Bacteria 12977
660 Ga0495681_0007002 3300047470 Bacteria 7286
661 Ga0495681_0008872 3300047470 Bacteria 6249
662 Ga0495681_0037694 3300047470 Bacteria 2378
663 Ga0495681_0043194 3300047470 Bacteria 2175
664 Ga0495686_0000627 3300047472 Bacteria 48600
665 Ga0495686_0003319 3300047472 Bacteria 14049
666 Ga0495686_0038635 3300047472 Bacteria 3052
667 Ga0495686_0121925 3300047472 Bacteria 1553
668 Ga0495686_0181227 3300047472 Bacteria 1220
669 Ga0495602_0050698 3300048088 Bacteria 3706
670 Ga0495615_0000170 3300048090 Bacteria 16086
671 Ga0495626_0000011 3300048091 Bacteria 260928
672 Ga0495626_0000290 3300048091 Bacteria 54140
673 Ga0495626_0011297 3300048091 Bacteria 4728
674 Ga0495626_0011964 3300048091 Bacteria 4567
675 Ga0495626_0020550 3300048091 Bacteria 3288
676 Ga0495626_0094246 3300048091 Bacteria 1313
677 Ga0496101_0138280 3300048904 Bacteria 1855
678 Ga0496101_0156154 3300048904 Bacteria 1748
679 Ga0496102_0060133 3300048905 Bacteria 3476
680 Ga0496102_0244086 3300048905 Bacteria 1693
681 Ga0496103_0049655 3300048906 Bacteria 2594
682 Ga0496104_0073802 3300048907 Bacteria 3246
683 Ga0496106_0012017 3300048909 Bacteria 6389
684 Ga0496106_0061377 3300048909 Bacteria 2852
685 Ga0496107_0037314 3300048910 Bacteria 3487
686 Ga0496107_0040886 3300048910 Bacteria 3329
687 Ga0496108_0607873 3300048911 Bacteria 952
688 Ga0496111_0016619 3300048914 Bacteria 5074
689 Ga0496113_0014394 3300048916 Bacteria 5395
690 Ga0496114_0214596 3300048917 Bacteria 1688
691 Ga0496114_0355574 3300048917 Bacteria 1296
692 Ga0496116_0031617 3300048919 Bacteria 3785
693 Ga0496116_0048918 3300048919 Bacteria 2832
694 Ga0496117_0000011 3300048920 Bacteria 610930
695 Ga0496118_0000010 3300048921 Bacteria 610930
696 Ga0496118_0076880 3300048921 Bacteria 2370
697 Ga0496119_0002111 3300048922 Bacteria 22397
698 Ga0496119_0011802 3300048922 Bacteria 7177
699 Ga0496119_0012354 3300048922 Bacteria 6944
700 Ga0496120_0025916 3300048923 Bacteria 3631
701 Ga0496120_0106982 3300048923 Bacteria 1468
702 Ga0496121_0000490 3300048924 Bacteria 75983
703 Ga0496121_0002266 3300048924 Bacteria 29939
704 Ga0496121_0004661 3300048924 Bacteria 18211
705 Ga0496121_0088627 3300048924 Bacteria 2425
706 Ga0496122_0000821 3300048925 Bacteria 59417
707 Ga0496122_0001042 3300048925 Bacteria 48555
708 Ga0496122_0005095 3300048925 Bacteria 15854
709 Ga0496122_0023924 3300048925 Bacteria 5364
710 Ga0496122_0069721 3300048925 Bacteria 2516
711 Ga0496123_0000872 3300048926 Bacteria 47911
712 Ga0496123_0001273 3300048926 Bacteria 36130
713 Ga0496123_0003879 3300048926 Bacteria 16268
714 Ga0496123_0030777 3300048926 Bacteria 3921
715 Ga0496123_0057754 3300048926 Bacteria 2523
716 Ga0496124_0017647 3300048927 Bacteria 6720
717 Ga0496124_0018875 3300048927 Bacteria 6440
718 Ga0496124_0233659 3300048927 Bacteria 1372
719 Ga0496125_0000884 3300048928 Bacteria 47543
720 Ga0496125_0034167 3300048928 Bacteria 4486
721 Ga0496125_0046007 3300048928 Bacteria 3666
722 Ga0496125_0116580 3300048928 Bacteria 1918
723 Ga0496125_0148245 3300048928 Bacteria 1617
724 Ga0496126_0001786 3300048929 Bacteria 31736
725 Ga0496126_0043152 3300048929 Bacteria 4162
726 Ga0496126_0088424 3300048929 Bacteria 2729
727 Ga0495678_007026 3300049459 Bacteria 5900
728 Ga0495678_053681 3300049459 Bacteria 1546
729 Ga0495678_070702 3300049459 Bacteria 1280
730 Ga0495682_0003951 3300049460 Bacteria 6467
731 Ga0495682_0016442 3300049460 Bacteria 2801
732 Ga0501292_003979 3300049515 Bacteria 2001
733 Ga0501033_0000186 3300049570 Bacteria 59624
734 Ga0501033_0029154 3300049570 Bacteria 4147
735 Ga0501037_0269359 3300049573 Bacteria 1189
736 Ga0501047_0008047 3300049581 Bacteria 9948
737 Ga0501067_0221256 3300049583 Bacteria 1054
738 Ga0501076_0215169 3300049592 Bacteria 1571
739 Ga0501079_0103835 3300049741 Bacteria 2205
740 Ga0501269_000203 3300049766 Bacteria 17659
741 Ga0501035_0000292 3300049822 Bacteria 59353
742 Ga0501035_0001063 3300049822 Bacteria 28793
743 Ga0501035_0028835 3300049822 Bacteria 5064
744 Ga0501044_0005038 3300049823 Bacteria 14756
745 Ga0501044_0118140 3300049823 Bacteria 2655
746 Ga0501044_0171576 3300049823 Bacteria 2140
747 nmdc:mga0k408_1383_c1 3300050493 Bacteria 13098
748 nmdc:mga0k408_189728_c1 3300050493 Bacteria 1226
749 nmdc:mga0k408_34927_c1 3300050493 Bacteria 2881
750 nmdc:mga0k408_48393_c1 3300050493 Bacteria 2459
751 nmdc:mga0k408_53133_c1 3300050493 Bacteria 2348
752 nmdc:mga0k408_6516_c1 3300050493 Bacteria 6220
753 nmdc:mga06z11_52034_c1 3300050494 Bacteria 2099
754 nmdc:mga06z11_8396_c1 3300050494 Bacteria 4304
755 nmdc:mga07m45_100192_c1 3300050496 Bacteria 1664
756 nmdc:mga07m45_3676_c1 3300050496 Bacteria 7416
757 nmdc:mga07m45_4791_c2 3300050496 Bacteria 6001
758 nmdc:mga07m45_6783_c1 3300050496 Bacteria 5817
759 nmdc:mga07m45_88556_c1 3300050496 Bacteria 1772
760 nmdc:mga0sz30_4699_c1 3300050516 Bacteria 4957
761 nmdc:mga0sz30_5171_c1 3300050516 Bacteria 4138
762 Ga0500578_0000028 3300053086 Bacteria 144081
763 Ga0500572_000038 3300053111 Bacteria 42226
764 Ga0500658_0013184 3300053134 Bacteria 3052
765 Ga0500559_0000326 3300053136 Bacteria 35945
766 Ga0500559_0002516 3300053136 Bacteria 9415
767 Ga0500568_0011765 3300053139 Bacteria 4044
768 Ga0500590_024655 3300053148 Bacteria 3122
769 Ga0500622_0003342 3300053156 Bacteria 10813
770 Ga0500645_006464 3300053730 Bacteria 4179
771 Ga0466962_0017319 3300061719 Bacteria 3469
772 Ga0466962_0019076 3300061719 Bacteria 3294
773 Ga0466962_0046904 3300061719 Bacteria 2065
774 Ga0466962_0093047 3300061719 Bacteria 1445

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046513 Ga0495616_0000799 Ga0495616_0000799_14704_15540 251
2 3300046665 Ga0495661_0011327 Ga0495661_0011327_3301_4137 251
3 3300047445 Ga0495677_0001907 Ga0495677_0001907_6767_7603 251
4 3300037471 Ga0395905_0307363 Ga0395905_0307363_353_1219 266
5 3300046506 Ga0495583_0013411 Ga0495583_0013411_3655_4521 266
6 3300046694 Ga0495649_0213616 Ga0495649_0213616_11_877 266
7 3300028794 Ga0307515_10016038 Ga0307515_100160386 267
8 3300032004 Ga0307414_10233689 Ga0307414_102336892 267
9 3300046500 Ga0495596_0000833 Ga0495596_0000833_9165_10031 267
10 3300046507 Ga0495606_0003081 Ga0495606_0003081_7281_8147 267
11 3300046513 Ga0495616_0084619 Ga0495616_0084619_344_1207 267
12 3300046518 Ga0495631_0028238 Ga0495631_0028238_487_1353 267
13 3300046520 Ga0495637_0075744 Ga0495637_0075744_341_1204 267
14 3300046794 Ga0495589_0024226 Ga0495589_0024226_2165_3031 267
15 3300047323 Ga0495683_0007433 Ga0495683_0007433_1453_2319 267
16 3300047470 Ga0495681_0000907 Ga0495681_0000907_9674_10540 267
17 3300047472 Ga0495686_0000627 Ga0495686_0000627_448_1311 267
18 3300050493 nmdc:mga0k408_189728_c1 nmdc:mga0k408_189728_c1_297_1160 267
19 3300053136 Ga0500559_0002516 Ga0500559_0002516_8329_9192 267
20 3300003794 Ga0055531_10014463 Ga0055531_100144634 268
21 3300025304 Ga0209257_1000710 Ga0209257_100071050 268
22 3300046660 Ga0495625_0000143 Ga0495625_0000143_36841_37704 268
23 3300046616 Ga0495668_0000006 Ga0495668_0000006_479358_480224 269
24 3300049766 Ga0501269_000203 Ga0501269_000203_7019_7885 269
25 3300003771 Ga0055526_1000358 Ga0055526_100035826 270
26 3300003775 Ga0055524_1000462 Ga0055524_10004624 270
27 3300003791 Ga0055530_10000078 Ga0055530_1000007815 270
28 3300005331 Ga0070670_100394202 Ga0070670_1003942021 270
29 3300025263 Ga0209565_1001351 Ga0209565_10013513 270
30 3300025263 Ga0209565_1020588 Ga0209565_10205881 270
31 3300025295 Ga0209564_1000124 Ga0209564_100012489 270
32 3300025298 Ga0209050_1000313 Ga0209050_100031315 270
33 3300025299 Ga0209256_1001270 Ga0209256_100127019 270
34 3300025913 Ga0207695_10006045 Ga0207695_1000604514 270
35 3300025914 Ga0207671_10016293 Ga0207671_100162934 270
36 3300025949 Ga0207667_10001977 Ga0207667_1000197716 270
37 3300028379 Ga0268266_10195998 Ga0268266_101959982 270
38 3300030731 Ga0316177_1033553 Ga0316177_10335532 270
39 3300031548 Ga0307408_100000022 Ga0307408_10000002285 270
40 3300046539 Ga0495621_0008835 Ga0495621_0008835_2071_2925 270
41 iso_pu_bacteria 2599185359 2600225879 270
42 iso_pu_bacteria 2928526807 2928529346 270
43 3300025933 Ga0207706_10272887 Ga0207706_102728871 271
44 3300044684 Ga0466966_0072487 Ga0466966_0072487_1036_1902 271
45 3300044694 Ga0466963_0069977 Ga0466963_0069977_1016_1882 271
46 3300045049 Ga0466959_0018046 Ga0466959_0018046_1778_2644 271
47 3300046491 Ga0495584_0003323 Ga0495584_0003323_7332_8198 271
48 3300046501 Ga0495607_0000316 Ga0495607_0000316_31982_32848 271
49 3300046513 Ga0495616_0001668 Ga0495616_0001668_11101_11967 271
50 3300046513 Ga0495616_0040554 Ga0495616_0040554_82_948 271
51 3300046538 Ga0495609_0000001 Ga0495609_0000001_77806_78672 271
52 3300046615 Ga0495656_0007073 Ga0495656_0007073_2497_3363 271
53 3300046615 Ga0495656_0075010 Ga0495656_0075010_51_917 271
54 3300046665 Ga0495661_0000053 Ga0495661_0000053_75298_76164 271
55 3300046794 Ga0495589_0000103 Ga0495589_0000103_77806_78672 271
56 3300047443 Ga0495687_000019 Ga0495687_000019_77806_78672 271
57 3300047445 Ga0495677_0000009 Ga0495677_0000009_92256_93122 271
58 3300048091 Ga0495626_0000290 Ga0495626_0000290_25699_26565 271
59 3300048924 Ga0496121_0002266 Ga0496121_0002266_13228_14094 271
60 3300003544 Ga0007417J51691_1037902 Ga0007417J51691_10379021 272
61 3300003577 Ga0007416J51690_1048530 Ga0007416J51690_10485302 272
62 3300003693 Ga0032354_1067082 Ga0032354_10670821 272
63 3300003759 Ga0055525_1000047 Ga0055525_1000047186 272
64 3300005339 Ga0070660_100057569 Ga0070660_1000575692 272
65 3300005366 Ga0070659_100460885 Ga0070659_1004608851 272
66 3300025230 Ga0209563_100003 Ga0209563_100003717 272
67 3300025253 Ga0209677_101295 Ga0209677_1012952 272
68 3300025254 Ga0209148_1000871 Ga0209148_10008719 272
69 3300025909 Ga0207705_10105830 Ga0207705_101058302 272
70 3300025919 Ga0207657_10001383 Ga0207657_1000138319 272
71 3300025932 Ga0207690_10150778 Ga0207690_101507782 272
72 3300028794 Ga0307515_10091070 Ga0307515_100910704 272
73 3300031507 Ga0307509_10005739 Ga0307509_100057399 272
74 3300031507 Ga0307509_10030138 Ga0307509_100301385 272
75 3300031616 Ga0307508_10000048 Ga0307508_10000048129 272
76 3300037312 Ga0395899_0094703 Ga0395899_0094703_64_930 272
77 3300037418 Ga0395900_0000148 Ga0395900_0000148_20450_21316 272
78 3300042134 Ga0450898_006057 Ga0450898_006057_446_1312 272
79 3300044658 Ga0466972_0000568 Ga0466972_0000568_13160_14026 272
80 3300044683 Ga0466965_0005218 Ga0466965_0005218_1671_2537 272
81 3300044706 Ga0466964_0000492 Ga0466964_0000492_7120_7986 272
82 3300044735 Ga0466968_0000879 Ga0466968_0000879_1101_1967 272
83 3300046660 Ga0495625_0134454 Ga0495625_0134454_403_1269 272
84 3300046674 Ga0495588_0000062 Ga0495588_0000062_216626_217492 272
85 3300047320 Ga0495672_0000132 Ga0495672_0000132_52539_53405 272
86 3300048905 Ga0496102_0244086 Ga0496102_0244086_224_1090 272
87 3300048910 Ga0496107_0037314 Ga0496107_0037314_570_1436 272
88 3300048916 Ga0496113_0014394 Ga0496113_0014394_4208_5074 272
89 3300048925 Ga0496122_0001042 Ga0496122_0001042_24904_25770 272
90 3300048927 Ga0496124_0018875 Ga0496124_0018875_4159_5025 272
91 3300048928 Ga0496125_0034167 Ga0496125_0034167_3166_4032 272
92 3300031251 Ga0265327_10106312 Ga0265327_101063122 273
93 3300005339 Ga0070660_100005946 Ga0070660_1000059463 274
94 3300005344 Ga0070661_100116935 Ga0070661_1001169352 274
95 3300005564 Ga0070664_100044628 Ga0070664_1000446283 274
96 3300009148 Ga0105243_10300929 Ga0105243_103009292 274
97 3300009545 Ga0105237_10008094 Ga0105237_100080944 274
98 3300025909 Ga0207705_10008110 Ga0207705_100081107 274
99 3300025919 Ga0207657_10003004 Ga0207657_1000300419 274
100 3300025920 Ga0207649_10017322 Ga0207649_100173223 274
101 3300025933 Ga0207706_10194269 Ga0207706_101942692 274
102 3300025935 Ga0207709_10399284 Ga0207709_103992841 274
103 3300025945 Ga0207679_10021508 Ga0207679_100215082 274
104 3300026116 Ga0207674_10139145 Ga0207674_101391452 274
105 3300026116 Ga0207674_10193829 Ga0207674_101938293 274
106 3300037312 Ga0395899_0005351 Ga0395899_0005351_4772_5638 274
107 3300037418 Ga0395900_0001208 Ga0395900_0001208_24834_25700 274
108 3300037471 Ga0395905_0017108 Ga0395905_0017108_645_1511 274
109 3300041413 Ga0439465_0053030 Ga0439465_0053030_171_1037 274
110 3300042005 Ga0439448_0000555 Ga0439448_0000555_239_1105 274
111 3300042007 Ga0439449_0021002 Ga0439449_0021002_1403_2269 274
112 3300044693 Ga0466961_0203342 Ga0466961_0203342_164_1030 274
113 3300044706 Ga0466964_0002109 Ga0466964_0002109_5610_6476 274
114 3300046543 Ga0495645_0096352 Ga0495645_0096352_124_990 274
115 3300048927 Ga0496124_0017647 Ga0496124_0017647_1604_2455 274
116 3300048929 Ga0496126_0001786 Ga0496126_0001786_28014_28871 274
117 iso_pu_bacteria 2588253510 2588291951 274
118 iso_pu_bacteria 2887375801 2887376945 274
119 3300025938 Ga0207704_10537849 Ga0207704_105378491 275
120 iso_pu_bacteria 2521172590 2521557198 275
121 iso_pu_bacteria 2524023205 2524441154 275
122 iso_pu_bacteria 2582581866 2585395586 275
123 iso_pu_bacteria 2599185292 2599907671 275
124 iso_pu_bacteria 2600255292 2601669511 275
125 iso_pu_bacteria 2643221554 2643791702 275
126 iso_pu_bacteria 2643221556 2643798796 275
127 iso_pu_bacteria 2643221569 2643858729 275
128 iso_pu_bacteria 2643221585 2643935169 275
129 iso_pu_bacteria 2643221594 2643982111 275
130 iso_pu_bacteria 2643221621 2644120501 275
131 iso_pu_bacteria 2643221645 2644253122 275
132 iso_pu_bacteria 2643221654 2644303811 275
133 iso_pu_bacteria 2643221656 2644314933 275
134 iso_pu_bacteria 2643221664 2644354982 275
135 iso_pu_bacteria 2643221684 2644471109 275
136 iso_pu_bacteria 2738541280 2738741760 275
137 iso_pu_bacteria 2738541300 2738843920 275
138 iso_pu_bacteria 2738543018 2739274519 275
139 iso_pu_bacteria 2738543030 2739343563 275
140 iso_pu_bacteria 2808606395 2809034215 275
141 iso_pu_bacteria 2842711865 2842712542 275
142 iso_pu_bacteria 2857504554 2857506541 275
143 iso_pu_bacteria 2857537821 2857540163 275
144 iso_pu_bacteria 2858950400 2858954130 275
145 iso_pu_bacteria 2904424332 2904430445 275
146 iso_pu_bacteria 2932410948 2932414780 275
147 iso_pu_bacteria 2932416698 2932420700 275
148 iso_pu_bacteria 2941479691 2941480008 275
149 iso_pu_bacteria 2974320154 2974323399 275
150 iso_pu_bacteria 8002869464 8002870213 275
151 iso_pu_bacteria 8047673197 8047678355 275
152 3300035170 Ga0373943_0092010 Ga0373943_0092010_95_952 276
153 3300037312 Ga0395899_0014220 Ga0395899_0014220_4251_5108 276
154 3300046472 Ga0495580_0242368 Ga0495580_0242368_205_1062 276
155 iso_pu_bacteria 2808606361 2808855184 276
156 iso_pu_bacteria 2808606376 2808922906 276
157 iso_pu_bacteria 2808606378 2808935240 276
158 iso_pu_bacteria 2808606380 2808945219 276
159 iso_pu_bacteria 2808606383 2808963689 276
160 iso_pu_bacteria 2808606389 2808998577 276
161 iso_pu_bacteria 2919125081 2919128191 276
162 iso_pu_bacteria 8019769354 8019775346 276
163 3300005617 Ga0068859_100003193 Ga0068859_1000031939 278
164 3300006931 Ga0097620_100003193 Ga0097620_1000031939 278
165 3300009094 Ga0111539_10534465 Ga0111539_105344651 278
166 3300025299 Ga0209256_1026092 Ga0209256_10260922 278
167 3300028794 Ga0307515_10000525 Ga0307515_1000052581 278
168 3300031456 Ga0307513_10329004 Ga0307513_103290042 278
169 3300031507 Ga0307509_10206077 Ga0307509_102060772 278
170 3300031548 Ga0307408_100227833 Ga0307408_1002278331 278
171 3300031731 Ga0307405_10283079 Ga0307405_102830791 278
172 3300031911 Ga0307412_10029815 Ga0307412_100298152 278
173 3300032002 Ga0307416_100360100 Ga0307416_1003601002 278
174 3300046519 Ga0495632_0038404 Ga0495632_0038404_756_1619 278
175 3300049515 Ga0501292_003979 Ga0501292_003979_278_1138 278
176 3300053086 Ga0500578_0000028 Ga0500578_0000028_80697_81560 278
177 3300053148 Ga0500590_024655 Ga0500590_024655_991_1854 278
178 3300002739 JGI25158J39367_1000072 JGI25158J39367_100007214 279
179 3300002773 JGI25152J39213_1000002 JGI25152J39213_100000254 279
180 3300002773 JGI25152J39213_1002551 JGI25152J39213_10025512 279
181 3300002774 JGI25150J39212_1000038 JGI25150J39212_100003826 279
182 3300002774 JGI25150J39212_1004440 JGI25150J39212_10044402 279
183 3300002774 JGI25150J39212_1014009 JGI25150J39212_10140092 279
184 3300002987 JGI25159J45721_1000185 JGI25159J45721_10001858 279
185 3300002987 JGI25159J45721_1000254 JGI25159J45721_100025412 279
186 3300003215 JGI25153J46596_10002426 JGI25153J46596_100024268 279
187 3300003354 JGI25160J50197_1010928 JGI25160J50197_10109283 279
188 3300003374 JGI25161J50226_1000062 JGI25161J50226_100006235 279
189 3300003374 JGI25161J50226_1001608 JGI25161J50226_10016082 279
190 3300003763 Ga0055529_1000330 Ga0055529_10003308 279
191 3300003771 Ga0055526_1000632 Ga0055526_100063218 279
192 3300003773 Ga0055537_1010324 Ga0055537_10103242 279
193 3300003775 Ga0055524_1000105 Ga0055524_100010523 279
194 3300003784 Ga0055534_1006004 Ga0055534_10060042 279
195 3300003791 Ga0055530_10006780 Ga0055530_100067802 279
196 3300003791 Ga0055530_10015724 Ga0055530_100157243 279
197 3300003794 Ga0055531_10001856 Ga0055531_1000185613 279
198 3300003794 Ga0055531_10007148 Ga0055531_100071482 279
199 3300004625 Ga0055543_1000121 Ga0055543_100012120 279
200 3300004625 Ga0055543_1018635 Ga0055543_10186352 279
201 3300005262 Ga0065165_1000261 Ga0065165_100026148 279
202 3300005262 Ga0065165_1018238 Ga0065165_10182382 279
203 3300005262 Ga0065165_1022086 Ga0065165_10220862 279
204 3300005295 Ga0065707_10087177 Ga0065707_100871772 279
205 3300005327 Ga0070658_10090392 Ga0070658_100903922 279
206 3300005327 Ga0070658_10147892 Ga0070658_101478922 279
207 3300005328 Ga0070676_10128148 Ga0070676_101281482 279
208 3300005330 Ga0070690_100040624 Ga0070690_1000406242 279
209 3300005333 Ga0070677_10061668 Ga0070677_100616682 279
210 3300005334 Ga0068869_100014797 Ga0068869_1000147972 279
211 3300005335 Ga0070666_10001793 Ga0070666_100017935 279
212 3300005335 Ga0070666_10117478 Ga0070666_101174782 279
213 3300005338 Ga0068868_100000185 Ga0068868_1000001854 279
214 3300005338 Ga0068868_100039078 Ga0068868_1000390783 279
215 3300005340 Ga0070689_100010833 Ga0070689_1000108332 279
216 3300005344 Ga0070661_100062889 Ga0070661_1000628892 279
217 3300005347 Ga0070668_100088387 Ga0070668_1000883872 279
218 3300005354 Ga0070675_100001427 Ga0070675_1000014272 279
219 3300005355 Ga0070671_100015468 Ga0070671_1000154682 279
220 3300005355 Ga0070671_100032748 Ga0070671_1000327482 279
221 3300005355 Ga0070671_100065906 Ga0070671_1000659063 279
222 3300005356 Ga0070674_100013873 Ga0070674_1000138731 279
223 3300005364 Ga0070673_100002536 Ga0070673_1000025363 279
224 3300005367 Ga0070667_100004052 Ga0070667_10000405211 279
225 3300005367 Ga0070667_100020821 Ga0070667_1000208213 279
226 3300005367 Ga0070667_100102348 Ga0070667_1001023482 279
227 3300005436 Ga0070713_100017602 Ga0070713_1000176023 279
228 3300005436 Ga0070713_100127463 Ga0070713_1001274632 279
229 3300005436 Ga0070713_100428249 Ga0070713_1004282491 279
230 3300005455 Ga0070663_100003487 Ga0070663_1000034876 279
231 3300005456 Ga0070678_100007438 Ga0070678_1000074382 279
232 3300005457 Ga0070662_100023588 Ga0070662_1000235883 279
233 3300005457 Ga0070662_100073159 Ga0070662_1000731593 279
234 3300005459 Ga0068867_100000091 Ga0068867_10000009135 279
235 3300005459 Ga0068867_100000575 Ga0068867_1000005753 279
236 3300005459 Ga0068867_100030151 Ga0068867_1000301512 279
237 3300005467 Ga0070706_100053808 Ga0070706_1000538083 279
238 3300005468 Ga0070707_100037519 Ga0070707_1000375193 279
239 3300005539 Ga0068853_100450510 Ga0068853_1004505101 279
240 3300005548 Ga0070665_100067489 Ga0070665_1000674892 279
241 3300005563 Ga0068855_100028111 Ga0068855_1000281115 279
242 3300005563 Ga0068855_100243636 Ga0068855_1002436362 279
243 3300005563 Ga0068855_100732488 Ga0068855_1007324881 279
244 3300005564 Ga0070664_100045657 Ga0070664_1000456574 279
245 3300005577 Ga0068857_100072314 Ga0068857_1000723142 279
246 3300005578 Ga0068854_100038548 Ga0068854_1000385482 279
247 3300005616 Ga0068852_100002707 Ga0068852_1000027074 279
248 3300005616 Ga0068852_100039543 Ga0068852_1000395433 279
249 3300005616 Ga0068852_100527833 Ga0068852_1005278331 279
250 3300005617 Ga0068859_100001283 Ga0068859_1000012837 279
251 3300005617 Ga0068859_100470370 Ga0068859_1004703702 279
252 3300005618 Ga0068864_100001050 Ga0068864_1000010508 279
253 3300005618 Ga0068864_100012823 Ga0068864_1000128232 279
254 3300005618 Ga0068864_100079789 Ga0068864_1000797892 279
255 3300005718 Ga0068866_10009221 Ga0068866_100092214 279
256 3300005841 Ga0068863_100004913 Ga0068863_1000049134 279
257 3300005841 Ga0068863_100052600 Ga0068863_1000526004 279
258 3300005842 Ga0068858_100000885 Ga0068858_10000088518 279
259 3300005842 Ga0068858_100039812 Ga0068858_1000398123 279
260 3300005937 Ga0081455_10191201 Ga0081455_101912012 279
261 3300006042 Ga0075368_10034434 Ga0075368_100344342 279
262 3300006048 Ga0075363_100065833 Ga0075363_1000658331 279
263 3300006177 Ga0075362_10039556 Ga0075362_100395562 279
264 3300006178 Ga0075367_10007260 Ga0075367_100072602 279
265 3300006178 Ga0075367_10035029 Ga0075367_100350292 279
266 3300006178 Ga0075367_10044514 Ga0075367_100445141 279
267 3300006186 Ga0075369_10014572 Ga0075369_100145722 279
268 3300006195 Ga0075366_10028470 Ga0075366_100284702 279
269 3300006195 Ga0075366_10038701 Ga0075366_100387011 279
270 3300006195 Ga0075366_10166616 Ga0075366_101666162 279
271 3300006195 Ga0075366_10174630 Ga0075366_101746302 279
272 3300006195 Ga0075366_10208723 Ga0075366_102087232 279
273 3300006237 Ga0097621_100032688 Ga0097621_1000326882 279
274 3300006353 Ga0075370_10001906 Ga0075370_1000190610 279
275 3300006353 Ga0075370_10026207 Ga0075370_100262074 279
276 3300006353 Ga0075370_10097513 Ga0075370_100975132 279
277 3300006353 Ga0075370_10147990 Ga0075370_101479901 279
278 3300006846 Ga0075430_100349794 Ga0075430_1003497942 279
279 3300006881 Ga0068865_100027990 Ga0068865_1000279902 279
280 3300006931 Ga0097620_100001283 Ga0097620_1000012837 279
281 3300006931 Ga0097620_100470364 Ga0097620_1004703642 279
282 3300006931 Ga0097620_100521135 Ga0097620_1005211352 279
283 3300007265 Ga0099794_10102458 Ga0099794_101024581 279
284 3300007788 Ga0099795_10000365 Ga0099795_100003653 279
285 3300009093 Ga0105240_10285404 Ga0105240_102854042 279
286 3300009093 Ga0105240_10347248 Ga0105240_103472482 279
287 3300009148 Ga0105243_10002148 Ga0105243_100021487 279
288 3300009148 Ga0105243_10004977 Ga0105243_100049775 279
289 3300009174 Ga0105241_10041921 Ga0105241_100419214 279
290 3300009177 Ga0105248_10015738 Ga0105248_100157384 279
291 3300009177 Ga0105248_10029339 Ga0105248_100293396 279
292 3300009177 Ga0105248_10133406 Ga0105248_101334062 279
293 3300009545 Ga0105237_10023051 Ga0105237_100230515 279
294 3300009545 Ga0105237_10119406 Ga0105237_101194062 279
295 3300009545 Ga0105237_10515995 Ga0105237_105159952 279
296 3300009551 Ga0105238_10537803 Ga0105238_105378031 279
297 3300010159 Ga0099796_10004703 Ga0099796_100047032 279
298 3300010375 Ga0105239_10021983 Ga0105239_100219837 279
299 3300010375 Ga0105239_10150048 Ga0105239_101500482 279
300 3300013104 Ga0157370_10099698 Ga0157370_100996981 279
301 3300013296 Ga0157374_10021504 Ga0157374_100215046 279
302 3300013306 Ga0163162_10009476 Ga0163162_100094764 279
303 3300013306 Ga0163162_10044850 Ga0163162_100448502 279
304 3300013306 Ga0163162_10141381 Ga0163162_101413813 279
305 3300013307 Ga0157372_10139423 Ga0157372_101394232 279
306 3300013308 Ga0157375_10053711 Ga0157375_100537112 279
307 3300014497 Ga0182008_10000190 Ga0182008_1000019041 279
308 3300014497 Ga0182008_10000949 Ga0182008_1000094918 279
309 3300014745 Ga0157377_10000036 Ga0157377_1000003612 279
310 3300014745 Ga0157377_10000107 Ga0157377_1000010735 279
311 3300014968 Ga0157379_10002653 Ga0157379_100026533 279
312 3300014968 Ga0157379_10045551 Ga0157379_100455514 279
313 3300014968 Ga0157379_10214056 Ga0157379_102140562 279
314 3300014969 Ga0157376_10652482 Ga0157376_106524822 279
315 3300014969 Ga0157376_10731186 Ga0157376_107311861 279
316 3300015261 Ga0182006_1000004 Ga0182006_1000004347 279
317 3300015262 Ga0182007_10000018 Ga0182007_1000001824 279
318 3300015262 Ga0182007_10001150 Ga0182007_100011506 279
319 3300015265 Ga0182005_1000011 Ga0182005_100001134 279
320 3300025208 Ga0209436_100005 Ga0209436_10000583 279
321 3300025208 Ga0209436_100153 Ga0209436_10015317 279
322 3300025245 Ga0207425_1000001 Ga0207425_10000011227 279
323 3300025245 Ga0207425_1000033 Ga0207425_100003382 279
324 3300025245 Ga0207425_1000430 Ga0207425_10004303 279
325 3300025245 Ga0207425_1000883 Ga0207425_100088312 279
326 3300025246 Ga0209646_1000106 Ga0209646_100010622 279
327 3300025258 Ga0209129_1000001 Ga0209129_1000001404 279
328 3300025258 Ga0209129_1000841 Ga0209129_10008413 279
329 3300025258 Ga0209129_1010442 Ga0209129_10104422 279
330 3300025263 Ga0209565_1006156 Ga0209565_10061563 279
331 3300025263 Ga0209565_1006380 Ga0209565_10063803 279
332 3300025263 Ga0209565_1013441 Ga0209565_10134412 279
333 3300025271 Ga0207666_1004244 Ga0207666_10042442 279
334 3300025272 Ga0209455_1000033 Ga0209455_100003344 279
335 3300025284 Ga0209130_1000055 Ga0209130_1000055133 279
336 3300025284 Ga0209130_1000592 Ga0209130_100059214 279
337 3300025291 Ga0209675_1005505 Ga0209675_10055054 279
338 3300025292 Ga0209676_1000136 Ga0209676_1000136101 279
339 3300025292 Ga0209676_1004568 Ga0209676_10045682 279
340 3300025294 Ga0209025_1016139 Ga0209025_10161395 279
341 3300025295 Ga0209564_1000162 Ga0209564_100016256 279
342 3300025295 Ga0209564_1006907 Ga0209564_10069073 279
343 3300025297 Ga0209758_1000020 Ga0209758_100002049 279
344 3300025297 Ga0209758_1000152 Ga0209758_100015298 279
345 3300025297 Ga0209758_1003711 Ga0209758_100371111 279
346 3300025298 Ga0209050_1000011 Ga0209050_1000011402 279
347 3300025298 Ga0209050_1000238 Ga0209050_100023848 279
348 3300025299 Ga0209256_1000028 Ga0209256_100002823 279
349 3300025299 Ga0209256_1011459 Ga0209256_10114592 279
350 3300025302 Ga0207426_1000818 Ga0207426_100081818 279
351 3300025304 Ga0209257_1000003 Ga0209257_10000031174 279
352 3300025304 Ga0209257_1000142 Ga0209257_1000142101 279
353 3300025304 Ga0209257_1003802 Ga0209257_100380212 279
354 3300025304 Ga0209257_1016214 Ga0209257_10162142 279
355 3300025728 Ga0207655_1017922 Ga0207655_10179223 279
356 3300025899 Ga0207642_10002078 Ga0207642_100020786 279
357 3300025903 Ga0207680_10000931 Ga0207680_1000093110 279
358 3300025907 Ga0207645_10134585 Ga0207645_101345851 279
359 3300025907 Ga0207645_10217032 Ga0207645_102170322 279
360 3300025909 Ga0207705_10267695 Ga0207705_102676952 279
361 3300025910 Ga0207684_10045998 Ga0207684_100459983 279
362 3300025911 Ga0207654_10032395 Ga0207654_100323951 279
363 3300025913 Ga0207695_10153996 Ga0207695_101539962 279
364 3300025919 Ga0207657_10051608 Ga0207657_100516081 279
365 3300025920 Ga0207649_10281189 Ga0207649_102811892 279
366 3300025921 Ga0207652_10012965 Ga0207652_100129653 279
367 3300025921 Ga0207652_10026937 Ga0207652_100269376 279
368 3300025923 Ga0207681_10004760 Ga0207681_100047601 279
369 3300025923 Ga0207681_10124342 Ga0207681_101243422 279
370 3300025924 Ga0207694_10306244 Ga0207694_103062442 279
371 3300025926 Ga0207659_10007353 Ga0207659_100073537 279
372 3300025927 Ga0207687_10136900 Ga0207687_101369002 279
373 3300025928 Ga0207700_10063851 Ga0207700_100638512 279
374 3300025928 Ga0207700_10238989 Ga0207700_102389892 279
375 3300025931 Ga0207644_10000635 Ga0207644_100006355 279
376 3300025931 Ga0207644_10073826 Ga0207644_100738263 279
377 3300025931 Ga0207644_10213875 Ga0207644_102138752 279
378 3300025932 Ga0207690_10115771 Ga0207690_101157712 279
379 3300025933 Ga0207706_10002765 Ga0207706_100027657 279
380 3300025933 Ga0207706_10091551 Ga0207706_100915512 279
381 3300025935 Ga0207709_10002921 Ga0207709_100029214 279
382 3300025935 Ga0207709_10014308 Ga0207709_100143084 279
383 3300025935 Ga0207709_10076157 Ga0207709_100761572 279
384 3300025935 Ga0207709_10111399 Ga0207709_101113992 279
385 3300025937 Ga0207669_10489982 Ga0207669_104899821 279
386 3300025938 Ga0207704_10015573 Ga0207704_100155731 279
387 3300025941 Ga0207711_10007617 Ga0207711_100076173 279
388 3300025942 Ga0207689_10050185 Ga0207689_100501853 279
389 3300025942 Ga0207689_10083483 Ga0207689_100834832 279
390 3300025944 Ga0207661_10529876 Ga0207661_105298761 279
391 3300025949 Ga0207667_10003039 Ga0207667_100030397 279
392 3300025949 Ga0207667_10306085 Ga0207667_103060852 279
393 3300025961 Ga0207712_10001798 Ga0207712_100017986 279
394 3300025972 Ga0207668_10430596 Ga0207668_104305961 279
395 3300025981 Ga0207640_10069116 Ga0207640_100691161 279
396 3300025986 Ga0207658_10005671 Ga0207658_100056719 279
397 3300026023 Ga0207677_10002592 Ga0207677_100025924 279
398 3300026023 Ga0207677_10053176 Ga0207677_100531762 279
399 3300026035 Ga0207703_10001221 Ga0207703_100012217 279
400 3300026035 Ga0207703_10312239 Ga0207703_103122391 279
401 3300026067 Ga0207678_10008575 Ga0207678_100085756 279
402 3300026088 Ga0207641_10025598 Ga0207641_100255983 279
403 3300026088 Ga0207641_10027564 Ga0207641_100275645 279
404 3300026088 Ga0207641_10052325 Ga0207641_100523252 279
405 3300026089 Ga0207648_10000037 Ga0207648_1000003776 279
406 3300026089 Ga0207648_10000227 Ga0207648_1000022737 279
407 3300026095 Ga0207676_10001143 Ga0207676_1000114314 279
408 3300026095 Ga0207676_10038637 Ga0207676_100386372 279
409 3300026095 Ga0207676_10746276 Ga0207676_107462761 279
410 3300026116 Ga0207674_10018123 Ga0207674_100181238 279
411 3300026116 Ga0207674_10144764 Ga0207674_101447642 279
412 3300026116 Ga0207674_10325891 Ga0207674_103258912 279
413 3300026118 Ga0207675_100008494 Ga0207675_1000084944 279
414 3300026121 Ga0207683_10006411 Ga0207683_1000641112 279
415 3300026142 Ga0207698_10002142 Ga0207698_100021429 279
416 3300027512 Ga0209179_1004020 Ga0209179_10040202 279
417 3300027866 Ga0209813_10022180 Ga0209813_100221802 279
418 3300027876 Ga0209974_10003999 Ga0209974_100039995 279
419 3300028379 Ga0268266_10014233 Ga0268266_100142337 279
420 3300028379 Ga0268266_10347295 Ga0268266_103472952 279
421 3300028380 Ga0268265_10051838 Ga0268265_100518381 279
422 3300028380 Ga0268265_10091944 Ga0268265_100919442 279
423 3300028381 Ga0268264_10005954 Ga0268264_100059544 279
424 3300028556 Ga0265337_1026696 Ga0265337_10266962 279
425 3300028786 Ga0307517_10002278 Ga0307517_100022787 279
426 3300028794 Ga0307515_10018830 Ga0307515_1001883017 279
427 3300028794 Ga0307515_10086362 Ga0307515_100863624 279
428 3300028794 Ga0307515_10149059 Ga0307515_101490593 279
429 3300028794 Ga0307515_10157370 Ga0307515_101573703 279
430 3300030731 Ga0316177_1163442 Ga0316177_11634421 279
431 3300030745 Ga0316182_1128715 Ga0316182_11287152 279
432 3300031240 Ga0265320_10017913 Ga0265320_100179134 279
433 3300031249 Ga0265339_10006224 Ga0265339_100062245 279
434 3300031456 Ga0307513_10104938 Ga0307513_101049382 279
435 3300031456 Ga0307513_10217135 Ga0307513_102171352 279
436 3300031507 Ga0307509_10000157 Ga0307509_1000015776 279
437 3300031507 Ga0307509_10034314 Ga0307509_100343146 279
438 3300031507 Ga0307509_10356449 Ga0307509_103564492 279
439 3300031548 Ga0307408_100000046 Ga0307408_100000046104 279
440 3300031548 Ga0307408_100001037 Ga0307408_1000010377 279
441 3300031548 Ga0307408_100001365 Ga0307408_10000136511 279
442 3300031548 Ga0307408_100003010 Ga0307408_1000030102 279
443 3300031548 Ga0307408_100084007 Ga0307408_1000840072 279
444 3300031548 Ga0307408_100090754 Ga0307408_1000907542 279
445 3300031616 Ga0307508_10045664 Ga0307508_100456643 279
446 3300031616 Ga0307508_10071542 Ga0307508_100715422 279
447 3300031616 Ga0307508_10086959 Ga0307508_100869593 279
448 3300031649 Ga0307514_10028808 Ga0307514_100288082 279
449 3300031649 Ga0307514_10053972 Ga0307514_100539722 279
450 3300031711 Ga0265314_10089759 Ga0265314_100897592 279
451 3300031911 Ga0307412_10071852 Ga0307412_100718522 279
452 3300032004 Ga0307414_10222409 Ga0307414_102224092 279
453 3300033180 Ga0307510_10000883 Ga0307510_100008833 279
454 3300033180 Ga0307510_10010444 Ga0307510_100104442 279
455 3300035114 Ga0373939_0037803 Ga0373939_0037803_414_1280 279
456 3300035691 Ga0373931_0035876 Ga0373931_0035876_441_1307 279
457 3300035725 Ga0373947_0049489 Ga0373947_0049489_829_1674 279
458 3300036401 Ga0373937_0005178 Ga0373937_0005178_4833_5678 279
459 3300037068 Ga0373925_0017299 Ga0373925_0017299_3587_4432 279
460 3300037068 Ga0373925_0190579 Ga0373925_0190579_748_1593 279
461 3300037068 Ga0373925_0260437 Ga0373925_0260437_344_1189 279
462 3300037312 Ga0395899_0001092 Ga0395899_0001092_14618_15484 279
463 3300037312 Ga0395899_0002955 Ga0395899_0002955_1279_2145 279
464 3300037312 Ga0395899_0022519 Ga0395899_0022519_1631_2497 279
465 3300037312 Ga0395899_0044223 Ga0395899_0044223_948_1802 279
466 3300037418 Ga0395900_0000081 Ga0395900_0000081_61606_62472 279
467 3300037418 Ga0395900_0003059 Ga0395900_0003059_16686_17552 279
468 3300037418 Ga0395900_0036687 Ga0395900_0036687_205_1059 279
469 3300037418 Ga0395900_0057623 Ga0395900_0057623_2199_3065 279
470 3300037418 Ga0395900_0136768 Ga0395900_0136768_697_1563 279
471 3300037466 Ga0395898_0119308 Ga0395898_0119308_769_1635 279
472 3300037471 Ga0395905_0009494 Ga0395905_0009494_4544_5410 279
473 3300037471 Ga0395905_0127464 Ga0395905_0127464_667_1533 279
474 3300037853 Ga0436364_0407173 Ga0436364_0407173_80_925 279
475 3300038443 Ga0395901_0000237 Ga0395901_0000237_29412_30278 279
476 3300038443 Ga0395901_0090868 Ga0395901_0090868_2139_3005 279
477 3300038443 Ga0395901_0172932 Ga0395901_0172932_1366_2220 279
478 3300038443 Ga0395901_0308767 Ga0395901_0308767_324_1190 279
479 3300039438 Ga0436360_0544857 Ga0436360_0544857_750_1595 279
480 3300039453 Ga0436362_0381357 Ga0436362_0381357_285_1130 279
481 3300041512 Ga0451853_2845666 Ga0451853_2845666_302_1144 279
482 3300041997 Ga0439431_0006250 Ga0439431_0006250_1132_1998 279
483 3300042876 Ga0451577_0051628 Ga0451577_0051628_677_1543 279
484 3300042876 Ga0451577_0094783 Ga0451577_0094783_1230_2093 279
485 3300044656 Ga0466969_0006699 Ga0466969_0006699_1911_2756 279
486 3300044656 Ga0466969_0014607 Ga0466969_0014607_1562_2428 279
487 3300044656 Ga0466969_0035390 Ga0466969_0035390_479_1345 279
488 3300044658 Ga0466972_0000383 Ga0466972_0000383_5099_5965 279
489 3300044658 Ga0466972_0006200 Ga0466972_0006200_4470_5318 279
490 3300044658 Ga0466972_0036061 Ga0466972_0036061_1067_1933 279
491 3300044683 Ga0466965_0001230 Ga0466965_0001230_8846_9712 279
492 3300044683 Ga0466965_0085184 Ga0466965_0085184_280_1146 279
493 3300044684 Ga0466966_0000428 Ga0466966_0000428_17557_18402 279
494 3300044684 Ga0466966_0002106 Ga0466966_0002106_7668_8534 279
495 3300044684 Ga0466966_0005887 Ga0466966_0005887_189_1055 279
496 3300044684 Ga0466966_0009166 Ga0466966_0009166_4192_5058 279
497 3300044684 Ga0466966_0023505 Ga0466966_0023505_2550_3416 279
498 3300044684 Ga0466966_0032955 Ga0466966_0032955_837_1703 279
499 3300044684 Ga0466966_0254042 Ga0466966_0254042_22_888 279
500 3300044693 Ga0466961_0019174 Ga0466961_0019174_3304_4170 279
501 3300044693 Ga0466961_0151018 Ga0466961_0151018_391_1257 279
502 3300044706 Ga0466964_0013400 Ga0466964_0013400_1770_2636 279
503 3300044719 Ga0466971_0035615 Ga0466971_0035615_1189_2034 279
504 3300044735 Ga0466968_0013820 Ga0466968_0013820_725_1591 279
505 3300044765 Ga0466970_0008945 Ga0466970_0008945_377_1222 279
506 3300044765 Ga0466970_0054294 Ga0466970_0054294_21_887 279
507 3300044842 Ga0466957_0000337 Ga0466957_0000337_4796_5662 279
508 3300044842 Ga0466957_0010664 Ga0466957_0010664_3006_3851 279
509 3300044901 Ga0466960_0061170 Ga0466960_0061170_599_1465 279
510 3300045049 Ga0466959_0076778 Ga0466959_0076778_357_1223 279
511 3300045049 Ga0466959_0113022 Ga0466959_0113022_442_1308 279
512 3300045051 Ga0451576_0089607 Ga0451576_0089607_2057_2974 279
513 3300045836 Ga0466958_0021614 Ga0466958_0021614_844_1710 279
514 3300045836 Ga0466958_0148404 Ga0466958_0148404_384_1229 279
515 3300046454 Ga0495592_0000058 Ga0495592_0000058_71579_72445 279
516 3300046457 Ga0495590_0000016 Ga0495590_0000016_124955_125821 279
517 3300046457 Ga0495590_0044047 Ga0495590_0044047_587_1453 279
518 3300046460 Ga0495638_0000057 Ga0495638_0000057_69391_70257 279
519 3300046463 Ga0495653_0003297 Ga0495653_0003297_7355_8221 279
520 3300046471 Ga0495650_0002031 Ga0495650_0002031_5773_6639 279
521 3300046474 Ga0495605_0000684 Ga0495605_0000684_1780_2646 279
522 3300046474 Ga0495605_0003913 Ga0495605_0003913_6583_7449 279
523 3300046474 Ga0495605_0064763 Ga0495605_0064763_851_1717 279
524 3300046475 Ga0495639_0009356 Ga0495639_0009356_1346_2212 279
525 3300046491 Ga0495584_0000915 Ga0495584_0000915_5098_5949 279
526 3300046491 Ga0495584_0002336 Ga0495584_0002336_6387_7253 279
527 3300046491 Ga0495584_0011193 Ga0495584_0011193_2068_2934 279
528 3300046492 Ga0495585_0000005 Ga0495585_0000005_219039_219905 279
529 3300046492 Ga0495585_0000162 Ga0495585_0000162_66371_67237 279
530 3300046492 Ga0495585_0007241 Ga0495585_0007241_5425_6291 279
531 3300046492 Ga0495585_0009385 Ga0495585_0009385_4734_5585 279
532 3300046492 Ga0495585_0036768 Ga0495585_0036768_885_1751 279
533 3300046492 Ga0495585_0041772 Ga0495585_0041772_329_1195 279
534 3300046492 Ga0495585_0071056 Ga0495585_0071056_461_1327 279
535 3300046492 Ga0495585_0130399 Ga0495585_0130399_361_1227 279
536 3300046500 Ga0495596_0000013 Ga0495596_0000013_58650_59516 279
537 3300046500 Ga0495596_0000901 Ga0495596_0000901_16653_17519 279
538 3300046500 Ga0495596_0003244 Ga0495596_0003244_94_960 279
539 3300046501 Ga0495607_0001702 Ga0495607_0001702_9924_10790 279
540 3300046501 Ga0495607_0003182 Ga0495607_0003182_5150_6016 279
541 3300046501 Ga0495607_0003268 Ga0495607_0003268_4765_5631 279
542 3300046501 Ga0495607_0021859 Ga0495607_0021859_2358_3224 279
543 3300046506 Ga0495583_0000189 Ga0495583_0000189_94254_95120 279
544 3300046506 Ga0495583_0000655 Ga0495583_0000655_9237_10103 279
545 3300046506 Ga0495583_0000688 Ga0495583_0000688_17868_18734 279
546 3300046506 Ga0495583_0002721 Ga0495583_0002721_11453_12319 279
547 3300046506 Ga0495583_0041851 Ga0495583_0041851_1107_1973 279
548 3300046506 Ga0495583_0090147 Ga0495583_0090147_140_1006 279
549 3300046507 Ga0495606_0000070 Ga0495606_0000070_169705_170571 279
550 3300046507 Ga0495606_0052909 Ga0495606_0052909_1706_2572 279
551 3300046507 Ga0495606_0054698 Ga0495606_0054698_1485_2351 279
552 3300046507 Ga0495606_0229514 Ga0495606_0229514_77_943 279
553 3300046512 Ga0495610_0004252 Ga0495610_0004252_3162_4007 279
554 3300046512 Ga0495610_0026614 Ga0495610_0026614_49_915 279
555 3300046513 Ga0495616_0000646 Ga0495616_0000646_5451_6317 279
556 3300046513 Ga0495616_0019559 Ga0495616_0019559_1045_1911 279
557 3300046513 Ga0495616_0046894 Ga0495616_0046894_1048_1914 279
558 3300046515 Ga0495620_0001634 Ga0495620_0001634_3342_4187 279
559 3300046516 Ga0495628_0000109 Ga0495628_0000109_13931_14797 279
560 3300046518 Ga0495631_0004026 Ga0495631_0004026_2149_3015 279
561 3300046518 Ga0495631_0010136 Ga0495631_0010136_1446_2297 279
562 3300046518 Ga0495631_0039780 Ga0495631_0039780_1056_1922 279
563 3300046519 Ga0495632_0000118 Ga0495632_0000118_45902_46768 279
564 3300046519 Ga0495632_0000321 Ga0495632_0000321_42681_43547 279
565 3300046519 Ga0495632_0001878 Ga0495632_0001878_8649_9515 279
566 3300046519 Ga0495632_0006806 Ga0495632_0006806_3665_4531 279
567 3300046519 Ga0495632_0014187 Ga0495632_0014187_2549_3415 279
568 3300046520 Ga0495637_0023384 Ga0495637_0023384_879_1745 279
569 3300046522 Ga0495643_0000236 Ga0495643_0000236_41286_42152 279
570 3300046522 Ga0495643_0002480 Ga0495643_0002480_9536_10402 279
571 3300046522 Ga0495643_0050575 Ga0495643_0050575_148_1014 279
572 3300046522 Ga0495643_0066689 Ga0495643_0066689_10_876 279
573 3300046523 Ga0495644_0001385 Ga0495644_0001385_356_1222 279
574 3300046523 Ga0495644_0027680 Ga0495644_0027680_484_1350 279
575 3300046524 Ga0495648_0000002 Ga0495648_0000002_466580_467446 279
576 3300046524 Ga0495648_0000033 Ga0495648_0000033_90124_90990 279
577 3300046524 Ga0495648_0007546 Ga0495648_0007546_4089_4955 279
578 3300046525 Ga0495663_0001760 Ga0495663_0001760_5812_6678 279
579 3300046525 Ga0495663_0067745 Ga0495663_0067745_203_1069 279
580 3300046528 Ga0495642_0000673 Ga0495642_0000673_4825_5691 279
581 3300046528 Ga0495642_0005081 Ga0495642_0005081_3554_4420 279
582 3300046528 Ga0495642_0008493 Ga0495642_0008493_1947_2813 279
583 3300046529 Ga0495652_0082260 Ga0495652_0082260_528_1394 279
584 3300046529 Ga0495652_0123081 Ga0495652_0123081_653_1498 279
585 3300046530 Ga0495654_0014733 Ga0495654_0014733_698_1564 279
586 3300046530 Ga0495654_0050233 Ga0495654_0050233_1096_1941 279
587 3300046533 Ga0495640_0140977 Ga0495640_0140977_169_1014 279
588 3300046538 Ga0495609_0000084 Ga0495609_0000084_32321_33187 279
589 3300046538 Ga0495609_0059233 Ga0495609_0059233_441_1307 279
590 3300046542 Ga0495597_0000028 Ga0495597_0000028_111159_112004 279
591 3300046542 Ga0495597_0000080 Ga0495597_0000080_69996_70862 279
592 3300046542 Ga0495597_0005046 Ga0495597_0005046_2415_3281 279
593 3300046542 Ga0495597_0021109 Ga0495597_0021109_267_1133 279
594 3300046542 Ga0495597_0023629 Ga0495597_0023629_1428_2294 279
595 3300046542 Ga0495597_0036901 Ga0495597_0036901_1316_2167 279
596 3300046557 Ga0495622_0000483 Ga0495622_0000483_17251_18117 279
597 3300046557 Ga0495622_0029884 Ga0495622_0029884_247_1113 279
598 3300046558 Ga0495633_0000204 Ga0495633_0000204_7125_7991 279
599 3300046558 Ga0495633_0000399 Ga0495633_0000399_26836_27702 279
600 3300046558 Ga0495633_0009652 Ga0495633_0009652_1343_2194 279
601 3300046558 Ga0495633_0019359 Ga0495633_0019359_671_1537 279
602 3300046558 Ga0495633_0052919 Ga0495633_0052919_213_1079 279
603 3300046615 Ga0495656_0028866 Ga0495656_0028866_333_1199 279
604 3300046616 Ga0495668_0000132 Ga0495668_0000132_67717_68583 279
605 3300046616 Ga0495668_0003093 Ga0495668_0003093_5099_5965 279
606 3300046616 Ga0495668_0009077 Ga0495668_0009077_4104_4970 279
607 3300046616 Ga0495668_0010419 Ga0495668_0010419_374_1240 279
608 3300046616 Ga0495668_0013502 Ga0495668_0013502_2755_3621 279
609 3300046616 Ga0495668_0064593 Ga0495668_0064593_750_1616 279
610 3300046648 Ga0495611_0001712 Ga0495611_0001712_3652_4503 279
611 3300046648 Ga0495611_0010146 Ga0495611_0010146_94_960 279
612 3300046648 Ga0495611_0016943 Ga0495611_0016943_59_925 279
613 3300046660 Ga0495625_0000177 Ga0495625_0000177_26722_27588 279
614 3300046660 Ga0495625_0001203 Ga0495625_0001203_30110_30976 279
615 3300046660 Ga0495625_0010429 Ga0495625_0010429_4083_4949 279
616 3300046660 Ga0495625_0042302 Ga0495625_0042302_988_1854 279
617 3300046664 Ga0495659_0000185 Ga0495659_0000185_21720_22586 279
618 3300046664 Ga0495659_0024668 Ga0495659_0024668_913_1779 279
619 3300046665 Ga0495661_0000170 Ga0495661_0000170_52481_53347 279
620 3300046665 Ga0495661_0006188 Ga0495661_0006188_3482_4348 279
621 3300046665 Ga0495661_0010366 Ga0495661_0010366_57_923 279
622 3300046665 Ga0495661_0037821 Ga0495661_0037821_729_1595 279
623 3300046665 Ga0495661_0079702 Ga0495661_0079702_163_1029 279
624 3300046665 Ga0495661_0105990 Ga0495661_0105990_238_1104 279
625 3300046674 Ga0495588_0051070 Ga0495588_0051070_157_1023 279
626 3300046678 Ga0495599_0069794 Ga0495599_0069794_713_1558 279
627 3300046684 Ga0495669_0001281 Ga0495669_0001281_702_1568 279
628 3300046684 Ga0495669_0005080 Ga0495669_0005080_866_1732 279
629 3300046690 Ga0495624_0018331 Ga0495624_0018331_974_1840 279
630 3300046690 Ga0495624_0071891 Ga0495624_0071891_843_1709 279
631 3300046691 Ga0495670_0001661 Ga0495670_0001661_8143_8994 279
632 3300046691 Ga0495670_0002325 Ga0495670_0002325_6172_7038 279
633 3300046691 Ga0495670_0013246 Ga0495670_0013246_1885_2751 279
634 3300046692 Ga0495671_0000088 Ga0495671_0000088_51903_52769 279
635 3300046692 Ga0495671_0009586 Ga0495671_0009586_84_950 279
636 3300046692 Ga0495671_0084406 Ga0495671_0084406_504_1370 279
637 3300046694 Ga0495649_0001312 Ga0495649_0001312_14391_15257 279
638 3300046694 Ga0495649_0012827 Ga0495649_0012827_3071_3937 279
639 3300046694 Ga0495649_0039555 Ga0495649_0039555_682_1548 279
640 3300046794 Ga0495589_0001144 Ga0495589_0001144_13064_13930 279
641 3300046794 Ga0495589_0024179 Ga0495589_0024179_749_1615 279
642 3300046794 Ga0495589_0040034 Ga0495589_0040034_818_1684 279
643 3300046810 Ga0495660_0000057 Ga0495660_0000057_26686_27552 279
644 3300046810 Ga0495660_0000208 Ga0495660_0000208_20662_21528 279
645 3300046810 Ga0495660_0001806 Ga0495660_0001806_1424_2290 279
646 3300046810 Ga0495660_0024071 Ga0495660_0024071_1043_1909 279
647 3300046810 Ga0495660_0048056 Ga0495660_0048056_955_1821 279
648 3300046810 Ga0495660_0093189 Ga0495660_0093189_25_891 279
649 3300047318 Ga0495636_0000716 Ga0495636_0000716_4318_5169 279
650 3300047318 Ga0495636_0028191 Ga0495636_0028191_1079_1945 279
651 3300047320 Ga0495672_0000262 Ga0495672_0000262_64296_65162 279
652 3300047320 Ga0495672_0029883 Ga0495672_0029883_1236_2102 279
653 3300047322 Ga0495680_0011827 Ga0495680_0011827_3419_4264 279
654 3300047323 Ga0495683_0000072 Ga0495683_0000072_33947_34813 279
655 3300047323 Ga0495683_0033348 Ga0495683_0033348_1456_2322 279
656 3300047323 Ga0495683_0039010 Ga0495683_0039010_322_1188 279
657 3300047443 Ga0495687_000722 Ga0495687_000722_10543_11409 279
658 3300047443 Ga0495687_000740 Ga0495687_000740_31731_32597 279
659 3300047443 Ga0495687_001604 Ga0495687_001604_9450_10316 279
660 3300047443 Ga0495687_003773 Ga0495687_003773_6576_7442 279
661 3300047443 Ga0495687_020008 Ga0495687_020008_881_1747 279
662 3300047445 Ga0495677_0000217 Ga0495677_0000217_7718_8584 279
663 3300047445 Ga0495677_0000873 Ga0495677_0000873_3137_4003 279
664 3300047445 Ga0495677_0002104 Ga0495677_0002104_4876_5742 279
665 3300047445 Ga0495677_0002684 Ga0495677_0002684_957_1823 279
666 3300047445 Ga0495677_0003892 Ga0495677_0003892_3693_4559 279
667 3300047445 Ga0495677_0004159 Ga0495677_0004159_2531_3397 279
668 3300047445 Ga0495677_0005946 Ga0495677_0005946_2027_2893 279
669 3300047445 Ga0495677_0008922 Ga0495677_0008922_576_1427 279
670 3300047446 Ga0495679_005033 Ga0495679_005033_4064_4930 279
671 3300047470 Ga0495681_0002551 Ga0495681_0002551_9087_9932 279
672 3300047470 Ga0495681_0007002 Ga0495681_0007002_6174_7040 279
673 3300047470 Ga0495681_0008872 Ga0495681_0008872_2673_3539 279
674 3300047470 Ga0495681_0037694 Ga0495681_0037694_1369_2235 279
675 3300047470 Ga0495681_0043194 Ga0495681_0043194_1243_2109 279
676 3300047472 Ga0495686_0003319 Ga0495686_0003319_9007_9849 279
677 3300047472 Ga0495686_0038635 Ga0495686_0038635_1797_2663 279
678 3300047472 Ga0495686_0121925 Ga0495686_0121925_586_1452 279
679 3300047472 Ga0495686_0181227 Ga0495686_0181227_229_1095 279
680 3300048088 Ga0495602_0050698 Ga0495602_0050698_608_1474 279
681 3300048091 Ga0495626_0000011 Ga0495626_0000011_251981_252847 279
682 3300048091 Ga0495626_0011297 Ga0495626_0011297_1353_2219 279
683 3300048091 Ga0495626_0011964 Ga0495626_0011964_244_1110 279
684 3300048091 Ga0495626_0020550 Ga0495626_0020550_1336_2202 279
685 3300048091 Ga0495626_0094246 Ga0495626_0094246_70_936 279
686 3300048904 Ga0496101_0138280 Ga0496101_0138280_469_1335 279
687 3300048904 Ga0496101_0156154 Ga0496101_0156154_540_1406 279
688 3300048905 Ga0496102_0060133 Ga0496102_0060133_917_1783 279
689 3300048906 Ga0496103_0049655 Ga0496103_0049655_191_1057 279
690 3300048907 Ga0496104_0073802 Ga0496104_0073802_1165_2031 279
691 3300048909 Ga0496106_0012017 Ga0496106_0012017_4746_5612 279
692 3300048909 Ga0496106_0061377 Ga0496106_0061377_503_1369 279
693 3300048910 Ga0496107_0040886 Ga0496107_0040886_370_1236 279
694 3300048911 Ga0496108_0607873 Ga0496108_0607873_63_929 279
695 3300048914 Ga0496111_0016619 Ga0496111_0016619_568_1434 279
696 3300048917 Ga0496114_0214596 Ga0496114_0214596_520_1386 279
697 3300048919 Ga0496116_0031617 Ga0496116_0031617_1757_2623 279
698 3300048919 Ga0496116_0048918 Ga0496116_0048918_808_1674 279
699 3300048920 Ga0496117_0000011 Ga0496117_0000011_387764_388630 279
700 3300048921 Ga0496118_0000010 Ga0496118_0000010_222301_223167 279
701 3300048921 Ga0496118_0076880 Ga0496118_0076880_1398_2264 279
702 3300048922 Ga0496119_0011802 Ga0496119_0011802_5894_6739 279
703 3300048922 Ga0496119_0012354 Ga0496119_0012354_2010_2876 279
704 3300048923 Ga0496120_0025916 Ga0496120_0025916_2567_3433 279
705 3300048923 Ga0496120_0106982 Ga0496120_0106982_306_1151 279
706 3300048924 Ga0496121_0000490 Ga0496121_0000490_2123_2989 279
707 3300048924 Ga0496121_0004661 Ga0496121_0004661_4830_5696 279
708 3300048924 Ga0496121_0088627 Ga0496121_0088627_1544_2392 279
709 3300048925 Ga0496122_0000821 Ga0496122_0000821_18405_19271 279
710 3300048925 Ga0496122_0023924 Ga0496122_0023924_229_1095 279
711 3300048925 Ga0496122_0069721 Ga0496122_0069721_1138_2004 279
712 3300048926 Ga0496123_0000872 Ga0496123_0000872_36011_36877 279
713 3300048926 Ga0496123_0001273 Ga0496123_0001273_25333_26199 279
714 3300048926 Ga0496123_0030777 Ga0496123_0030777_1784_2650 279
715 3300048926 Ga0496123_0057754 Ga0496123_0057754_1428_2294 279
716 3300048927 Ga0496124_0233659 Ga0496124_0233659_138_1004 279
717 3300048928 Ga0496125_0000884 Ga0496125_0000884_30885_31751 279
718 3300048928 Ga0496125_0116580 Ga0496125_0116580_999_1865 279
719 3300048929 Ga0496126_0043152 Ga0496126_0043152_1766_2632 279
720 3300048929 Ga0496126_0088424 Ga0496126_0088424_1314_2180 279
721 3300049459 Ga0495678_007026 Ga0495678_007026_3073_3939 279
722 3300049459 Ga0495678_053681 Ga0495678_053681_389_1255 279
723 3300049459 Ga0495678_070702 Ga0495678_070702_386_1252 279
724 3300049460 Ga0495682_0003951 Ga0495682_0003951_4629_5495 279
725 3300049460 Ga0495682_0016442 Ga0495682_0016442_1778_2644 279
726 3300049570 Ga0501033_0000186 Ga0501033_0000186_7569_8417 279
727 3300049570 Ga0501033_0029154 Ga0501033_0029154_1717_2580 279
728 3300049581 Ga0501047_0008047 Ga0501047_0008047_2425_3288 279
729 3300049592 Ga0501076_0215169 Ga0501076_0215169_431_1276 279
730 3300049822 Ga0501035_0000292 Ga0501035_0000292_12023_12889 279
731 3300049822 Ga0501035_0001063 Ga0501035_0001063_22057_22905 279
732 3300049822 Ga0501035_0028835 Ga0501035_0028835_2378_3241 279
733 3300049823 Ga0501044_0005038 Ga0501044_0005038_2609_3472 279
734 3300049823 Ga0501044_0171576 Ga0501044_0171576_64_930 279
735 3300050493 nmdc:mga0k408_1383_c1 nmdc:mga0k408_1383_c1_10106_10972 279
736 3300050493 nmdc:mga0k408_34927_c1 nmdc:mga0k408_34927_c1_1909_2775 279
737 3300050493 nmdc:mga0k408_53133_c1 nmdc:mga0k408_53133_c1_950_1816 279
738 3300050494 nmdc:mga06z11_52034_c1 nmdc:mga06z11_52034_c1_1105_1971 279
739 3300050494 nmdc:mga06z11_8396_c1 nmdc:mga06z11_8396_c1_1311_2177 279
740 3300050496 nmdc:mga07m45_100192_c1 nmdc:mga07m45_100192_c1_446_1312 279
741 3300050496 nmdc:mga07m45_3676_c1 nmdc:mga07m45_3676_c1_3561_4427 279
742 3300050496 nmdc:mga07m45_6783_c1 nmdc:mga07m45_6783_c1_4769_5635 279
743 3300050496 nmdc:mga07m45_88556_c1 nmdc:mga07m45_88556_c1_64_930 279
744 3300050516 nmdc:mga0sz30_4699_c1 nmdc:mga0sz30_4699_c1_3674_4540 279
745 3300050516 nmdc:mga0sz30_5171_c1 nmdc:mga0sz30_5171_c1_1332_2198 279
746 3300053111 Ga0500572_000038 Ga0500572_000038_10535_11386 279
747 3300053134 Ga0500658_0013184 Ga0500658_0013184_1800_2666 279
748 3300053136 Ga0500559_0000326 Ga0500559_0000326_26823_27689 279
749 3300053139 Ga0500568_0011765 Ga0500568_0011765_2003_2869 279
750 3300053156 Ga0500622_0003342 Ga0500622_0003342_1777_2643 279
751 3300053730 Ga0500645_006464 Ga0500645_006464_2059_2925 279
752 3300061719 Ga0466962_0019076 Ga0466962_0019076_515_1360 279
753 3300061719 Ga0466962_0046904 Ga0466962_0046904_201_1067 279
754 3300061719 Ga0466962_0093047 Ga0466962_0093047_397_1263 279
755 2162886007 SwRhRL2b_contig_3045014 SwRhRL2b_0237.00006530 280
756 3300005289 Ga0065704_10075819 Ga0065704_100758194 280
757 3300005456 Ga0070678_100031159 Ga0070678_1000311593 280
758 3300005468 Ga0070707_100053914 Ga0070707_1000539142 280
759 3300005563 Ga0068855_100007936 Ga0068855_1000079362 280
760 3300006195 Ga0075366_10001538 Ga0075366_100015388 280
761 3300009093 Ga0105240_10033580 Ga0105240_100335803 280
762 3300009545 Ga0105237_10006766 Ga0105237_100067667 280
763 3300009545 Ga0105237_10007760 Ga0105237_100077607 280
764 3300009545 Ga0105237_10038836 Ga0105237_100388365 280
765 3300009551 Ga0105238_10010968 Ga0105238_100109683 280
766 3300009553 Ga0105249_10003126 Ga0105249_100031268 280
767 3300010375 Ga0105239_10000663 Ga0105239_100006632 280
768 3300010375 Ga0105239_10004145 Ga0105239_1000414512 280
769 3300013104 Ga0157370_10008953 Ga0157370_100089538 280
770 3300025303 Ga0209051_1002074 Ga0209051_100207412 280
771 3300025303 Ga0209051_1068898 Ga0209051_10688981 280
772 3300025909 Ga0207705_10000481 Ga0207705_1000048121 280
773 3300025910 Ga0207684_10011762 Ga0207684_100117624 280
774 3300025913 Ga0207695_10015843 Ga0207695_100158437 280
775 3300025913 Ga0207695_10022800 Ga0207695_100228007 280
776 3300025913 Ga0207695_10305994 Ga0207695_103059942 280
777 3300025914 Ga0207671_10006346 Ga0207671_100063466 280
778 3300025914 Ga0207671_10007479 Ga0207671_100074793 280
779 3300025914 Ga0207671_10037912 Ga0207671_100379122 280
780 3300025924 Ga0207694_10005550 Ga0207694_100055509 280
781 3300025949 Ga0207667_10006345 Ga0207667_100063456 280
782 3300025961 Ga0207712_10002005 Ga0207712_100020057 280
783 3300026121 Ga0207683_10017139 Ga0207683_100171394 280
784 3300027876 Ga0209974_10051954 Ga0209974_100519542 280
785 3300031903 Ga0307407_10339071 Ga0307407_103390711 280
786 3300032002 Ga0307416_100551542 Ga0307416_1005515421 280
787 3300037466 Ga0395898_0000201 Ga0395898_0000201_139587_140453 280
788 3300037466 Ga0395898_0241195 Ga0395898_0241195_765_1613 280
789 3300044656 Ga0466969_0000232 Ga0466969_0000232_8063_8926 280
790 3300044683 Ga0466965_0000082 Ga0466965_0000082_20076_20939 280
791 3300044684 Ga0466966_0004513 Ga0466966_0004513_6318_7181 280
792 3300044693 Ga0466961_0000229 Ga0466961_0000229_29032_29895 280
793 3300044693 Ga0466961_0006081 Ga0466961_0006081_3672_4535 280
794 3300044694 Ga0466963_0005033 Ga0466963_0005033_2968_3831 280
795 3300044765 Ga0466970_0040109 Ga0466970_0040109_67_930 280
796 3300044765 Ga0466970_0087732 Ga0466970_0087732_618_1481 280
797 3300044842 Ga0466957_0005060 Ga0466957_0005060_4947_5810 280
798 3300045049 Ga0466959_0013955 Ga0466959_0013955_3567_4430 280
799 3300045836 Ga0466958_0005517 Ga0466958_0005517_5293_6156 280
800 3300045976 Ga0466967_0693098 Ga0466967_0693098_66_914 280
801 3300046472 Ga0495580_0019602 Ga0495580_0019602_2619_3479 280
802 3300046524 Ga0495648_0043992 Ga0495648_0043992_1092_1952 280
803 3300046660 Ga0495625_0065650 Ga0495625_0065650_1278_2120 280
804 3300048090 Ga0495615_0000170 Ga0495615_0000170_10259_11104 280
805 3300048917 Ga0496114_0355574 Ga0496114_0355574_333_1181 280
806 3300048922 Ga0496119_0002111 Ga0496119_0002111_10245_11090 280
807 3300048925 Ga0496122_0005095 Ga0496122_0005095_10770_11615 280
808 3300048926 Ga0496123_0003879 Ga0496123_0003879_10973_11818 280
809 3300048928 Ga0496125_0046007 Ga0496125_0046007_1349_2194 280
810 3300048928 Ga0496125_0148245 Ga0496125_0148245_752_1603 280
811 3300049573 Ga0501037_0269359 Ga0501037_0269359_295_1143 280
812 3300049583 Ga0501067_0221256 Ga0501067_0221256_124_972 280
813 3300049741 Ga0501079_0103835 Ga0501079_0103835_63_911 280
814 3300049823 Ga0501044_0118140 Ga0501044_0118140_1107_1955 280
815 3300050493 nmdc:mga0k408_48393_c1 nmdc:mga0k408_48393_c1_1357_2211 280
816 3300050493 nmdc:mga0k408_6516_c1 nmdc:mga0k408_6516_c1_4111_4971 280
817 3300050496 nmdc:mga07m45_4791_c2 nmdc:mga07m45_4791_c2_4405_5265 280
818 3300061719 Ga0466962_0017319 Ga0466962_0017319_2465_3328 280

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01557

FAA_hydrolase

Fumarylacetoacetate (FAA) hydrolase family

68

274

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8gst-assembly2.cif.gz_D crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (pyruvate bound-form) 0.9689 1 280
8gst-assembly2.cif.gz_D crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (pyruvate bound-form) 0.9553 1 280
6fog-assembly4.cif.gz_D x-ray structure of homo sapiens fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate at 1.94a resolution. 0.9443 71 280
6sbi-assembly2.cif.gz_C x-ray structure of murine fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate 0.9292 71 279
1wzo-assembly1.cif.gz_C crystal structure of the hpce from thermus thermophilus hb8 0.9291 1 279
ID Description Score Start End Superfamily
af_Q9VU50_128_337_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9788 68 280 3.90.850.10
af_A0A1D8PI10_75_291_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9767 69 277 3.90.850.10
af_Q9VU50_128_337_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.965 68 280 3.90.850.10
af_Q96GK7_51_314_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9625 27 277 3.90.850.10
af_Q2FZT4_90_300_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9613 70 277 3.90.850.10
ID Description Score Start End GO Terms
AF-A0A7V1SP07-F1-model_v4 FAA hydrolase family protein 0.9942 75 280 GO:0016787
GO:0044281
AF-A0A7C7BQ93-F1-model_v4 deleted 0.994 102 279
AF-A0A6J5CQM4-F1-model_v4 2-keto-4-pentenoate hydratase (EC 4.2.1.80) 0.9939 1 280 GO:0008684
GO:0044281
AF-A0A0Q4TVS1-F1-model_v4 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase 0.9938 1 278 GO:0016853
GO:0044281
AF-A0A1M5XN10-F1-model_v4 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase (Catechol pathway) 0.9935 1 280 GO:0003824
GO:0044281

Feature Viewer

pLDDT pTM Quality
95.2 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map