F482143

General Info

Members Datasets Scaffolds Average Seq Length
818 378 755 335

Family's Representative Sequence

Representative Sequence 3300049513|Ga0501290_001810|Ga0501290_001810_474_1520
Length 328
Sequence MSTPAEKSIPLTVVADTPAPGMLQVAGDKIARSPVQFADAPVLRKPSWIRVRIPSGNAVQNLKAKLRENRLVTVCEEASCPNIHECFSHGTATFMILGEVCTRRCSFCDVAHGRPKPPDPSEPLSLARTIADMRLKYVVITSVDDLRDGGASHFVDCIAAIREFSPRTKIEILTPDFRGKGRMERALEILATNPPDVFNHNLETVPDLYRNVRPGADYQWSLTLLQKFKAQHPDVATKSGIMLGLGETMEQVELTLRDLRAHDVDMVTIGQYLQPSPHHHPVMRYWTPDEFKALEDYGMALGFTHVASGPMVRSSYHADKQAADAGFA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
3 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
4 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
5 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
6 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
7 2643221559 Lysobacter sp. Root559 Isolate Unclassified
8 2643221573 Lysobacter sp. Root604 Isolate Unclassified
9 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
10 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
11 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
12 2643221586 Lysobacter sp. Root667 Isolate Unclassified
13 2643221593 Lysobacter sp. Root690 Isolate Unclassified
14 2643221612 Lysobacter sp. Root76 Isolate Unclassified
15 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
16 2643221695 Lysobacter sp. Root494 Isolate Unclassified
17 2643221720 Lysobacter sp. Root916 Isolate Unclassified
18 2643221727 Lysobacter sp. Root96 Isolate Unclassified
19 2643221728 Lysobacter sp. Root983 Isolate Unclassified
20 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
21 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
22 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
23 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
24 2818991457 Xanthomonas translucens 569 Isolate Unclassified
25 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
26 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
27 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
28 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
29 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
30 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
31 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
32 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
33 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
34 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
35 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
36 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
37 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
38 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
39 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
40 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
41 2919513703 Luteimonas sp. 3794 Isolate Unclassified
42 2919675420 Luteimonas terrae 4099 Isolate Unclassified
43 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
44 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
45 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
46 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
47 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
48 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
49 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
50 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
51 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
52 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
53 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
54 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
55 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
56 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
57 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
58 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
59 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
60 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
61 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
62 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
63 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
64 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
65 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
66 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
67 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
68 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
69 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
70 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
71 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
72 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
73 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
74 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
75 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
76 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
77 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
78 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
79 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
80 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
81 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
82 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
83 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
84 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
85 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
86 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
87 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
88 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
89 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
90 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
91 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
92 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
93 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
94 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
95 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
96 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
97 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
98 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
99 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
100 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
101 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
102 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
103 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
104 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
105 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
106 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
107 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
108 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
109 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
110 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
111 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
112 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
113 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
114 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
115 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
116 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
117 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
118 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
119 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
120 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
121 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
122 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
123 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
124 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
125 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
126 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
127 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
128 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
129 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
130 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
131 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
132 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
133 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
134 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
135 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
136 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
137 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
138 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
139 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
140 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
141 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
142 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
143 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
144 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
145 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
146 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
147 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
148 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
149 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
150 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
151 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
152 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
153 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
154 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
155 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
156 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
157 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
158 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
159 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
160 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
161 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
162 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
163 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
164 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
165 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
166 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
167 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
168 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
169 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
170 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
171 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
172 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
173 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
175 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
176 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
177 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
179 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
229 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
233 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
234 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
235 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
236 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
237 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
238 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
239 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
240 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
241 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
242 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
243 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
244 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
245 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
246 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
247 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
248 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
249 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
250 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
251 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
252 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
253 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
254 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
255 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
256 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
257 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
258 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
259 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
260 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
261 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
262 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
263 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
264 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
265 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
266 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
267 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
268 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
269 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
270 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
271 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
272 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
273 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
274 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
275 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
276 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
277 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
278 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
279 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
280 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
281 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
282 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
283 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
284 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
285 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
286 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
287 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
288 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
289 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
290 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
291 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
292 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
293 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
294 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
295 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
296 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
297 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
298 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
299 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
300 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
301 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
302 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
303 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
304 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
305 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
306 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
307 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
308 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
309 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
310 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
311 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
312 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
313 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
314 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
315 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
316 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
317 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
318 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
319 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
320 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
321 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
322 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
323 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
324 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
325 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
326 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
327 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
328 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
329 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
330 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
331 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
332 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
347 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
348 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
349 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
350 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
351 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
352 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
353 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
354 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
355 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
356 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
357 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
358 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
359 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
360 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
361 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
364 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
365 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
366 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
367 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
368 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
369 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
370 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
371 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
372 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
373 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
374 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
375 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
376 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
377 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
378 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.18
Metatranscriptomes 0.12
Isolates 7.7

Biome Distribution

Category Percentage (%)
Aerial Root 0.12
Bulb 0
Endosphere 11.98
Nodule 0.12
Rhizoplane 1.1
Rhizosphere 74.57
Stem 0
Stem Tuber 0
Unclassified 12.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1097717 2162886007 Bacteria 5538
2 JGI24736J21556_1013961 3300001904 Bacteria 1294
3 JGI25152J39213_1000103 3300002773 Bacteria 59472
4 JGI25150J39212_1000183 3300002774 Bacteria 35389
5 JGI25151J46595_10000102 3300003187 Bacteria 114881
6 JGI25151J46595_10000271 3300003187 Bacteria 59472
7 JGI25151J46595_10003508 3300003187 Bacteria 8641
8 JGI25153J46596_10000190 3300003215 Bacteria 59472
9 Ga0055526_1000014 3300003771 Bacteria 233327
10 Ga0055526_1006479 3300003771 Bacteria 6343
11 Ga0055526_1017503 3300003771 Bacteria 2732
12 Ga0055537_1000059 3300003773 Bacteria 79628
13 Ga0055537_1001365 3300003773 Bacteria 9847
14 Ga0055524_1000019 3300003775 Bacteria 233561
15 Ga0055524_1036000 3300003775 Bacteria 1339
16 Ga0055524_1036005 3300003775 Bacteria 1339
17 Ga0055536_1000773 3300003781 Bacteria 21299
18 Ga0055536_1010813 3300003781 Bacteria 3573
19 Ga0055536_1016739 3300003781 Bacteria 2437
20 Ga0055536_1028308 3300003781 Bacteria 1529
21 Ga0055534_1000012 3300003784 Bacteria 153530
22 Ga0055534_1000112 3300003784 Bacteria 59920
23 Ga0055528_1000007 3300003790 Bacteria 233327
24 Ga0055528_1001337 3300003790 Bacteria 15339
25 Ga0055530_10001674 3300003791 Bacteria 15731
26 Ga0055530_10002094 3300003791 Bacteria 13328
27 Ga0055530_10008584 3300003791 Bacteria 4064
28 Ga0055540_1034558 3300003792 Bacteria 1137
29 Ga0055531_10013881 3300003794 Bacteria 3678
30 Ga0055531_10015740 3300003794 Bacteria 3310
31 Ga0055531_10018425 3300003794 Bacteria 2881
32 Ga0055531_10035979 3300003794 Bacteria 1538
33 Ga0055531_10041479 3300003794 Bacteria 1332
34 Ga0058692_1000053 3300003856 Bacteria 107166
35 Ga0058692_1000065 3300003856 Bacteria 89723
36 Ga0065714_10017440 3300005288 Bacteria 3114
37 Ga0065704_10070850 3300005289 Bacteria 15417
38 Ga0065704_10072499 3300005289 Bacteria 8420
39 Ga0065715_10001991 3300005293 Bacteria 6051
40 Ga0065715_10008446 3300005293 Bacteria 3910
41 Ga0070658_10007622 3300005327 Bacteria 8729
42 Ga0070658_10061938 3300005327 Bacteria 3049
43 Ga0070683_100207011 3300005329 Bacteria 1863
44 Ga0070670_100001962 3300005331 Bacteria 16837
45 Ga0070670_100147541 3300005331 Bacteria 2035
46 Ga0070670_100197263 3300005331 Bacteria 1749
47 Ga0068869_100079398 3300005334 Bacteria 2446
48 Ga0068869_100355130 3300005334 Bacteria 1196
49 Ga0070666_10000022 3300005335 Bacteria 166910
50 Ga0070666_10000442 3300005335 Bacteria 25310
51 Ga0070666_10086043 3300005335 Bacteria 2153
52 Ga0070666_10118619 3300005335 Bacteria 1834
53 Ga0070666_10260359 3300005335 Bacteria 1230
54 Ga0070682_100000806 3300005337 Bacteria 18399
55 Ga0070682_100053517 3300005337 Bacteria 2530
56 Ga0070682_100088428 3300005337 Bacteria 2022
57 Ga0068868_100006535 3300005338 Bacteria 8257
58 Ga0068868_100128293 3300005338 Bacteria 2073
59 Ga0070661_100009383 3300005344 Bacteria 6771
60 Ga0070661_100015590 3300005344 Bacteria 5364
61 Ga0070661_100124692 3300005344 Bacteria 1931
62 Ga0070668_100004046 3300005347 Bacteria 10853
63 Ga0070668_100156977 3300005347 Bacteria 1844
64 Ga0070669_100039609 3300005353 Bacteria 3425
65 Ga0070669_100180249 3300005353 Bacteria 1652
66 Ga0070675_100387590 3300005354 Bacteria 1245
67 Ga0070671_100045193 3300005355 Bacteria 3661
68 Ga0070671_100069039 3300005355 Bacteria 2947
69 Ga0070671_100082960 3300005355 Bacteria 2680
70 Ga0070674_100082237 3300005356 Bacteria 2303
71 Ga0070673_100111799 3300005364 Bacteria 2267
72 Ga0070659_100011336 3300005366 Bacteria 6591
73 Ga0070659_100018023 3300005366 Bacteria 5324
74 Ga0070659_100067261 3300005366 Bacteria 2841
75 Ga0070667_100000049 3300005367 Bacteria 158483
76 Ga0070667_100005400 3300005367 Bacteria 10674
77 Ga0070667_100022905 3300005367 Bacteria 5179
78 Ga0070667_100023232 3300005367 Bacteria 5144
79 Ga0070667_100041398 3300005367 Bacteria 3865
80 Ga0070667_100050689 3300005367 Bacteria 3499
81 Ga0070667_100081048 3300005367 Bacteria 2777
82 Ga0070667_100082066 3300005367 Bacteria 2759
83 Ga0070667_100139793 3300005367 Bacteria 2120
84 Ga0070667_100155273 3300005367 Bacteria 2012
85 Ga0070667_100447199 3300005367 Bacteria 1180
86 Ga0070705_100173054 3300005440 Bacteria 1455
87 Ga0070663_100000042 3300005455 Bacteria 57899
88 Ga0070663_100006318 3300005455 Bacteria 7114
89 Ga0070663_100105609 3300005455 Bacteria 2108
90 Ga0070663_100319566 3300005455 Bacteria 1248
91 Ga0070678_100108757 3300005456 Bacteria 2165
92 Ga0070662_100001452 3300005457 Bacteria 14621
93 Ga0070681_10009167 3300005458 Bacteria 9724
94 Ga0070681_10013412 3300005458 Bacteria 8141
95 Ga0068867_100032307 3300005459 Bacteria 3785
96 Ga0068867_100090251 3300005459 Bacteria 2324
97 Ga0068867_100140107 3300005459 Bacteria 1890
98 Ga0070685_10007386 3300005466 Bacteria 5621
99 Ga0070679_100175899 3300005530 Bacteria 2113
100 Ga0070684_100024537 3300005535 Bacteria 5060
101 Ga0070684_100048363 3300005535 Bacteria 3690
102 Ga0068853_100000720 3300005539 Bacteria 22869
103 Ga0068853_100004195 3300005539 Bacteria 11116
104 Ga0068853_100007213 3300005539 Bacteria 8902
105 Ga0068853_100011114 3300005539 Bacteria 7303
106 Ga0068853_100028892 3300005539 Bacteria 4668
107 Ga0068853_100033305 3300005539 Bacteria 4371
108 Ga0068853_100148770 3300005539 Bacteria 2106
109 Ga0068853_100294941 3300005539 Bacteria 1497
110 Ga0070672_100003657 3300005543 Bacteria 9989
111 Ga0070672_100004334 3300005543 Bacteria 9283
112 Ga0070693_100005405 3300005547 Bacteria 6129
113 Ga0070693_100012299 3300005547 Bacteria 4328
114 Ga0070665_100000028 3300005548 Bacteria 351357
115 Ga0070665_100000394 3300005548 Bacteria 64434
116 Ga0070665_100008261 3300005548 Bacteria 10529
117 Ga0070665_100010878 3300005548 Bacteria 9204
118 Ga0070665_100027661 3300005548 Bacteria 5710
119 Ga0070665_100050597 3300005548 Bacteria 4169
120 Ga0070665_100067472 3300005548 Bacteria 3587
121 Ga0070665_100159083 3300005548 Bacteria 2260
122 Ga0070665_100168154 3300005548 Bacteria 2194
123 Ga0068855_100005951 3300005563 Bacteria 14870
124 Ga0068855_100105650 3300005563 Bacteria 3237
125 Ga0068855_100268834 3300005563 Bacteria 1896
126 Ga0068855_100497865 3300005563 Bacteria 1324
127 Ga0068857_100053558 3300005577 Bacteria 3579
128 Ga0068857_100168752 3300005577 Bacteria 1988
129 Ga0068854_100080020 3300005578 Bacteria 2411
130 Ga0068854_100128325 3300005578 Bacteria 1934
131 Ga0068856_100007098 3300005614 Bacteria 10939
132 Ga0068856_100229373 3300005614 Bacteria 1872
133 Ga0068852_100005973 3300005616 Bacteria 8769
134 Ga0068852_100014146 3300005616 Bacteria 6129
135 Ga0068852_100029267 3300005616 Bacteria 4522
136 Ga0068852_100055732 3300005616 Bacteria 3413
137 Ga0068859_100000280 3300005617 Bacteria 50848
138 Ga0068859_100308584 3300005617 Bacteria 1676
139 Ga0068859_100343091 3300005617 Bacteria 1588
140 Ga0068864_100020044 3300005618 Bacteria 5592
141 Ga0068866_10129171 3300005718 Bacteria 1435
142 Ga0068861_100061050 3300005719 Bacteria 2892
143 Ga0068851_10000308 3300005834 Bacteria 22240
144 Ga0068851_10032986 3300005834 Bacteria 2578
145 Ga0068851_10087320 3300005834 Bacteria 1637
146 Ga0068863_100018882 3300005841 Bacteria 6597
147 Ga0068863_100024540 3300005841 Bacteria 5751
148 Ga0068863_100066084 3300005841 Bacteria 3421
149 Ga0068863_100077761 3300005841 Bacteria 3140
150 Ga0068858_100008594 3300005842 Bacteria 9807
151 Ga0068858_100160243 3300005842 Bacteria 2118
152 Ga0068860_100002386 3300005843 Bacteria 19708
153 Ga0068860_100107390 3300005843 Bacteria 2667
154 Ga0068860_100124956 3300005843 Bacteria 2466
155 Ga0068862_100000215 3300005844 Bacteria 64251
156 Ga0068862_100099430 3300005844 Bacteria 2543
157 Ga0081540_1008082 3300005983 Bacteria 7391
158 Ga0081539_10008186 3300005985 Bacteria 9212
159 Ga0075365_10216007 3300006038 Bacteria 1345
160 Ga0075364_10002739 3300006051 Bacteria 9901
161 Ga0075367_10028635 3300006178 Bacteria 3179
162 Ga0075369_10020023 3300006186 Bacteria 2738
163 Ga0097621_100012950 3300006237 Bacteria 6197
164 Ga0097621_100083770 3300006237 Bacteria 2657
165 Ga0097621_100164034 3300006237 Bacteria 1912
166 Ga0097621_100326759 3300006237 Bacteria 1359
167 Ga0068871_100039983 3300006358 Bacteria 3755
168 Ga0068871_100190334 3300006358 Bacteria 1767
169 Ga0068865_100001586 3300006881 Bacteria 13298
170 Ga0068865_100027085 3300006881 Bacteria 3784
171 Ga0068865_100053746 3300006881 Bacteria 2795
172 Ga0097620_100000280 3300006931 Bacteria 50848
173 Ga0097620_100308555 3300006931 Bacteria 1676
174 Ga0097620_100343093 3300006931 Bacteria 1588
175 Ga0105251_10000205 3300009011 Bacteria 59437
176 Ga0105251_10002055 3300009011 Bacteria 16280
177 Ga0105244_10021621 3300009036 Bacteria 3556
178 Ga0105244_10106462 3300009036 Bacteria 1368
179 Ga0105240_10001002 3300009093 Bacteria 50418
180 Ga0105240_10004247 3300009093 Bacteria 21906
181 Ga0105240_10152371 3300009093 Bacteria 2752
182 Ga0105240_10424643 3300009093 Bacteria 1493
183 Ga0105240_10489488 3300009093 Bacteria 1370
184 Ga0105245_10083715 3300009098 Bacteria 2920
185 Ga0105245_10165864 3300009098 Bacteria 2100
186 Ga0105243_10002435 3300009148 Bacteria 15549
187 Ga0105243_10013395 3300009148 Bacteria 6201
188 Ga0105241_10055846 3300009174 Bacteria 3026
189 Ga0105241_10122713 3300009174 Bacteria 2094
190 Ga0105242_10079196 3300009176 Bacteria 2744
191 Ga0105248_10000120 3300009177 Bacteria 89960
192 Ga0105248_10117468 3300009177 Bacteria 3000
193 Ga0105237_10010356 3300009545 Bacteria 9929
194 Ga0105237_10011173 3300009545 Bacteria 9517
195 Ga0105237_10035094 3300009545 Bacteria 5076
196 Ga0105237_10053179 3300009545 Bacteria 4062
197 Ga0105237_10118736 3300009545 Bacteria 2638
198 Ga0105237_10298437 3300009545 Bacteria 1614
199 Ga0105237_10388462 3300009545 Bacteria 1400
200 Ga0105238_10000175 3300009551 Bacteria 69973
201 Ga0105238_10006626 3300009551 Bacteria 11543
202 Ga0105238_10009039 3300009551 Bacteria 9969
203 Ga0105238_10011923 3300009551 Bacteria 8758
204 Ga0105238_10030434 3300009551 Bacteria 5495
205 Ga0105238_10030657 3300009551 Bacteria 5474
206 Ga0105238_10041838 3300009551 Bacteria 4641
207 Ga0105249_10000898 3300009553 Bacteria 26273
208 Ga0105249_10001097 3300009553 Bacteria 24066
209 Ga0105249_10173073 3300009553 Bacteria 2095
210 Ga0105249_10355553 3300009553 Bacteria 1485
211 Ga0105032_100317 3300009979 Bacteria 4937
212 Ga0105239_10005391 3300010375 Bacteria 15027
213 Ga0105239_10010309 3300010375 Bacteria 10466
214 Ga0105239_10107680 3300010375 Bacteria 3088
215 Ga0105239_10331311 3300010375 Bacteria 1717
216 Ga0105239_10472879 3300010375 Bacteria 1423
217 Ga0105246_10020817 3300011119 Bacteria 4212
218 Ga0105246_10064583 3300011119 Bacteria 2558
219 Ga0157373_10009800 3300013100 Bacteria 7067
220 Ga0157373_10012798 3300013100 Bacteria 6163
221 Ga0157373_10042694 3300013100 Bacteria 3240
222 Ga0157373_10087870 3300013100 Bacteria 2190
223 Ga0157371_10000397 3300013102 Bacteria 54547
224 Ga0157371_10010395 3300013102 Bacteria 7255
225 Ga0157371_10053932 3300013102 Bacteria 2855
226 Ga0157370_10000918 3300013104 Bacteria 37372
227 Ga0157370_10001260 3300013104 Bacteria 31632
228 Ga0157370_10044732 3300013104 Bacteria 4252
229 Ga0157370_10131797 3300013104 Bacteria 2331
230 Ga0157369_10002250 3300013105 Bacteria 23203
231 Ga0157369_10004413 3300013105 Bacteria 16604
232 Ga0157369_10169167 3300013105 Bacteria 2303
233 Ga0157369_10263395 3300013105 Bacteria 1797
234 Ga0157369_10273993 3300013105 Bacteria 1758
235 Ga0157378_10254634 3300013297 Bacteria 1682
236 Ga0163162_10018817 3300013306 Bacteria 6771
237 Ga0163162_10028377 3300013306 Bacteria 5537
238 Ga0163162_10151246 3300013306 Bacteria 2439
239 Ga0163162_10280900 3300013306 Bacteria 1797
240 Ga0157372_10000344 3300013307 Bacteria 51217
241 Ga0157372_10028390 3300013307 Bacteria 6105
242 Ga0157372_10051825 3300013307 Bacteria 4568
243 Ga0157372_10057810 3300013307 Bacteria 4336
244 Ga0157375_10004149 3300013308 Bacteria 12573
245 Ga0157375_10019950 3300013308 Bacteria 6112
246 Ga0163163_10000029 3300014325 Bacteria 174973
247 Ga0163163_10000564 3300014325 Bacteria 32582
248 Ga0163163_10286193 3300014325 Bacteria 1700
249 Ga0182008_10000076 3300014497 Bacteria 77484
250 Ga0182008_10008822 3300014497 Bacteria 5474
251 Ga0182008_10020566 3300014497 Bacteria 3397
252 Ga0182008_10126418 3300014497 Bacteria 1273
253 Ga0157379_10001942 3300014968 Bacteria 17106
254 Ga0157379_10153983 3300014968 Bacteria 2073
255 Ga0157379_10220782 3300014968 Bacteria 1717
256 Ga0157376_10005280 3300014969 Bacteria 9025
257 Ga0157376_10007306 3300014969 Bacteria 7869
258 Ga0157376_10063340 3300014969 Bacteria 3114
259 Ga0182006_1004720 3300015261 Bacteria 6662
260 Ga0182007_10000079 3300015262 Bacteria 73543
261 Ga0182005_1000166 3300015265 Bacteria 45594
262 Ga0182005_1002582 3300015265 Bacteria 6416
263 Ga0183360_10002 3300015689 Bacteria 953821
264 Ga0163161_10002679 3300017792 Bacteria 12658
265 Ga0163161_10013517 3300017792 Bacteria 5684
266 Ga0163161_10021626 3300017792 Bacteria 4521
267 Ga0206349_1121353 3300020075 Bacteria 4561
268 Ga0207427_100349 3300025231 Bacteria 29540
269 Ga0209437_100886 3300025233 Bacteria 12095
270 Ga0207425_1000148 3300025245 Bacteria 59862
271 Ga0207425_1017410 3300025245 Bacteria 1579
272 Ga0209129_1000239 3300025258 Bacteria 59863
273 Ga0209129_1001622 3300025258 Bacteria 12193
274 Ga0209233_1000715 3300025261 Bacteria 15448
275 Ga0209233_1000998 3300025261 Bacteria 12103
276 Ga0209565_1000001 3300025263 Bacteria 2950419
277 Ga0209565_1000060 3300025263 Bacteria 188543
278 Ga0209565_1004771 3300025263 Bacteria 4064
279 Ga0209673_1000001 3300025273 Bacteria 3176258
280 Ga0209673_1000047 3300025273 Bacteria 289276
281 Ga0209673_1004700 3300025273 Bacteria 7194
282 Ga0209130_1002163 3300025284 Bacteria 10367
283 Ga0209675_1000001 3300025291 Bacteria 2950293
284 Ga0209675_1000007 3300025291 Bacteria 683430
285 Ga0209676_1000018 3300025292 Bacteria 631385
286 Ga0209676_1000360 3300025292 Bacteria 86307
287 Ga0209676_1000411 3300025292 Bacteria 77084
288 Ga0209676_1001983 3300025292 Bacteria 16281
289 Ga0209676_1003671 3300025292 Bacteria 9197
290 Ga0209676_1010297 3300025292 Bacteria 3918
291 Ga0209025_1000006 3300025294 Bacteria 1153444
292 Ga0209025_1000048 3300025294 Bacteria 335574
293 Ga0209025_1002898 3300025294 Bacteria 17124
294 Ga0209025_1011601 3300025294 Bacteria 5781
295 Ga0209564_1000001 3300025295 Bacteria 3176258
296 Ga0209564_1000252 3300025295 Bacteria 114416
297 Ga0209564_1008800 3300025295 Bacteria 4919
298 Ga0209758_1000056 3300025297 Bacteria 335574
299 Ga0209758_1006577 3300025297 Bacteria 8257
300 Ga0209758_1009524 3300025297 Bacteria 6014
301 Ga0209050_1000146 3300025298 Bacteria 166930
302 Ga0209050_1000592 3300025298 Bacteria 57827
303 Ga0209050_1003938 3300025298 Bacteria 10501
304 Ga0209256_1000006 3300025299 Bacteria 1250310
305 Ga0209256_1005338 3300025299 Bacteria 7467
306 Ga0209256_1005932 3300025299 Bacteria 6743
307 Ga0209256_1010244 3300025299 Bacteria 3956
308 Ga0209256_1013376 3300025299 Bacteria 3047
309 Ga0209256_1013442 3300025299 Bacteria 3036
310 Ga0209051_1003638 3300025303 Bacteria 9986
311 Ga0209257_1000035 3300025304 Bacteria 631463
312 Ga0209257_1000078 3300025304 Bacteria 317483
313 Ga0209257_1000414 3300025304 Bacteria 82489
314 Ga0209257_1000642 3300025304 Bacteria 55895
315 Ga0209257_1001448 3300025304 Bacteria 28059
316 Ga0209257_1003369 3300025304 Bacteria 13803
317 Ga0209257_1006510 3300025304 Bacteria 7479
318 Ga0209257_1010878 3300025304 Bacteria 4500
319 Ga0209257_1013090 3300025304 Bacteria 3738
320 Ga0207656_10000283 3300025321 Bacteria 17451
321 Ga0207656_10054810 3300025321 Bacteria 1734
322 Ga0207713_1000196 3300025735 Bacteria 84000
323 Ga0207713_1002516 3300025735 Bacteria 13272
324 Ga0207680_10000001 3300025903 Bacteria 1091453
325 Ga0207680_10000529 3300025903 Bacteria 18152
326 Ga0207680_10011565 3300025903 Bacteria 4464
327 Ga0207647_10001336 3300025904 Bacteria 18958
328 Ga0207647_10001796 3300025904 Bacteria 16435
329 Ga0207705_10001049 3300025909 Bacteria 22456
330 Ga0207705_10096042 3300025909 Bacteria 2176
331 Ga0207654_10000458 3300025911 Bacteria 23295
332 Ga0207654_10031499 3300025911 Bacteria 2922
333 Ga0207654_10063425 3300025911 Bacteria 2169
334 Ga0207654_10071741 3300025911 Bacteria 2060
335 Ga0207707_10000578 3300025912 Bacteria 37213
336 Ga0207707_10045794 3300025912 Bacteria 3811
337 Ga0207707_10242082 3300025912 Bacteria 1568
338 Ga0207695_10000040 3300025913 Bacteria 452787
339 Ga0207695_10000772 3300025913 Bacteria 60706
340 Ga0207695_10006223 3300025913 Bacteria 15542
341 Ga0207695_10015003 3300025913 Bacteria 9141
342 Ga0207695_10042105 3300025913 Bacteria 4883
343 Ga0207695_10048332 3300025913 Bacteria 4494
344 Ga0207671_10007551 3300025914 Bacteria 9414
345 Ga0207671_10009290 3300025914 Bacteria 8235
346 Ga0207671_10011332 3300025914 Bacteria 7263
347 Ga0207671_10030679 3300025914 Bacteria 4008
348 Ga0207671_10043030 3300025914 Bacteria 3341
349 Ga0207671_10071007 3300025914 Bacteria 2597
350 Ga0207671_10171438 3300025914 Bacteria 1685
351 Ga0207663_10175468 3300025916 Bacteria 1526
352 Ga0207657_10002547 3300025919 Bacteria 19710
353 Ga0207657_10170713 3300025919 Bacteria 1762
354 Ga0207657_10366742 3300025919 Bacteria 1135
355 Ga0207649_10004292 3300025920 Bacteria 7757
356 Ga0207649_10012167 3300025920 Bacteria 4764
357 Ga0207652_10150244 3300025921 Bacteria 2085
358 Ga0207681_10046931 3300025923 Bacteria 2907
359 Ga0207681_10273924 3300025923 Bacteria 1326
360 Ga0207694_10000257 3300025924 Bacteria 50545
361 Ga0207694_10001852 3300025924 Bacteria 17610
362 Ga0207694_10003883 3300025924 Bacteria 11817
363 Ga0207694_10006803 3300025924 Bacteria 8679
364 Ga0207694_10024311 3300025924 Bacteria 4599
365 Ga0207694_10056309 3300025924 Bacteria 3053
366 Ga0207694_10143318 3300025924 Bacteria 1922
367 Ga0207650_10001926 3300025925 Bacteria 14613
368 Ga0207650_10104287 3300025925 Bacteria 2187
369 Ga0207650_10112978 3300025925 Bacteria 2105
370 Ga0207650_10168174 3300025925 Bacteria 1741
371 Ga0207644_10017204 3300025931 Bacteria 4877
372 Ga0207644_10166932 3300025931 Bacteria 1715
373 Ga0207690_10019109 3300025932 Bacteria 4211
374 Ga0207690_10042976 3300025932 Bacteria 2972
375 Ga0207690_10191206 3300025932 Bacteria 1548
376 Ga0207706_10000876 3300025933 Bacteria 30901
377 Ga0207706_10028883 3300025933 Bacteria 4950
378 Ga0207709_10000527 3300025935 Bacteria 33281
379 Ga0207709_10002230 3300025935 Bacteria 12353
380 Ga0207669_10014325 3300025937 Bacteria 3971
381 Ga0207704_10053643 3300025938 Bacteria 2452
382 Ga0207704_10082336 3300025938 Bacteria 2085
383 Ga0207691_10007233 3300025940 Bacteria 10709
384 Ga0207691_10007375 3300025940 Bacteria 10597
385 Ga0207691_10009099 3300025940 Bacteria 9532
386 Ga0207711_10010606 3300025941 Bacteria 7662
387 Ga0207711_10149769 3300025941 Bacteria 2105
388 Ga0207689_10017785 3300025942 Bacteria 6007
389 Ga0207689_10034224 3300025942 Bacteria 4219
390 Ga0207689_10080295 3300025942 Bacteria 2681
391 Ga0207689_10093372 3300025942 Bacteria 2472
392 Ga0207689_10130781 3300025942 Bacteria 2066
393 Ga0207689_10217979 3300025942 Bacteria 1577
394 Ga0207661_10071965 3300025944 Bacteria 2828
395 Ga0207661_10113455 3300025944 Bacteria 2296
396 Ga0207679_10026576 3300025945 Bacteria 3993
397 Ga0207667_10012090 3300025949 Bacteria 9979
398 Ga0207667_10019912 3300025949 Bacteria 7477
399 Ga0207667_10038594 3300025949 Bacteria 5098
400 Ga0207667_10049542 3300025949 Bacteria 4436
401 Ga0207667_10164835 3300025949 Bacteria 2278
402 Ga0207667_10258218 3300025949 Bacteria 1782
403 Ga0207667_10264415 3300025949 Bacteria 1759
404 Ga0207667_10287852 3300025949 Bacteria 1679
405 Ga0207651_10097067 3300025960 Bacteria 2175
406 Ga0207651_10321806 3300025960 Bacteria 1293
407 Ga0207712_10000120 3300025961 Bacteria 84214
408 Ga0207712_10000305 3300025961 Bacteria 45213
409 Ga0207712_10024220 3300025961 Bacteria 4017
410 Ga0207712_10279439 3300025961 Bacteria 1362
411 Ga0207668_10019101 3300025972 Bacteria 4326
412 Ga0207668_10056198 3300025972 Bacteria 2740
413 Ga0207668_10130946 3300025972 Bacteria 1915
414 Ga0207640_10019306 3300025981 Bacteria 4025
415 Ga0207658_10000033 3300025986 Bacteria 158540
416 Ga0207658_10004845 3300025986 Bacteria 9300
417 Ga0207658_10009244 3300025986 Bacteria 6684
418 Ga0207658_10090619 3300025986 Bacteria 2370
419 Ga0207658_10124864 3300025986 Bacteria 2058
420 Ga0207658_10253279 3300025986 Bacteria 1497
421 Ga0207658_10262455 3300025986 Bacteria 1472
422 Ga0207677_10008057 3300026023 Bacteria 5868
423 Ga0207677_10095502 3300026023 Bacteria 2173
424 Ga0207703_10028041 3300026035 Bacteria 4435
425 Ga0207703_10109403 3300026035 Bacteria 2356
426 Ga0207703_10116118 3300026035 Bacteria 2291
427 Ga0207703_10235448 3300026035 Bacteria 1643
428 Ga0207703_10326770 3300026035 Bacteria 1406
429 Ga0207639_10000236 3300026041 Bacteria 41381
430 Ga0207639_10000437 3300026041 Bacteria 28831
431 Ga0207639_10000514 3300026041 Bacteria 26656
432 Ga0207639_10003146 3300026041 Bacteria 11096
433 Ga0207639_10019356 3300026041 Bacteria 4854
434 Ga0207639_10057841 3300026041 Bacteria 2980
435 Ga0207639_10119482 3300026041 Bacteria 2163
436 Ga0207639_10140881 3300026041 Bacteria 2009
437 Ga0207639_10191740 3300026041 Bacteria 1746
438 Ga0207639_10230228 3300026041 Bacteria 1606
439 Ga0207678_10012827 3300026067 Bacteria 7357
440 Ga0207678_10171560 3300026067 Bacteria 1852
441 Ga0207678_10175178 3300026067 Bacteria 1831
442 Ga0207702_10003377 3300026078 Bacteria 14632
443 Ga0207702_10027084 3300026078 Bacteria 4759
444 Ga0207702_10027877 3300026078 Bacteria 4692
445 Ga0207641_10042543 3300026088 Bacteria 3811
446 Ga0207641_10045468 3300026088 Bacteria 3697
447 Ga0207641_10060657 3300026088 Bacteria 3224
448 Ga0207641_10165970 3300026088 Bacteria 2011
449 Ga0207641_10214292 3300026088 Bacteria 1782
450 Ga0207648_10038304 3300026089 Bacteria 4220
451 Ga0207648_10071014 3300026089 Bacteria 3035
452 Ga0207676_10005524 3300026095 Bacteria 8947
453 Ga0207674_10008389 3300026116 Bacteria 11948
454 Ga0207674_10059733 3300026116 Bacteria 3857
455 Ga0207674_10135861 3300026116 Bacteria 2421
456 Ga0207675_100070634 3300026118 Bacteria 3264
457 Ga0207698_10041061 3300026142 Bacteria 3444
458 Ga0207698_10142520 3300026142 Bacteria 2067
459 Ga0207698_10223440 3300026142 Bacteria 1704
460 Ga0209371_1000018 3300027312 Bacteria 614700
461 Ga0209371_1000025 3300027312 Bacteria 450640
462 Ga0209983_1001045 3300027665 Bacteria 6100
463 Ga0209971_1006224 3300027682 Bacteria 2826
464 Ga0209974_10004142 3300027876 Bacteria 5181
465 Ga0268266_10000007 3300028379 Bacteria 1372921
466 Ga0268266_10000017 3300028379 Bacteria 607272
467 Ga0268266_10000091 3300028379 Bacteria 195002
468 Ga0268266_10042299 3300028379 Bacteria 3891
469 Ga0268266_10080274 3300028379 Bacteria 2842
470 Ga0268266_10196408 3300028379 Bacteria 1845
471 Ga0268265_10000376 3300028380 Bacteria 48178
472 Ga0268264_10096469 3300028381 Bacteria 2561
473 Ga0268264_10153509 3300028381 Bacteria 2067
474 Ga0307517_10113675 3300028786 Bacteria 2042
475 Ga0307515_10125655 3300028794 Bacteria 2868
476 Ga0268256_1000016 3300030500 Bacteria 614700
477 Ga0268256_1000027 3300030500 Bacteria 450640
478 Ga0316177_1045917 3300030731 Bacteria 6532
479 Ga0314311_1009359 3300030733 Bacteria 5847
480 Ga0316181_1160836 3300030744 Bacteria 1305
481 Ga0316182_1299775 3300030745 Bacteria 2931
482 Ga0307513_10006814 3300031456 Bacteria 14893
483 Ga0307408_100193051 3300031548 Bacteria 1642
484 Ga0307508_10027818 3300031616 Bacteria 5116
485 Ga0316575_10014957 3300031665 Bacteria 2921
486 Ga0316575_10079546 3300031665 Bacteria 1322
487 Ga0316579_10002710 3300031691 Bacteria 6743
488 Ga0316576_10006785 3300031727 Bacteria 7154
489 Ga0316576_10060931 3300031727 Bacteria 2765
490 Ga0316576_10182135 3300031727 Bacteria 1584
491 Ga0316578_10046275 3300031728 Bacteria 2535
492 Ga0307516_10068264 3300031730 Bacteria 3424
493 Ga0307516_10101976 3300031730 Bacteria 2685
494 Ga0307516_10176328 3300031730 Bacteria 1874
495 Ga0316577_10019739 3300031733 Bacteria 3733
496 Ga0316577_10056979 3300031733 Bacteria 2182
497 Ga0316577_10064644 3300031733 Bacteria 2042
498 Ga0307413_10021709 3300031824 Bacteria 3443
499 Ga0307413_10226927 3300031824 Bacteria 1368
500 Ga0307406_10003433 3300031901 Bacteria 8623
501 Ga0307407_10141410 3300031903 Bacteria 1553
502 Ga0307412_10103765 3300031911 Bacteria 2016
503 Ga0307412_10164312 3300031911 Bacteria 1653
504 Ga0307416_100024526 3300032002 Bacteria 4405
505 Ga0307414_10000883 3300032004 Bacteria 15349
506 Ga0307414_10000928 3300032004 Bacteria 15008
507 Ga0307414_10002330 3300032004 Bacteria 9920
508 Ga0307414_10003632 3300032004 Bacteria 8265
509 Ga0307414_10035418 3300032004 Bacteria 3321
510 Ga0307414_10043563 3300032004 Bacteria 3058
511 Ga0307414_10102681 3300032004 Bacteria 2155
512 Ga0307414_10128603 3300032004 Bacteria 1962
513 Ga0307414_10146111 3300032004 Bacteria 1858
514 Ga0307414_10321320 3300032004 Bacteria 1317
515 Ga0307411_10327448 3300032005 Bacteria 1240
516 Ga0307411_10390328 3300032005 Bacteria 1147
517 Ga0307507_10191851 3300033179 Bacteria 1434
518 Ga0307507_10216035 3300033179 Bacteria 1298
519 Ga0307510_10006402 3300033180 Bacteria 14038
520 Ga0373957_0028125 3300035120 Bacteria 2047
521 Ga0316574_0008265 3300035398 Bacteria 5769
522 Ga0316574_0058217 3300035398 Bacteria 2420
523 Ga0316574_0066006 3300035398 Bacteria 2279
524 Ga0316574_0098537 3300035398 Bacteria 1869
525 Ga0373933_0179551 3300035724 Bacteria 1350
526 Ga0373937_0007519 3300036401 Bacteria 9431
527 Ga0373937_0519868 3300036401 Bacteria 1131
528 Ga0316584_0004592 3300036712 Bacteria 9152
529 Ga0316584_0189592 3300036712 Bacteria 1520
530 Ga0395900_0000163 3300037418 Bacteria 109199
531 Ga0395900_0078437 3300037418 Bacteria 3393
532 Ga0395900_0391702 3300037418 Bacteria 1355
533 Ga0395898_0137307 3300037466 Bacteria 2341
534 Ga0395905_0002925 3300037471 Bacteria 18608
535 Ga0395905_0115628 3300037471 Bacteria 2521
536 Ga0395901_0006253 3300038443 Bacteria 12068
537 Ga0237819_00598 3300038705 Bacteria 12061
538 Ga0237819_04072 3300038705 Bacteria 2466
539 Ga0237816_00007 3300039145 Bacteria 13042
540 Ga0439436_0000009 3300041404 Bacteria 108375
541 Ga0439436_0010843 3300041404 Bacteria 2776
542 Ga0439436_0032731 3300041404 Bacteria 1507
543 Ga0439447_000276 3300041407 Bacteria 18194
544 Ga0439465_0001199 3300041413 Bacteria 8345
545 Ga0439465_0002680 3300041413 Bacteria 5821
546 Ga0451793_0608164 3300041452 Bacteria 2909
547 Ga0451806_117351 3300041462 Bacteria 8065
548 Ga0451833_0665795 3300041491 Bacteria 1670
549 Ga0451837_0845588 3300041494 Bacteria 1483
550 Ga0451841_0688799 3300041498 Bacteria 1462
551 Ga0451843_0273968 3300041509 Bacteria 2245
552 Ga0451853_3774819 3300041512 Bacteria 1455
553 Ga0439445_0027556 3300042004 Bacteria 1460
554 Ga0439449_0000582 3300042007 Bacteria 13681
555 Ga0439449_0005572 3300042007 Bacteria 4820
556 Ga0439457_014730 3300042014 Bacteria 1748
557 Ga0439462_0022440 3300042015 Bacteria 1652
558 Ga0451577_0016708 3300042876 Bacteria 6787
559 Ga0466972_0001414 3300044658 Bacteria 11634
560 Ga0453684_0000531 3300044712 Bacteria 145390
561 Ga0466970_0001522 3300044765 Bacteria 11158
562 Ga0466959_0012881 3300045049 Bacteria 6053
563 Ga0451576_0000212 3300045051 Bacteria 145396
564 Ga0495638_0000526 3300046460 Bacteria 44654
565 Ga0495638_0052794 3300046460 Bacteria 2531
566 Ga0495650_0000469 3300046471 Bacteria 62135
567 Ga0495582_0009245 3300046473 Bacteria 5436
568 Ga0495607_0079949 3300046501 Bacteria 1799
569 Ga0495606_0005893 3300046507 Bacteria 11529
570 Ga0495606_0204894 3300046507 Bacteria 1122
571 Ga0495610_0002419 3300046512 Bacteria 15714
572 Ga0495631_0003548 3300046518 Bacteria 8529
573 Ga0495643_0010311 3300046522 Bacteria 5754
574 Ga0495663_0003392 3300046525 Bacteria 4604
575 Ga0495663_0007926 3300046525 Bacteria 2936
576 Ga0495663_0017245 3300046525 Bacteria 2047
577 Ga0495665_0054589 3300046531 Bacteria 2111
578 Ga0495587_0125298 3300046536 Bacteria 1470
579 Ga0495598_0004631 3300046537 Bacteria 2992
580 Ga0495621_0020577 3300046539 Bacteria 2167
581 Ga0495633_0053967 3300046558 Bacteria 1891
582 Ga0495656_0003859 3300046615 Bacteria 5098
583 Ga0495625_0007542 3300046660 Bacteria 9451
584 Ga0495625_0107781 3300046660 Bacteria 1906
585 Ga0495635_0085671 3300046663 Bacteria 2156
586 Ga0495659_0017398 3300046664 Bacteria 2382
587 Ga0495659_0042025 3300046664 Bacteria 1635
588 Ga0495658_0011054 3300046683 Bacteria 4529
589 Ga0495670_0006739 3300046691 Bacteria 5651
590 Ga0495649_0030572 3300046694 Bacteria 2974
591 Ga0495636_0004749 3300047318 Bacteria 5331
592 Ga0495636_0006456 3300047318 Bacteria 4607
593 Ga0495636_0030269 3300047318 Bacteria 2212
594 Ga0495672_0000087 3300047320 Bacteria 154275
595 Ga0495684_0078978 3300047471 Bacteria 2498
596 Ga0495686_0004214 3300047472 Bacteria 11939
597 Ga0495686_0038417 3300047472 Bacteria 3061
598 Ga0495686_0145793 3300047472 Bacteria 1393
599 Ga0495615_0003458 3300048090 Bacteria 2648
600 Ga0496101_0109743 3300048904 Bacteria 2076
601 Ga0496103_0081056 3300048906 Bacteria 2041
602 Ga0496104_0000005 3300048907 Bacteria 620360
603 Ga0496105_0000106 3300048908 Bacteria 56944
604 Ga0496105_0029746 3300048908 Bacteria 4472
605 Ga0496112_0324194 3300048915 Bacteria 1484
606 Ga0496115_0000077 3300048918 Bacteria 89885
607 Ga0496116_0078873 3300048919 Bacteria 2051
608 Ga0496117_0001430 3300048920 Bacteria 34487
609 Ga0496117_0007883 3300048920 Bacteria 10239
610 Ga0496117_0009829 3300048920 Bacteria 8812
611 Ga0496117_0018836 3300048920 Bacteria 5697
612 Ga0496117_0028737 3300048920 Bacteria 4301
613 Ga0496117_0091047 3300048920 Bacteria 1963
614 Ga0496118_0001349 3300048921 Bacteria 37069
615 Ga0496118_0001867 3300048921 Bacteria 30139
616 Ga0496118_0003009 3300048921 Bacteria 21768
617 Ga0496118_0006523 3300048921 Bacteria 12777
618 Ga0496118_0009851 3300048921 Bacteria 9560
619 Ga0496118_0030781 3300048921 Bacteria 4467
620 Ga0496118_0035939 3300048921 Bacteria 4014
621 Ga0496118_0120660 3300048921 Bacteria 1710
622 Ga0496119_0000711 3300048922 Bacteria 44692
623 Ga0496119_0001836 3300048922 Bacteria 24586
624 Ga0496120_0000273 3300048923 Bacteria 86248
625 Ga0496120_0000727 3300048923 Bacteria 48259
626 Ga0496121_0009703 3300048924 Bacteria 11019
627 Ga0496121_0177607 3300048924 Bacteria 1540
628 Ga0496122_0000417 3300048925 Bacteria 90401
629 Ga0496122_0001517 3300048925 Bacteria 37011
630 Ga0496122_0008629 3300048925 Bacteria 10938
631 Ga0496122_0009264 3300048925 Bacteria 10414
632 Ga0496123_0000137 3300048926 Bacteria 152169
633 Ga0496123_0000323 3300048926 Bacteria 91212
634 Ga0496124_0000006 3300048927 Bacteria 904259
635 Ga0496124_0001552 3300048927 Bacteria 33193
636 Ga0496124_0003391 3300048927 Bacteria 19565
637 Ga0496124_0003834 3300048927 Bacteria 18012
638 Ga0496124_0019869 3300048927 Bacteria 6231
639 Ga0496124_0030860 3300048927 Bacteria 4748
640 Ga0496124_0034545 3300048927 Bacteria 4435
641 Ga0496124_0038566 3300048927 Bacteria 4147
642 Ga0496124_0127669 3300048927 Bacteria 2024
643 Ga0496125_0014536 3300048928 Bacteria 7662
644 Ga0496125_0030941 3300048928 Bacteria 4778
645 Ga0496125_0077822 3300048928 Bacteria 2553
646 Ga0496125_0110368 3300048928 Bacteria 1994
647 Ga0496126_0000047 3300048929 Bacteria 322212
648 Ga0496126_0003861 3300048929 Bacteria 18507
649 Ga0496126_0093660 3300048929 Bacteria 2637
650 Ga0496126_0150106 3300048929 Bacteria 1998
651 Ga0496126_0269868 3300048929 Bacteria 1412
652 Ga0501290_001810 3300049513 Bacteria 2839
653 Ga0501031_0011342 3300049568 Bacteria 5804
654 Ga0501032_0009391 3300049569 Bacteria 7085
655 Ga0501032_0058995 3300049569 Bacteria 2575
656 Ga0501032_0115088 3300049569 Bacteria 1778
657 Ga0501033_0000648 3300049570 Bacteria 32231
658 Ga0501033_0011737 3300049570 Bacteria 6699
659 Ga0501033_0111712 3300049570 Bacteria 1988
660 Ga0501034_0000404 3300049571 Bacteria 72780
661 Ga0501034_0002782 3300049571 Bacteria 20512
662 Ga0501034_0004087 3300049571 Bacteria 16376
663 Ga0501034_0011508 3300049571 Bacteria 9169
664 Ga0501034_0030969 3300049571 Bacteria 5436
665 Ga0501034_0039821 3300049571 Bacteria 4759
666 Ga0501034_0065145 3300049571 Bacteria 3656
667 Ga0501036_0008180 3300049572 Bacteria 8573
668 Ga0501036_0031163 3300049572 Bacteria 4506
669 Ga0501036_0078118 3300049572 Bacteria 2800
670 Ga0501037_0001193 3300049573 Bacteria 19215
671 Ga0501037_0002066 3300049573 Bacteria 14559
672 Ga0501037_0010898 3300049573 Bacteria 6680
673 Ga0501038_0002825 3300049574 Bacteria 16162
674 Ga0501039_0017656 3300049575 Bacteria 5473
675 Ga0501040_0028881 3300049576 Bacteria 3740
676 Ga0501042_0088828 3300049578 Bacteria 2217
677 Ga0501043_0001302 3300049579 Bacteria 21839
678 Ga0501043_0004836 3300049579 Bacteria 10896
679 Ga0501043_0016644 3300049579 Bacteria 5762
680 Ga0501043_0033628 3300049579 Bacteria 4034
681 Ga0501043_0034199 3300049579 Bacteria 3998
682 Ga0501043_0045909 3300049579 Bacteria 3434
683 Ga0501046_0002835 3300049580 Bacteria 16129
684 Ga0501046_0048382 3300049580 Bacteria 3367
685 Ga0501046_0110201 3300049580 Bacteria 2104
686 Ga0501047_0001828 3300049581 Bacteria 20569
687 Ga0501047_0012857 3300049581 Bacteria 7931
688 Ga0501047_0015935 3300049581 Bacteria 7165
689 Ga0501047_0018902 3300049581 Bacteria 6608
690 Ga0501047_0029824 3300049581 Bacteria 5258
691 Ga0501047_0185728 3300049581 Bacteria 1944
692 Ga0501047_0400771 3300049581 Bacteria 1205
693 Ga0501048_0005076 3300049582 Bacteria 10027
694 Ga0501067_0000857 3300049583 Bacteria 16400
695 Ga0501067_0070404 3300049583 Bacteria 1937
696 Ga0501068_0041232 3300049584 Bacteria 2773
697 Ga0501069_0002885 3300049585 Bacteria 8823
698 Ga0501069_0004343 3300049585 Bacteria 7320
699 Ga0501070_0005876 3300049586 Bacteria 10464
700 Ga0501070_0013142 3300049586 Bacteria 6977
701 Ga0501070_0015006 3300049586 Bacteria 6518
702 Ga0501070_0053490 3300049586 Bacteria 3349
703 Ga0501070_0157575 3300049586 Bacteria 1872
704 Ga0501071_0071996 3300049587 Bacteria 2520
705 Ga0501072_0000573 3300049588 Bacteria 26511
706 Ga0501073_0000434 3300049589 Bacteria 28757
707 Ga0501073_0006243 3300049589 Bacteria 8891
708 Ga0501073_0021629 3300049589 Bacteria 4635
709 Ga0501073_0044889 3300049589 Bacteria 3114
710 Ga0501074_0003202 3300049590 Bacteria 11546
711 Ga0501074_0004731 3300049590 Bacteria 9756
712 Ga0501074_0050760 3300049590 Bacteria 2994
713 Ga0501074_0054530 3300049590 Bacteria 2882
714 Ga0501074_0091798 3300049590 Bacteria 2175
715 Ga0501225_0007795 3300049705 Bacteria 3091
716 Ga0501079_0004962 3300049741 Bacteria 9869
717 Ga0501079_0011079 3300049741 Bacteria 6877
718 Ga0501080_0000764 3300049742 Bacteria 26124
719 Ga0501080_0029198 3300049742 Bacteria 5133
720 Ga0501080_0040656 3300049742 Bacteria 4336
721 Ga0501080_0182486 3300049742 Bacteria 1930
722 Ga0501080_0245214 3300049742 Bacteria 1634
723 Ga0501080_0303139 3300049742 Bacteria 1448
724 Ga0501081_0063341 3300049743 Bacteria 2566
725 Ga0501083_0000246 3300049744 Bacteria 34511
726 Ga0501083_0156733 3300049744 Bacteria 1490
727 Ga0501266_001423 3300049763 Bacteria 3052
728 Ga0501275_000512 3300049772 Bacteria 4353
729 Ga0501035_0013478 3300049822 Bacteria 7546
730 Ga0501035_0062096 3300049822 Bacteria 3324
731 Ga0501035_0062673 3300049822 Bacteria 3309
732 Ga0501044_0004071 3300049823 Bacteria 16399
733 Ga0501044_0015664 3300049823 Bacteria 8165
734 Ga0501044_0017726 3300049823 Bacteria 7638
735 Ga0501044_0051173 3300049823 Bacteria 4259
736 Ga0501044_0081743 3300049823 Bacteria 3269
737 Ga0501044_0104618 3300049823 Bacteria 2844
738 Ga0501044_0133983 3300049823 Bacteria 2470
739 Ga0501044_0149448 3300049823 Bacteria 2319
740 Ga0501045_0074346 3300049824 Bacteria 2502
741 nmdc:mga00v17_2252_c1 3300050491 Bacteria 9886
742 Ga0500610_0000365 3300053079 Bacteria 13645
743 Ga0500643_000012 3300053087 Bacteria 369839
744 Ga0500651_0003309 3300053093 Bacteria 8779
745 Ga0500651_0006630 3300053093 Bacteria 6696
746 Ga0500651_0034171 3300053093 Bacteria 3206
747 Ga0500597_000088 3300053120 Bacteria 19053
748 Ga0500559_0018767 3300053136 Bacteria 2921
749 Ga0500568_0000233 3300053139 Bacteria 47567
750 Ga0500634_0000377 3300053161 Bacteria 14223
751 Ga0501084_0121189 3300054114 Bacteria 2199
752 Ga0501084_0138315 3300054114 Bacteria 2050
753 Ga0500661_008171 3300055283 Bacteria 1924
754 Ga0501082_0000107 3300060353 Bacteria 65178
755 Ga0501082_0151352 3300060353 Bacteria 2015

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047471 Ga0495684_0078978 Ga0495684_0078978_41_934 295
2 3300005367 Ga0070667_100082066 Ga0070667_1000820662 301
3 3300032004 Ga0307414_10003632 Ga0307414_100036323 307
4 3300005364 Ga0070673_100111799 Ga0070673_1001117992 308
5 3300005459 Ga0068867_100140107 Ga0068867_1001401072 308
6 3300025960 Ga0207651_10321806 Ga0207651_103218062 308
7 3300026089 Ga0207648_10071014 Ga0207648_100710142 308
8 3300032004 Ga0307414_10000883 Ga0307414_100008835 310
9 3300005616 Ga0068852_100014146 Ga0068852_1000141466 311
10 3300025949 Ga0207667_10258218 Ga0207667_102582182 311
11 3300048921 Ga0496118_0006523 Ga0496118_0006523_291_1325 311
12 iso_pu_bacteria 2643221593 2643973375 311
13 3300002773 JGI25152J39213_1000103 JGI25152J39213_10001035 312
14 3300002774 JGI25150J39212_1000183 JGI25150J39212_100018327 312
15 3300003187 JGI25151J46595_10000271 JGI25151J46595_1000027146 312
16 3300003215 JGI25153J46596_10000190 JGI25153J46596_1000019046 312
17 3300009098 Ga0105245_10165864 Ga0105245_101658642 312
18 3300025245 Ga0207425_1000148 Ga0207425_10001485 312
19 3300025258 Ga0209129_1000239 Ga0209129_10002395 312
20 3300025294 Ga0209025_1000048 Ga0209025_1000048250 312
21 3300025297 Ga0209758_1000056 Ga0209758_1000056250 312
22 3300005844 Ga0068862_100099430 Ga0068862_1000994302 313
23 3300005331 Ga0070670_100147541 Ga0070670_1001475412 317
24 3300025925 Ga0207650_10112978 Ga0207650_101129782 317
25 3300028794 Ga0307515_10125655 Ga0307515_101256552 317
26 3300025933 Ga0207706_10028883 Ga0207706_100288832 318
27 3300005354 Ga0070675_100387590 Ga0070675_1003875901 319
28 3300031456 Ga0307513_10006814 Ga0307513_100068143 320
29 3300031730 Ga0307516_10176328 Ga0307516_101763282 321
30 3300005841 Ga0068863_100024540 Ga0068863_1000245404 323
31 3300006237 Ga0097621_100326759 Ga0097621_1003267592 323
32 3300009551 Ga0105238_10009039 Ga0105238_100090392 323
33 3300013306 Ga0163162_10280900 Ga0163162_102809002 323
34 3300025924 Ga0207694_10056309 Ga0207694_100563092 323
35 3300026088 Ga0207641_10045468 Ga0207641_100454684 323
36 3300031691 Ga0316579_10002710 Ga0316579_100027104 323
37 3300031727 Ga0316576_10006785 Ga0316576_100067856 323
38 3300031727 Ga0316576_10182135 Ga0316576_101821352 323
39 3300031728 Ga0316578_10046275 Ga0316578_100462754 323
40 3300031733 Ga0316577_10019739 Ga0316577_100197392 323
41 3300031733 Ga0316577_10064644 Ga0316577_100646441 323
42 3300035398 Ga0316574_0058217 Ga0316574_0058217_1285_2268 323
43 3300036712 Ga0316584_0189592 Ga0316584_0189592_293_1276 323
44 3300046471 Ga0495650_0000469 Ga0495650_0000469_42938_43912 323
45 3300046660 Ga0495625_0007542 Ga0495625_0007542_5483_6457 323
46 3300048924 Ga0496121_0177607 Ga0496121_0177607_301_1275 323
47 3300048929 Ga0496126_0093660 Ga0496126_0093660_661_1635 323
48 3300005614 Ga0068856_100007098 Ga0068856_1000070984 324
49 3300026078 Ga0207702_10003377 Ga0207702_100033779 324
50 3300049513 Ga0501290_001810 Ga0501290_001810_474_1520 324
51 3300049569 Ga0501032_0058995 Ga0501032_0058995_276_1262 324
52 3300049570 Ga0501033_0000648 Ga0501033_0000648_2218_3204 324
53 3300049572 Ga0501036_0008180 Ga0501036_0008180_1499_2485 324
54 3300049579 Ga0501043_0016644 Ga0501043_0016644_1062_2048 324
55 3300049580 Ga0501046_0048382 Ga0501046_0048382_1482_2468 324
56 3300049590 Ga0501074_0050760 Ga0501074_0050760_291_1277 324
57 3300049823 Ga0501044_0081743 Ga0501044_0081743_1663_2649 324
58 3300053136 Ga0500559_0018767 Ga0500559_0018767_827_1804 324
59 iso_pu_bacteria 2643221577 2643897016 324
60 iso_pu_bacteria 2643221685 2644479221 324
61 iso_pu_bacteria 2842918807 2842921935 324
62 iso_pu_bacteria 2953994433 2953997027 324
63 3300005335 Ga0070666_10000442 Ga0070666_1000044222 325
64 3300005458 Ga0070681_10009167 Ga0070681_100091674 325
65 3300013100 Ga0157373_10012798 Ga0157373_100127986 325
66 3300014325 Ga0163163_10000029 Ga0163163_1000002942 325
67 3300025903 Ga0207680_10000529 Ga0207680_1000052911 325
68 3300025912 Ga0207707_10000578 Ga0207707_100005784 325
69 3300025986 Ga0207658_10253279 Ga0207658_102532792 325
70 3300031665 Ga0316575_10014957 Ga0316575_100149574 325
71 3300031730 Ga0307516_10068264 Ga0307516_100682642 325
72 3300049571 Ga0501034_0030969 Ga0501034_0030969_3962_4951 325
73 3300049572 Ga0501036_0078118 Ga0501036_0078118_1137_2126 325
74 3300049579 Ga0501043_0033628 Ga0501043_0033628_2404_3390 325
75 3300049579 Ga0501043_0045909 Ga0501043_0045909_1398_2387 325
76 3300049580 Ga0501046_0110201 Ga0501046_0110201_837_1826 325
77 3300049581 Ga0501047_0001828 Ga0501047_0001828_14806_15792 325
78 3300049581 Ga0501047_0012857 Ga0501047_0012857_3397_4386 325
79 3300049586 Ga0501070_0005876 Ga0501070_0005876_6853_7839 325
80 3300049586 Ga0501070_0013142 Ga0501070_0013142_2934_3923 325
81 3300049590 Ga0501074_0054530 Ga0501074_0054530_247_1236 325
82 3300049590 Ga0501074_0091798 Ga0501074_0091798_822_1808 325
83 3300049742 Ga0501080_0000764 Ga0501080_0000764_15584_16570 325
84 3300049742 Ga0501080_0029198 Ga0501080_0029198_799_1788 325
85 3300049823 Ga0501044_0133983 Ga0501044_0133983_728_1717 325
86 3300001904 JGI24736J21556_1013961 JGI24736J21556_10139612 326
87 3300005329 Ga0070683_100207011 Ga0070683_1002070112 326
88 3300005335 Ga0070666_10260359 Ga0070666_102603591 326
89 3300005366 Ga0070659_100067261 Ga0070659_1000672612 326
90 3300005367 Ga0070667_100139793 Ga0070667_1001397932 326
91 3300005530 Ga0070679_100175899 Ga0070679_1001758992 326
92 3300005535 Ga0070684_100024537 Ga0070684_1000245372 326
93 3300005539 Ga0068853_100028892 Ga0068853_1000288925 326
94 3300005563 Ga0068855_100105650 Ga0068855_1001056502 326
95 3300005577 Ga0068857_100168752 Ga0068857_1001687522 326
96 3300005618 Ga0068864_100020044 Ga0068864_1000200446 326
97 3300005834 Ga0068851_10032986 Ga0068851_100329862 326
98 3300005843 Ga0068860_100002386 Ga0068860_10000238613 326
99 3300005843 Ga0068860_100124956 Ga0068860_1001249564 326
100 3300009177 Ga0105248_10117468 Ga0105248_101174682 326
101 3300009545 Ga0105237_10118736 Ga0105237_101187362 326
102 3300010375 Ga0105239_10010309 Ga0105239_100103096 326
103 3300011119 Ga0105246_10020817 Ga0105246_100208172 326
104 3300011119 Ga0105246_10064583 Ga0105246_100645832 326
105 3300013100 Ga0157373_10042694 Ga0157373_100426944 326
106 3300013104 Ga0157370_10131797 Ga0157370_101317973 326
107 3300013307 Ga0157372_10028390 Ga0157372_100283902 326
108 3300014325 Ga0163163_10000564 Ga0163163_1000056427 326
109 3300014497 Ga0182008_10020566 Ga0182008_100205662 326
110 3300014968 Ga0157379_10001942 Ga0157379_1000194217 326
111 3300014969 Ga0157376_10063340 Ga0157376_100633402 326
112 3300025904 Ga0207647_10001336 Ga0207647_1000133611 326
113 3300025912 Ga0207707_10242082 Ga0207707_102420822 326
114 3300025919 Ga0207657_10002547 Ga0207657_1000254720 326
115 3300025921 Ga0207652_10150244 Ga0207652_101502442 326
116 3300025932 Ga0207690_10191206 Ga0207690_101912062 326
117 3300025941 Ga0207711_10149769 Ga0207711_101497692 326
118 3300025942 Ga0207689_10080295 Ga0207689_100802952 326
119 3300025944 Ga0207661_10113455 Ga0207661_101134554 326
120 3300025949 Ga0207667_10038594 Ga0207667_100385943 326
121 3300025949 Ga0207667_10264415 Ga0207667_102644151 326
122 3300026035 Ga0207703_10235448 Ga0207703_102354482 326
123 3300026088 Ga0207641_10042543 Ga0207641_100425432 326
124 3300026095 Ga0207676_10005524 Ga0207676_100055248 326
125 3300026116 Ga0207674_10008389 Ga0207674_100083897 326
126 3300028381 Ga0268264_10096469 Ga0268264_100964692 326
127 3300031665 Ga0316575_10079546 Ga0316575_100795461 326
128 3300031727 Ga0316576_10060931 Ga0316576_100609312 326
129 3300035398 Ga0316574_0008265 Ga0316574_0008265_3993_4991 326
130 3300035398 Ga0316574_0066006 Ga0316574_0066006_657_1667 326
131 3300035398 Ga0316574_0098537 Ga0316574_0098537_775_1773 326
132 3300037418 Ga0395900_0000163 Ga0395900_0000163_37235_38221 326
133 3300037466 Ga0395898_0137307 Ga0395898_0137307_390_1376 326
134 3300047472 Ga0495686_0145793 Ga0495686_0145793_34_1020 326
135 3300048906 Ga0496103_0081056 Ga0496103_0081056_938_1942 326
136 3300048918 Ga0496115_0000077 Ga0496115_0000077_56102_57103 326
137 3300048921 Ga0496118_0009851 Ga0496118_0009851_3597_4601 326
138 3300048929 Ga0496126_0000047 Ga0496126_0000047_237479_238480 326
139 3300053093 Ga0500651_0003309 Ga0500651_0003309_2495_3475 326
140 3300005327 Ga0070658_10007622 Ga0070658_100076224 327
141 3300005331 Ga0070670_100197263 Ga0070670_1001972632 327
142 3300005335 Ga0070666_10000022 Ga0070666_10000022108 327
143 3300005338 Ga0068868_100128293 Ga0068868_1001282932 327
144 3300005344 Ga0070661_100009383 Ga0070661_1000093835 327
145 3300005344 Ga0070661_100015590 Ga0070661_1000155905 327
146 3300005344 Ga0070661_100124692 Ga0070661_1001246922 327
147 3300005355 Ga0070671_100045193 Ga0070671_1000451932 327
148 3300005367 Ga0070667_100005400 Ga0070667_10000540011 327
149 3300005367 Ga0070667_100041398 Ga0070667_1000413982 327
150 3300005535 Ga0070684_100048363 Ga0070684_1000483632 327
151 3300005539 Ga0068853_100004195 Ga0068853_1000041956 327
152 3300005547 Ga0070693_100012299 Ga0070693_1000122992 327
153 3300005548 Ga0070665_100000028 Ga0070665_100000028164 327
154 3300005548 Ga0070665_100010878 Ga0070665_1000108782 327
155 3300005578 Ga0068854_100080020 Ga0068854_1000800202 327
156 3300005614 Ga0068856_100229373 Ga0068856_1002293732 327
157 3300005616 Ga0068852_100005973 Ga0068852_1000059733 327
158 3300005842 Ga0068858_100160243 Ga0068858_1001602432 327
159 3300006237 Ga0097621_100083770 Ga0097621_1000837702 327
160 3300006358 Ga0068871_100039983 Ga0068871_1000399832 327
161 3300009093 Ga0105240_10152371 Ga0105240_101523712 327
162 3300009174 Ga0105241_10055846 Ga0105241_100558462 327
163 3300009545 Ga0105237_10011173 Ga0105237_100111737 327
164 3300009551 Ga0105238_10000175 Ga0105238_1000017543 327
165 3300009551 Ga0105238_10006626 Ga0105238_100066264 327
166 3300009551 Ga0105238_10030657 Ga0105238_100306575 327
167 3300010375 Ga0105239_10107680 Ga0105239_101076802 327
168 3300013105 Ga0157369_10002250 Ga0157369_1000225016 327
169 3300013307 Ga0157372_10000344 Ga0157372_1000034418 327
170 3300014325 Ga0163163_10286193 Ga0163163_102861932 327
171 3300014497 Ga0182008_10008822 Ga0182008_100088222 327
172 3300014968 Ga0157379_10153983 Ga0157379_101539832 327
173 3300015261 Ga0182006_1004720 Ga0182006_10047204 327
174 3300017792 Ga0163161_10013517 Ga0163161_100135174 327
175 3300025258 Ga0209129_1001622 Ga0209129_10016226 327
176 3300025297 Ga0209758_1009524 Ga0209758_10095242 327
177 3300025903 Ga0207680_10000001 Ga0207680_10000001511 327
178 3300025909 Ga0207705_10001049 Ga0207705_100010495 327
179 3300025911 Ga0207654_10000458 Ga0207654_100004584 327
180 3300025911 Ga0207654_10063425 Ga0207654_100634252 327
181 3300025913 Ga0207695_10000772 Ga0207695_1000077210 327
182 3300025914 Ga0207671_10030679 Ga0207671_100306792 327
183 3300025919 Ga0207657_10170713 Ga0207657_101707132 327
184 3300025920 Ga0207649_10004292 Ga0207649_100042922 327
185 3300025920 Ga0207649_10012167 Ga0207649_100121674 327
186 3300025924 Ga0207694_10000257 Ga0207694_1000025752 327
187 3300025924 Ga0207694_10006803 Ga0207694_100068038 327
188 3300025925 Ga0207650_10168174 Ga0207650_101681742 327
189 3300025931 Ga0207644_10166932 Ga0207644_101669322 327
190 3300025938 Ga0207704_10053643 Ga0207704_100536432 327
191 3300025945 Ga0207679_10026576 Ga0207679_100265762 327
192 3300025949 Ga0207667_10019912 Ga0207667_100199128 327
193 3300025949 Ga0207667_10164835 Ga0207667_101648352 327
194 3300025972 Ga0207668_10130946 Ga0207668_101309462 327
195 3300025986 Ga0207658_10009244 Ga0207658_100092442 327
196 3300025986 Ga0207658_10090619 Ga0207658_100906192 327
197 3300026023 Ga0207677_10008057 Ga0207677_100080576 327
198 3300026035 Ga0207703_10109403 Ga0207703_101094032 327
199 3300026035 Ga0207703_10116118 Ga0207703_101161182 327
200 3300026041 Ga0207639_10000514 Ga0207639_1000051412 327
201 3300026041 Ga0207639_10140881 Ga0207639_101408812 327
202 3300026078 Ga0207702_10027084 Ga0207702_100270843 327
203 3300026088 Ga0207641_10214292 Ga0207641_102142922 327
204 3300026142 Ga0207698_10041061 Ga0207698_100410612 327
205 3300028379 Ga0268266_10000017 Ga0268266_10000017308 327
206 3300028379 Ga0268266_10000091 Ga0268266_1000009146 327
207 3300028379 Ga0268266_10196408 Ga0268266_101964082 327
208 3300028381 Ga0268264_10153509 Ga0268264_101535093 327
209 3300028786 Ga0307517_10113675 Ga0307517_101136752 327
210 3300033180 Ga0307510_10006402 Ga0307510_1000640213 327
211 3300041404 Ga0439436_0000009 Ga0439436_0000009_8918_9916 327
212 3300041413 Ga0439465_0001199 Ga0439465_0001199_3359_4357 327
213 3300042004 Ga0439445_0027556 Ga0439445_0027556_209_1207 327
214 3300045049 Ga0466959_0012881 Ga0466959_0012881_2431_3414 327
215 3300046507 Ga0495606_0204894 Ga0495606_0204894_41_1039 327
216 3300046512 Ga0495610_0002419 Ga0495610_0002419_4900_5898 327
217 3300046691 Ga0495670_0006739 Ga0495670_0006739_4452_5450 327
218 3300046694 Ga0495649_0030572 Ga0495649_0030572_1660_2658 327
219 3300049581 Ga0501047_0185728 Ga0501047_0185728_407_1420 327
220 3300049742 Ga0501080_0245214 Ga0501080_0245214_198_1184 327
221 3300049823 Ga0501044_0004071 Ga0501044_0004071_10330_11343 327
222 3300053087 Ga0500643_000012 Ga0500643_000012_17377_18375 327
223 iso_pu_bacteria 2919513703 2919517140 327
224 iso_pu_bacteria 2919675420 2919677595 327
225 3300003792 Ga0055540_1034558 Ga0055540_10345581 328
226 3300005327 Ga0070658_10061938 Ga0070658_100619382 328
227 3300005335 Ga0070666_10118619 Ga0070666_101186192 328
228 3300005347 Ga0070668_100156977 Ga0070668_1001569772 328
229 3300005367 Ga0070667_100447199 Ga0070667_1004471991 328
230 3300005539 Ga0068853_100007213 Ga0068853_1000072138 328
231 3300005548 Ga0070665_100027661 Ga0070665_1000276615 328
232 3300005548 Ga0070665_100168154 Ga0070665_1001681543 328
233 3300005563 Ga0068855_100268834 Ga0068855_1002688342 328
234 3300005577 Ga0068857_100053558 Ga0068857_1000535583 328
235 3300005617 Ga0068859_100000280 Ga0068859_10000028032 328
236 3300005834 Ga0068851_10087320 Ga0068851_100873202 328
237 3300005841 Ga0068863_100077761 Ga0068863_1000777613 328
238 3300005844 Ga0068862_100000215 Ga0068862_10000021516 328
239 3300006237 Ga0097621_100012950 Ga0097621_1000129506 328
240 3300006931 Ga0097620_100000280 Ga0097620_10000028013 328
241 3300009545 Ga0105237_10298437 Ga0105237_102984372 328
242 3300009553 Ga0105249_10355553 Ga0105249_103555531 328
243 3300010375 Ga0105239_10472879 Ga0105239_104728791 328
244 3300013100 Ga0157373_10087870 Ga0157373_100878702 328
245 3300013105 Ga0157369_10004413 Ga0157369_100044137 328
246 3300013105 Ga0157369_10169167 Ga0157369_101691672 328
247 3300013307 Ga0157372_10057810 Ga0157372_100578102 328
248 3300025321 Ga0207656_10054810 Ga0207656_100548102 328
249 3300025909 Ga0207705_10096042 Ga0207705_100960422 328
250 3300025911 Ga0207654_10071741 Ga0207654_100717412 328
251 3300025912 Ga0207707_10045794 Ga0207707_100457942 328
252 3300025913 Ga0207695_10006223 Ga0207695_100062236 328
253 3300025914 Ga0207671_10011332 Ga0207671_100113327 328
254 3300025914 Ga0207671_10171438 Ga0207671_101714382 328
255 3300025916 Ga0207663_10175468 Ga0207663_101754681 328
256 3300025924 Ga0207694_10024311 Ga0207694_100243112 328
257 3300025940 Ga0207691_10007233 Ga0207691_1000723310 328
258 3300025961 Ga0207712_10279439 Ga0207712_102794391 328
259 3300026041 Ga0207639_10191740 Ga0207639_101917402 328
260 3300026041 Ga0207639_10230228 Ga0207639_102302282 328
261 3300026088 Ga0207641_10060657 Ga0207641_100606573 328
262 3300026116 Ga0207674_10059733 Ga0207674_100597332 328
263 3300028379 Ga0268266_10080274 Ga0268266_100802741 328
264 3300028380 Ga0268265_10000376 Ga0268265_1000037616 328
265 3300033179 Ga0307507_10216035 Ga0307507_102160351 328
266 3300044658 Ga0466972_0001414 Ga0466972_0001414_5785_6771 328
267 3300044765 Ga0466970_0001522 Ga0466970_0001522_4428_5414 328
268 3300049568 Ga0501031_0011342 Ga0501031_0011342_529_1545 328
269 3300049569 Ga0501032_0009391 Ga0501032_0009391_3553_4554 328
270 3300049570 Ga0501033_0011737 Ga0501033_0011737_1427_2413 328
271 3300049570 Ga0501033_0111712 Ga0501033_0111712_444_1460 328
272 3300049571 Ga0501034_0002782 Ga0501034_0002782_6899_7915 328
273 3300049571 Ga0501034_0004087 Ga0501034_0004087_14118_15104 328
274 3300049571 Ga0501034_0011508 Ga0501034_0011508_600_1601 328
275 3300049573 Ga0501037_0001193 Ga0501037_0001193_4330_5316 328
276 3300049574 Ga0501038_0002825 Ga0501038_0002825_14095_15081 328
277 3300049575 Ga0501039_0017656 Ga0501039_0017656_4384_5400 328
278 3300049576 Ga0501040_0028881 Ga0501040_0028881_1545_2561 328
279 3300049578 Ga0501042_0088828 Ga0501042_0088828_218_1234 328
280 3300049579 Ga0501043_0004836 Ga0501043_0004836_822_1808 328
281 3300049580 Ga0501046_0002835 Ga0501046_0002835_1644_2630 328
282 3300049581 Ga0501047_0015935 Ga0501047_0015935_3536_4552 328
283 3300049581 Ga0501047_0018902 Ga0501047_0018902_571_1572 328
284 3300049582 Ga0501048_0005076 Ga0501048_0005076_5258_6274 328
285 3300049583 Ga0501067_0000857 Ga0501067_0000857_6202_7203 328
286 3300049583 Ga0501067_0070404 Ga0501067_0070404_123_1109 328
287 3300049584 Ga0501068_0041232 Ga0501068_0041232_1357_2373 328
288 3300049585 Ga0501069_0002885 Ga0501069_0002885_575_1591 328
289 3300049585 Ga0501069_0004343 Ga0501069_0004343_3351_4352 328
290 3300049586 Ga0501070_0157575 Ga0501070_0157575_413_1429 328
291 3300049587 Ga0501071_0071996 Ga0501071_0071996_971_1987 328
292 3300049588 Ga0501072_0000573 Ga0501072_0000573_16500_17501 328
293 3300049589 Ga0501073_0000434 Ga0501073_0000434_2818_3819 328
294 3300049589 Ga0501073_0006243 Ga0501073_0006243_6352_7338 328
295 3300049589 Ga0501073_0044889 Ga0501073_0044889_1940_2956 328
296 3300049590 Ga0501074_0003202 Ga0501074_0003202_9206_10207 328
297 3300049590 Ga0501074_0004731 Ga0501074_0004731_2201_3217 328
298 3300049741 Ga0501079_0004962 Ga0501079_0004962_7111_8112 328
299 3300049741 Ga0501079_0011079 Ga0501079_0011079_3909_4925 328
300 3300049742 Ga0501080_0040656 Ga0501080_0040656_1080_2081 328
301 3300049742 Ga0501080_0182486 Ga0501080_0182486_340_1356 328
302 3300049743 Ga0501081_0063341 Ga0501081_0063341_586_1602 328
303 3300049744 Ga0501083_0000246 Ga0501083_0000246_24403_25404 328
304 3300049823 Ga0501044_0015664 Ga0501044_0015664_5886_6872 328
305 3300049823 Ga0501044_0104618 Ga0501044_0104618_397_1398 328
306 3300049824 Ga0501045_0074346 Ga0501045_0074346_1037_2053 328
307 3300053093 Ga0500651_0034171 Ga0500651_0034171_773_1765 328
308 3300054114 Ga0501084_0121189 Ga0501084_0121189_594_1595 328
309 3300060353 Ga0501082_0151352 Ga0501082_0151352_550_1551 328
310 3300005337 Ga0070682_100000806 Ga0070682_1000008065 329
311 3300005337 Ga0070682_100088428 Ga0070682_1000884282 329
312 3300005366 Ga0070659_100011336 Ga0070659_1000113362 329
313 3300005366 Ga0070659_100018023 Ga0070659_1000180233 329
314 3300005539 Ga0068853_100000720 Ga0068853_1000007208 329
315 3300005539 Ga0068853_100148770 Ga0068853_1001487702 329
316 3300005578 Ga0068854_100128325 Ga0068854_1001283252 329
317 3300005616 Ga0068852_100055732 Ga0068852_1000557324 329
318 3300005843 Ga0068860_100107390 Ga0068860_1001073902 329
319 3300006881 Ga0068865_100001586 Ga0068865_1000015869 329
320 3300009176 Ga0105242_10079196 Ga0105242_100791961 329
321 3300009551 Ga0105238_10041838 Ga0105238_100418386 329
322 3300009979 Ga0105032_100317 Ga0105032_1003173 329
323 3300013100 Ga0157373_10009800 Ga0157373_100098005 329
324 3300013102 Ga0157371_10010395 Ga0157371_100103956 329
325 3300013104 Ga0157370_10001260 Ga0157370_1000126011 329
326 3300013104 Ga0157370_10044732 Ga0157370_100447322 329
327 3300013306 Ga0163162_10018817 Ga0163162_100188172 329
328 3300013308 Ga0157375_10019950 Ga0157375_100199501 329
329 3300014969 Ga0157376_10007306 Ga0157376_100073064 329
330 3300025231 Ga0207427_100349 Ga0207427_10034912 329
331 3300025233 Ga0209437_100886 Ga0209437_10088611 329
332 3300025261 Ga0209233_1000998 Ga0209233_100099811 329
333 3300025924 Ga0207694_10143318 Ga0207694_101433182 329
334 3300025932 Ga0207690_10019109 Ga0207690_100191094 329
335 3300025932 Ga0207690_10042976 Ga0207690_100429762 329
336 3300025949 Ga0207667_10012090 Ga0207667_100120908 329
337 3300025981 Ga0207640_10019306 Ga0207640_100193062 329
338 3300026035 Ga0207703_10326770 Ga0207703_103267702 329
339 3300026041 Ga0207639_10003146 Ga0207639_100031463 329
340 3300026041 Ga0207639_10119482 Ga0207639_101194822 329
341 3300035120 Ga0373957_0028125 Ga0373957_0028125_134_1135 329
342 3300035724 Ga0373933_0179551 Ga0373933_0179551_32_1033 329
343 3300036401 Ga0373937_0007519 Ga0373937_0007519_4958_5959 329
344 3300046473 Ga0495582_0009245 Ga0495582_0009245_4377_5378 329
345 3300046531 Ga0495665_0054589 Ga0495665_0054589_753_1754 329
346 3300046536 Ga0495587_0125298 Ga0495587_0125298_314_1315 329
347 3300046663 Ga0495635_0085671 Ga0495635_0085671_1050_2051 329
348 3300046683 Ga0495658_0011054 Ga0495658_0011054_509_1510 329
349 3300048907 Ga0496104_0000005 Ga0496104_0000005_48100_49101 329
350 3300048908 Ga0496105_0000106 Ga0496105_0000106_12216_13217 329
351 3300049571 Ga0501034_0039821 Ga0501034_0039821_2593_3603 329
352 3300049573 Ga0501037_0002066 Ga0501037_0002066_4113_5123 329
353 3300049586 Ga0501070_0015006 Ga0501070_0015006_4823_5833 329
354 3300049772 Ga0501275_000512 Ga0501275_000512_2187_3209 329
355 3300049822 Ga0501035_0062096 Ga0501035_0062096_345_1337 329
356 3300049822 Ga0501035_0062673 Ga0501035_0062673_1424_2434 329
357 3300049823 Ga0501044_0017726 Ga0501044_0017726_155_1147 329
358 3300049823 Ga0501044_0149448 Ga0501044_0149448_612_1622 329
359 iso_pu_bacteria 2547132130 2547503588 329
360 iso_pu_bacteria 2576861471 2578456968 329
361 iso_pu_bacteria 2643221695 2644528196 329
362 iso_pu_bacteria 2747842428 2747949942 329
363 iso_pu_bacteria 2765235840 2765580538 329
364 iso_pu_bacteria 2816332141 2816518438 329
365 iso_pu_bacteria 2842391507 2842394453 329
366 iso_pu_bacteria 2842757796 2842758985 329
367 iso_pu_bacteria 2857442823 2857446999 329
368 iso_pu_bacteria 2874220319 2874223201 329
369 iso_pu_bacteria 2894414249 2894414281 329
370 iso_pu_bacteria 2919089067 2919093236 329
371 iso_pu_bacteria 2919134579 2919138751 329
372 iso_pu_bacteria 2928496128 2928499867 329
373 iso_pu_bacteria 2931380184 2931383362 329
374 iso_pu_bacteria 2937610967 2937614335 329
375 iso_pu_bacteria 2939589442 2939589839 329
376 iso_pu_bacteria 2939622612 2939624952 329
377 iso_pu_bacteria 2939626828 2939630925 329
378 iso_pu_bacteria 2961047084 2961049965 329
379 iso_pu_bacteria 2961064222 2961064872 329
380 iso_pu_bacteria 2974307012 2974307616 329
381 iso_pu_bacteria 2977247770 2977248327 329
382 iso_pu_bacteria 2984514374 2984517180 329
383 3300005335 Ga0070666_10086043 Ga0070666_100860432 330
384 3300005356 Ga0070674_100082237 Ga0070674_1000822372 330
385 3300005367 Ga0070667_100155273 Ga0070667_1001552731 330
386 3300005455 Ga0070663_100319566 Ga0070663_1003195661 330
387 3300005456 Ga0070678_100108757 Ga0070678_1001087571 330
388 3300005458 Ga0070681_10013412 Ga0070681_100134125 330
389 3300005459 Ga0068867_100090251 Ga0068867_1000902512 330
390 3300005466 Ga0070685_10007386 Ga0070685_100073862 330
391 3300005539 Ga0068853_100033305 Ga0068853_1000333054 330
392 3300005548 Ga0070665_100159083 Ga0070665_1001590832 330
393 3300005617 Ga0068859_100308584 Ga0068859_1003085841 330
394 3300005718 Ga0068866_10129171 Ga0068866_101291712 330
395 3300005841 Ga0068863_100066084 Ga0068863_1000660841 330
396 3300005983 Ga0081540_1008082 Ga0081540_10080825 330
397 3300006358 Ga0068871_100190334 Ga0068871_1001903342 330
398 3300006881 Ga0068865_100053746 Ga0068865_1000537463 330
399 3300006931 Ga0097620_100308555 Ga0097620_1003085552 330
400 3300009093 Ga0105240_10001002 Ga0105240_1000100238 330
401 3300009545 Ga0105237_10035094 Ga0105237_100350944 330
402 3300009551 Ga0105238_10030434 Ga0105238_100304342 330
403 3300013306 Ga0163162_10028377 Ga0163162_100283772 330
404 3300014968 Ga0157379_10220782 Ga0157379_102207822 330
405 3300014969 Ga0157376_10005280 Ga0157376_100052808 330
406 3300025261 Ga0209233_1000715 Ga0209233_100071516 330
407 3300025913 Ga0207695_10000040 Ga0207695_10000040192 330
408 3300025914 Ga0207671_10043030 Ga0207671_100430302 330
409 3300025919 Ga0207657_10366742 Ga0207657_103667421 330
410 3300025924 Ga0207694_10003883 Ga0207694_100038834 330
411 3300025925 Ga0207650_10104287 Ga0207650_101042873 330
412 3300025942 Ga0207689_10034224 Ga0207689_100342243 330
413 3300025942 Ga0207689_10093372 Ga0207689_100933722 330
414 3300026023 Ga0207677_10095502 Ga0207677_100955022 330
415 3300026067 Ga0207678_10175178 Ga0207678_101751782 330
416 3300026089 Ga0207648_10038304 Ga0207648_100383042 330
417 3300031903 Ga0307407_10141410 Ga0307407_101414102 330
418 3300049571 Ga0501034_0065145 Ga0501034_0065145_1547_2542 330
419 3300049572 Ga0501036_0031163 Ga0501036_0031163_1646_2641 330
420 3300049573 Ga0501037_0010898 Ga0501037_0010898_5627_6622 330
421 3300049581 Ga0501047_0029824 Ga0501047_0029824_864_1916 330
422 3300049589 Ga0501073_0021629 Ga0501073_0021629_256_1308 330
423 3300049742 Ga0501080_0303139 Ga0501080_0303139_17_1012 330
424 3300049744 Ga0501083_0156733 Ga0501083_0156733_139_1191 330
425 3300053139 Ga0500568_0000233 Ga0500568_0000233_25340_26377 330
426 3300054114 Ga0501084_0138315 Ga0501084_0138315_684_1736 330
427 3300060353 Ga0501082_0000107 Ga0501082_0000107_11358_12410 330
428 iso_pu_bacteria 2571042365 2572254306 330
429 iso_pu_bacteria 2643221559 2643818264 330
430 iso_pu_bacteria 2643221586 2643937933 330
431 iso_pu_bacteria 2643221612 2644078842 330
432 iso_pu_bacteria 2643221727 2644693619 330
433 iso_pu_bacteria 2747842501 2748018807 330
434 iso_pu_bacteria 2818991457 2819661327 330
435 iso_pu_bacteria 2842780639 2842782584 330
436 iso_pu_bacteria 2852649853 2852652120 330
437 iso_pu_bacteria 2852684882 2852687198 330
438 iso_pu_bacteria 2895498888 2895499871 330
439 iso_pu_bacteria 2895511927 2895512847 330
440 iso_pu_bacteria 2895522137 2895522856 330
441 iso_pu_bacteria 2895525241 2895525372 330
442 iso_pu_bacteria 2919130084 2919131045 330
443 iso_pu_bacteria 2929195423 2929196284 330
444 iso_pu_bacteria 2941475908 2941478743 330
445 iso_pu_bacteria 2941489479 2941494605 330
446 iso_pu_bacteria 2987605356 2987608826 330
447 iso_pu_bacteria 2995948881 2995949630 330
448 iso_pu_bacteria 8002869464 8002870948 330
449 iso_pu_bacteria 8021622325 8021625553 330
450 iso_pu_bacteria 8021648035 8021649750 330
451 3300005334 Ga0068869_100079398 Ga0068869_1000793982 331
452 3300005367 Ga0070667_100000049 Ga0070667_10000004936 331
453 3300005455 Ga0070663_100000042 Ga0070663_1000000427 331
454 3300005459 Ga0068867_100032307 Ga0068867_1000323072 331
455 3300005539 Ga0068853_100011114 Ga0068853_1000111143 331
456 3300005543 Ga0070672_100003657 Ga0070672_1000036577 331
457 3300005548 Ga0070665_100008261 Ga0070665_1000082617 331
458 3300005617 Ga0068859_100343091 Ga0068859_1003430912 331
459 3300006931 Ga0097620_100343093 Ga0097620_1003430932 331
460 3300009093 Ga0105240_10424643 Ga0105240_104246432 331
461 3300009177 Ga0105248_10000120 Ga0105248_1000012041 331
462 3300009545 Ga0105237_10010356 Ga0105237_100103565 331
463 3300009553 Ga0105249_10000898 Ga0105249_1000089817 331
464 3300025914 Ga0207671_10007551 Ga0207671_100075514 331
465 3300025940 Ga0207691_10009099 Ga0207691_100090993 331
466 3300025941 Ga0207711_10010606 Ga0207711_100106062 331
467 3300025942 Ga0207689_10130781 Ga0207689_101307812 331
468 3300025960 Ga0207651_10097067 Ga0207651_100970672 331
469 3300025961 Ga0207712_10000305 Ga0207712_100003059 331
470 3300025972 Ga0207668_10056198 Ga0207668_100561984 331
471 3300025986 Ga0207658_10000033 Ga0207658_10000033114 331
472 3300026041 Ga0207639_10019356 Ga0207639_100193562 331
473 3300026088 Ga0207641_10165970 Ga0207641_101659702 331
474 3300026142 Ga0207698_10223440 Ga0207698_102234402 331
475 3300031730 Ga0307516_10101976 Ga0307516_101019762 331
476 3300041491 Ga0451833_0665795 Ga0451833_0665795_273_1274 331
477 3300041494 Ga0451837_0845588 Ga0451837_0845588_216_1223 331
478 3300041512 Ga0451853_3774819 Ga0451853_3774819_43_1044 331
479 3300042876 Ga0451577_0016708 Ga0451577_0016708_3012_4028 331
480 3300047472 Ga0495686_0004214 Ga0495686_0004214_4823_5824 331
481 3300048925 Ga0496122_0001517 Ga0496122_0001517_29199_30200 331
482 3300048926 Ga0496123_0000323 Ga0496123_0000323_11106_12107 331
483 3300048929 Ga0496126_0150106 Ga0496126_0150106_644_1645 331
484 3300053079 Ga0500610_0000365 Ga0500610_0000365_9883_10884 331
485 3300053120 Ga0500597_000088 Ga0500597_000088_97_1098 331
486 iso_pu_bacteria 2643221573 2643880456 331
487 iso_pu_bacteria 2643221720 2644661031 331
488 iso_pu_bacteria 2643221728 2644699113 331
489 iso_pu_bacteria 8003014200 8003015464 331
490 3300005288 Ga0065714_10017440 Ga0065714_100174402 332
491 3300005293 Ga0065715_10001991 Ga0065715_100019915 332
492 3300005293 Ga0065715_10008446 Ga0065715_100084465 332
493 3300005347 Ga0070668_100004046 Ga0070668_1000040462 332
494 3300005353 Ga0070669_100039609 Ga0070669_1000396092 332
495 3300025923 Ga0207681_10046931 Ga0207681_100469312 332
496 3300025972 Ga0207668_10019101 Ga0207668_100191012 332
497 3300031616 Ga0307508_10027818 Ga0307508_100278184 332
498 3300031733 Ga0316577_10056979 Ga0316577_100569792 332
499 3300031824 Ga0307413_10226927 Ga0307413_102269272 332
500 3300032004 Ga0307414_10002330 Ga0307414_100023304 332
501 3300032004 Ga0307414_10321320 Ga0307414_103213201 332
502 3300033179 Ga0307507_10191851 Ga0307507_101918511 332
503 3300036712 Ga0316584_0004592 Ga0316584_0004592_1257_2306 332
504 3300041404 Ga0439436_0032731 Ga0439436_0032731_289_1350 332
505 3300048920 Ga0496117_0018836 Ga0496117_0018836_436_1449 332
506 3300048921 Ga0496118_0001867 Ga0496118_0001867_14788_15801 332
507 3300049571 Ga0501034_0000404 Ga0501034_0000404_55083_56087 332
508 3300049763 Ga0501266_001423 Ga0501266_001423_388_1392 332
509 3300055283 Ga0500661_008171 Ga0500661_008171_395_1399 332
510 iso_pu_bacteria 2524614729 2525556568 332
511 iso_pu_bacteria 2627854209 2630649797 332
512 3300003771 Ga0055526_1006479 Ga0055526_10064796 333
513 3300003773 Ga0055537_1001365 Ga0055537_100136510 333
514 3300003781 Ga0055536_1000773 Ga0055536_10007736 333
515 3300003784 Ga0055534_1000112 Ga0055534_10001121 333
516 3300003790 Ga0055528_1001337 Ga0055528_10013372 333
517 3300003791 Ga0055530_10001674 Ga0055530_1000167412 333
518 3300003791 Ga0055530_10002094 Ga0055530_1000209414 333
519 3300003794 Ga0055531_10013881 Ga0055531_100138815 333
520 3300003856 Ga0058692_1000053 Ga0058692_100005373 333
521 3300005334 Ga0068869_100355130 Ga0068869_1003551301 333
522 3300005337 Ga0070682_100053517 Ga0070682_1000535172 333
523 3300005353 Ga0070669_100180249 Ga0070669_1001802492 333
524 3300005367 Ga0070667_100050689 Ga0070667_1000506893 333
525 3300005440 Ga0070705_100173054 Ga0070705_1001730541 333
526 3300005455 Ga0070663_100105609 Ga0070663_1001056092 333
527 3300005539 Ga0068853_100294941 Ga0068853_1002949412 333
528 3300005547 Ga0070693_100005405 Ga0070693_1000054054 333
529 3300005548 Ga0070665_100050597 Ga0070665_1000505973 333
530 3300005548 Ga0070665_100067472 Ga0070665_1000674722 333
531 3300005563 Ga0068855_100005951 Ga0068855_1000059512 333
532 3300005841 Ga0068863_100018882 Ga0068863_1000188825 333
533 3300005985 Ga0081539_10008186 Ga0081539_100081869 333
534 3300006038 Ga0075365_10216007 Ga0075365_102160071 333
535 3300006178 Ga0075367_10028635 Ga0075367_100286351 333
536 3300006186 Ga0075369_10020023 Ga0075369_100200232 333
537 3300009011 Ga0105251_10002055 Ga0105251_100020558 333
538 3300009036 Ga0105244_10106462 Ga0105244_101064622 333
539 3300009148 Ga0105243_10013395 Ga0105243_100133956 333
540 3300009545 Ga0105237_10053179 Ga0105237_100531793 333
541 3300009553 Ga0105249_10173073 Ga0105249_101730732 333
542 3300010375 Ga0105239_10005391 Ga0105239_100053912 333
543 3300013104 Ga0157370_10000918 Ga0157370_100009184 333
544 3300013306 Ga0163162_10151246 Ga0163162_101512462 333
545 3300014497 Ga0182008_10000076 Ga0182008_1000007660 333
546 3300017792 Ga0163161_10002679 Ga0163161_100026794 333
547 3300025263 Ga0209565_1000060 Ga0209565_1000060119 333
548 3300025273 Ga0209673_1000047 Ga0209673_100004743 333
549 3300025291 Ga0209675_1000007 Ga0209675_1000007561 333
550 3300025292 Ga0209676_1000018 Ga0209676_100001829 333
551 3300025292 Ga0209676_1000411 Ga0209676_100041145 333
552 3300025292 Ga0209676_1001983 Ga0209676_100198314 333
553 3300025295 Ga0209564_1000252 Ga0209564_100025220 333
554 3300025298 Ga0209050_1000146 Ga0209050_100014616 333
555 3300025298 Ga0209050_1000592 Ga0209050_100059229 333
556 3300025299 Ga0209256_1005932 Ga0209256_10059323 333
557 3300025299 Ga0209256_1013442 Ga0209256_10134422 333
558 3300025303 Ga0209051_1003638 Ga0209051_10036381 333
559 3300025304 Ga0209257_1000035 Ga0209257_100003529 333
560 3300025304 Ga0209257_1000078 Ga0209257_100007897 333
561 3300025304 Ga0209257_1001448 Ga0209257_10014489 333
562 3300025304 Ga0209257_1010878 Ga0209257_10108781 333
563 3300025735 Ga0207713_1002516 Ga0207713_10025166 333
564 3300025914 Ga0207671_10071007 Ga0207671_100710072 333
565 3300025923 Ga0207681_10273924 Ga0207681_102739241 333
566 3300025935 Ga0207709_10000527 Ga0207709_1000052715 333
567 3300025942 Ga0207689_10217979 Ga0207689_102179792 333
568 3300025949 Ga0207667_10049542 Ga0207667_100495422 333
569 3300025961 Ga0207712_10024220 Ga0207712_100242202 333
570 3300026041 Ga0207639_10000437 Ga0207639_1000043727 333
571 3300026067 Ga0207678_10171560 Ga0207678_101715602 333
572 3300026116 Ga0207674_10135861 Ga0207674_101358612 333
573 3300027312 Ga0209371_1000018 Ga0209371_1000018535 333
574 3300028379 Ga0268266_10042299 Ga0268266_100422993 333
575 3300030500 Ga0268256_1000016 Ga0268256_1000016535 333
576 3300030744 Ga0316181_1160836 Ga0316181_11608361 333
577 3300030745 Ga0316182_1299775 Ga0316182_12997755 333
578 3300031548 Ga0307408_100193051 Ga0307408_1001930513 333
579 3300031911 Ga0307412_10103765 Ga0307412_101037652 333
580 3300031911 Ga0307412_10164312 Ga0307412_101643122 333
581 3300032004 Ga0307414_10102681 Ga0307414_101026812 333
582 3300032005 Ga0307411_10327448 Ga0307411_103274481 333
583 3300032005 Ga0307411_10390328 Ga0307411_103903281 333
584 3300038705 Ga0237819_04072 Ga0237819_04072_1163_2173 333
585 3300044712 Ga0453684_0000531 Ga0453684_0000531_58002_59015 333
586 3300045051 Ga0451576_0000212 Ga0451576_0000212_58008_59021 333
587 3300046460 Ga0495638_0000526 Ga0495638_0000526_3560_4570 333
588 3300046518 Ga0495631_0003548 Ga0495631_0003548_7233_8243 333
589 3300046522 Ga0495643_0010311 Ga0495643_0010311_2725_3735 333
590 3300046525 Ga0495663_0003392 Ga0495663_0003392_3176_4204 333
591 3300046525 Ga0495663_0007926 Ga0495663_0007926_28_1038 333
592 3300046558 Ga0495633_0053967 Ga0495633_0053967_303_1313 333
593 3300046660 Ga0495625_0107781 Ga0495625_0107781_796_1806 333
594 3300047320 Ga0495672_0000087 Ga0495672_0000087_11453_12463 333
595 3300047472 Ga0495686_0038417 Ga0495686_0038417_126_1136 333
596 3300048090 Ga0495615_0003458 Ga0495615_0003458_792_1796 333
597 3300048920 Ga0496117_0001430 Ga0496117_0001430_23328_24338 333
598 3300048920 Ga0496117_0007883 Ga0496117_0007883_1737_2747 333
599 3300048921 Ga0496118_0001349 Ga0496118_0001349_23329_24339 333
600 3300048921 Ga0496118_0003009 Ga0496118_0003009_13757_14767 333
601 3300048921 Ga0496118_0035939 Ga0496118_0035939_17_1027 333
602 3300048924 Ga0496121_0009703 Ga0496121_0009703_2481_3491 333
603 3300048925 Ga0496122_0008629 Ga0496122_0008629_9647_10657 333
604 3300048927 Ga0496124_0000006 Ga0496124_0000006_364773_365783 333
605 3300048927 Ga0496124_0001552 Ga0496124_0001552_11492_12502 333
606 3300048927 Ga0496124_0019869 Ga0496124_0019869_1344_2354 333
607 3300048927 Ga0496124_0030860 Ga0496124_0030860_471_1481 333
608 3300048927 Ga0496124_0038566 Ga0496124_0038566_2823_3833 333
609 3300048927 Ga0496124_0127669 Ga0496124_0127669_967_1977 333
610 3300048928 Ga0496125_0014536 Ga0496125_0014536_3052_4062 333
611 3300048928 Ga0496125_0077822 Ga0496125_0077822_27_1037 333
612 3300048929 Ga0496126_0269868 Ga0496126_0269868_87_1097 333
613 3300053093 Ga0500651_0006630 Ga0500651_0006630_2934_3941 333
614 3300003771 Ga0055526_1000014 Ga0055526_100001418 334
615 3300003773 Ga0055537_1000059 Ga0055537_100005913 334
616 3300003775 Ga0055524_1000019 Ga0055524_1000019198 334
617 3300003784 Ga0055534_1000012 Ga0055534_100001218 334
618 3300003790 Ga0055528_1000007 Ga0055528_100000718 334
619 3300003794 Ga0055531_10018425 Ga0055531_100184252 334
620 3300003856 Ga0058692_1000065 Ga0058692_100006527 334
621 3300005289 Ga0065704_10072499 Ga0065704_100724998 334
622 3300005331 Ga0070670_100001962 Ga0070670_1000019628 334
623 3300005338 Ga0068868_100006535 Ga0068868_1000065356 334
624 3300005355 Ga0070671_100069039 Ga0070671_1000690395 334
625 3300005355 Ga0070671_100082960 Ga0070671_1000829602 334
626 3300005367 Ga0070667_100022905 Ga0070667_1000229053 334
627 3300005367 Ga0070667_100023232 Ga0070667_1000232324 334
628 3300005367 Ga0070667_100081048 Ga0070667_1000810482 334
629 3300005455 Ga0070663_100006318 Ga0070663_1000063182 334
630 3300005457 Ga0070662_100001452 Ga0070662_1000014524 334
631 3300005543 Ga0070672_100004334 Ga0070672_1000043348 334
632 3300005548 Ga0070665_100000394 Ga0070665_10000039444 334
633 3300005563 Ga0068855_100497865 Ga0068855_1004978652 334
634 3300005616 Ga0068852_100029267 Ga0068852_1000292672 334
635 3300005719 Ga0068861_100061050 Ga0068861_1000610502 334
636 3300005834 Ga0068851_10000308 Ga0068851_100003085 334
637 3300005842 Ga0068858_100008594 Ga0068858_1000085942 334
638 3300006051 Ga0075364_10002739 Ga0075364_100027397 334
639 3300006237 Ga0097621_100164034 Ga0097621_1001640341 334
640 3300006881 Ga0068865_100027085 Ga0068865_1000270852 334
641 3300009011 Ga0105251_10000205 Ga0105251_100002058 334
642 3300009036 Ga0105244_10021621 Ga0105244_100216212 334
643 3300009093 Ga0105240_10489488 Ga0105240_104894881 334
644 3300009098 Ga0105245_10083715 Ga0105245_100837152 334
645 3300009148 Ga0105243_10002435 Ga0105243_1000243511 334
646 3300009545 Ga0105237_10388462 Ga0105237_103884622 334
647 3300009551 Ga0105238_10011923 Ga0105238_100119234 334
648 3300009553 Ga0105249_10001097 Ga0105249_100010978 334
649 3300010375 Ga0105239_10331311 Ga0105239_103313112 334
650 3300013102 Ga0157371_10000397 Ga0157371_1000039730 334
651 3300013105 Ga0157369_10263395 Ga0157369_102633952 334
652 3300013297 Ga0157378_10254634 Ga0157378_102546342 334
653 3300013308 Ga0157375_10004149 Ga0157375_1000414914 334
654 3300015262 Ga0182007_10000079 Ga0182007_1000007913 334
655 3300015265 Ga0182005_1000166 Ga0182005_10001665 334
656 3300015265 Ga0182005_1002582 Ga0182005_10025822 334
657 3300015689 Ga0183360_10002 Ga0183360_10002770 334
658 3300020075 Ga0206349_1121353 Ga0206349_11213533 334
659 3300025263 Ga0209565_1000001 Ga0209565_1000001439 334
660 3300025263 Ga0209565_1004771 Ga0209565_10047714 334
661 3300025273 Ga0209673_1000001 Ga0209673_1000001439 334
662 3300025291 Ga0209675_1000001 Ga0209675_10000012093 334
663 3300025295 Ga0209564_1000001 Ga0209564_10000012255 334
664 3300025299 Ga0209256_1000006 Ga0209256_1000006691 334
665 3300025304 Ga0209257_1000642 Ga0209257_10006427 334
666 3300025321 Ga0207656_10000283 Ga0207656_100002837 334
667 3300025735 Ga0207713_1000196 Ga0207713_100019627 334
668 3300025903 Ga0207680_10011565 Ga0207680_100115652 334
669 3300025904 Ga0207647_10001796 Ga0207647_100017965 334
670 3300025911 Ga0207654_10031499 Ga0207654_100314992 334
671 3300025913 Ga0207695_10015003 Ga0207695_100150032 334
672 3300025913 Ga0207695_10042105 Ga0207695_100421053 334
673 3300025914 Ga0207671_10009290 Ga0207671_100092904 334
674 3300025924 Ga0207694_10001852 Ga0207694_1000185213 334
675 3300025925 Ga0207650_10001926 Ga0207650_100019267 334
676 3300025931 Ga0207644_10017204 Ga0207644_100172042 334
677 3300025933 Ga0207706_10000876 Ga0207706_100008765 334
678 3300025935 Ga0207709_10002230 Ga0207709_100022304 334
679 3300025937 Ga0207669_10014325 Ga0207669_100143252 334
680 3300025938 Ga0207704_10082336 Ga0207704_100823362 334
681 3300025940 Ga0207691_10007375 Ga0207691_100073755 334
682 3300025942 Ga0207689_10017785 Ga0207689_100177856 334
683 3300025944 Ga0207661_10071965 Ga0207661_100719655 334
684 3300025949 Ga0207667_10287852 Ga0207667_102878522 334
685 3300025961 Ga0207712_10000120 Ga0207712_1000012044 334
686 3300025986 Ga0207658_10004845 Ga0207658_100048454 334
687 3300025986 Ga0207658_10124864 Ga0207658_101248642 334
688 3300025986 Ga0207658_10262455 Ga0207658_102624552 334
689 3300026035 Ga0207703_10028041 Ga0207703_100280412 334
690 3300026041 Ga0207639_10000236 Ga0207639_1000023632 334
691 3300026041 Ga0207639_10057841 Ga0207639_100578412 334
692 3300026067 Ga0207678_10012827 Ga0207678_100128272 334
693 3300026078 Ga0207702_10027877 Ga0207702_100278773 334
694 3300026118 Ga0207675_100070634 Ga0207675_1000706342 334
695 3300026142 Ga0207698_10142520 Ga0207698_101425202 334
696 3300027312 Ga0209371_1000025 Ga0209371_100002542 334
697 3300028379 Ga0268266_10000007 Ga0268266_10000007171 334
698 3300030500 Ga0268256_1000027 Ga0268256_100002742 334
699 3300032004 Ga0307414_10128603 Ga0307414_101286032 334
700 3300037418 Ga0395900_0078437 Ga0395900_0078437_1484_2497 334
701 3300037418 Ga0395900_0391702 Ga0395900_0391702_81_1094 334
702 3300037471 Ga0395905_0002925 Ga0395905_0002925_862_1875 334
703 3300038443 Ga0395901_0006253 Ga0395901_0006253_10033_11046 334
704 3300038705 Ga0237819_00598 Ga0237819_00598_6256_7269 334
705 3300041413 Ga0439465_0002680 Ga0439465_0002680_1934_2944 334
706 3300041452 Ga0451793_0608164 Ga0451793_0608164_1695_2705 334
707 3300041462 Ga0451806_117351 Ga0451806_117351_3847_4857 334
708 3300041498 Ga0451841_0688799 Ga0451841_0688799_385_1422 334
709 3300041509 Ga0451843_0273968 Ga0451843_0273968_270_1298 334
710 3300042007 Ga0439449_0000582 Ga0439449_0000582_6655_7665 334
711 3300042015 Ga0439462_0022440 Ga0439462_0022440_429_1442 334
712 3300046460 Ga0495638_0052794 Ga0495638_0052794_1392_2402 334
713 3300046501 Ga0495607_0079949 Ga0495607_0079949_325_1335 334
714 3300046507 Ga0495606_0005893 Ga0495606_0005893_8375_9385 334
715 3300046537 Ga0495598_0004631 Ga0495598_0004631_1619_2635 334
716 3300046539 Ga0495621_0020577 Ga0495621_0020577_701_1717 334
717 3300046664 Ga0495659_0017398 Ga0495659_0017398_369_1376 334
718 3300047318 Ga0495636_0004749 Ga0495636_0004749_3661_4668 334
719 3300048904 Ga0496101_0109743 Ga0496101_0109743_562_1575 334
720 3300048908 Ga0496105_0029746 Ga0496105_0029746_274_1287 334
721 3300048915 Ga0496112_0324194 Ga0496112_0324194_308_1318 334
722 3300048919 Ga0496116_0078873 Ga0496116_0078873_829_1842 334
723 3300048920 Ga0496117_0009829 Ga0496117_0009829_6452_7462 334
724 3300048920 Ga0496117_0091047 Ga0496117_0091047_676_1689 334
725 3300048921 Ga0496118_0030781 Ga0496118_0030781_2955_3968 334
726 3300048921 Ga0496118_0120660 Ga0496118_0120660_634_1644 334
727 3300048922 Ga0496119_0000711 Ga0496119_0000711_30595_31608 334
728 3300048922 Ga0496119_0001836 Ga0496119_0001836_22107_23117 334
729 3300048923 Ga0496120_0000273 Ga0496120_0000273_62579_63589 334
730 3300048923 Ga0496120_0000727 Ga0496120_0000727_34003_35016 334
731 3300048925 Ga0496122_0000417 Ga0496122_0000417_72598_73608 334
732 3300048925 Ga0496122_0009264 Ga0496122_0009264_3987_5015 334
733 3300048926 Ga0496123_0000137 Ga0496123_0000137_127989_128999 334
734 3300048927 Ga0496124_0003391 Ga0496124_0003391_16838_17848 334
735 3300048927 Ga0496124_0003834 Ga0496124_0003834_107_1120 334
736 3300048928 Ga0496125_0030941 Ga0496125_0030941_900_1913 334
737 3300048928 Ga0496125_0110368 Ga0496125_0110368_214_1227 334
738 3300048929 Ga0496126_0003861 Ga0496126_0003861_17410_18423 334
739 3300049705 Ga0501225_0007795 Ga0501225_0007795_984_1994 334
740 3300050491 nmdc:mga00v17_2252_c1 nmdc:mga00v17_2252_c1_1796_2806 334
741 3300053161 Ga0500634_0000377 Ga0500634_0000377_3615_4628 334
742 iso_pu_bacteria 2643221579 2643905851 334
743 iso_pu_bacteria 2643221581 2643914735 334
744 iso_pu_bacteria 2923516293 2923517194 334
745 3300003187 JGI25151J46595_10000102 JGI25151J46595_100001026 335
746 3300003187 JGI25151J46595_10003508 JGI25151J46595_100035085 335
747 3300003771 Ga0055526_1017503 Ga0055526_10175032 335
748 3300003775 Ga0055524_1036000 Ga0055524_10360001 335
749 3300003775 Ga0055524_1036005 Ga0055524_10360051 335
750 3300003781 Ga0055536_1016739 Ga0055536_10167392 335
751 3300003781 Ga0055536_1028308 Ga0055536_10283082 335
752 3300003791 Ga0055530_10008584 Ga0055530_100085845 335
753 3300003794 Ga0055531_10015740 Ga0055531_100157402 335
754 3300003794 Ga0055531_10035979 Ga0055531_100359791 335
755 3300003794 Ga0055531_10041479 Ga0055531_100414791 335
756 3300014497 Ga0182008_10126418 Ga0182008_101264182 335
757 3300017792 Ga0163161_10021626 Ga0163161_100216265 335
758 3300025245 Ga0207425_1017410 Ga0207425_10174101 335
759 3300025273 Ga0209673_1004700 Ga0209673_10047007 335
760 3300025284 Ga0209130_1002163 Ga0209130_100216310 335
761 3300025292 Ga0209676_1003671 Ga0209676_10036712 335
762 3300025292 Ga0209676_1010297 Ga0209676_10102972 335
763 3300025294 Ga0209025_1000006 Ga0209025_1000006652 335
764 3300025294 Ga0209025_1002898 Ga0209025_10028985 335
765 3300025295 Ga0209564_1008800 Ga0209564_10088002 335
766 3300025297 Ga0209758_1006577 Ga0209758_10065773 335
767 3300025298 Ga0209050_1003938 Ga0209050_10039385 335
768 3300025299 Ga0209256_1005338 Ga0209256_10053382 335
769 3300025299 Ga0209256_1010244 Ga0209256_10102445 335
770 3300025299 Ga0209256_1013376 Ga0209256_10133764 335
771 3300025304 Ga0209257_1000414 Ga0209257_100041420 335
772 3300025304 Ga0209257_1003369 Ga0209257_100336911 335
773 3300025304 Ga0209257_1006510 Ga0209257_10065102 335
774 3300025304 Ga0209257_1013090 Ga0209257_10130904 335
775 3300030731 Ga0316177_1045917 Ga0316177_10459173 335
776 3300030733 Ga0314311_1009359 Ga0314311_10093592 335
777 3300031824 Ga0307413_10021709 Ga0307413_100217094 335
778 3300032002 Ga0307416_100024526 Ga0307416_1000245262 335
779 3300032004 Ga0307414_10035418 Ga0307414_100354182 335
780 3300032004 Ga0307414_10146111 Ga0307414_101461112 335
781 3300041404 Ga0439436_0010843 Ga0439436_0010843_1620_2633 335
782 3300041407 Ga0439447_000276 Ga0439447_000276_8679_9719 335
783 3300046525 Ga0495663_0017245 Ga0495663_0017245_588_1628 335
784 3300046664 Ga0495659_0042025 Ga0495659_0042025_294_1319 335
785 3300047318 Ga0495636_0030269 Ga0495636_0030269_245_1270 335
786 3300048920 Ga0496117_0028737 Ga0496117_0028737_1830_2846 335
787 3300048927 Ga0496124_0034545 Ga0496124_0034545_1358_2374 335
788 3300049579 Ga0501043_0001302 Ga0501043_0001302_9976_10989 335
789 3300013307 Ga0157372_10051825 Ga0157372_100518254 336
790 3300025294 Ga0209025_1011601 Ga0209025_10116012 336
791 3300032004 Ga0307414_10043563 Ga0307414_100435631 336
792 3300036401 Ga0373937_0519868 Ga0373937_0519868_14_1042 336
793 3300037471 Ga0395905_0115628 Ga0395905_0115628_1359_2378 336
794 3300042007 Ga0439449_0005572 Ga0439449_0005572_3006_4022 336
795 3300042014 Ga0439457_014730 Ga0439457_014730_237_1274 336
796 3300046615 Ga0495656_0003859 Ga0495656_0003859_2308_3327 336
797 3300047318 Ga0495636_0006456 Ga0495636_0006456_3139_4158 336
798 3300049569 Ga0501032_0115088 Ga0501032_0115088_672_1706 336
799 3300049579 Ga0501043_0034199 Ga0501043_0034199_2849_3883 336
800 3300049581 Ga0501047_0400771 Ga0501047_0400771_115_1149 336
801 3300049586 Ga0501070_0053490 Ga0501070_0053490_1657_2691 336
802 3300049822 Ga0501035_0013478 Ga0501035_0013478_1532_2566 336
803 3300049823 Ga0501044_0051173 Ga0501044_0051173_2984_4018 336
804 3300009093 Ga0105240_10004247 Ga0105240_100042478 337
805 3300009174 Ga0105241_10122713 Ga0105241_101227132 337
806 3300013105 Ga0157369_10273993 Ga0157369_102739931 337
807 3300025913 Ga0207695_10048332 Ga0207695_100483323 337
808 3300027665 Ga0209983_1001045 Ga0209983_10010453 337
809 3300027682 Ga0209971_1006224 Ga0209971_10062242 337
810 3300027876 Ga0209974_10004142 Ga0209974_100041426 337
811 2162886007 SwRhRL2b_contig_1097717 SwRhRL2b_0990.00006070 338
812 3300003781 Ga0055536_1010813 Ga0055536_10108132 338
813 3300005289 Ga0065704_10070850 Ga0065704_100708502 338
814 3300013102 Ga0157371_10053932 Ga0157371_100539322 338
815 3300025292 Ga0209676_1000360 Ga0209676_100036022 338
816 3300031901 Ga0307406_10003433 Ga0307406_100034333 338
817 3300032004 Ga0307414_10000928 Ga0307414_100009284 338
818 3300039145 Ga0237816_00007 Ga0237816_00007_5909_6940 338

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04055

Radical_SAM

Radical SAM superfamily

95

259

0.94

PF16881

LIAS_N

N-terminal domain of lipoyl synthase of Radical_SAM family

28

80

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4u0o-assembly1.cif.gz_B crystal structure of thermosynechococcus elongatus lipoyl synthase 2 complexed with mta and dtt 0.9124 49 323
4u0p-assembly1.cif.gz_B the crystal structure of lipoyl synthase in complex with s-adenosyl homocysteine 0.9072 47 323
5exk-assembly6.cif.gz_K crystal structure of m. tuberculosis lipoyl synthase with 6-thiooctanoyl peptide intermediate 0.9038 44 329
4u0o-assembly1.cif.gz_B crystal structure of thermosynechococcus elongatus lipoyl synthase 2 complexed with mta and dtt 0.9028 49 323
4u0p-assembly1.cif.gz_B the crystal structure of lipoyl synthase in complex with s-adenosyl homocysteine 0.8828 47 323
ID Description Score Start End Superfamily
af_P60716_82_298_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9409 92 310 3.20.20.70
af_P60716_82_298_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9367 92 310 3.20.20.70
af_Q2FZX4_3_265_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.927 40 303 3.20.20.70
af_Q2FZX4_3_265_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9202 40 303 3.20.20.70
af_P0CH67_115_331_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9081 94 298 3.20.20.70
ID Description Score Start End GO Terms
AF-T1A2Y7-F1-model_v4 Lipoyl synthase 0.9831 162 296 GO:0016992
GO:0046872
GO:0051539
AF-A0A8A7QWW1-F1-model_v4 deleted 0.9764 189 305
AF-T1A2Y7-F1-model_v4 Lipoyl synthase 0.9759 162 296 GO:0016992
GO:0046872
GO:0051539
AF-A0A367LWG9-F1-model_v4 Lipoyl synthase (EC 2.8.1.8) 0.9758 161 279 GO:0016992
GO:0046872
GO:0051539
AF-A0A1B1TG46-F1-model_v4 Radical SAM core domain-containing protein 0.968 222 320 GO:0016992
GO:0046872
GO:0051539

Feature Viewer

pLDDT pTM Quality
77.06 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map