F482143
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 818 | 378 | 755 | 335 |
Family's Representative Sequence
| Representative Sequence | 3300049513|Ga0501290_001810|Ga0501290_001810_474_1520 |
| Length | 328 |
| Sequence | MSTPAEKSIPLTVVADTPAPGMLQVAGDKIARSPVQFADAPVLRKPSWIRVRIPSGNAVQNLKAKLRENRLVTVCEEASCPNIHECFSHGTATFMILGEVCTRRCSFCDVAHGRPKPPDPSEPLSLARTIADMRLKYVVITSVDDLRDGGASHFVDCIAAIREFSPRTKIEILTPDFRGKGRMERALEILATNPPDVFNHNLETVPDLYRNVRPGADYQWSLTLLQKFKAQHPDVATKSGIMLGLGETMEQVELTLRDLRAHDVDMVTIGQYLQPSPHHHPVMRYWTPDEFKALEDYGMALGFTHVASGPMVRSSYHADKQAADAGFA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2524614729 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 3 | 2547132130 | Stenotrophomonas maltophilia RR-10 | Isolate | Unclassified |
| 4 | 2571042365 | Lysobacter oryzae DSM 21044 | Isolate | Rhizosphere |
| 5 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 6 | 2627854209 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 7 | 2643221559 | Lysobacter sp. Root559 | Isolate | Unclassified |
| 8 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 9 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 10 | 2643221579 | Pseudoxanthomonas sp. Root630 | Isolate | Unclassified |
| 11 | 2643221581 | Pseudoxanthomonas sp. Root65 | Isolate | Unclassified |
| 12 | 2643221586 | Lysobacter sp. Root667 | Isolate | Unclassified |
| 13 | 2643221593 | Lysobacter sp. Root690 | Isolate | Unclassified |
| 14 | 2643221612 | Lysobacter sp. Root76 | Isolate | Unclassified |
| 15 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 16 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 17 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 18 | 2643221727 | Lysobacter sp. Root96 | Isolate | Unclassified |
| 19 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 20 | 2747842428 | Stenotrophomonas sp. WCS2014-113 | Isolate | Unclassified |
| 21 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 22 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 23 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 24 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 25 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 26 | 2842757796 | Stenotrophomonas sp. R-72406 | Isolate | Unclassified |
| 27 | 2842780639 | Pseudoxanthomonas sp. R-71986 | Isolate | Unclassified |
| 28 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 29 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 30 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 31 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 32 | 2874220319 | Stenotrophomonas maltophilia PS5 | Isolate | Unclassified |
| 33 | 2894414249 | Luteimonas sp. LNNU 24178 | Isolate | Rhizosphere |
| 34 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 35 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 36 | 2895522137 | Pseudoxanthomonas sp. SGNA-20 | Isolate | Rhizosphere |
| 37 | 2895525241 | Pseudoxanthomonas sp. SGT-18 | Isolate | Rhizosphere |
| 38 | 2919089067 | Stenotrophomonas sp. 1337 | Isolate | Rhizosphere |
| 39 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 40 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 41 | 2919513703 | Luteimonas sp. 3794 | Isolate | Unclassified |
| 42 | 2919675420 | Luteimonas terrae 4099 | Isolate | Unclassified |
| 43 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 44 | 2928496128 | Stenotrophomonas indicatrix 1163 | Isolate | Unclassified |
| 45 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 46 | 2931380184 | Stenotrophomonas sp. DR822 | Isolate | Rhizosphere |
| 47 | 2937610967 | Stenotrophomonas maltophilia EP20 | Isolate | Unclassified |
| 48 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 49 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 50 | 2939626828 | Stenotrophomonas sp. 2694 | Isolate | Rhizosphere |
| 51 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 52 | 2941489479 | Lysobacter enzymogenes 2943 | Isolate | Rhizosphere |
| 53 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 54 | 2961047084 | Stenotrophomonas maltophilia EP5 | Isolate | Unclassified |
| 55 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 56 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 57 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 58 | 2984514374 | Stenotrophomonas sp. SORGH_AS282 | Isolate | Aerial Root |
| 59 | 2987605356 | Stenotrophomonas sp. ATCM1_4 | Isolate | Unclassified |
| 60 | 2995948881 | Lysobacter enzymogenes B25 | Isolate | Unclassified |
| 61 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 62 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 63 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 64 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 65 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 66 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 67 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 68 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 69 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 70 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 71 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 72 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 73 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 74 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 75 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 76 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 77 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 78 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 79 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 81 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 83 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 85 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 86 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 100 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 101 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 102 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 103 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 104 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 105 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 109 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 110 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 111 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 112 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 113 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 114 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 115 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 116 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 117 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 118 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 119 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 120 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 121 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 122 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 123 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 124 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 125 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 126 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 127 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 128 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 130 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 131 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009979 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG | Metagenome | Rhizosphere |
| 144 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 156 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 159 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 160 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 161 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 162 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 164 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 167 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 168 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 170 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 171 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 173 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 176 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 179 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 233 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 234 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 235 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 236 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 237 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 238 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 239 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 240 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 241 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 242 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 243 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 244 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 245 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 246 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 247 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 248 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 249 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 250 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 251 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 252 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 253 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 254 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 255 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 256 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 257 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 258 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 259 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 260 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 261 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 262 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 263 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 264 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 265 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 266 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 267 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 268 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 269 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 270 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 271 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 272 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 273 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 274 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 275 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 276 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 277 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 278 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 279 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 280 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 281 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 282 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 283 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 284 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 285 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 286 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 287 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 288 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 316 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 317 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 318 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 319 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 320 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 321 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 322 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 323 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 324 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 325 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 326 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 327 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 328 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 329 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 330 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 331 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 332 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 355 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 360 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 361 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 365 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 366 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 367 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 368 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 369 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 370 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 371 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 372 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 374 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 375 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
| 376 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
| 377 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 378 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.18 |
| Metatranscriptomes | 0.12 |
| Isolates | 7.7 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.12 |
| Bulb | 0 |
| Endosphere | 11.98 |
| Nodule | 0.12 |
| Rhizoplane | 1.1 |
| Rhizosphere | 74.57 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1097717 | 2162886007 | Bacteria | 5538 |
| 2 | JGI24736J21556_1013961 | 3300001904 | Bacteria | 1294 |
| 3 | JGI25152J39213_1000103 | 3300002773 | Bacteria | 59472 |
| 4 | JGI25150J39212_1000183 | 3300002774 | Bacteria | 35389 |
| 5 | JGI25151J46595_10000102 | 3300003187 | Bacteria | 114881 |
| 6 | JGI25151J46595_10000271 | 3300003187 | Bacteria | 59472 |
| 7 | JGI25151J46595_10003508 | 3300003187 | Bacteria | 8641 |
| 8 | JGI25153J46596_10000190 | 3300003215 | Bacteria | 59472 |
| 9 | Ga0055526_1000014 | 3300003771 | Bacteria | 233327 |
| 10 | Ga0055526_1006479 | 3300003771 | Bacteria | 6343 |
| 11 | Ga0055526_1017503 | 3300003771 | Bacteria | 2732 |
| 12 | Ga0055537_1000059 | 3300003773 | Bacteria | 79628 |
| 13 | Ga0055537_1001365 | 3300003773 | Bacteria | 9847 |
| 14 | Ga0055524_1000019 | 3300003775 | Bacteria | 233561 |
| 15 | Ga0055524_1036000 | 3300003775 | Bacteria | 1339 |
| 16 | Ga0055524_1036005 | 3300003775 | Bacteria | 1339 |
| 17 | Ga0055536_1000773 | 3300003781 | Bacteria | 21299 |
| 18 | Ga0055536_1010813 | 3300003781 | Bacteria | 3573 |
| 19 | Ga0055536_1016739 | 3300003781 | Bacteria | 2437 |
| 20 | Ga0055536_1028308 | 3300003781 | Bacteria | 1529 |
| 21 | Ga0055534_1000012 | 3300003784 | Bacteria | 153530 |
| 22 | Ga0055534_1000112 | 3300003784 | Bacteria | 59920 |
| 23 | Ga0055528_1000007 | 3300003790 | Bacteria | 233327 |
| 24 | Ga0055528_1001337 | 3300003790 | Bacteria | 15339 |
| 25 | Ga0055530_10001674 | 3300003791 | Bacteria | 15731 |
| 26 | Ga0055530_10002094 | 3300003791 | Bacteria | 13328 |
| 27 | Ga0055530_10008584 | 3300003791 | Bacteria | 4064 |
| 28 | Ga0055540_1034558 | 3300003792 | Bacteria | 1137 |
| 29 | Ga0055531_10013881 | 3300003794 | Bacteria | 3678 |
| 30 | Ga0055531_10015740 | 3300003794 | Bacteria | 3310 |
| 31 | Ga0055531_10018425 | 3300003794 | Bacteria | 2881 |
| 32 | Ga0055531_10035979 | 3300003794 | Bacteria | 1538 |
| 33 | Ga0055531_10041479 | 3300003794 | Bacteria | 1332 |
| 34 | Ga0058692_1000053 | 3300003856 | Bacteria | 107166 |
| 35 | Ga0058692_1000065 | 3300003856 | Bacteria | 89723 |
| 36 | Ga0065714_10017440 | 3300005288 | Bacteria | 3114 |
| 37 | Ga0065704_10070850 | 3300005289 | Bacteria | 15417 |
| 38 | Ga0065704_10072499 | 3300005289 | Bacteria | 8420 |
| 39 | Ga0065715_10001991 | 3300005293 | Bacteria | 6051 |
| 40 | Ga0065715_10008446 | 3300005293 | Bacteria | 3910 |
| 41 | Ga0070658_10007622 | 3300005327 | Bacteria | 8729 |
| 42 | Ga0070658_10061938 | 3300005327 | Bacteria | 3049 |
| 43 | Ga0070683_100207011 | 3300005329 | Bacteria | 1863 |
| 44 | Ga0070670_100001962 | 3300005331 | Bacteria | 16837 |
| 45 | Ga0070670_100147541 | 3300005331 | Bacteria | 2035 |
| 46 | Ga0070670_100197263 | 3300005331 | Bacteria | 1749 |
| 47 | Ga0068869_100079398 | 3300005334 | Bacteria | 2446 |
| 48 | Ga0068869_100355130 | 3300005334 | Bacteria | 1196 |
| 49 | Ga0070666_10000022 | 3300005335 | Bacteria | 166910 |
| 50 | Ga0070666_10000442 | 3300005335 | Bacteria | 25310 |
| 51 | Ga0070666_10086043 | 3300005335 | Bacteria | 2153 |
| 52 | Ga0070666_10118619 | 3300005335 | Bacteria | 1834 |
| 53 | Ga0070666_10260359 | 3300005335 | Bacteria | 1230 |
| 54 | Ga0070682_100000806 | 3300005337 | Bacteria | 18399 |
| 55 | Ga0070682_100053517 | 3300005337 | Bacteria | 2530 |
| 56 | Ga0070682_100088428 | 3300005337 | Bacteria | 2022 |
| 57 | Ga0068868_100006535 | 3300005338 | Bacteria | 8257 |
| 58 | Ga0068868_100128293 | 3300005338 | Bacteria | 2073 |
| 59 | Ga0070661_100009383 | 3300005344 | Bacteria | 6771 |
| 60 | Ga0070661_100015590 | 3300005344 | Bacteria | 5364 |
| 61 | Ga0070661_100124692 | 3300005344 | Bacteria | 1931 |
| 62 | Ga0070668_100004046 | 3300005347 | Bacteria | 10853 |
| 63 | Ga0070668_100156977 | 3300005347 | Bacteria | 1844 |
| 64 | Ga0070669_100039609 | 3300005353 | Bacteria | 3425 |
| 65 | Ga0070669_100180249 | 3300005353 | Bacteria | 1652 |
| 66 | Ga0070675_100387590 | 3300005354 | Bacteria | 1245 |
| 67 | Ga0070671_100045193 | 3300005355 | Bacteria | 3661 |
| 68 | Ga0070671_100069039 | 3300005355 | Bacteria | 2947 |
| 69 | Ga0070671_100082960 | 3300005355 | Bacteria | 2680 |
| 70 | Ga0070674_100082237 | 3300005356 | Bacteria | 2303 |
| 71 | Ga0070673_100111799 | 3300005364 | Bacteria | 2267 |
| 72 | Ga0070659_100011336 | 3300005366 | Bacteria | 6591 |
| 73 | Ga0070659_100018023 | 3300005366 | Bacteria | 5324 |
| 74 | Ga0070659_100067261 | 3300005366 | Bacteria | 2841 |
| 75 | Ga0070667_100000049 | 3300005367 | Bacteria | 158483 |
| 76 | Ga0070667_100005400 | 3300005367 | Bacteria | 10674 |
| 77 | Ga0070667_100022905 | 3300005367 | Bacteria | 5179 |
| 78 | Ga0070667_100023232 | 3300005367 | Bacteria | 5144 |
| 79 | Ga0070667_100041398 | 3300005367 | Bacteria | 3865 |
| 80 | Ga0070667_100050689 | 3300005367 | Bacteria | 3499 |
| 81 | Ga0070667_100081048 | 3300005367 | Bacteria | 2777 |
| 82 | Ga0070667_100082066 | 3300005367 | Bacteria | 2759 |
| 83 | Ga0070667_100139793 | 3300005367 | Bacteria | 2120 |
| 84 | Ga0070667_100155273 | 3300005367 | Bacteria | 2012 |
| 85 | Ga0070667_100447199 | 3300005367 | Bacteria | 1180 |
| 86 | Ga0070705_100173054 | 3300005440 | Bacteria | 1455 |
| 87 | Ga0070663_100000042 | 3300005455 | Bacteria | 57899 |
| 88 | Ga0070663_100006318 | 3300005455 | Bacteria | 7114 |
| 89 | Ga0070663_100105609 | 3300005455 | Bacteria | 2108 |
| 90 | Ga0070663_100319566 | 3300005455 | Bacteria | 1248 |
| 91 | Ga0070678_100108757 | 3300005456 | Bacteria | 2165 |
| 92 | Ga0070662_100001452 | 3300005457 | Bacteria | 14621 |
| 93 | Ga0070681_10009167 | 3300005458 | Bacteria | 9724 |
| 94 | Ga0070681_10013412 | 3300005458 | Bacteria | 8141 |
| 95 | Ga0068867_100032307 | 3300005459 | Bacteria | 3785 |
| 96 | Ga0068867_100090251 | 3300005459 | Bacteria | 2324 |
| 97 | Ga0068867_100140107 | 3300005459 | Bacteria | 1890 |
| 98 | Ga0070685_10007386 | 3300005466 | Bacteria | 5621 |
| 99 | Ga0070679_100175899 | 3300005530 | Bacteria | 2113 |
| 100 | Ga0070684_100024537 | 3300005535 | Bacteria | 5060 |
| 101 | Ga0070684_100048363 | 3300005535 | Bacteria | 3690 |
| 102 | Ga0068853_100000720 | 3300005539 | Bacteria | 22869 |
| 103 | Ga0068853_100004195 | 3300005539 | Bacteria | 11116 |
| 104 | Ga0068853_100007213 | 3300005539 | Bacteria | 8902 |
| 105 | Ga0068853_100011114 | 3300005539 | Bacteria | 7303 |
| 106 | Ga0068853_100028892 | 3300005539 | Bacteria | 4668 |
| 107 | Ga0068853_100033305 | 3300005539 | Bacteria | 4371 |
| 108 | Ga0068853_100148770 | 3300005539 | Bacteria | 2106 |
| 109 | Ga0068853_100294941 | 3300005539 | Bacteria | 1497 |
| 110 | Ga0070672_100003657 | 3300005543 | Bacteria | 9989 |
| 111 | Ga0070672_100004334 | 3300005543 | Bacteria | 9283 |
| 112 | Ga0070693_100005405 | 3300005547 | Bacteria | 6129 |
| 113 | Ga0070693_100012299 | 3300005547 | Bacteria | 4328 |
| 114 | Ga0070665_100000028 | 3300005548 | Bacteria | 351357 |
| 115 | Ga0070665_100000394 | 3300005548 | Bacteria | 64434 |
| 116 | Ga0070665_100008261 | 3300005548 | Bacteria | 10529 |
| 117 | Ga0070665_100010878 | 3300005548 | Bacteria | 9204 |
| 118 | Ga0070665_100027661 | 3300005548 | Bacteria | 5710 |
| 119 | Ga0070665_100050597 | 3300005548 | Bacteria | 4169 |
| 120 | Ga0070665_100067472 | 3300005548 | Bacteria | 3587 |
| 121 | Ga0070665_100159083 | 3300005548 | Bacteria | 2260 |
| 122 | Ga0070665_100168154 | 3300005548 | Bacteria | 2194 |
| 123 | Ga0068855_100005951 | 3300005563 | Bacteria | 14870 |
| 124 | Ga0068855_100105650 | 3300005563 | Bacteria | 3237 |
| 125 | Ga0068855_100268834 | 3300005563 | Bacteria | 1896 |
| 126 | Ga0068855_100497865 | 3300005563 | Bacteria | 1324 |
| 127 | Ga0068857_100053558 | 3300005577 | Bacteria | 3579 |
| 128 | Ga0068857_100168752 | 3300005577 | Bacteria | 1988 |
| 129 | Ga0068854_100080020 | 3300005578 | Bacteria | 2411 |
| 130 | Ga0068854_100128325 | 3300005578 | Bacteria | 1934 |
| 131 | Ga0068856_100007098 | 3300005614 | Bacteria | 10939 |
| 132 | Ga0068856_100229373 | 3300005614 | Bacteria | 1872 |
| 133 | Ga0068852_100005973 | 3300005616 | Bacteria | 8769 |
| 134 | Ga0068852_100014146 | 3300005616 | Bacteria | 6129 |
| 135 | Ga0068852_100029267 | 3300005616 | Bacteria | 4522 |
| 136 | Ga0068852_100055732 | 3300005616 | Bacteria | 3413 |
| 137 | Ga0068859_100000280 | 3300005617 | Bacteria | 50848 |
| 138 | Ga0068859_100308584 | 3300005617 | Bacteria | 1676 |
| 139 | Ga0068859_100343091 | 3300005617 | Bacteria | 1588 |
| 140 | Ga0068864_100020044 | 3300005618 | Bacteria | 5592 |
| 141 | Ga0068866_10129171 | 3300005718 | Bacteria | 1435 |
| 142 | Ga0068861_100061050 | 3300005719 | Bacteria | 2892 |
| 143 | Ga0068851_10000308 | 3300005834 | Bacteria | 22240 |
| 144 | Ga0068851_10032986 | 3300005834 | Bacteria | 2578 |
| 145 | Ga0068851_10087320 | 3300005834 | Bacteria | 1637 |
| 146 | Ga0068863_100018882 | 3300005841 | Bacteria | 6597 |
| 147 | Ga0068863_100024540 | 3300005841 | Bacteria | 5751 |
| 148 | Ga0068863_100066084 | 3300005841 | Bacteria | 3421 |
| 149 | Ga0068863_100077761 | 3300005841 | Bacteria | 3140 |
| 150 | Ga0068858_100008594 | 3300005842 | Bacteria | 9807 |
| 151 | Ga0068858_100160243 | 3300005842 | Bacteria | 2118 |
| 152 | Ga0068860_100002386 | 3300005843 | Bacteria | 19708 |
| 153 | Ga0068860_100107390 | 3300005843 | Bacteria | 2667 |
| 154 | Ga0068860_100124956 | 3300005843 | Bacteria | 2466 |
| 155 | Ga0068862_100000215 | 3300005844 | Bacteria | 64251 |
| 156 | Ga0068862_100099430 | 3300005844 | Bacteria | 2543 |
| 157 | Ga0081540_1008082 | 3300005983 | Bacteria | 7391 |
| 158 | Ga0081539_10008186 | 3300005985 | Bacteria | 9212 |
| 159 | Ga0075365_10216007 | 3300006038 | Bacteria | 1345 |
| 160 | Ga0075364_10002739 | 3300006051 | Bacteria | 9901 |
| 161 | Ga0075367_10028635 | 3300006178 | Bacteria | 3179 |
| 162 | Ga0075369_10020023 | 3300006186 | Bacteria | 2738 |
| 163 | Ga0097621_100012950 | 3300006237 | Bacteria | 6197 |
| 164 | Ga0097621_100083770 | 3300006237 | Bacteria | 2657 |
| 165 | Ga0097621_100164034 | 3300006237 | Bacteria | 1912 |
| 166 | Ga0097621_100326759 | 3300006237 | Bacteria | 1359 |
| 167 | Ga0068871_100039983 | 3300006358 | Bacteria | 3755 |
| 168 | Ga0068871_100190334 | 3300006358 | Bacteria | 1767 |
| 169 | Ga0068865_100001586 | 3300006881 | Bacteria | 13298 |
| 170 | Ga0068865_100027085 | 3300006881 | Bacteria | 3784 |
| 171 | Ga0068865_100053746 | 3300006881 | Bacteria | 2795 |
| 172 | Ga0097620_100000280 | 3300006931 | Bacteria | 50848 |
| 173 | Ga0097620_100308555 | 3300006931 | Bacteria | 1676 |
| 174 | Ga0097620_100343093 | 3300006931 | Bacteria | 1588 |
| 175 | Ga0105251_10000205 | 3300009011 | Bacteria | 59437 |
| 176 | Ga0105251_10002055 | 3300009011 | Bacteria | 16280 |
| 177 | Ga0105244_10021621 | 3300009036 | Bacteria | 3556 |
| 178 | Ga0105244_10106462 | 3300009036 | Bacteria | 1368 |
| 179 | Ga0105240_10001002 | 3300009093 | Bacteria | 50418 |
| 180 | Ga0105240_10004247 | 3300009093 | Bacteria | 21906 |
| 181 | Ga0105240_10152371 | 3300009093 | Bacteria | 2752 |
| 182 | Ga0105240_10424643 | 3300009093 | Bacteria | 1493 |
| 183 | Ga0105240_10489488 | 3300009093 | Bacteria | 1370 |
| 184 | Ga0105245_10083715 | 3300009098 | Bacteria | 2920 |
| 185 | Ga0105245_10165864 | 3300009098 | Bacteria | 2100 |
| 186 | Ga0105243_10002435 | 3300009148 | Bacteria | 15549 |
| 187 | Ga0105243_10013395 | 3300009148 | Bacteria | 6201 |
| 188 | Ga0105241_10055846 | 3300009174 | Bacteria | 3026 |
| 189 | Ga0105241_10122713 | 3300009174 | Bacteria | 2094 |
| 190 | Ga0105242_10079196 | 3300009176 | Bacteria | 2744 |
| 191 | Ga0105248_10000120 | 3300009177 | Bacteria | 89960 |
| 192 | Ga0105248_10117468 | 3300009177 | Bacteria | 3000 |
| 193 | Ga0105237_10010356 | 3300009545 | Bacteria | 9929 |
| 194 | Ga0105237_10011173 | 3300009545 | Bacteria | 9517 |
| 195 | Ga0105237_10035094 | 3300009545 | Bacteria | 5076 |
| 196 | Ga0105237_10053179 | 3300009545 | Bacteria | 4062 |
| 197 | Ga0105237_10118736 | 3300009545 | Bacteria | 2638 |
| 198 | Ga0105237_10298437 | 3300009545 | Bacteria | 1614 |
| 199 | Ga0105237_10388462 | 3300009545 | Bacteria | 1400 |
| 200 | Ga0105238_10000175 | 3300009551 | Bacteria | 69973 |
| 201 | Ga0105238_10006626 | 3300009551 | Bacteria | 11543 |
| 202 | Ga0105238_10009039 | 3300009551 | Bacteria | 9969 |
| 203 | Ga0105238_10011923 | 3300009551 | Bacteria | 8758 |
| 204 | Ga0105238_10030434 | 3300009551 | Bacteria | 5495 |
| 205 | Ga0105238_10030657 | 3300009551 | Bacteria | 5474 |
| 206 | Ga0105238_10041838 | 3300009551 | Bacteria | 4641 |
| 207 | Ga0105249_10000898 | 3300009553 | Bacteria | 26273 |
| 208 | Ga0105249_10001097 | 3300009553 | Bacteria | 24066 |
| 209 | Ga0105249_10173073 | 3300009553 | Bacteria | 2095 |
| 210 | Ga0105249_10355553 | 3300009553 | Bacteria | 1485 |
| 211 | Ga0105032_100317 | 3300009979 | Bacteria | 4937 |
| 212 | Ga0105239_10005391 | 3300010375 | Bacteria | 15027 |
| 213 | Ga0105239_10010309 | 3300010375 | Bacteria | 10466 |
| 214 | Ga0105239_10107680 | 3300010375 | Bacteria | 3088 |
| 215 | Ga0105239_10331311 | 3300010375 | Bacteria | 1717 |
| 216 | Ga0105239_10472879 | 3300010375 | Bacteria | 1423 |
| 217 | Ga0105246_10020817 | 3300011119 | Bacteria | 4212 |
| 218 | Ga0105246_10064583 | 3300011119 | Bacteria | 2558 |
| 219 | Ga0157373_10009800 | 3300013100 | Bacteria | 7067 |
| 220 | Ga0157373_10012798 | 3300013100 | Bacteria | 6163 |
| 221 | Ga0157373_10042694 | 3300013100 | Bacteria | 3240 |
| 222 | Ga0157373_10087870 | 3300013100 | Bacteria | 2190 |
| 223 | Ga0157371_10000397 | 3300013102 | Bacteria | 54547 |
| 224 | Ga0157371_10010395 | 3300013102 | Bacteria | 7255 |
| 225 | Ga0157371_10053932 | 3300013102 | Bacteria | 2855 |
| 226 | Ga0157370_10000918 | 3300013104 | Bacteria | 37372 |
| 227 | Ga0157370_10001260 | 3300013104 | Bacteria | 31632 |
| 228 | Ga0157370_10044732 | 3300013104 | Bacteria | 4252 |
| 229 | Ga0157370_10131797 | 3300013104 | Bacteria | 2331 |
| 230 | Ga0157369_10002250 | 3300013105 | Bacteria | 23203 |
| 231 | Ga0157369_10004413 | 3300013105 | Bacteria | 16604 |
| 232 | Ga0157369_10169167 | 3300013105 | Bacteria | 2303 |
| 233 | Ga0157369_10263395 | 3300013105 | Bacteria | 1797 |
| 234 | Ga0157369_10273993 | 3300013105 | Bacteria | 1758 |
| 235 | Ga0157378_10254634 | 3300013297 | Bacteria | 1682 |
| 236 | Ga0163162_10018817 | 3300013306 | Bacteria | 6771 |
| 237 | Ga0163162_10028377 | 3300013306 | Bacteria | 5537 |
| 238 | Ga0163162_10151246 | 3300013306 | Bacteria | 2439 |
| 239 | Ga0163162_10280900 | 3300013306 | Bacteria | 1797 |
| 240 | Ga0157372_10000344 | 3300013307 | Bacteria | 51217 |
| 241 | Ga0157372_10028390 | 3300013307 | Bacteria | 6105 |
| 242 | Ga0157372_10051825 | 3300013307 | Bacteria | 4568 |
| 243 | Ga0157372_10057810 | 3300013307 | Bacteria | 4336 |
| 244 | Ga0157375_10004149 | 3300013308 | Bacteria | 12573 |
| 245 | Ga0157375_10019950 | 3300013308 | Bacteria | 6112 |
| 246 | Ga0163163_10000029 | 3300014325 | Bacteria | 174973 |
| 247 | Ga0163163_10000564 | 3300014325 | Bacteria | 32582 |
| 248 | Ga0163163_10286193 | 3300014325 | Bacteria | 1700 |
| 249 | Ga0182008_10000076 | 3300014497 | Bacteria | 77484 |
| 250 | Ga0182008_10008822 | 3300014497 | Bacteria | 5474 |
| 251 | Ga0182008_10020566 | 3300014497 | Bacteria | 3397 |
| 252 | Ga0182008_10126418 | 3300014497 | Bacteria | 1273 |
| 253 | Ga0157379_10001942 | 3300014968 | Bacteria | 17106 |
| 254 | Ga0157379_10153983 | 3300014968 | Bacteria | 2073 |
| 255 | Ga0157379_10220782 | 3300014968 | Bacteria | 1717 |
| 256 | Ga0157376_10005280 | 3300014969 | Bacteria | 9025 |
| 257 | Ga0157376_10007306 | 3300014969 | Bacteria | 7869 |
| 258 | Ga0157376_10063340 | 3300014969 | Bacteria | 3114 |
| 259 | Ga0182006_1004720 | 3300015261 | Bacteria | 6662 |
| 260 | Ga0182007_10000079 | 3300015262 | Bacteria | 73543 |
| 261 | Ga0182005_1000166 | 3300015265 | Bacteria | 45594 |
| 262 | Ga0182005_1002582 | 3300015265 | Bacteria | 6416 |
| 263 | Ga0183360_10002 | 3300015689 | Bacteria | 953821 |
| 264 | Ga0163161_10002679 | 3300017792 | Bacteria | 12658 |
| 265 | Ga0163161_10013517 | 3300017792 | Bacteria | 5684 |
| 266 | Ga0163161_10021626 | 3300017792 | Bacteria | 4521 |
| 267 | Ga0206349_1121353 | 3300020075 | Bacteria | 4561 |
| 268 | Ga0207427_100349 | 3300025231 | Bacteria | 29540 |
| 269 | Ga0209437_100886 | 3300025233 | Bacteria | 12095 |
| 270 | Ga0207425_1000148 | 3300025245 | Bacteria | 59862 |
| 271 | Ga0207425_1017410 | 3300025245 | Bacteria | 1579 |
| 272 | Ga0209129_1000239 | 3300025258 | Bacteria | 59863 |
| 273 | Ga0209129_1001622 | 3300025258 | Bacteria | 12193 |
| 274 | Ga0209233_1000715 | 3300025261 | Bacteria | 15448 |
| 275 | Ga0209233_1000998 | 3300025261 | Bacteria | 12103 |
| 276 | Ga0209565_1000001 | 3300025263 | Bacteria | 2950419 |
| 277 | Ga0209565_1000060 | 3300025263 | Bacteria | 188543 |
| 278 | Ga0209565_1004771 | 3300025263 | Bacteria | 4064 |
| 279 | Ga0209673_1000001 | 3300025273 | Bacteria | 3176258 |
| 280 | Ga0209673_1000047 | 3300025273 | Bacteria | 289276 |
| 281 | Ga0209673_1004700 | 3300025273 | Bacteria | 7194 |
| 282 | Ga0209130_1002163 | 3300025284 | Bacteria | 10367 |
| 283 | Ga0209675_1000001 | 3300025291 | Bacteria | 2950293 |
| 284 | Ga0209675_1000007 | 3300025291 | Bacteria | 683430 |
| 285 | Ga0209676_1000018 | 3300025292 | Bacteria | 631385 |
| 286 | Ga0209676_1000360 | 3300025292 | Bacteria | 86307 |
| 287 | Ga0209676_1000411 | 3300025292 | Bacteria | 77084 |
| 288 | Ga0209676_1001983 | 3300025292 | Bacteria | 16281 |
| 289 | Ga0209676_1003671 | 3300025292 | Bacteria | 9197 |
| 290 | Ga0209676_1010297 | 3300025292 | Bacteria | 3918 |
| 291 | Ga0209025_1000006 | 3300025294 | Bacteria | 1153444 |
| 292 | Ga0209025_1000048 | 3300025294 | Bacteria | 335574 |
| 293 | Ga0209025_1002898 | 3300025294 | Bacteria | 17124 |
| 294 | Ga0209025_1011601 | 3300025294 | Bacteria | 5781 |
| 295 | Ga0209564_1000001 | 3300025295 | Bacteria | 3176258 |
| 296 | Ga0209564_1000252 | 3300025295 | Bacteria | 114416 |
| 297 | Ga0209564_1008800 | 3300025295 | Bacteria | 4919 |
| 298 | Ga0209758_1000056 | 3300025297 | Bacteria | 335574 |
| 299 | Ga0209758_1006577 | 3300025297 | Bacteria | 8257 |
| 300 | Ga0209758_1009524 | 3300025297 | Bacteria | 6014 |
| 301 | Ga0209050_1000146 | 3300025298 | Bacteria | 166930 |
| 302 | Ga0209050_1000592 | 3300025298 | Bacteria | 57827 |
| 303 | Ga0209050_1003938 | 3300025298 | Bacteria | 10501 |
| 304 | Ga0209256_1000006 | 3300025299 | Bacteria | 1250310 |
| 305 | Ga0209256_1005338 | 3300025299 | Bacteria | 7467 |
| 306 | Ga0209256_1005932 | 3300025299 | Bacteria | 6743 |
| 307 | Ga0209256_1010244 | 3300025299 | Bacteria | 3956 |
| 308 | Ga0209256_1013376 | 3300025299 | Bacteria | 3047 |
| 309 | Ga0209256_1013442 | 3300025299 | Bacteria | 3036 |
| 310 | Ga0209051_1003638 | 3300025303 | Bacteria | 9986 |
| 311 | Ga0209257_1000035 | 3300025304 | Bacteria | 631463 |
| 312 | Ga0209257_1000078 | 3300025304 | Bacteria | 317483 |
| 313 | Ga0209257_1000414 | 3300025304 | Bacteria | 82489 |
| 314 | Ga0209257_1000642 | 3300025304 | Bacteria | 55895 |
| 315 | Ga0209257_1001448 | 3300025304 | Bacteria | 28059 |
| 316 | Ga0209257_1003369 | 3300025304 | Bacteria | 13803 |
| 317 | Ga0209257_1006510 | 3300025304 | Bacteria | 7479 |
| 318 | Ga0209257_1010878 | 3300025304 | Bacteria | 4500 |
| 319 | Ga0209257_1013090 | 3300025304 | Bacteria | 3738 |
| 320 | Ga0207656_10000283 | 3300025321 | Bacteria | 17451 |
| 321 | Ga0207656_10054810 | 3300025321 | Bacteria | 1734 |
| 322 | Ga0207713_1000196 | 3300025735 | Bacteria | 84000 |
| 323 | Ga0207713_1002516 | 3300025735 | Bacteria | 13272 |
| 324 | Ga0207680_10000001 | 3300025903 | Bacteria | 1091453 |
| 325 | Ga0207680_10000529 | 3300025903 | Bacteria | 18152 |
| 326 | Ga0207680_10011565 | 3300025903 | Bacteria | 4464 |
| 327 | Ga0207647_10001336 | 3300025904 | Bacteria | 18958 |
| 328 | Ga0207647_10001796 | 3300025904 | Bacteria | 16435 |
| 329 | Ga0207705_10001049 | 3300025909 | Bacteria | 22456 |
| 330 | Ga0207705_10096042 | 3300025909 | Bacteria | 2176 |
| 331 | Ga0207654_10000458 | 3300025911 | Bacteria | 23295 |
| 332 | Ga0207654_10031499 | 3300025911 | Bacteria | 2922 |
| 333 | Ga0207654_10063425 | 3300025911 | Bacteria | 2169 |
| 334 | Ga0207654_10071741 | 3300025911 | Bacteria | 2060 |
| 335 | Ga0207707_10000578 | 3300025912 | Bacteria | 37213 |
| 336 | Ga0207707_10045794 | 3300025912 | Bacteria | 3811 |
| 337 | Ga0207707_10242082 | 3300025912 | Bacteria | 1568 |
| 338 | Ga0207695_10000040 | 3300025913 | Bacteria | 452787 |
| 339 | Ga0207695_10000772 | 3300025913 | Bacteria | 60706 |
| 340 | Ga0207695_10006223 | 3300025913 | Bacteria | 15542 |
| 341 | Ga0207695_10015003 | 3300025913 | Bacteria | 9141 |
| 342 | Ga0207695_10042105 | 3300025913 | Bacteria | 4883 |
| 343 | Ga0207695_10048332 | 3300025913 | Bacteria | 4494 |
| 344 | Ga0207671_10007551 | 3300025914 | Bacteria | 9414 |
| 345 | Ga0207671_10009290 | 3300025914 | Bacteria | 8235 |
| 346 | Ga0207671_10011332 | 3300025914 | Bacteria | 7263 |
| 347 | Ga0207671_10030679 | 3300025914 | Bacteria | 4008 |
| 348 | Ga0207671_10043030 | 3300025914 | Bacteria | 3341 |
| 349 | Ga0207671_10071007 | 3300025914 | Bacteria | 2597 |
| 350 | Ga0207671_10171438 | 3300025914 | Bacteria | 1685 |
| 351 | Ga0207663_10175468 | 3300025916 | Bacteria | 1526 |
| 352 | Ga0207657_10002547 | 3300025919 | Bacteria | 19710 |
| 353 | Ga0207657_10170713 | 3300025919 | Bacteria | 1762 |
| 354 | Ga0207657_10366742 | 3300025919 | Bacteria | 1135 |
| 355 | Ga0207649_10004292 | 3300025920 | Bacteria | 7757 |
| 356 | Ga0207649_10012167 | 3300025920 | Bacteria | 4764 |
| 357 | Ga0207652_10150244 | 3300025921 | Bacteria | 2085 |
| 358 | Ga0207681_10046931 | 3300025923 | Bacteria | 2907 |
| 359 | Ga0207681_10273924 | 3300025923 | Bacteria | 1326 |
| 360 | Ga0207694_10000257 | 3300025924 | Bacteria | 50545 |
| 361 | Ga0207694_10001852 | 3300025924 | Bacteria | 17610 |
| 362 | Ga0207694_10003883 | 3300025924 | Bacteria | 11817 |
| 363 | Ga0207694_10006803 | 3300025924 | Bacteria | 8679 |
| 364 | Ga0207694_10024311 | 3300025924 | Bacteria | 4599 |
| 365 | Ga0207694_10056309 | 3300025924 | Bacteria | 3053 |
| 366 | Ga0207694_10143318 | 3300025924 | Bacteria | 1922 |
| 367 | Ga0207650_10001926 | 3300025925 | Bacteria | 14613 |
| 368 | Ga0207650_10104287 | 3300025925 | Bacteria | 2187 |
| 369 | Ga0207650_10112978 | 3300025925 | Bacteria | 2105 |
| 370 | Ga0207650_10168174 | 3300025925 | Bacteria | 1741 |
| 371 | Ga0207644_10017204 | 3300025931 | Bacteria | 4877 |
| 372 | Ga0207644_10166932 | 3300025931 | Bacteria | 1715 |
| 373 | Ga0207690_10019109 | 3300025932 | Bacteria | 4211 |
| 374 | Ga0207690_10042976 | 3300025932 | Bacteria | 2972 |
| 375 | Ga0207690_10191206 | 3300025932 | Bacteria | 1548 |
| 376 | Ga0207706_10000876 | 3300025933 | Bacteria | 30901 |
| 377 | Ga0207706_10028883 | 3300025933 | Bacteria | 4950 |
| 378 | Ga0207709_10000527 | 3300025935 | Bacteria | 33281 |
| 379 | Ga0207709_10002230 | 3300025935 | Bacteria | 12353 |
| 380 | Ga0207669_10014325 | 3300025937 | Bacteria | 3971 |
| 381 | Ga0207704_10053643 | 3300025938 | Bacteria | 2452 |
| 382 | Ga0207704_10082336 | 3300025938 | Bacteria | 2085 |
| 383 | Ga0207691_10007233 | 3300025940 | Bacteria | 10709 |
| 384 | Ga0207691_10007375 | 3300025940 | Bacteria | 10597 |
| 385 | Ga0207691_10009099 | 3300025940 | Bacteria | 9532 |
| 386 | Ga0207711_10010606 | 3300025941 | Bacteria | 7662 |
| 387 | Ga0207711_10149769 | 3300025941 | Bacteria | 2105 |
| 388 | Ga0207689_10017785 | 3300025942 | Bacteria | 6007 |
| 389 | Ga0207689_10034224 | 3300025942 | Bacteria | 4219 |
| 390 | Ga0207689_10080295 | 3300025942 | Bacteria | 2681 |
| 391 | Ga0207689_10093372 | 3300025942 | Bacteria | 2472 |
| 392 | Ga0207689_10130781 | 3300025942 | Bacteria | 2066 |
| 393 | Ga0207689_10217979 | 3300025942 | Bacteria | 1577 |
| 394 | Ga0207661_10071965 | 3300025944 | Bacteria | 2828 |
| 395 | Ga0207661_10113455 | 3300025944 | Bacteria | 2296 |
| 396 | Ga0207679_10026576 | 3300025945 | Bacteria | 3993 |
| 397 | Ga0207667_10012090 | 3300025949 | Bacteria | 9979 |
| 398 | Ga0207667_10019912 | 3300025949 | Bacteria | 7477 |
| 399 | Ga0207667_10038594 | 3300025949 | Bacteria | 5098 |
| 400 | Ga0207667_10049542 | 3300025949 | Bacteria | 4436 |
| 401 | Ga0207667_10164835 | 3300025949 | Bacteria | 2278 |
| 402 | Ga0207667_10258218 | 3300025949 | Bacteria | 1782 |
| 403 | Ga0207667_10264415 | 3300025949 | Bacteria | 1759 |
| 404 | Ga0207667_10287852 | 3300025949 | Bacteria | 1679 |
| 405 | Ga0207651_10097067 | 3300025960 | Bacteria | 2175 |
| 406 | Ga0207651_10321806 | 3300025960 | Bacteria | 1293 |
| 407 | Ga0207712_10000120 | 3300025961 | Bacteria | 84214 |
| 408 | Ga0207712_10000305 | 3300025961 | Bacteria | 45213 |
| 409 | Ga0207712_10024220 | 3300025961 | Bacteria | 4017 |
| 410 | Ga0207712_10279439 | 3300025961 | Bacteria | 1362 |
| 411 | Ga0207668_10019101 | 3300025972 | Bacteria | 4326 |
| 412 | Ga0207668_10056198 | 3300025972 | Bacteria | 2740 |
| 413 | Ga0207668_10130946 | 3300025972 | Bacteria | 1915 |
| 414 | Ga0207640_10019306 | 3300025981 | Bacteria | 4025 |
| 415 | Ga0207658_10000033 | 3300025986 | Bacteria | 158540 |
| 416 | Ga0207658_10004845 | 3300025986 | Bacteria | 9300 |
| 417 | Ga0207658_10009244 | 3300025986 | Bacteria | 6684 |
| 418 | Ga0207658_10090619 | 3300025986 | Bacteria | 2370 |
| 419 | Ga0207658_10124864 | 3300025986 | Bacteria | 2058 |
| 420 | Ga0207658_10253279 | 3300025986 | Bacteria | 1497 |
| 421 | Ga0207658_10262455 | 3300025986 | Bacteria | 1472 |
| 422 | Ga0207677_10008057 | 3300026023 | Bacteria | 5868 |
| 423 | Ga0207677_10095502 | 3300026023 | Bacteria | 2173 |
| 424 | Ga0207703_10028041 | 3300026035 | Bacteria | 4435 |
| 425 | Ga0207703_10109403 | 3300026035 | Bacteria | 2356 |
| 426 | Ga0207703_10116118 | 3300026035 | Bacteria | 2291 |
| 427 | Ga0207703_10235448 | 3300026035 | Bacteria | 1643 |
| 428 | Ga0207703_10326770 | 3300026035 | Bacteria | 1406 |
| 429 | Ga0207639_10000236 | 3300026041 | Bacteria | 41381 |
| 430 | Ga0207639_10000437 | 3300026041 | Bacteria | 28831 |
| 431 | Ga0207639_10000514 | 3300026041 | Bacteria | 26656 |
| 432 | Ga0207639_10003146 | 3300026041 | Bacteria | 11096 |
| 433 | Ga0207639_10019356 | 3300026041 | Bacteria | 4854 |
| 434 | Ga0207639_10057841 | 3300026041 | Bacteria | 2980 |
| 435 | Ga0207639_10119482 | 3300026041 | Bacteria | 2163 |
| 436 | Ga0207639_10140881 | 3300026041 | Bacteria | 2009 |
| 437 | Ga0207639_10191740 | 3300026041 | Bacteria | 1746 |
| 438 | Ga0207639_10230228 | 3300026041 | Bacteria | 1606 |
| 439 | Ga0207678_10012827 | 3300026067 | Bacteria | 7357 |
| 440 | Ga0207678_10171560 | 3300026067 | Bacteria | 1852 |
| 441 | Ga0207678_10175178 | 3300026067 | Bacteria | 1831 |
| 442 | Ga0207702_10003377 | 3300026078 | Bacteria | 14632 |
| 443 | Ga0207702_10027084 | 3300026078 | Bacteria | 4759 |
| 444 | Ga0207702_10027877 | 3300026078 | Bacteria | 4692 |
| 445 | Ga0207641_10042543 | 3300026088 | Bacteria | 3811 |
| 446 | Ga0207641_10045468 | 3300026088 | Bacteria | 3697 |
| 447 | Ga0207641_10060657 | 3300026088 | Bacteria | 3224 |
| 448 | Ga0207641_10165970 | 3300026088 | Bacteria | 2011 |
| 449 | Ga0207641_10214292 | 3300026088 | Bacteria | 1782 |
| 450 | Ga0207648_10038304 | 3300026089 | Bacteria | 4220 |
| 451 | Ga0207648_10071014 | 3300026089 | Bacteria | 3035 |
| 452 | Ga0207676_10005524 | 3300026095 | Bacteria | 8947 |
| 453 | Ga0207674_10008389 | 3300026116 | Bacteria | 11948 |
| 454 | Ga0207674_10059733 | 3300026116 | Bacteria | 3857 |
| 455 | Ga0207674_10135861 | 3300026116 | Bacteria | 2421 |
| 456 | Ga0207675_100070634 | 3300026118 | Bacteria | 3264 |
| 457 | Ga0207698_10041061 | 3300026142 | Bacteria | 3444 |
| 458 | Ga0207698_10142520 | 3300026142 | Bacteria | 2067 |
| 459 | Ga0207698_10223440 | 3300026142 | Bacteria | 1704 |
| 460 | Ga0209371_1000018 | 3300027312 | Bacteria | 614700 |
| 461 | Ga0209371_1000025 | 3300027312 | Bacteria | 450640 |
| 462 | Ga0209983_1001045 | 3300027665 | Bacteria | 6100 |
| 463 | Ga0209971_1006224 | 3300027682 | Bacteria | 2826 |
| 464 | Ga0209974_10004142 | 3300027876 | Bacteria | 5181 |
| 465 | Ga0268266_10000007 | 3300028379 | Bacteria | 1372921 |
| 466 | Ga0268266_10000017 | 3300028379 | Bacteria | 607272 |
| 467 | Ga0268266_10000091 | 3300028379 | Bacteria | 195002 |
| 468 | Ga0268266_10042299 | 3300028379 | Bacteria | 3891 |
| 469 | Ga0268266_10080274 | 3300028379 | Bacteria | 2842 |
| 470 | Ga0268266_10196408 | 3300028379 | Bacteria | 1845 |
| 471 | Ga0268265_10000376 | 3300028380 | Bacteria | 48178 |
| 472 | Ga0268264_10096469 | 3300028381 | Bacteria | 2561 |
| 473 | Ga0268264_10153509 | 3300028381 | Bacteria | 2067 |
| 474 | Ga0307517_10113675 | 3300028786 | Bacteria | 2042 |
| 475 | Ga0307515_10125655 | 3300028794 | Bacteria | 2868 |
| 476 | Ga0268256_1000016 | 3300030500 | Bacteria | 614700 |
| 477 | Ga0268256_1000027 | 3300030500 | Bacteria | 450640 |
| 478 | Ga0316177_1045917 | 3300030731 | Bacteria | 6532 |
| 479 | Ga0314311_1009359 | 3300030733 | Bacteria | 5847 |
| 480 | Ga0316181_1160836 | 3300030744 | Bacteria | 1305 |
| 481 | Ga0316182_1299775 | 3300030745 | Bacteria | 2931 |
| 482 | Ga0307513_10006814 | 3300031456 | Bacteria | 14893 |
| 483 | Ga0307408_100193051 | 3300031548 | Bacteria | 1642 |
| 484 | Ga0307508_10027818 | 3300031616 | Bacteria | 5116 |
| 485 | Ga0316575_10014957 | 3300031665 | Bacteria | 2921 |
| 486 | Ga0316575_10079546 | 3300031665 | Bacteria | 1322 |
| 487 | Ga0316579_10002710 | 3300031691 | Bacteria | 6743 |
| 488 | Ga0316576_10006785 | 3300031727 | Bacteria | 7154 |
| 489 | Ga0316576_10060931 | 3300031727 | Bacteria | 2765 |
| 490 | Ga0316576_10182135 | 3300031727 | Bacteria | 1584 |
| 491 | Ga0316578_10046275 | 3300031728 | Bacteria | 2535 |
| 492 | Ga0307516_10068264 | 3300031730 | Bacteria | 3424 |
| 493 | Ga0307516_10101976 | 3300031730 | Bacteria | 2685 |
| 494 | Ga0307516_10176328 | 3300031730 | Bacteria | 1874 |
| 495 | Ga0316577_10019739 | 3300031733 | Bacteria | 3733 |
| 496 | Ga0316577_10056979 | 3300031733 | Bacteria | 2182 |
| 497 | Ga0316577_10064644 | 3300031733 | Bacteria | 2042 |
| 498 | Ga0307413_10021709 | 3300031824 | Bacteria | 3443 |
| 499 | Ga0307413_10226927 | 3300031824 | Bacteria | 1368 |
| 500 | Ga0307406_10003433 | 3300031901 | Bacteria | 8623 |
| 501 | Ga0307407_10141410 | 3300031903 | Bacteria | 1553 |
| 502 | Ga0307412_10103765 | 3300031911 | Bacteria | 2016 |
| 503 | Ga0307412_10164312 | 3300031911 | Bacteria | 1653 |
| 504 | Ga0307416_100024526 | 3300032002 | Bacteria | 4405 |
| 505 | Ga0307414_10000883 | 3300032004 | Bacteria | 15349 |
| 506 | Ga0307414_10000928 | 3300032004 | Bacteria | 15008 |
| 507 | Ga0307414_10002330 | 3300032004 | Bacteria | 9920 |
| 508 | Ga0307414_10003632 | 3300032004 | Bacteria | 8265 |
| 509 | Ga0307414_10035418 | 3300032004 | Bacteria | 3321 |
| 510 | Ga0307414_10043563 | 3300032004 | Bacteria | 3058 |
| 511 | Ga0307414_10102681 | 3300032004 | Bacteria | 2155 |
| 512 | Ga0307414_10128603 | 3300032004 | Bacteria | 1962 |
| 513 | Ga0307414_10146111 | 3300032004 | Bacteria | 1858 |
| 514 | Ga0307414_10321320 | 3300032004 | Bacteria | 1317 |
| 515 | Ga0307411_10327448 | 3300032005 | Bacteria | 1240 |
| 516 | Ga0307411_10390328 | 3300032005 | Bacteria | 1147 |
| 517 | Ga0307507_10191851 | 3300033179 | Bacteria | 1434 |
| 518 | Ga0307507_10216035 | 3300033179 | Bacteria | 1298 |
| 519 | Ga0307510_10006402 | 3300033180 | Bacteria | 14038 |
| 520 | Ga0373957_0028125 | 3300035120 | Bacteria | 2047 |
| 521 | Ga0316574_0008265 | 3300035398 | Bacteria | 5769 |
| 522 | Ga0316574_0058217 | 3300035398 | Bacteria | 2420 |
| 523 | Ga0316574_0066006 | 3300035398 | Bacteria | 2279 |
| 524 | Ga0316574_0098537 | 3300035398 | Bacteria | 1869 |
| 525 | Ga0373933_0179551 | 3300035724 | Bacteria | 1350 |
| 526 | Ga0373937_0007519 | 3300036401 | Bacteria | 9431 |
| 527 | Ga0373937_0519868 | 3300036401 | Bacteria | 1131 |
| 528 | Ga0316584_0004592 | 3300036712 | Bacteria | 9152 |
| 529 | Ga0316584_0189592 | 3300036712 | Bacteria | 1520 |
| 530 | Ga0395900_0000163 | 3300037418 | Bacteria | 109199 |
| 531 | Ga0395900_0078437 | 3300037418 | Bacteria | 3393 |
| 532 | Ga0395900_0391702 | 3300037418 | Bacteria | 1355 |
| 533 | Ga0395898_0137307 | 3300037466 | Bacteria | 2341 |
| 534 | Ga0395905_0002925 | 3300037471 | Bacteria | 18608 |
| 535 | Ga0395905_0115628 | 3300037471 | Bacteria | 2521 |
| 536 | Ga0395901_0006253 | 3300038443 | Bacteria | 12068 |
| 537 | Ga0237819_00598 | 3300038705 | Bacteria | 12061 |
| 538 | Ga0237819_04072 | 3300038705 | Bacteria | 2466 |
| 539 | Ga0237816_00007 | 3300039145 | Bacteria | 13042 |
| 540 | Ga0439436_0000009 | 3300041404 | Bacteria | 108375 |
| 541 | Ga0439436_0010843 | 3300041404 | Bacteria | 2776 |
| 542 | Ga0439436_0032731 | 3300041404 | Bacteria | 1507 |
| 543 | Ga0439447_000276 | 3300041407 | Bacteria | 18194 |
| 544 | Ga0439465_0001199 | 3300041413 | Bacteria | 8345 |
| 545 | Ga0439465_0002680 | 3300041413 | Bacteria | 5821 |
| 546 | Ga0451793_0608164 | 3300041452 | Bacteria | 2909 |
| 547 | Ga0451806_117351 | 3300041462 | Bacteria | 8065 |
| 548 | Ga0451833_0665795 | 3300041491 | Bacteria | 1670 |
| 549 | Ga0451837_0845588 | 3300041494 | Bacteria | 1483 |
| 550 | Ga0451841_0688799 | 3300041498 | Bacteria | 1462 |
| 551 | Ga0451843_0273968 | 3300041509 | Bacteria | 2245 |
| 552 | Ga0451853_3774819 | 3300041512 | Bacteria | 1455 |
| 553 | Ga0439445_0027556 | 3300042004 | Bacteria | 1460 |
| 554 | Ga0439449_0000582 | 3300042007 | Bacteria | 13681 |
| 555 | Ga0439449_0005572 | 3300042007 | Bacteria | 4820 |
| 556 | Ga0439457_014730 | 3300042014 | Bacteria | 1748 |
| 557 | Ga0439462_0022440 | 3300042015 | Bacteria | 1652 |
| 558 | Ga0451577_0016708 | 3300042876 | Bacteria | 6787 |
| 559 | Ga0466972_0001414 | 3300044658 | Bacteria | 11634 |
| 560 | Ga0453684_0000531 | 3300044712 | Bacteria | 145390 |
| 561 | Ga0466970_0001522 | 3300044765 | Bacteria | 11158 |
| 562 | Ga0466959_0012881 | 3300045049 | Bacteria | 6053 |
| 563 | Ga0451576_0000212 | 3300045051 | Bacteria | 145396 |
| 564 | Ga0495638_0000526 | 3300046460 | Bacteria | 44654 |
| 565 | Ga0495638_0052794 | 3300046460 | Bacteria | 2531 |
| 566 | Ga0495650_0000469 | 3300046471 | Bacteria | 62135 |
| 567 | Ga0495582_0009245 | 3300046473 | Bacteria | 5436 |
| 568 | Ga0495607_0079949 | 3300046501 | Bacteria | 1799 |
| 569 | Ga0495606_0005893 | 3300046507 | Bacteria | 11529 |
| 570 | Ga0495606_0204894 | 3300046507 | Bacteria | 1122 |
| 571 | Ga0495610_0002419 | 3300046512 | Bacteria | 15714 |
| 572 | Ga0495631_0003548 | 3300046518 | Bacteria | 8529 |
| 573 | Ga0495643_0010311 | 3300046522 | Bacteria | 5754 |
| 574 | Ga0495663_0003392 | 3300046525 | Bacteria | 4604 |
| 575 | Ga0495663_0007926 | 3300046525 | Bacteria | 2936 |
| 576 | Ga0495663_0017245 | 3300046525 | Bacteria | 2047 |
| 577 | Ga0495665_0054589 | 3300046531 | Bacteria | 2111 |
| 578 | Ga0495587_0125298 | 3300046536 | Bacteria | 1470 |
| 579 | Ga0495598_0004631 | 3300046537 | Bacteria | 2992 |
| 580 | Ga0495621_0020577 | 3300046539 | Bacteria | 2167 |
| 581 | Ga0495633_0053967 | 3300046558 | Bacteria | 1891 |
| 582 | Ga0495656_0003859 | 3300046615 | Bacteria | 5098 |
| 583 | Ga0495625_0007542 | 3300046660 | Bacteria | 9451 |
| 584 | Ga0495625_0107781 | 3300046660 | Bacteria | 1906 |
| 585 | Ga0495635_0085671 | 3300046663 | Bacteria | 2156 |
| 586 | Ga0495659_0017398 | 3300046664 | Bacteria | 2382 |
| 587 | Ga0495659_0042025 | 3300046664 | Bacteria | 1635 |
| 588 | Ga0495658_0011054 | 3300046683 | Bacteria | 4529 |
| 589 | Ga0495670_0006739 | 3300046691 | Bacteria | 5651 |
| 590 | Ga0495649_0030572 | 3300046694 | Bacteria | 2974 |
| 591 | Ga0495636_0004749 | 3300047318 | Bacteria | 5331 |
| 592 | Ga0495636_0006456 | 3300047318 | Bacteria | 4607 |
| 593 | Ga0495636_0030269 | 3300047318 | Bacteria | 2212 |
| 594 | Ga0495672_0000087 | 3300047320 | Bacteria | 154275 |
| 595 | Ga0495684_0078978 | 3300047471 | Bacteria | 2498 |
| 596 | Ga0495686_0004214 | 3300047472 | Bacteria | 11939 |
| 597 | Ga0495686_0038417 | 3300047472 | Bacteria | 3061 |
| 598 | Ga0495686_0145793 | 3300047472 | Bacteria | 1393 |
| 599 | Ga0495615_0003458 | 3300048090 | Bacteria | 2648 |
| 600 | Ga0496101_0109743 | 3300048904 | Bacteria | 2076 |
| 601 | Ga0496103_0081056 | 3300048906 | Bacteria | 2041 |
| 602 | Ga0496104_0000005 | 3300048907 | Bacteria | 620360 |
| 603 | Ga0496105_0000106 | 3300048908 | Bacteria | 56944 |
| 604 | Ga0496105_0029746 | 3300048908 | Bacteria | 4472 |
| 605 | Ga0496112_0324194 | 3300048915 | Bacteria | 1484 |
| 606 | Ga0496115_0000077 | 3300048918 | Bacteria | 89885 |
| 607 | Ga0496116_0078873 | 3300048919 | Bacteria | 2051 |
| 608 | Ga0496117_0001430 | 3300048920 | Bacteria | 34487 |
| 609 | Ga0496117_0007883 | 3300048920 | Bacteria | 10239 |
| 610 | Ga0496117_0009829 | 3300048920 | Bacteria | 8812 |
| 611 | Ga0496117_0018836 | 3300048920 | Bacteria | 5697 |
| 612 | Ga0496117_0028737 | 3300048920 | Bacteria | 4301 |
| 613 | Ga0496117_0091047 | 3300048920 | Bacteria | 1963 |
| 614 | Ga0496118_0001349 | 3300048921 | Bacteria | 37069 |
| 615 | Ga0496118_0001867 | 3300048921 | Bacteria | 30139 |
| 616 | Ga0496118_0003009 | 3300048921 | Bacteria | 21768 |
| 617 | Ga0496118_0006523 | 3300048921 | Bacteria | 12777 |
| 618 | Ga0496118_0009851 | 3300048921 | Bacteria | 9560 |
| 619 | Ga0496118_0030781 | 3300048921 | Bacteria | 4467 |
| 620 | Ga0496118_0035939 | 3300048921 | Bacteria | 4014 |
| 621 | Ga0496118_0120660 | 3300048921 | Bacteria | 1710 |
| 622 | Ga0496119_0000711 | 3300048922 | Bacteria | 44692 |
| 623 | Ga0496119_0001836 | 3300048922 | Bacteria | 24586 |
| 624 | Ga0496120_0000273 | 3300048923 | Bacteria | 86248 |
| 625 | Ga0496120_0000727 | 3300048923 | Bacteria | 48259 |
| 626 | Ga0496121_0009703 | 3300048924 | Bacteria | 11019 |
| 627 | Ga0496121_0177607 | 3300048924 | Bacteria | 1540 |
| 628 | Ga0496122_0000417 | 3300048925 | Bacteria | 90401 |
| 629 | Ga0496122_0001517 | 3300048925 | Bacteria | 37011 |
| 630 | Ga0496122_0008629 | 3300048925 | Bacteria | 10938 |
| 631 | Ga0496122_0009264 | 3300048925 | Bacteria | 10414 |
| 632 | Ga0496123_0000137 | 3300048926 | Bacteria | 152169 |
| 633 | Ga0496123_0000323 | 3300048926 | Bacteria | 91212 |
| 634 | Ga0496124_0000006 | 3300048927 | Bacteria | 904259 |
| 635 | Ga0496124_0001552 | 3300048927 | Bacteria | 33193 |
| 636 | Ga0496124_0003391 | 3300048927 | Bacteria | 19565 |
| 637 | Ga0496124_0003834 | 3300048927 | Bacteria | 18012 |
| 638 | Ga0496124_0019869 | 3300048927 | Bacteria | 6231 |
| 639 | Ga0496124_0030860 | 3300048927 | Bacteria | 4748 |
| 640 | Ga0496124_0034545 | 3300048927 | Bacteria | 4435 |
| 641 | Ga0496124_0038566 | 3300048927 | Bacteria | 4147 |
| 642 | Ga0496124_0127669 | 3300048927 | Bacteria | 2024 |
| 643 | Ga0496125_0014536 | 3300048928 | Bacteria | 7662 |
| 644 | Ga0496125_0030941 | 3300048928 | Bacteria | 4778 |
| 645 | Ga0496125_0077822 | 3300048928 | Bacteria | 2553 |
| 646 | Ga0496125_0110368 | 3300048928 | Bacteria | 1994 |
| 647 | Ga0496126_0000047 | 3300048929 | Bacteria | 322212 |
| 648 | Ga0496126_0003861 | 3300048929 | Bacteria | 18507 |
| 649 | Ga0496126_0093660 | 3300048929 | Bacteria | 2637 |
| 650 | Ga0496126_0150106 | 3300048929 | Bacteria | 1998 |
| 651 | Ga0496126_0269868 | 3300048929 | Bacteria | 1412 |
| 652 | Ga0501290_001810 | 3300049513 | Bacteria | 2839 |
| 653 | Ga0501031_0011342 | 3300049568 | Bacteria | 5804 |
| 654 | Ga0501032_0009391 | 3300049569 | Bacteria | 7085 |
| 655 | Ga0501032_0058995 | 3300049569 | Bacteria | 2575 |
| 656 | Ga0501032_0115088 | 3300049569 | Bacteria | 1778 |
| 657 | Ga0501033_0000648 | 3300049570 | Bacteria | 32231 |
| 658 | Ga0501033_0011737 | 3300049570 | Bacteria | 6699 |
| 659 | Ga0501033_0111712 | 3300049570 | Bacteria | 1988 |
| 660 | Ga0501034_0000404 | 3300049571 | Bacteria | 72780 |
| 661 | Ga0501034_0002782 | 3300049571 | Bacteria | 20512 |
| 662 | Ga0501034_0004087 | 3300049571 | Bacteria | 16376 |
| 663 | Ga0501034_0011508 | 3300049571 | Bacteria | 9169 |
| 664 | Ga0501034_0030969 | 3300049571 | Bacteria | 5436 |
| 665 | Ga0501034_0039821 | 3300049571 | Bacteria | 4759 |
| 666 | Ga0501034_0065145 | 3300049571 | Bacteria | 3656 |
| 667 | Ga0501036_0008180 | 3300049572 | Bacteria | 8573 |
| 668 | Ga0501036_0031163 | 3300049572 | Bacteria | 4506 |
| 669 | Ga0501036_0078118 | 3300049572 | Bacteria | 2800 |
| 670 | Ga0501037_0001193 | 3300049573 | Bacteria | 19215 |
| 671 | Ga0501037_0002066 | 3300049573 | Bacteria | 14559 |
| 672 | Ga0501037_0010898 | 3300049573 | Bacteria | 6680 |
| 673 | Ga0501038_0002825 | 3300049574 | Bacteria | 16162 |
| 674 | Ga0501039_0017656 | 3300049575 | Bacteria | 5473 |
| 675 | Ga0501040_0028881 | 3300049576 | Bacteria | 3740 |
| 676 | Ga0501042_0088828 | 3300049578 | Bacteria | 2217 |
| 677 | Ga0501043_0001302 | 3300049579 | Bacteria | 21839 |
| 678 | Ga0501043_0004836 | 3300049579 | Bacteria | 10896 |
| 679 | Ga0501043_0016644 | 3300049579 | Bacteria | 5762 |
| 680 | Ga0501043_0033628 | 3300049579 | Bacteria | 4034 |
| 681 | Ga0501043_0034199 | 3300049579 | Bacteria | 3998 |
| 682 | Ga0501043_0045909 | 3300049579 | Bacteria | 3434 |
| 683 | Ga0501046_0002835 | 3300049580 | Bacteria | 16129 |
| 684 | Ga0501046_0048382 | 3300049580 | Bacteria | 3367 |
| 685 | Ga0501046_0110201 | 3300049580 | Bacteria | 2104 |
| 686 | Ga0501047_0001828 | 3300049581 | Bacteria | 20569 |
| 687 | Ga0501047_0012857 | 3300049581 | Bacteria | 7931 |
| 688 | Ga0501047_0015935 | 3300049581 | Bacteria | 7165 |
| 689 | Ga0501047_0018902 | 3300049581 | Bacteria | 6608 |
| 690 | Ga0501047_0029824 | 3300049581 | Bacteria | 5258 |
| 691 | Ga0501047_0185728 | 3300049581 | Bacteria | 1944 |
| 692 | Ga0501047_0400771 | 3300049581 | Bacteria | 1205 |
| 693 | Ga0501048_0005076 | 3300049582 | Bacteria | 10027 |
| 694 | Ga0501067_0000857 | 3300049583 | Bacteria | 16400 |
| 695 | Ga0501067_0070404 | 3300049583 | Bacteria | 1937 |
| 696 | Ga0501068_0041232 | 3300049584 | Bacteria | 2773 |
| 697 | Ga0501069_0002885 | 3300049585 | Bacteria | 8823 |
| 698 | Ga0501069_0004343 | 3300049585 | Bacteria | 7320 |
| 699 | Ga0501070_0005876 | 3300049586 | Bacteria | 10464 |
| 700 | Ga0501070_0013142 | 3300049586 | Bacteria | 6977 |
| 701 | Ga0501070_0015006 | 3300049586 | Bacteria | 6518 |
| 702 | Ga0501070_0053490 | 3300049586 | Bacteria | 3349 |
| 703 | Ga0501070_0157575 | 3300049586 | Bacteria | 1872 |
| 704 | Ga0501071_0071996 | 3300049587 | Bacteria | 2520 |
| 705 | Ga0501072_0000573 | 3300049588 | Bacteria | 26511 |
| 706 | Ga0501073_0000434 | 3300049589 | Bacteria | 28757 |
| 707 | Ga0501073_0006243 | 3300049589 | Bacteria | 8891 |
| 708 | Ga0501073_0021629 | 3300049589 | Bacteria | 4635 |
| 709 | Ga0501073_0044889 | 3300049589 | Bacteria | 3114 |
| 710 | Ga0501074_0003202 | 3300049590 | Bacteria | 11546 |
| 711 | Ga0501074_0004731 | 3300049590 | Bacteria | 9756 |
| 712 | Ga0501074_0050760 | 3300049590 | Bacteria | 2994 |
| 713 | Ga0501074_0054530 | 3300049590 | Bacteria | 2882 |
| 714 | Ga0501074_0091798 | 3300049590 | Bacteria | 2175 |
| 715 | Ga0501225_0007795 | 3300049705 | Bacteria | 3091 |
| 716 | Ga0501079_0004962 | 3300049741 | Bacteria | 9869 |
| 717 | Ga0501079_0011079 | 3300049741 | Bacteria | 6877 |
| 718 | Ga0501080_0000764 | 3300049742 | Bacteria | 26124 |
| 719 | Ga0501080_0029198 | 3300049742 | Bacteria | 5133 |
| 720 | Ga0501080_0040656 | 3300049742 | Bacteria | 4336 |
| 721 | Ga0501080_0182486 | 3300049742 | Bacteria | 1930 |
| 722 | Ga0501080_0245214 | 3300049742 | Bacteria | 1634 |
| 723 | Ga0501080_0303139 | 3300049742 | Bacteria | 1448 |
| 724 | Ga0501081_0063341 | 3300049743 | Bacteria | 2566 |
| 725 | Ga0501083_0000246 | 3300049744 | Bacteria | 34511 |
| 726 | Ga0501083_0156733 | 3300049744 | Bacteria | 1490 |
| 727 | Ga0501266_001423 | 3300049763 | Bacteria | 3052 |
| 728 | Ga0501275_000512 | 3300049772 | Bacteria | 4353 |
| 729 | Ga0501035_0013478 | 3300049822 | Bacteria | 7546 |
| 730 | Ga0501035_0062096 | 3300049822 | Bacteria | 3324 |
| 731 | Ga0501035_0062673 | 3300049822 | Bacteria | 3309 |
| 732 | Ga0501044_0004071 | 3300049823 | Bacteria | 16399 |
| 733 | Ga0501044_0015664 | 3300049823 | Bacteria | 8165 |
| 734 | Ga0501044_0017726 | 3300049823 | Bacteria | 7638 |
| 735 | Ga0501044_0051173 | 3300049823 | Bacteria | 4259 |
| 736 | Ga0501044_0081743 | 3300049823 | Bacteria | 3269 |
| 737 | Ga0501044_0104618 | 3300049823 | Bacteria | 2844 |
| 738 | Ga0501044_0133983 | 3300049823 | Bacteria | 2470 |
| 739 | Ga0501044_0149448 | 3300049823 | Bacteria | 2319 |
| 740 | Ga0501045_0074346 | 3300049824 | Bacteria | 2502 |
| 741 | nmdc:mga00v17_2252_c1 | 3300050491 | Bacteria | 9886 |
| 742 | Ga0500610_0000365 | 3300053079 | Bacteria | 13645 |
| 743 | Ga0500643_000012 | 3300053087 | Bacteria | 369839 |
| 744 | Ga0500651_0003309 | 3300053093 | Bacteria | 8779 |
| 745 | Ga0500651_0006630 | 3300053093 | Bacteria | 6696 |
| 746 | Ga0500651_0034171 | 3300053093 | Bacteria | 3206 |
| 747 | Ga0500597_000088 | 3300053120 | Bacteria | 19053 |
| 748 | Ga0500559_0018767 | 3300053136 | Bacteria | 2921 |
| 749 | Ga0500568_0000233 | 3300053139 | Bacteria | 47567 |
| 750 | Ga0500634_0000377 | 3300053161 | Bacteria | 14223 |
| 751 | Ga0501084_0121189 | 3300054114 | Bacteria | 2199 |
| 752 | Ga0501084_0138315 | 3300054114 | Bacteria | 2050 |
| 753 | Ga0500661_008171 | 3300055283 | Bacteria | 1924 |
| 754 | Ga0501082_0000107 | 3300060353 | Bacteria | 65178 |
| 755 | Ga0501082_0151352 | 3300060353 | Bacteria | 2015 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047471 | Ga0495684_0078978 | Ga0495684_0078978_41_934 | 295 |
| 2 | 3300005367 | Ga0070667_100082066 | Ga0070667_1000820662 | 301 |
| 3 | 3300032004 | Ga0307414_10003632 | Ga0307414_100036323 | 307 |
| 4 | 3300005364 | Ga0070673_100111799 | Ga0070673_1001117992 | 308 |
| 5 | 3300005459 | Ga0068867_100140107 | Ga0068867_1001401072 | 308 |
| 6 | 3300025960 | Ga0207651_10321806 | Ga0207651_103218062 | 308 |
| 7 | 3300026089 | Ga0207648_10071014 | Ga0207648_100710142 | 308 |
| 8 | 3300032004 | Ga0307414_10000883 | Ga0307414_100008835 | 310 |
| 9 | 3300005616 | Ga0068852_100014146 | Ga0068852_1000141466 | 311 |
| 10 | 3300025949 | Ga0207667_10258218 | Ga0207667_102582182 | 311 |
| 11 | 3300048921 | Ga0496118_0006523 | Ga0496118_0006523_291_1325 | 311 |
| 12 | iso_pu_bacteria | 2643221593 | 2643973375 | 311 |
| 13 | 3300002773 | JGI25152J39213_1000103 | JGI25152J39213_10001035 | 312 |
| 14 | 3300002774 | JGI25150J39212_1000183 | JGI25150J39212_100018327 | 312 |
| 15 | 3300003187 | JGI25151J46595_10000271 | JGI25151J46595_1000027146 | 312 |
| 16 | 3300003215 | JGI25153J46596_10000190 | JGI25153J46596_1000019046 | 312 |
| 17 | 3300009098 | Ga0105245_10165864 | Ga0105245_101658642 | 312 |
| 18 | 3300025245 | Ga0207425_1000148 | Ga0207425_10001485 | 312 |
| 19 | 3300025258 | Ga0209129_1000239 | Ga0209129_10002395 | 312 |
| 20 | 3300025294 | Ga0209025_1000048 | Ga0209025_1000048250 | 312 |
| 21 | 3300025297 | Ga0209758_1000056 | Ga0209758_1000056250 | 312 |
| 22 | 3300005844 | Ga0068862_100099430 | Ga0068862_1000994302 | 313 |
| 23 | 3300005331 | Ga0070670_100147541 | Ga0070670_1001475412 | 317 |
| 24 | 3300025925 | Ga0207650_10112978 | Ga0207650_101129782 | 317 |
| 25 | 3300028794 | Ga0307515_10125655 | Ga0307515_101256552 | 317 |
| 26 | 3300025933 | Ga0207706_10028883 | Ga0207706_100288832 | 318 |
| 27 | 3300005354 | Ga0070675_100387590 | Ga0070675_1003875901 | 319 |
| 28 | 3300031456 | Ga0307513_10006814 | Ga0307513_100068143 | 320 |
| 29 | 3300031730 | Ga0307516_10176328 | Ga0307516_101763282 | 321 |
| 30 | 3300005841 | Ga0068863_100024540 | Ga0068863_1000245404 | 323 |
| 31 | 3300006237 | Ga0097621_100326759 | Ga0097621_1003267592 | 323 |
| 32 | 3300009551 | Ga0105238_10009039 | Ga0105238_100090392 | 323 |
| 33 | 3300013306 | Ga0163162_10280900 | Ga0163162_102809002 | 323 |
| 34 | 3300025924 | Ga0207694_10056309 | Ga0207694_100563092 | 323 |
| 35 | 3300026088 | Ga0207641_10045468 | Ga0207641_100454684 | 323 |
| 36 | 3300031691 | Ga0316579_10002710 | Ga0316579_100027104 | 323 |
| 37 | 3300031727 | Ga0316576_10006785 | Ga0316576_100067856 | 323 |
| 38 | 3300031727 | Ga0316576_10182135 | Ga0316576_101821352 | 323 |
| 39 | 3300031728 | Ga0316578_10046275 | Ga0316578_100462754 | 323 |
| 40 | 3300031733 | Ga0316577_10019739 | Ga0316577_100197392 | 323 |
| 41 | 3300031733 | Ga0316577_10064644 | Ga0316577_100646441 | 323 |
| 42 | 3300035398 | Ga0316574_0058217 | Ga0316574_0058217_1285_2268 | 323 |
| 43 | 3300036712 | Ga0316584_0189592 | Ga0316584_0189592_293_1276 | 323 |
| 44 | 3300046471 | Ga0495650_0000469 | Ga0495650_0000469_42938_43912 | 323 |
| 45 | 3300046660 | Ga0495625_0007542 | Ga0495625_0007542_5483_6457 | 323 |
| 46 | 3300048924 | Ga0496121_0177607 | Ga0496121_0177607_301_1275 | 323 |
| 47 | 3300048929 | Ga0496126_0093660 | Ga0496126_0093660_661_1635 | 323 |
| 48 | 3300005614 | Ga0068856_100007098 | Ga0068856_1000070984 | 324 |
| 49 | 3300026078 | Ga0207702_10003377 | Ga0207702_100033779 | 324 |
| 50 | 3300049513 | Ga0501290_001810 | Ga0501290_001810_474_1520 | 324 |
| 51 | 3300049569 | Ga0501032_0058995 | Ga0501032_0058995_276_1262 | 324 |
| 52 | 3300049570 | Ga0501033_0000648 | Ga0501033_0000648_2218_3204 | 324 |
| 53 | 3300049572 | Ga0501036_0008180 | Ga0501036_0008180_1499_2485 | 324 |
| 54 | 3300049579 | Ga0501043_0016644 | Ga0501043_0016644_1062_2048 | 324 |
| 55 | 3300049580 | Ga0501046_0048382 | Ga0501046_0048382_1482_2468 | 324 |
| 56 | 3300049590 | Ga0501074_0050760 | Ga0501074_0050760_291_1277 | 324 |
| 57 | 3300049823 | Ga0501044_0081743 | Ga0501044_0081743_1663_2649 | 324 |
| 58 | 3300053136 | Ga0500559_0018767 | Ga0500559_0018767_827_1804 | 324 |
| 59 | iso_pu_bacteria | 2643221577 | 2643897016 | 324 |
| 60 | iso_pu_bacteria | 2643221685 | 2644479221 | 324 |
| 61 | iso_pu_bacteria | 2842918807 | 2842921935 | 324 |
| 62 | iso_pu_bacteria | 2953994433 | 2953997027 | 324 |
| 63 | 3300005335 | Ga0070666_10000442 | Ga0070666_1000044222 | 325 |
| 64 | 3300005458 | Ga0070681_10009167 | Ga0070681_100091674 | 325 |
| 65 | 3300013100 | Ga0157373_10012798 | Ga0157373_100127986 | 325 |
| 66 | 3300014325 | Ga0163163_10000029 | Ga0163163_1000002942 | 325 |
| 67 | 3300025903 | Ga0207680_10000529 | Ga0207680_1000052911 | 325 |
| 68 | 3300025912 | Ga0207707_10000578 | Ga0207707_100005784 | 325 |
| 69 | 3300025986 | Ga0207658_10253279 | Ga0207658_102532792 | 325 |
| 70 | 3300031665 | Ga0316575_10014957 | Ga0316575_100149574 | 325 |
| 71 | 3300031730 | Ga0307516_10068264 | Ga0307516_100682642 | 325 |
| 72 | 3300049571 | Ga0501034_0030969 | Ga0501034_0030969_3962_4951 | 325 |
| 73 | 3300049572 | Ga0501036_0078118 | Ga0501036_0078118_1137_2126 | 325 |
| 74 | 3300049579 | Ga0501043_0033628 | Ga0501043_0033628_2404_3390 | 325 |
| 75 | 3300049579 | Ga0501043_0045909 | Ga0501043_0045909_1398_2387 | 325 |
| 76 | 3300049580 | Ga0501046_0110201 | Ga0501046_0110201_837_1826 | 325 |
| 77 | 3300049581 | Ga0501047_0001828 | Ga0501047_0001828_14806_15792 | 325 |
| 78 | 3300049581 | Ga0501047_0012857 | Ga0501047_0012857_3397_4386 | 325 |
| 79 | 3300049586 | Ga0501070_0005876 | Ga0501070_0005876_6853_7839 | 325 |
| 80 | 3300049586 | Ga0501070_0013142 | Ga0501070_0013142_2934_3923 | 325 |
| 81 | 3300049590 | Ga0501074_0054530 | Ga0501074_0054530_247_1236 | 325 |
| 82 | 3300049590 | Ga0501074_0091798 | Ga0501074_0091798_822_1808 | 325 |
| 83 | 3300049742 | Ga0501080_0000764 | Ga0501080_0000764_15584_16570 | 325 |
| 84 | 3300049742 | Ga0501080_0029198 | Ga0501080_0029198_799_1788 | 325 |
| 85 | 3300049823 | Ga0501044_0133983 | Ga0501044_0133983_728_1717 | 325 |
| 86 | 3300001904 | JGI24736J21556_1013961 | JGI24736J21556_10139612 | 326 |
| 87 | 3300005329 | Ga0070683_100207011 | Ga0070683_1002070112 | 326 |
| 88 | 3300005335 | Ga0070666_10260359 | Ga0070666_102603591 | 326 |
| 89 | 3300005366 | Ga0070659_100067261 | Ga0070659_1000672612 | 326 |
| 90 | 3300005367 | Ga0070667_100139793 | Ga0070667_1001397932 | 326 |
| 91 | 3300005530 | Ga0070679_100175899 | Ga0070679_1001758992 | 326 |
| 92 | 3300005535 | Ga0070684_100024537 | Ga0070684_1000245372 | 326 |
| 93 | 3300005539 | Ga0068853_100028892 | Ga0068853_1000288925 | 326 |
| 94 | 3300005563 | Ga0068855_100105650 | Ga0068855_1001056502 | 326 |
| 95 | 3300005577 | Ga0068857_100168752 | Ga0068857_1001687522 | 326 |
| 96 | 3300005618 | Ga0068864_100020044 | Ga0068864_1000200446 | 326 |
| 97 | 3300005834 | Ga0068851_10032986 | Ga0068851_100329862 | 326 |
| 98 | 3300005843 | Ga0068860_100002386 | Ga0068860_10000238613 | 326 |
| 99 | 3300005843 | Ga0068860_100124956 | Ga0068860_1001249564 | 326 |
| 100 | 3300009177 | Ga0105248_10117468 | Ga0105248_101174682 | 326 |
| 101 | 3300009545 | Ga0105237_10118736 | Ga0105237_101187362 | 326 |
| 102 | 3300010375 | Ga0105239_10010309 | Ga0105239_100103096 | 326 |
| 103 | 3300011119 | Ga0105246_10020817 | Ga0105246_100208172 | 326 |
| 104 | 3300011119 | Ga0105246_10064583 | Ga0105246_100645832 | 326 |
| 105 | 3300013100 | Ga0157373_10042694 | Ga0157373_100426944 | 326 |
| 106 | 3300013104 | Ga0157370_10131797 | Ga0157370_101317973 | 326 |
| 107 | 3300013307 | Ga0157372_10028390 | Ga0157372_100283902 | 326 |
| 108 | 3300014325 | Ga0163163_10000564 | Ga0163163_1000056427 | 326 |
| 109 | 3300014497 | Ga0182008_10020566 | Ga0182008_100205662 | 326 |
| 110 | 3300014968 | Ga0157379_10001942 | Ga0157379_1000194217 | 326 |
| 111 | 3300014969 | Ga0157376_10063340 | Ga0157376_100633402 | 326 |
| 112 | 3300025904 | Ga0207647_10001336 | Ga0207647_1000133611 | 326 |
| 113 | 3300025912 | Ga0207707_10242082 | Ga0207707_102420822 | 326 |
| 114 | 3300025919 | Ga0207657_10002547 | Ga0207657_1000254720 | 326 |
| 115 | 3300025921 | Ga0207652_10150244 | Ga0207652_101502442 | 326 |
| 116 | 3300025932 | Ga0207690_10191206 | Ga0207690_101912062 | 326 |
| 117 | 3300025941 | Ga0207711_10149769 | Ga0207711_101497692 | 326 |
| 118 | 3300025942 | Ga0207689_10080295 | Ga0207689_100802952 | 326 |
| 119 | 3300025944 | Ga0207661_10113455 | Ga0207661_101134554 | 326 |
| 120 | 3300025949 | Ga0207667_10038594 | Ga0207667_100385943 | 326 |
| 121 | 3300025949 | Ga0207667_10264415 | Ga0207667_102644151 | 326 |
| 122 | 3300026035 | Ga0207703_10235448 | Ga0207703_102354482 | 326 |
| 123 | 3300026088 | Ga0207641_10042543 | Ga0207641_100425432 | 326 |
| 124 | 3300026095 | Ga0207676_10005524 | Ga0207676_100055248 | 326 |
| 125 | 3300026116 | Ga0207674_10008389 | Ga0207674_100083897 | 326 |
| 126 | 3300028381 | Ga0268264_10096469 | Ga0268264_100964692 | 326 |
| 127 | 3300031665 | Ga0316575_10079546 | Ga0316575_100795461 | 326 |
| 128 | 3300031727 | Ga0316576_10060931 | Ga0316576_100609312 | 326 |
| 129 | 3300035398 | Ga0316574_0008265 | Ga0316574_0008265_3993_4991 | 326 |
| 130 | 3300035398 | Ga0316574_0066006 | Ga0316574_0066006_657_1667 | 326 |
| 131 | 3300035398 | Ga0316574_0098537 | Ga0316574_0098537_775_1773 | 326 |
| 132 | 3300037418 | Ga0395900_0000163 | Ga0395900_0000163_37235_38221 | 326 |
| 133 | 3300037466 | Ga0395898_0137307 | Ga0395898_0137307_390_1376 | 326 |
| 134 | 3300047472 | Ga0495686_0145793 | Ga0495686_0145793_34_1020 | 326 |
| 135 | 3300048906 | Ga0496103_0081056 | Ga0496103_0081056_938_1942 | 326 |
| 136 | 3300048918 | Ga0496115_0000077 | Ga0496115_0000077_56102_57103 | 326 |
| 137 | 3300048921 | Ga0496118_0009851 | Ga0496118_0009851_3597_4601 | 326 |
| 138 | 3300048929 | Ga0496126_0000047 | Ga0496126_0000047_237479_238480 | 326 |
| 139 | 3300053093 | Ga0500651_0003309 | Ga0500651_0003309_2495_3475 | 326 |
| 140 | 3300005327 | Ga0070658_10007622 | Ga0070658_100076224 | 327 |
| 141 | 3300005331 | Ga0070670_100197263 | Ga0070670_1001972632 | 327 |
| 142 | 3300005335 | Ga0070666_10000022 | Ga0070666_10000022108 | 327 |
| 143 | 3300005338 | Ga0068868_100128293 | Ga0068868_1001282932 | 327 |
| 144 | 3300005344 | Ga0070661_100009383 | Ga0070661_1000093835 | 327 |
| 145 | 3300005344 | Ga0070661_100015590 | Ga0070661_1000155905 | 327 |
| 146 | 3300005344 | Ga0070661_100124692 | Ga0070661_1001246922 | 327 |
| 147 | 3300005355 | Ga0070671_100045193 | Ga0070671_1000451932 | 327 |
| 148 | 3300005367 | Ga0070667_100005400 | Ga0070667_10000540011 | 327 |
| 149 | 3300005367 | Ga0070667_100041398 | Ga0070667_1000413982 | 327 |
| 150 | 3300005535 | Ga0070684_100048363 | Ga0070684_1000483632 | 327 |
| 151 | 3300005539 | Ga0068853_100004195 | Ga0068853_1000041956 | 327 |
| 152 | 3300005547 | Ga0070693_100012299 | Ga0070693_1000122992 | 327 |
| 153 | 3300005548 | Ga0070665_100000028 | Ga0070665_100000028164 | 327 |
| 154 | 3300005548 | Ga0070665_100010878 | Ga0070665_1000108782 | 327 |
| 155 | 3300005578 | Ga0068854_100080020 | Ga0068854_1000800202 | 327 |
| 156 | 3300005614 | Ga0068856_100229373 | Ga0068856_1002293732 | 327 |
| 157 | 3300005616 | Ga0068852_100005973 | Ga0068852_1000059733 | 327 |
| 158 | 3300005842 | Ga0068858_100160243 | Ga0068858_1001602432 | 327 |
| 159 | 3300006237 | Ga0097621_100083770 | Ga0097621_1000837702 | 327 |
| 160 | 3300006358 | Ga0068871_100039983 | Ga0068871_1000399832 | 327 |
| 161 | 3300009093 | Ga0105240_10152371 | Ga0105240_101523712 | 327 |
| 162 | 3300009174 | Ga0105241_10055846 | Ga0105241_100558462 | 327 |
| 163 | 3300009545 | Ga0105237_10011173 | Ga0105237_100111737 | 327 |
| 164 | 3300009551 | Ga0105238_10000175 | Ga0105238_1000017543 | 327 |
| 165 | 3300009551 | Ga0105238_10006626 | Ga0105238_100066264 | 327 |
| 166 | 3300009551 | Ga0105238_10030657 | Ga0105238_100306575 | 327 |
| 167 | 3300010375 | Ga0105239_10107680 | Ga0105239_101076802 | 327 |
| 168 | 3300013105 | Ga0157369_10002250 | Ga0157369_1000225016 | 327 |
| 169 | 3300013307 | Ga0157372_10000344 | Ga0157372_1000034418 | 327 |
| 170 | 3300014325 | Ga0163163_10286193 | Ga0163163_102861932 | 327 |
| 171 | 3300014497 | Ga0182008_10008822 | Ga0182008_100088222 | 327 |
| 172 | 3300014968 | Ga0157379_10153983 | Ga0157379_101539832 | 327 |
| 173 | 3300015261 | Ga0182006_1004720 | Ga0182006_10047204 | 327 |
| 174 | 3300017792 | Ga0163161_10013517 | Ga0163161_100135174 | 327 |
| 175 | 3300025258 | Ga0209129_1001622 | Ga0209129_10016226 | 327 |
| 176 | 3300025297 | Ga0209758_1009524 | Ga0209758_10095242 | 327 |
| 177 | 3300025903 | Ga0207680_10000001 | Ga0207680_10000001511 | 327 |
| 178 | 3300025909 | Ga0207705_10001049 | Ga0207705_100010495 | 327 |
| 179 | 3300025911 | Ga0207654_10000458 | Ga0207654_100004584 | 327 |
| 180 | 3300025911 | Ga0207654_10063425 | Ga0207654_100634252 | 327 |
| 181 | 3300025913 | Ga0207695_10000772 | Ga0207695_1000077210 | 327 |
| 182 | 3300025914 | Ga0207671_10030679 | Ga0207671_100306792 | 327 |
| 183 | 3300025919 | Ga0207657_10170713 | Ga0207657_101707132 | 327 |
| 184 | 3300025920 | Ga0207649_10004292 | Ga0207649_100042922 | 327 |
| 185 | 3300025920 | Ga0207649_10012167 | Ga0207649_100121674 | 327 |
| 186 | 3300025924 | Ga0207694_10000257 | Ga0207694_1000025752 | 327 |
| 187 | 3300025924 | Ga0207694_10006803 | Ga0207694_100068038 | 327 |
| 188 | 3300025925 | Ga0207650_10168174 | Ga0207650_101681742 | 327 |
| 189 | 3300025931 | Ga0207644_10166932 | Ga0207644_101669322 | 327 |
| 190 | 3300025938 | Ga0207704_10053643 | Ga0207704_100536432 | 327 |
| 191 | 3300025945 | Ga0207679_10026576 | Ga0207679_100265762 | 327 |
| 192 | 3300025949 | Ga0207667_10019912 | Ga0207667_100199128 | 327 |
| 193 | 3300025949 | Ga0207667_10164835 | Ga0207667_101648352 | 327 |
| 194 | 3300025972 | Ga0207668_10130946 | Ga0207668_101309462 | 327 |
| 195 | 3300025986 | Ga0207658_10009244 | Ga0207658_100092442 | 327 |
| 196 | 3300025986 | Ga0207658_10090619 | Ga0207658_100906192 | 327 |
| 197 | 3300026023 | Ga0207677_10008057 | Ga0207677_100080576 | 327 |
| 198 | 3300026035 | Ga0207703_10109403 | Ga0207703_101094032 | 327 |
| 199 | 3300026035 | Ga0207703_10116118 | Ga0207703_101161182 | 327 |
| 200 | 3300026041 | Ga0207639_10000514 | Ga0207639_1000051412 | 327 |
| 201 | 3300026041 | Ga0207639_10140881 | Ga0207639_101408812 | 327 |
| 202 | 3300026078 | Ga0207702_10027084 | Ga0207702_100270843 | 327 |
| 203 | 3300026088 | Ga0207641_10214292 | Ga0207641_102142922 | 327 |
| 204 | 3300026142 | Ga0207698_10041061 | Ga0207698_100410612 | 327 |
| 205 | 3300028379 | Ga0268266_10000017 | Ga0268266_10000017308 | 327 |
| 206 | 3300028379 | Ga0268266_10000091 | Ga0268266_1000009146 | 327 |
| 207 | 3300028379 | Ga0268266_10196408 | Ga0268266_101964082 | 327 |
| 208 | 3300028381 | Ga0268264_10153509 | Ga0268264_101535093 | 327 |
| 209 | 3300028786 | Ga0307517_10113675 | Ga0307517_101136752 | 327 |
| 210 | 3300033180 | Ga0307510_10006402 | Ga0307510_1000640213 | 327 |
| 211 | 3300041404 | Ga0439436_0000009 | Ga0439436_0000009_8918_9916 | 327 |
| 212 | 3300041413 | Ga0439465_0001199 | Ga0439465_0001199_3359_4357 | 327 |
| 213 | 3300042004 | Ga0439445_0027556 | Ga0439445_0027556_209_1207 | 327 |
| 214 | 3300045049 | Ga0466959_0012881 | Ga0466959_0012881_2431_3414 | 327 |
| 215 | 3300046507 | Ga0495606_0204894 | Ga0495606_0204894_41_1039 | 327 |
| 216 | 3300046512 | Ga0495610_0002419 | Ga0495610_0002419_4900_5898 | 327 |
| 217 | 3300046691 | Ga0495670_0006739 | Ga0495670_0006739_4452_5450 | 327 |
| 218 | 3300046694 | Ga0495649_0030572 | Ga0495649_0030572_1660_2658 | 327 |
| 219 | 3300049581 | Ga0501047_0185728 | Ga0501047_0185728_407_1420 | 327 |
| 220 | 3300049742 | Ga0501080_0245214 | Ga0501080_0245214_198_1184 | 327 |
| 221 | 3300049823 | Ga0501044_0004071 | Ga0501044_0004071_10330_11343 | 327 |
| 222 | 3300053087 | Ga0500643_000012 | Ga0500643_000012_17377_18375 | 327 |
| 223 | iso_pu_bacteria | 2919513703 | 2919517140 | 327 |
| 224 | iso_pu_bacteria | 2919675420 | 2919677595 | 327 |
| 225 | 3300003792 | Ga0055540_1034558 | Ga0055540_10345581 | 328 |
| 226 | 3300005327 | Ga0070658_10061938 | Ga0070658_100619382 | 328 |
| 227 | 3300005335 | Ga0070666_10118619 | Ga0070666_101186192 | 328 |
| 228 | 3300005347 | Ga0070668_100156977 | Ga0070668_1001569772 | 328 |
| 229 | 3300005367 | Ga0070667_100447199 | Ga0070667_1004471991 | 328 |
| 230 | 3300005539 | Ga0068853_100007213 | Ga0068853_1000072138 | 328 |
| 231 | 3300005548 | Ga0070665_100027661 | Ga0070665_1000276615 | 328 |
| 232 | 3300005548 | Ga0070665_100168154 | Ga0070665_1001681543 | 328 |
| 233 | 3300005563 | Ga0068855_100268834 | Ga0068855_1002688342 | 328 |
| 234 | 3300005577 | Ga0068857_100053558 | Ga0068857_1000535583 | 328 |
| 235 | 3300005617 | Ga0068859_100000280 | Ga0068859_10000028032 | 328 |
| 236 | 3300005834 | Ga0068851_10087320 | Ga0068851_100873202 | 328 |
| 237 | 3300005841 | Ga0068863_100077761 | Ga0068863_1000777613 | 328 |
| 238 | 3300005844 | Ga0068862_100000215 | Ga0068862_10000021516 | 328 |
| 239 | 3300006237 | Ga0097621_100012950 | Ga0097621_1000129506 | 328 |
| 240 | 3300006931 | Ga0097620_100000280 | Ga0097620_10000028013 | 328 |
| 241 | 3300009545 | Ga0105237_10298437 | Ga0105237_102984372 | 328 |
| 242 | 3300009553 | Ga0105249_10355553 | Ga0105249_103555531 | 328 |
| 243 | 3300010375 | Ga0105239_10472879 | Ga0105239_104728791 | 328 |
| 244 | 3300013100 | Ga0157373_10087870 | Ga0157373_100878702 | 328 |
| 245 | 3300013105 | Ga0157369_10004413 | Ga0157369_100044137 | 328 |
| 246 | 3300013105 | Ga0157369_10169167 | Ga0157369_101691672 | 328 |
| 247 | 3300013307 | Ga0157372_10057810 | Ga0157372_100578102 | 328 |
| 248 | 3300025321 | Ga0207656_10054810 | Ga0207656_100548102 | 328 |
| 249 | 3300025909 | Ga0207705_10096042 | Ga0207705_100960422 | 328 |
| 250 | 3300025911 | Ga0207654_10071741 | Ga0207654_100717412 | 328 |
| 251 | 3300025912 | Ga0207707_10045794 | Ga0207707_100457942 | 328 |
| 252 | 3300025913 | Ga0207695_10006223 | Ga0207695_100062236 | 328 |
| 253 | 3300025914 | Ga0207671_10011332 | Ga0207671_100113327 | 328 |
| 254 | 3300025914 | Ga0207671_10171438 | Ga0207671_101714382 | 328 |
| 255 | 3300025916 | Ga0207663_10175468 | Ga0207663_101754681 | 328 |
| 256 | 3300025924 | Ga0207694_10024311 | Ga0207694_100243112 | 328 |
| 257 | 3300025940 | Ga0207691_10007233 | Ga0207691_1000723310 | 328 |
| 258 | 3300025961 | Ga0207712_10279439 | Ga0207712_102794391 | 328 |
| 259 | 3300026041 | Ga0207639_10191740 | Ga0207639_101917402 | 328 |
| 260 | 3300026041 | Ga0207639_10230228 | Ga0207639_102302282 | 328 |
| 261 | 3300026088 | Ga0207641_10060657 | Ga0207641_100606573 | 328 |
| 262 | 3300026116 | Ga0207674_10059733 | Ga0207674_100597332 | 328 |
| 263 | 3300028379 | Ga0268266_10080274 | Ga0268266_100802741 | 328 |
| 264 | 3300028380 | Ga0268265_10000376 | Ga0268265_1000037616 | 328 |
| 265 | 3300033179 | Ga0307507_10216035 | Ga0307507_102160351 | 328 |
| 266 | 3300044658 | Ga0466972_0001414 | Ga0466972_0001414_5785_6771 | 328 |
| 267 | 3300044765 | Ga0466970_0001522 | Ga0466970_0001522_4428_5414 | 328 |
| 268 | 3300049568 | Ga0501031_0011342 | Ga0501031_0011342_529_1545 | 328 |
| 269 | 3300049569 | Ga0501032_0009391 | Ga0501032_0009391_3553_4554 | 328 |
| 270 | 3300049570 | Ga0501033_0011737 | Ga0501033_0011737_1427_2413 | 328 |
| 271 | 3300049570 | Ga0501033_0111712 | Ga0501033_0111712_444_1460 | 328 |
| 272 | 3300049571 | Ga0501034_0002782 | Ga0501034_0002782_6899_7915 | 328 |
| 273 | 3300049571 | Ga0501034_0004087 | Ga0501034_0004087_14118_15104 | 328 |
| 274 | 3300049571 | Ga0501034_0011508 | Ga0501034_0011508_600_1601 | 328 |
| 275 | 3300049573 | Ga0501037_0001193 | Ga0501037_0001193_4330_5316 | 328 |
| 276 | 3300049574 | Ga0501038_0002825 | Ga0501038_0002825_14095_15081 | 328 |
| 277 | 3300049575 | Ga0501039_0017656 | Ga0501039_0017656_4384_5400 | 328 |
| 278 | 3300049576 | Ga0501040_0028881 | Ga0501040_0028881_1545_2561 | 328 |
| 279 | 3300049578 | Ga0501042_0088828 | Ga0501042_0088828_218_1234 | 328 |
| 280 | 3300049579 | Ga0501043_0004836 | Ga0501043_0004836_822_1808 | 328 |
| 281 | 3300049580 | Ga0501046_0002835 | Ga0501046_0002835_1644_2630 | 328 |
| 282 | 3300049581 | Ga0501047_0015935 | Ga0501047_0015935_3536_4552 | 328 |
| 283 | 3300049581 | Ga0501047_0018902 | Ga0501047_0018902_571_1572 | 328 |
| 284 | 3300049582 | Ga0501048_0005076 | Ga0501048_0005076_5258_6274 | 328 |
| 285 | 3300049583 | Ga0501067_0000857 | Ga0501067_0000857_6202_7203 | 328 |
| 286 | 3300049583 | Ga0501067_0070404 | Ga0501067_0070404_123_1109 | 328 |
| 287 | 3300049584 | Ga0501068_0041232 | Ga0501068_0041232_1357_2373 | 328 |
| 288 | 3300049585 | Ga0501069_0002885 | Ga0501069_0002885_575_1591 | 328 |
| 289 | 3300049585 | Ga0501069_0004343 | Ga0501069_0004343_3351_4352 | 328 |
| 290 | 3300049586 | Ga0501070_0157575 | Ga0501070_0157575_413_1429 | 328 |
| 291 | 3300049587 | Ga0501071_0071996 | Ga0501071_0071996_971_1987 | 328 |
| 292 | 3300049588 | Ga0501072_0000573 | Ga0501072_0000573_16500_17501 | 328 |
| 293 | 3300049589 | Ga0501073_0000434 | Ga0501073_0000434_2818_3819 | 328 |
| 294 | 3300049589 | Ga0501073_0006243 | Ga0501073_0006243_6352_7338 | 328 |
| 295 | 3300049589 | Ga0501073_0044889 | Ga0501073_0044889_1940_2956 | 328 |
| 296 | 3300049590 | Ga0501074_0003202 | Ga0501074_0003202_9206_10207 | 328 |
| 297 | 3300049590 | Ga0501074_0004731 | Ga0501074_0004731_2201_3217 | 328 |
| 298 | 3300049741 | Ga0501079_0004962 | Ga0501079_0004962_7111_8112 | 328 |
| 299 | 3300049741 | Ga0501079_0011079 | Ga0501079_0011079_3909_4925 | 328 |
| 300 | 3300049742 | Ga0501080_0040656 | Ga0501080_0040656_1080_2081 | 328 |
| 301 | 3300049742 | Ga0501080_0182486 | Ga0501080_0182486_340_1356 | 328 |
| 302 | 3300049743 | Ga0501081_0063341 | Ga0501081_0063341_586_1602 | 328 |
| 303 | 3300049744 | Ga0501083_0000246 | Ga0501083_0000246_24403_25404 | 328 |
| 304 | 3300049823 | Ga0501044_0015664 | Ga0501044_0015664_5886_6872 | 328 |
| 305 | 3300049823 | Ga0501044_0104618 | Ga0501044_0104618_397_1398 | 328 |
| 306 | 3300049824 | Ga0501045_0074346 | Ga0501045_0074346_1037_2053 | 328 |
| 307 | 3300053093 | Ga0500651_0034171 | Ga0500651_0034171_773_1765 | 328 |
| 308 | 3300054114 | Ga0501084_0121189 | Ga0501084_0121189_594_1595 | 328 |
| 309 | 3300060353 | Ga0501082_0151352 | Ga0501082_0151352_550_1551 | 328 |
| 310 | 3300005337 | Ga0070682_100000806 | Ga0070682_1000008065 | 329 |
| 311 | 3300005337 | Ga0070682_100088428 | Ga0070682_1000884282 | 329 |
| 312 | 3300005366 | Ga0070659_100011336 | Ga0070659_1000113362 | 329 |
| 313 | 3300005366 | Ga0070659_100018023 | Ga0070659_1000180233 | 329 |
| 314 | 3300005539 | Ga0068853_100000720 | Ga0068853_1000007208 | 329 |
| 315 | 3300005539 | Ga0068853_100148770 | Ga0068853_1001487702 | 329 |
| 316 | 3300005578 | Ga0068854_100128325 | Ga0068854_1001283252 | 329 |
| 317 | 3300005616 | Ga0068852_100055732 | Ga0068852_1000557324 | 329 |
| 318 | 3300005843 | Ga0068860_100107390 | Ga0068860_1001073902 | 329 |
| 319 | 3300006881 | Ga0068865_100001586 | Ga0068865_1000015869 | 329 |
| 320 | 3300009176 | Ga0105242_10079196 | Ga0105242_100791961 | 329 |
| 321 | 3300009551 | Ga0105238_10041838 | Ga0105238_100418386 | 329 |
| 322 | 3300009979 | Ga0105032_100317 | Ga0105032_1003173 | 329 |
| 323 | 3300013100 | Ga0157373_10009800 | Ga0157373_100098005 | 329 |
| 324 | 3300013102 | Ga0157371_10010395 | Ga0157371_100103956 | 329 |
| 325 | 3300013104 | Ga0157370_10001260 | Ga0157370_1000126011 | 329 |
| 326 | 3300013104 | Ga0157370_10044732 | Ga0157370_100447322 | 329 |
| 327 | 3300013306 | Ga0163162_10018817 | Ga0163162_100188172 | 329 |
| 328 | 3300013308 | Ga0157375_10019950 | Ga0157375_100199501 | 329 |
| 329 | 3300014969 | Ga0157376_10007306 | Ga0157376_100073064 | 329 |
| 330 | 3300025231 | Ga0207427_100349 | Ga0207427_10034912 | 329 |
| 331 | 3300025233 | Ga0209437_100886 | Ga0209437_10088611 | 329 |
| 332 | 3300025261 | Ga0209233_1000998 | Ga0209233_100099811 | 329 |
| 333 | 3300025924 | Ga0207694_10143318 | Ga0207694_101433182 | 329 |
| 334 | 3300025932 | Ga0207690_10019109 | Ga0207690_100191094 | 329 |
| 335 | 3300025932 | Ga0207690_10042976 | Ga0207690_100429762 | 329 |
| 336 | 3300025949 | Ga0207667_10012090 | Ga0207667_100120908 | 329 |
| 337 | 3300025981 | Ga0207640_10019306 | Ga0207640_100193062 | 329 |
| 338 | 3300026035 | Ga0207703_10326770 | Ga0207703_103267702 | 329 |
| 339 | 3300026041 | Ga0207639_10003146 | Ga0207639_100031463 | 329 |
| 340 | 3300026041 | Ga0207639_10119482 | Ga0207639_101194822 | 329 |
| 341 | 3300035120 | Ga0373957_0028125 | Ga0373957_0028125_134_1135 | 329 |
| 342 | 3300035724 | Ga0373933_0179551 | Ga0373933_0179551_32_1033 | 329 |
| 343 | 3300036401 | Ga0373937_0007519 | Ga0373937_0007519_4958_5959 | 329 |
| 344 | 3300046473 | Ga0495582_0009245 | Ga0495582_0009245_4377_5378 | 329 |
| 345 | 3300046531 | Ga0495665_0054589 | Ga0495665_0054589_753_1754 | 329 |
| 346 | 3300046536 | Ga0495587_0125298 | Ga0495587_0125298_314_1315 | 329 |
| 347 | 3300046663 | Ga0495635_0085671 | Ga0495635_0085671_1050_2051 | 329 |
| 348 | 3300046683 | Ga0495658_0011054 | Ga0495658_0011054_509_1510 | 329 |
| 349 | 3300048907 | Ga0496104_0000005 | Ga0496104_0000005_48100_49101 | 329 |
| 350 | 3300048908 | Ga0496105_0000106 | Ga0496105_0000106_12216_13217 | 329 |
| 351 | 3300049571 | Ga0501034_0039821 | Ga0501034_0039821_2593_3603 | 329 |
| 352 | 3300049573 | Ga0501037_0002066 | Ga0501037_0002066_4113_5123 | 329 |
| 353 | 3300049586 | Ga0501070_0015006 | Ga0501070_0015006_4823_5833 | 329 |
| 354 | 3300049772 | Ga0501275_000512 | Ga0501275_000512_2187_3209 | 329 |
| 355 | 3300049822 | Ga0501035_0062096 | Ga0501035_0062096_345_1337 | 329 |
| 356 | 3300049822 | Ga0501035_0062673 | Ga0501035_0062673_1424_2434 | 329 |
| 357 | 3300049823 | Ga0501044_0017726 | Ga0501044_0017726_155_1147 | 329 |
| 358 | 3300049823 | Ga0501044_0149448 | Ga0501044_0149448_612_1622 | 329 |
| 359 | iso_pu_bacteria | 2547132130 | 2547503588 | 329 |
| 360 | iso_pu_bacteria | 2576861471 | 2578456968 | 329 |
| 361 | iso_pu_bacteria | 2643221695 | 2644528196 | 329 |
| 362 | iso_pu_bacteria | 2747842428 | 2747949942 | 329 |
| 363 | iso_pu_bacteria | 2765235840 | 2765580538 | 329 |
| 364 | iso_pu_bacteria | 2816332141 | 2816518438 | 329 |
| 365 | iso_pu_bacteria | 2842391507 | 2842394453 | 329 |
| 366 | iso_pu_bacteria | 2842757796 | 2842758985 | 329 |
| 367 | iso_pu_bacteria | 2857442823 | 2857446999 | 329 |
| 368 | iso_pu_bacteria | 2874220319 | 2874223201 | 329 |
| 369 | iso_pu_bacteria | 2894414249 | 2894414281 | 329 |
| 370 | iso_pu_bacteria | 2919089067 | 2919093236 | 329 |
| 371 | iso_pu_bacteria | 2919134579 | 2919138751 | 329 |
| 372 | iso_pu_bacteria | 2928496128 | 2928499867 | 329 |
| 373 | iso_pu_bacteria | 2931380184 | 2931383362 | 329 |
| 374 | iso_pu_bacteria | 2937610967 | 2937614335 | 329 |
| 375 | iso_pu_bacteria | 2939589442 | 2939589839 | 329 |
| 376 | iso_pu_bacteria | 2939622612 | 2939624952 | 329 |
| 377 | iso_pu_bacteria | 2939626828 | 2939630925 | 329 |
| 378 | iso_pu_bacteria | 2961047084 | 2961049965 | 329 |
| 379 | iso_pu_bacteria | 2961064222 | 2961064872 | 329 |
| 380 | iso_pu_bacteria | 2974307012 | 2974307616 | 329 |
| 381 | iso_pu_bacteria | 2977247770 | 2977248327 | 329 |
| 382 | iso_pu_bacteria | 2984514374 | 2984517180 | 329 |
| 383 | 3300005335 | Ga0070666_10086043 | Ga0070666_100860432 | 330 |
| 384 | 3300005356 | Ga0070674_100082237 | Ga0070674_1000822372 | 330 |
| 385 | 3300005367 | Ga0070667_100155273 | Ga0070667_1001552731 | 330 |
| 386 | 3300005455 | Ga0070663_100319566 | Ga0070663_1003195661 | 330 |
| 387 | 3300005456 | Ga0070678_100108757 | Ga0070678_1001087571 | 330 |
| 388 | 3300005458 | Ga0070681_10013412 | Ga0070681_100134125 | 330 |
| 389 | 3300005459 | Ga0068867_100090251 | Ga0068867_1000902512 | 330 |
| 390 | 3300005466 | Ga0070685_10007386 | Ga0070685_100073862 | 330 |
| 391 | 3300005539 | Ga0068853_100033305 | Ga0068853_1000333054 | 330 |
| 392 | 3300005548 | Ga0070665_100159083 | Ga0070665_1001590832 | 330 |
| 393 | 3300005617 | Ga0068859_100308584 | Ga0068859_1003085841 | 330 |
| 394 | 3300005718 | Ga0068866_10129171 | Ga0068866_101291712 | 330 |
| 395 | 3300005841 | Ga0068863_100066084 | Ga0068863_1000660841 | 330 |
| 396 | 3300005983 | Ga0081540_1008082 | Ga0081540_10080825 | 330 |
| 397 | 3300006358 | Ga0068871_100190334 | Ga0068871_1001903342 | 330 |
| 398 | 3300006881 | Ga0068865_100053746 | Ga0068865_1000537463 | 330 |
| 399 | 3300006931 | Ga0097620_100308555 | Ga0097620_1003085552 | 330 |
| 400 | 3300009093 | Ga0105240_10001002 | Ga0105240_1000100238 | 330 |
| 401 | 3300009545 | Ga0105237_10035094 | Ga0105237_100350944 | 330 |
| 402 | 3300009551 | Ga0105238_10030434 | Ga0105238_100304342 | 330 |
| 403 | 3300013306 | Ga0163162_10028377 | Ga0163162_100283772 | 330 |
| 404 | 3300014968 | Ga0157379_10220782 | Ga0157379_102207822 | 330 |
| 405 | 3300014969 | Ga0157376_10005280 | Ga0157376_100052808 | 330 |
| 406 | 3300025261 | Ga0209233_1000715 | Ga0209233_100071516 | 330 |
| 407 | 3300025913 | Ga0207695_10000040 | Ga0207695_10000040192 | 330 |
| 408 | 3300025914 | Ga0207671_10043030 | Ga0207671_100430302 | 330 |
| 409 | 3300025919 | Ga0207657_10366742 | Ga0207657_103667421 | 330 |
| 410 | 3300025924 | Ga0207694_10003883 | Ga0207694_100038834 | 330 |
| 411 | 3300025925 | Ga0207650_10104287 | Ga0207650_101042873 | 330 |
| 412 | 3300025942 | Ga0207689_10034224 | Ga0207689_100342243 | 330 |
| 413 | 3300025942 | Ga0207689_10093372 | Ga0207689_100933722 | 330 |
| 414 | 3300026023 | Ga0207677_10095502 | Ga0207677_100955022 | 330 |
| 415 | 3300026067 | Ga0207678_10175178 | Ga0207678_101751782 | 330 |
| 416 | 3300026089 | Ga0207648_10038304 | Ga0207648_100383042 | 330 |
| 417 | 3300031903 | Ga0307407_10141410 | Ga0307407_101414102 | 330 |
| 418 | 3300049571 | Ga0501034_0065145 | Ga0501034_0065145_1547_2542 | 330 |
| 419 | 3300049572 | Ga0501036_0031163 | Ga0501036_0031163_1646_2641 | 330 |
| 420 | 3300049573 | Ga0501037_0010898 | Ga0501037_0010898_5627_6622 | 330 |
| 421 | 3300049581 | Ga0501047_0029824 | Ga0501047_0029824_864_1916 | 330 |
| 422 | 3300049589 | Ga0501073_0021629 | Ga0501073_0021629_256_1308 | 330 |
| 423 | 3300049742 | Ga0501080_0303139 | Ga0501080_0303139_17_1012 | 330 |
| 424 | 3300049744 | Ga0501083_0156733 | Ga0501083_0156733_139_1191 | 330 |
| 425 | 3300053139 | Ga0500568_0000233 | Ga0500568_0000233_25340_26377 | 330 |
| 426 | 3300054114 | Ga0501084_0138315 | Ga0501084_0138315_684_1736 | 330 |
| 427 | 3300060353 | Ga0501082_0000107 | Ga0501082_0000107_11358_12410 | 330 |
| 428 | iso_pu_bacteria | 2571042365 | 2572254306 | 330 |
| 429 | iso_pu_bacteria | 2643221559 | 2643818264 | 330 |
| 430 | iso_pu_bacteria | 2643221586 | 2643937933 | 330 |
| 431 | iso_pu_bacteria | 2643221612 | 2644078842 | 330 |
| 432 | iso_pu_bacteria | 2643221727 | 2644693619 | 330 |
| 433 | iso_pu_bacteria | 2747842501 | 2748018807 | 330 |
| 434 | iso_pu_bacteria | 2818991457 | 2819661327 | 330 |
| 435 | iso_pu_bacteria | 2842780639 | 2842782584 | 330 |
| 436 | iso_pu_bacteria | 2852649853 | 2852652120 | 330 |
| 437 | iso_pu_bacteria | 2852684882 | 2852687198 | 330 |
| 438 | iso_pu_bacteria | 2895498888 | 2895499871 | 330 |
| 439 | iso_pu_bacteria | 2895511927 | 2895512847 | 330 |
| 440 | iso_pu_bacteria | 2895522137 | 2895522856 | 330 |
| 441 | iso_pu_bacteria | 2895525241 | 2895525372 | 330 |
| 442 | iso_pu_bacteria | 2919130084 | 2919131045 | 330 |
| 443 | iso_pu_bacteria | 2929195423 | 2929196284 | 330 |
| 444 | iso_pu_bacteria | 2941475908 | 2941478743 | 330 |
| 445 | iso_pu_bacteria | 2941489479 | 2941494605 | 330 |
| 446 | iso_pu_bacteria | 2987605356 | 2987608826 | 330 |
| 447 | iso_pu_bacteria | 2995948881 | 2995949630 | 330 |
| 448 | iso_pu_bacteria | 8002869464 | 8002870948 | 330 |
| 449 | iso_pu_bacteria | 8021622325 | 8021625553 | 330 |
| 450 | iso_pu_bacteria | 8021648035 | 8021649750 | 330 |
| 451 | 3300005334 | Ga0068869_100079398 | Ga0068869_1000793982 | 331 |
| 452 | 3300005367 | Ga0070667_100000049 | Ga0070667_10000004936 | 331 |
| 453 | 3300005455 | Ga0070663_100000042 | Ga0070663_1000000427 | 331 |
| 454 | 3300005459 | Ga0068867_100032307 | Ga0068867_1000323072 | 331 |
| 455 | 3300005539 | Ga0068853_100011114 | Ga0068853_1000111143 | 331 |
| 456 | 3300005543 | Ga0070672_100003657 | Ga0070672_1000036577 | 331 |
| 457 | 3300005548 | Ga0070665_100008261 | Ga0070665_1000082617 | 331 |
| 458 | 3300005617 | Ga0068859_100343091 | Ga0068859_1003430912 | 331 |
| 459 | 3300006931 | Ga0097620_100343093 | Ga0097620_1003430932 | 331 |
| 460 | 3300009093 | Ga0105240_10424643 | Ga0105240_104246432 | 331 |
| 461 | 3300009177 | Ga0105248_10000120 | Ga0105248_1000012041 | 331 |
| 462 | 3300009545 | Ga0105237_10010356 | Ga0105237_100103565 | 331 |
| 463 | 3300009553 | Ga0105249_10000898 | Ga0105249_1000089817 | 331 |
| 464 | 3300025914 | Ga0207671_10007551 | Ga0207671_100075514 | 331 |
| 465 | 3300025940 | Ga0207691_10009099 | Ga0207691_100090993 | 331 |
| 466 | 3300025941 | Ga0207711_10010606 | Ga0207711_100106062 | 331 |
| 467 | 3300025942 | Ga0207689_10130781 | Ga0207689_101307812 | 331 |
| 468 | 3300025960 | Ga0207651_10097067 | Ga0207651_100970672 | 331 |
| 469 | 3300025961 | Ga0207712_10000305 | Ga0207712_100003059 | 331 |
| 470 | 3300025972 | Ga0207668_10056198 | Ga0207668_100561984 | 331 |
| 471 | 3300025986 | Ga0207658_10000033 | Ga0207658_10000033114 | 331 |
| 472 | 3300026041 | Ga0207639_10019356 | Ga0207639_100193562 | 331 |
| 473 | 3300026088 | Ga0207641_10165970 | Ga0207641_101659702 | 331 |
| 474 | 3300026142 | Ga0207698_10223440 | Ga0207698_102234402 | 331 |
| 475 | 3300031730 | Ga0307516_10101976 | Ga0307516_101019762 | 331 |
| 476 | 3300041491 | Ga0451833_0665795 | Ga0451833_0665795_273_1274 | 331 |
| 477 | 3300041494 | Ga0451837_0845588 | Ga0451837_0845588_216_1223 | 331 |
| 478 | 3300041512 | Ga0451853_3774819 | Ga0451853_3774819_43_1044 | 331 |
| 479 | 3300042876 | Ga0451577_0016708 | Ga0451577_0016708_3012_4028 | 331 |
| 480 | 3300047472 | Ga0495686_0004214 | Ga0495686_0004214_4823_5824 | 331 |
| 481 | 3300048925 | Ga0496122_0001517 | Ga0496122_0001517_29199_30200 | 331 |
| 482 | 3300048926 | Ga0496123_0000323 | Ga0496123_0000323_11106_12107 | 331 |
| 483 | 3300048929 | Ga0496126_0150106 | Ga0496126_0150106_644_1645 | 331 |
| 484 | 3300053079 | Ga0500610_0000365 | Ga0500610_0000365_9883_10884 | 331 |
| 485 | 3300053120 | Ga0500597_000088 | Ga0500597_000088_97_1098 | 331 |
| 486 | iso_pu_bacteria | 2643221573 | 2643880456 | 331 |
| 487 | iso_pu_bacteria | 2643221720 | 2644661031 | 331 |
| 488 | iso_pu_bacteria | 2643221728 | 2644699113 | 331 |
| 489 | iso_pu_bacteria | 8003014200 | 8003015464 | 331 |
| 490 | 3300005288 | Ga0065714_10017440 | Ga0065714_100174402 | 332 |
| 491 | 3300005293 | Ga0065715_10001991 | Ga0065715_100019915 | 332 |
| 492 | 3300005293 | Ga0065715_10008446 | Ga0065715_100084465 | 332 |
| 493 | 3300005347 | Ga0070668_100004046 | Ga0070668_1000040462 | 332 |
| 494 | 3300005353 | Ga0070669_100039609 | Ga0070669_1000396092 | 332 |
| 495 | 3300025923 | Ga0207681_10046931 | Ga0207681_100469312 | 332 |
| 496 | 3300025972 | Ga0207668_10019101 | Ga0207668_100191012 | 332 |
| 497 | 3300031616 | Ga0307508_10027818 | Ga0307508_100278184 | 332 |
| 498 | 3300031733 | Ga0316577_10056979 | Ga0316577_100569792 | 332 |
| 499 | 3300031824 | Ga0307413_10226927 | Ga0307413_102269272 | 332 |
| 500 | 3300032004 | Ga0307414_10002330 | Ga0307414_100023304 | 332 |
| 501 | 3300032004 | Ga0307414_10321320 | Ga0307414_103213201 | 332 |
| 502 | 3300033179 | Ga0307507_10191851 | Ga0307507_101918511 | 332 |
| 503 | 3300036712 | Ga0316584_0004592 | Ga0316584_0004592_1257_2306 | 332 |
| 504 | 3300041404 | Ga0439436_0032731 | Ga0439436_0032731_289_1350 | 332 |
| 505 | 3300048920 | Ga0496117_0018836 | Ga0496117_0018836_436_1449 | 332 |
| 506 | 3300048921 | Ga0496118_0001867 | Ga0496118_0001867_14788_15801 | 332 |
| 507 | 3300049571 | Ga0501034_0000404 | Ga0501034_0000404_55083_56087 | 332 |
| 508 | 3300049763 | Ga0501266_001423 | Ga0501266_001423_388_1392 | 332 |
| 509 | 3300055283 | Ga0500661_008171 | Ga0500661_008171_395_1399 | 332 |
| 510 | iso_pu_bacteria | 2524614729 | 2525556568 | 332 |
| 511 | iso_pu_bacteria | 2627854209 | 2630649797 | 332 |
| 512 | 3300003771 | Ga0055526_1006479 | Ga0055526_10064796 | 333 |
| 513 | 3300003773 | Ga0055537_1001365 | Ga0055537_100136510 | 333 |
| 514 | 3300003781 | Ga0055536_1000773 | Ga0055536_10007736 | 333 |
| 515 | 3300003784 | Ga0055534_1000112 | Ga0055534_10001121 | 333 |
| 516 | 3300003790 | Ga0055528_1001337 | Ga0055528_10013372 | 333 |
| 517 | 3300003791 | Ga0055530_10001674 | Ga0055530_1000167412 | 333 |
| 518 | 3300003791 | Ga0055530_10002094 | Ga0055530_1000209414 | 333 |
| 519 | 3300003794 | Ga0055531_10013881 | Ga0055531_100138815 | 333 |
| 520 | 3300003856 | Ga0058692_1000053 | Ga0058692_100005373 | 333 |
| 521 | 3300005334 | Ga0068869_100355130 | Ga0068869_1003551301 | 333 |
| 522 | 3300005337 | Ga0070682_100053517 | Ga0070682_1000535172 | 333 |
| 523 | 3300005353 | Ga0070669_100180249 | Ga0070669_1001802492 | 333 |
| 524 | 3300005367 | Ga0070667_100050689 | Ga0070667_1000506893 | 333 |
| 525 | 3300005440 | Ga0070705_100173054 | Ga0070705_1001730541 | 333 |
| 526 | 3300005455 | Ga0070663_100105609 | Ga0070663_1001056092 | 333 |
| 527 | 3300005539 | Ga0068853_100294941 | Ga0068853_1002949412 | 333 |
| 528 | 3300005547 | Ga0070693_100005405 | Ga0070693_1000054054 | 333 |
| 529 | 3300005548 | Ga0070665_100050597 | Ga0070665_1000505973 | 333 |
| 530 | 3300005548 | Ga0070665_100067472 | Ga0070665_1000674722 | 333 |
| 531 | 3300005563 | Ga0068855_100005951 | Ga0068855_1000059512 | 333 |
| 532 | 3300005841 | Ga0068863_100018882 | Ga0068863_1000188825 | 333 |
| 533 | 3300005985 | Ga0081539_10008186 | Ga0081539_100081869 | 333 |
| 534 | 3300006038 | Ga0075365_10216007 | Ga0075365_102160071 | 333 |
| 535 | 3300006178 | Ga0075367_10028635 | Ga0075367_100286351 | 333 |
| 536 | 3300006186 | Ga0075369_10020023 | Ga0075369_100200232 | 333 |
| 537 | 3300009011 | Ga0105251_10002055 | Ga0105251_100020558 | 333 |
| 538 | 3300009036 | Ga0105244_10106462 | Ga0105244_101064622 | 333 |
| 539 | 3300009148 | Ga0105243_10013395 | Ga0105243_100133956 | 333 |
| 540 | 3300009545 | Ga0105237_10053179 | Ga0105237_100531793 | 333 |
| 541 | 3300009553 | Ga0105249_10173073 | Ga0105249_101730732 | 333 |
| 542 | 3300010375 | Ga0105239_10005391 | Ga0105239_100053912 | 333 |
| 543 | 3300013104 | Ga0157370_10000918 | Ga0157370_100009184 | 333 |
| 544 | 3300013306 | Ga0163162_10151246 | Ga0163162_101512462 | 333 |
| 545 | 3300014497 | Ga0182008_10000076 | Ga0182008_1000007660 | 333 |
| 546 | 3300017792 | Ga0163161_10002679 | Ga0163161_100026794 | 333 |
| 547 | 3300025263 | Ga0209565_1000060 | Ga0209565_1000060119 | 333 |
| 548 | 3300025273 | Ga0209673_1000047 | Ga0209673_100004743 | 333 |
| 549 | 3300025291 | Ga0209675_1000007 | Ga0209675_1000007561 | 333 |
| 550 | 3300025292 | Ga0209676_1000018 | Ga0209676_100001829 | 333 |
| 551 | 3300025292 | Ga0209676_1000411 | Ga0209676_100041145 | 333 |
| 552 | 3300025292 | Ga0209676_1001983 | Ga0209676_100198314 | 333 |
| 553 | 3300025295 | Ga0209564_1000252 | Ga0209564_100025220 | 333 |
| 554 | 3300025298 | Ga0209050_1000146 | Ga0209050_100014616 | 333 |
| 555 | 3300025298 | Ga0209050_1000592 | Ga0209050_100059229 | 333 |
| 556 | 3300025299 | Ga0209256_1005932 | Ga0209256_10059323 | 333 |
| 557 | 3300025299 | Ga0209256_1013442 | Ga0209256_10134422 | 333 |
| 558 | 3300025303 | Ga0209051_1003638 | Ga0209051_10036381 | 333 |
| 559 | 3300025304 | Ga0209257_1000035 | Ga0209257_100003529 | 333 |
| 560 | 3300025304 | Ga0209257_1000078 | Ga0209257_100007897 | 333 |
| 561 | 3300025304 | Ga0209257_1001448 | Ga0209257_10014489 | 333 |
| 562 | 3300025304 | Ga0209257_1010878 | Ga0209257_10108781 | 333 |
| 563 | 3300025735 | Ga0207713_1002516 | Ga0207713_10025166 | 333 |
| 564 | 3300025914 | Ga0207671_10071007 | Ga0207671_100710072 | 333 |
| 565 | 3300025923 | Ga0207681_10273924 | Ga0207681_102739241 | 333 |
| 566 | 3300025935 | Ga0207709_10000527 | Ga0207709_1000052715 | 333 |
| 567 | 3300025942 | Ga0207689_10217979 | Ga0207689_102179792 | 333 |
| 568 | 3300025949 | Ga0207667_10049542 | Ga0207667_100495422 | 333 |
| 569 | 3300025961 | Ga0207712_10024220 | Ga0207712_100242202 | 333 |
| 570 | 3300026041 | Ga0207639_10000437 | Ga0207639_1000043727 | 333 |
| 571 | 3300026067 | Ga0207678_10171560 | Ga0207678_101715602 | 333 |
| 572 | 3300026116 | Ga0207674_10135861 | Ga0207674_101358612 | 333 |
| 573 | 3300027312 | Ga0209371_1000018 | Ga0209371_1000018535 | 333 |
| 574 | 3300028379 | Ga0268266_10042299 | Ga0268266_100422993 | 333 |
| 575 | 3300030500 | Ga0268256_1000016 | Ga0268256_1000016535 | 333 |
| 576 | 3300030744 | Ga0316181_1160836 | Ga0316181_11608361 | 333 |
| 577 | 3300030745 | Ga0316182_1299775 | Ga0316182_12997755 | 333 |
| 578 | 3300031548 | Ga0307408_100193051 | Ga0307408_1001930513 | 333 |
| 579 | 3300031911 | Ga0307412_10103765 | Ga0307412_101037652 | 333 |
| 580 | 3300031911 | Ga0307412_10164312 | Ga0307412_101643122 | 333 |
| 581 | 3300032004 | Ga0307414_10102681 | Ga0307414_101026812 | 333 |
| 582 | 3300032005 | Ga0307411_10327448 | Ga0307411_103274481 | 333 |
| 583 | 3300032005 | Ga0307411_10390328 | Ga0307411_103903281 | 333 |
| 584 | 3300038705 | Ga0237819_04072 | Ga0237819_04072_1163_2173 | 333 |
| 585 | 3300044712 | Ga0453684_0000531 | Ga0453684_0000531_58002_59015 | 333 |
| 586 | 3300045051 | Ga0451576_0000212 | Ga0451576_0000212_58008_59021 | 333 |
| 587 | 3300046460 | Ga0495638_0000526 | Ga0495638_0000526_3560_4570 | 333 |
| 588 | 3300046518 | Ga0495631_0003548 | Ga0495631_0003548_7233_8243 | 333 |
| 589 | 3300046522 | Ga0495643_0010311 | Ga0495643_0010311_2725_3735 | 333 |
| 590 | 3300046525 | Ga0495663_0003392 | Ga0495663_0003392_3176_4204 | 333 |
| 591 | 3300046525 | Ga0495663_0007926 | Ga0495663_0007926_28_1038 | 333 |
| 592 | 3300046558 | Ga0495633_0053967 | Ga0495633_0053967_303_1313 | 333 |
| 593 | 3300046660 | Ga0495625_0107781 | Ga0495625_0107781_796_1806 | 333 |
| 594 | 3300047320 | Ga0495672_0000087 | Ga0495672_0000087_11453_12463 | 333 |
| 595 | 3300047472 | Ga0495686_0038417 | Ga0495686_0038417_126_1136 | 333 |
| 596 | 3300048090 | Ga0495615_0003458 | Ga0495615_0003458_792_1796 | 333 |
| 597 | 3300048920 | Ga0496117_0001430 | Ga0496117_0001430_23328_24338 | 333 |
| 598 | 3300048920 | Ga0496117_0007883 | Ga0496117_0007883_1737_2747 | 333 |
| 599 | 3300048921 | Ga0496118_0001349 | Ga0496118_0001349_23329_24339 | 333 |
| 600 | 3300048921 | Ga0496118_0003009 | Ga0496118_0003009_13757_14767 | 333 |
| 601 | 3300048921 | Ga0496118_0035939 | Ga0496118_0035939_17_1027 | 333 |
| 602 | 3300048924 | Ga0496121_0009703 | Ga0496121_0009703_2481_3491 | 333 |
| 603 | 3300048925 | Ga0496122_0008629 | Ga0496122_0008629_9647_10657 | 333 |
| 604 | 3300048927 | Ga0496124_0000006 | Ga0496124_0000006_364773_365783 | 333 |
| 605 | 3300048927 | Ga0496124_0001552 | Ga0496124_0001552_11492_12502 | 333 |
| 606 | 3300048927 | Ga0496124_0019869 | Ga0496124_0019869_1344_2354 | 333 |
| 607 | 3300048927 | Ga0496124_0030860 | Ga0496124_0030860_471_1481 | 333 |
| 608 | 3300048927 | Ga0496124_0038566 | Ga0496124_0038566_2823_3833 | 333 |
| 609 | 3300048927 | Ga0496124_0127669 | Ga0496124_0127669_967_1977 | 333 |
| 610 | 3300048928 | Ga0496125_0014536 | Ga0496125_0014536_3052_4062 | 333 |
| 611 | 3300048928 | Ga0496125_0077822 | Ga0496125_0077822_27_1037 | 333 |
| 612 | 3300048929 | Ga0496126_0269868 | Ga0496126_0269868_87_1097 | 333 |
| 613 | 3300053093 | Ga0500651_0006630 | Ga0500651_0006630_2934_3941 | 333 |
| 614 | 3300003771 | Ga0055526_1000014 | Ga0055526_100001418 | 334 |
| 615 | 3300003773 | Ga0055537_1000059 | Ga0055537_100005913 | 334 |
| 616 | 3300003775 | Ga0055524_1000019 | Ga0055524_1000019198 | 334 |
| 617 | 3300003784 | Ga0055534_1000012 | Ga0055534_100001218 | 334 |
| 618 | 3300003790 | Ga0055528_1000007 | Ga0055528_100000718 | 334 |
| 619 | 3300003794 | Ga0055531_10018425 | Ga0055531_100184252 | 334 |
| 620 | 3300003856 | Ga0058692_1000065 | Ga0058692_100006527 | 334 |
| 621 | 3300005289 | Ga0065704_10072499 | Ga0065704_100724998 | 334 |
| 622 | 3300005331 | Ga0070670_100001962 | Ga0070670_1000019628 | 334 |
| 623 | 3300005338 | Ga0068868_100006535 | Ga0068868_1000065356 | 334 |
| 624 | 3300005355 | Ga0070671_100069039 | Ga0070671_1000690395 | 334 |
| 625 | 3300005355 | Ga0070671_100082960 | Ga0070671_1000829602 | 334 |
| 626 | 3300005367 | Ga0070667_100022905 | Ga0070667_1000229053 | 334 |
| 627 | 3300005367 | Ga0070667_100023232 | Ga0070667_1000232324 | 334 |
| 628 | 3300005367 | Ga0070667_100081048 | Ga0070667_1000810482 | 334 |
| 629 | 3300005455 | Ga0070663_100006318 | Ga0070663_1000063182 | 334 |
| 630 | 3300005457 | Ga0070662_100001452 | Ga0070662_1000014524 | 334 |
| 631 | 3300005543 | Ga0070672_100004334 | Ga0070672_1000043348 | 334 |
| 632 | 3300005548 | Ga0070665_100000394 | Ga0070665_10000039444 | 334 |
| 633 | 3300005563 | Ga0068855_100497865 | Ga0068855_1004978652 | 334 |
| 634 | 3300005616 | Ga0068852_100029267 | Ga0068852_1000292672 | 334 |
| 635 | 3300005719 | Ga0068861_100061050 | Ga0068861_1000610502 | 334 |
| 636 | 3300005834 | Ga0068851_10000308 | Ga0068851_100003085 | 334 |
| 637 | 3300005842 | Ga0068858_100008594 | Ga0068858_1000085942 | 334 |
| 638 | 3300006051 | Ga0075364_10002739 | Ga0075364_100027397 | 334 |
| 639 | 3300006237 | Ga0097621_100164034 | Ga0097621_1001640341 | 334 |
| 640 | 3300006881 | Ga0068865_100027085 | Ga0068865_1000270852 | 334 |
| 641 | 3300009011 | Ga0105251_10000205 | Ga0105251_100002058 | 334 |
| 642 | 3300009036 | Ga0105244_10021621 | Ga0105244_100216212 | 334 |
| 643 | 3300009093 | Ga0105240_10489488 | Ga0105240_104894881 | 334 |
| 644 | 3300009098 | Ga0105245_10083715 | Ga0105245_100837152 | 334 |
| 645 | 3300009148 | Ga0105243_10002435 | Ga0105243_1000243511 | 334 |
| 646 | 3300009545 | Ga0105237_10388462 | Ga0105237_103884622 | 334 |
| 647 | 3300009551 | Ga0105238_10011923 | Ga0105238_100119234 | 334 |
| 648 | 3300009553 | Ga0105249_10001097 | Ga0105249_100010978 | 334 |
| 649 | 3300010375 | Ga0105239_10331311 | Ga0105239_103313112 | 334 |
| 650 | 3300013102 | Ga0157371_10000397 | Ga0157371_1000039730 | 334 |
| 651 | 3300013105 | Ga0157369_10263395 | Ga0157369_102633952 | 334 |
| 652 | 3300013297 | Ga0157378_10254634 | Ga0157378_102546342 | 334 |
| 653 | 3300013308 | Ga0157375_10004149 | Ga0157375_1000414914 | 334 |
| 654 | 3300015262 | Ga0182007_10000079 | Ga0182007_1000007913 | 334 |
| 655 | 3300015265 | Ga0182005_1000166 | Ga0182005_10001665 | 334 |
| 656 | 3300015265 | Ga0182005_1002582 | Ga0182005_10025822 | 334 |
| 657 | 3300015689 | Ga0183360_10002 | Ga0183360_10002770 | 334 |
| 658 | 3300020075 | Ga0206349_1121353 | Ga0206349_11213533 | 334 |
| 659 | 3300025263 | Ga0209565_1000001 | Ga0209565_1000001439 | 334 |
| 660 | 3300025263 | Ga0209565_1004771 | Ga0209565_10047714 | 334 |
| 661 | 3300025273 | Ga0209673_1000001 | Ga0209673_1000001439 | 334 |
| 662 | 3300025291 | Ga0209675_1000001 | Ga0209675_10000012093 | 334 |
| 663 | 3300025295 | Ga0209564_1000001 | Ga0209564_10000012255 | 334 |
| 664 | 3300025299 | Ga0209256_1000006 | Ga0209256_1000006691 | 334 |
| 665 | 3300025304 | Ga0209257_1000642 | Ga0209257_10006427 | 334 |
| 666 | 3300025321 | Ga0207656_10000283 | Ga0207656_100002837 | 334 |
| 667 | 3300025735 | Ga0207713_1000196 | Ga0207713_100019627 | 334 |
| 668 | 3300025903 | Ga0207680_10011565 | Ga0207680_100115652 | 334 |
| 669 | 3300025904 | Ga0207647_10001796 | Ga0207647_100017965 | 334 |
| 670 | 3300025911 | Ga0207654_10031499 | Ga0207654_100314992 | 334 |
| 671 | 3300025913 | Ga0207695_10015003 | Ga0207695_100150032 | 334 |
| 672 | 3300025913 | Ga0207695_10042105 | Ga0207695_100421053 | 334 |
| 673 | 3300025914 | Ga0207671_10009290 | Ga0207671_100092904 | 334 |
| 674 | 3300025924 | Ga0207694_10001852 | Ga0207694_1000185213 | 334 |
| 675 | 3300025925 | Ga0207650_10001926 | Ga0207650_100019267 | 334 |
| 676 | 3300025931 | Ga0207644_10017204 | Ga0207644_100172042 | 334 |
| 677 | 3300025933 | Ga0207706_10000876 | Ga0207706_100008765 | 334 |
| 678 | 3300025935 | Ga0207709_10002230 | Ga0207709_100022304 | 334 |
| 679 | 3300025937 | Ga0207669_10014325 | Ga0207669_100143252 | 334 |
| 680 | 3300025938 | Ga0207704_10082336 | Ga0207704_100823362 | 334 |
| 681 | 3300025940 | Ga0207691_10007375 | Ga0207691_100073755 | 334 |
| 682 | 3300025942 | Ga0207689_10017785 | Ga0207689_100177856 | 334 |
| 683 | 3300025944 | Ga0207661_10071965 | Ga0207661_100719655 | 334 |
| 684 | 3300025949 | Ga0207667_10287852 | Ga0207667_102878522 | 334 |
| 685 | 3300025961 | Ga0207712_10000120 | Ga0207712_1000012044 | 334 |
| 686 | 3300025986 | Ga0207658_10004845 | Ga0207658_100048454 | 334 |
| 687 | 3300025986 | Ga0207658_10124864 | Ga0207658_101248642 | 334 |
| 688 | 3300025986 | Ga0207658_10262455 | Ga0207658_102624552 | 334 |
| 689 | 3300026035 | Ga0207703_10028041 | Ga0207703_100280412 | 334 |
| 690 | 3300026041 | Ga0207639_10000236 | Ga0207639_1000023632 | 334 |
| 691 | 3300026041 | Ga0207639_10057841 | Ga0207639_100578412 | 334 |
| 692 | 3300026067 | Ga0207678_10012827 | Ga0207678_100128272 | 334 |
| 693 | 3300026078 | Ga0207702_10027877 | Ga0207702_100278773 | 334 |
| 694 | 3300026118 | Ga0207675_100070634 | Ga0207675_1000706342 | 334 |
| 695 | 3300026142 | Ga0207698_10142520 | Ga0207698_101425202 | 334 |
| 696 | 3300027312 | Ga0209371_1000025 | Ga0209371_100002542 | 334 |
| 697 | 3300028379 | Ga0268266_10000007 | Ga0268266_10000007171 | 334 |
| 698 | 3300030500 | Ga0268256_1000027 | Ga0268256_100002742 | 334 |
| 699 | 3300032004 | Ga0307414_10128603 | Ga0307414_101286032 | 334 |
| 700 | 3300037418 | Ga0395900_0078437 | Ga0395900_0078437_1484_2497 | 334 |
| 701 | 3300037418 | Ga0395900_0391702 | Ga0395900_0391702_81_1094 | 334 |
| 702 | 3300037471 | Ga0395905_0002925 | Ga0395905_0002925_862_1875 | 334 |
| 703 | 3300038443 | Ga0395901_0006253 | Ga0395901_0006253_10033_11046 | 334 |
| 704 | 3300038705 | Ga0237819_00598 | Ga0237819_00598_6256_7269 | 334 |
| 705 | 3300041413 | Ga0439465_0002680 | Ga0439465_0002680_1934_2944 | 334 |
| 706 | 3300041452 | Ga0451793_0608164 | Ga0451793_0608164_1695_2705 | 334 |
| 707 | 3300041462 | Ga0451806_117351 | Ga0451806_117351_3847_4857 | 334 |
| 708 | 3300041498 | Ga0451841_0688799 | Ga0451841_0688799_385_1422 | 334 |
| 709 | 3300041509 | Ga0451843_0273968 | Ga0451843_0273968_270_1298 | 334 |
| 710 | 3300042007 | Ga0439449_0000582 | Ga0439449_0000582_6655_7665 | 334 |
| 711 | 3300042015 | Ga0439462_0022440 | Ga0439462_0022440_429_1442 | 334 |
| 712 | 3300046460 | Ga0495638_0052794 | Ga0495638_0052794_1392_2402 | 334 |
| 713 | 3300046501 | Ga0495607_0079949 | Ga0495607_0079949_325_1335 | 334 |
| 714 | 3300046507 | Ga0495606_0005893 | Ga0495606_0005893_8375_9385 | 334 |
| 715 | 3300046537 | Ga0495598_0004631 | Ga0495598_0004631_1619_2635 | 334 |
| 716 | 3300046539 | Ga0495621_0020577 | Ga0495621_0020577_701_1717 | 334 |
| 717 | 3300046664 | Ga0495659_0017398 | Ga0495659_0017398_369_1376 | 334 |
| 718 | 3300047318 | Ga0495636_0004749 | Ga0495636_0004749_3661_4668 | 334 |
| 719 | 3300048904 | Ga0496101_0109743 | Ga0496101_0109743_562_1575 | 334 |
| 720 | 3300048908 | Ga0496105_0029746 | Ga0496105_0029746_274_1287 | 334 |
| 721 | 3300048915 | Ga0496112_0324194 | Ga0496112_0324194_308_1318 | 334 |
| 722 | 3300048919 | Ga0496116_0078873 | Ga0496116_0078873_829_1842 | 334 |
| 723 | 3300048920 | Ga0496117_0009829 | Ga0496117_0009829_6452_7462 | 334 |
| 724 | 3300048920 | Ga0496117_0091047 | Ga0496117_0091047_676_1689 | 334 |
| 725 | 3300048921 | Ga0496118_0030781 | Ga0496118_0030781_2955_3968 | 334 |
| 726 | 3300048921 | Ga0496118_0120660 | Ga0496118_0120660_634_1644 | 334 |
| 727 | 3300048922 | Ga0496119_0000711 | Ga0496119_0000711_30595_31608 | 334 |
| 728 | 3300048922 | Ga0496119_0001836 | Ga0496119_0001836_22107_23117 | 334 |
| 729 | 3300048923 | Ga0496120_0000273 | Ga0496120_0000273_62579_63589 | 334 |
| 730 | 3300048923 | Ga0496120_0000727 | Ga0496120_0000727_34003_35016 | 334 |
| 731 | 3300048925 | Ga0496122_0000417 | Ga0496122_0000417_72598_73608 | 334 |
| 732 | 3300048925 | Ga0496122_0009264 | Ga0496122_0009264_3987_5015 | 334 |
| 733 | 3300048926 | Ga0496123_0000137 | Ga0496123_0000137_127989_128999 | 334 |
| 734 | 3300048927 | Ga0496124_0003391 | Ga0496124_0003391_16838_17848 | 334 |
| 735 | 3300048927 | Ga0496124_0003834 | Ga0496124_0003834_107_1120 | 334 |
| 736 | 3300048928 | Ga0496125_0030941 | Ga0496125_0030941_900_1913 | 334 |
| 737 | 3300048928 | Ga0496125_0110368 | Ga0496125_0110368_214_1227 | 334 |
| 738 | 3300048929 | Ga0496126_0003861 | Ga0496126_0003861_17410_18423 | 334 |
| 739 | 3300049705 | Ga0501225_0007795 | Ga0501225_0007795_984_1994 | 334 |
| 740 | 3300050491 | nmdc:mga00v17_2252_c1 | nmdc:mga00v17_2252_c1_1796_2806 | 334 |
| 741 | 3300053161 | Ga0500634_0000377 | Ga0500634_0000377_3615_4628 | 334 |
| 742 | iso_pu_bacteria | 2643221579 | 2643905851 | 334 |
| 743 | iso_pu_bacteria | 2643221581 | 2643914735 | 334 |
| 744 | iso_pu_bacteria | 2923516293 | 2923517194 | 334 |
| 745 | 3300003187 | JGI25151J46595_10000102 | JGI25151J46595_100001026 | 335 |
| 746 | 3300003187 | JGI25151J46595_10003508 | JGI25151J46595_100035085 | 335 |
| 747 | 3300003771 | Ga0055526_1017503 | Ga0055526_10175032 | 335 |
| 748 | 3300003775 | Ga0055524_1036000 | Ga0055524_10360001 | 335 |
| 749 | 3300003775 | Ga0055524_1036005 | Ga0055524_10360051 | 335 |
| 750 | 3300003781 | Ga0055536_1016739 | Ga0055536_10167392 | 335 |
| 751 | 3300003781 | Ga0055536_1028308 | Ga0055536_10283082 | 335 |
| 752 | 3300003791 | Ga0055530_10008584 | Ga0055530_100085845 | 335 |
| 753 | 3300003794 | Ga0055531_10015740 | Ga0055531_100157402 | 335 |
| 754 | 3300003794 | Ga0055531_10035979 | Ga0055531_100359791 | 335 |
| 755 | 3300003794 | Ga0055531_10041479 | Ga0055531_100414791 | 335 |
| 756 | 3300014497 | Ga0182008_10126418 | Ga0182008_101264182 | 335 |
| 757 | 3300017792 | Ga0163161_10021626 | Ga0163161_100216265 | 335 |
| 758 | 3300025245 | Ga0207425_1017410 | Ga0207425_10174101 | 335 |
| 759 | 3300025273 | Ga0209673_1004700 | Ga0209673_10047007 | 335 |
| 760 | 3300025284 | Ga0209130_1002163 | Ga0209130_100216310 | 335 |
| 761 | 3300025292 | Ga0209676_1003671 | Ga0209676_10036712 | 335 |
| 762 | 3300025292 | Ga0209676_1010297 | Ga0209676_10102972 | 335 |
| 763 | 3300025294 | Ga0209025_1000006 | Ga0209025_1000006652 | 335 |
| 764 | 3300025294 | Ga0209025_1002898 | Ga0209025_10028985 | 335 |
| 765 | 3300025295 | Ga0209564_1008800 | Ga0209564_10088002 | 335 |
| 766 | 3300025297 | Ga0209758_1006577 | Ga0209758_10065773 | 335 |
| 767 | 3300025298 | Ga0209050_1003938 | Ga0209050_10039385 | 335 |
| 768 | 3300025299 | Ga0209256_1005338 | Ga0209256_10053382 | 335 |
| 769 | 3300025299 | Ga0209256_1010244 | Ga0209256_10102445 | 335 |
| 770 | 3300025299 | Ga0209256_1013376 | Ga0209256_10133764 | 335 |
| 771 | 3300025304 | Ga0209257_1000414 | Ga0209257_100041420 | 335 |
| 772 | 3300025304 | Ga0209257_1003369 | Ga0209257_100336911 | 335 |
| 773 | 3300025304 | Ga0209257_1006510 | Ga0209257_10065102 | 335 |
| 774 | 3300025304 | Ga0209257_1013090 | Ga0209257_10130904 | 335 |
| 775 | 3300030731 | Ga0316177_1045917 | Ga0316177_10459173 | 335 |
| 776 | 3300030733 | Ga0314311_1009359 | Ga0314311_10093592 | 335 |
| 777 | 3300031824 | Ga0307413_10021709 | Ga0307413_100217094 | 335 |
| 778 | 3300032002 | Ga0307416_100024526 | Ga0307416_1000245262 | 335 |
| 779 | 3300032004 | Ga0307414_10035418 | Ga0307414_100354182 | 335 |
| 780 | 3300032004 | Ga0307414_10146111 | Ga0307414_101461112 | 335 |
| 781 | 3300041404 | Ga0439436_0010843 | Ga0439436_0010843_1620_2633 | 335 |
| 782 | 3300041407 | Ga0439447_000276 | Ga0439447_000276_8679_9719 | 335 |
| 783 | 3300046525 | Ga0495663_0017245 | Ga0495663_0017245_588_1628 | 335 |
| 784 | 3300046664 | Ga0495659_0042025 | Ga0495659_0042025_294_1319 | 335 |
| 785 | 3300047318 | Ga0495636_0030269 | Ga0495636_0030269_245_1270 | 335 |
| 786 | 3300048920 | Ga0496117_0028737 | Ga0496117_0028737_1830_2846 | 335 |
| 787 | 3300048927 | Ga0496124_0034545 | Ga0496124_0034545_1358_2374 | 335 |
| 788 | 3300049579 | Ga0501043_0001302 | Ga0501043_0001302_9976_10989 | 335 |
| 789 | 3300013307 | Ga0157372_10051825 | Ga0157372_100518254 | 336 |
| 790 | 3300025294 | Ga0209025_1011601 | Ga0209025_10116012 | 336 |
| 791 | 3300032004 | Ga0307414_10043563 | Ga0307414_100435631 | 336 |
| 792 | 3300036401 | Ga0373937_0519868 | Ga0373937_0519868_14_1042 | 336 |
| 793 | 3300037471 | Ga0395905_0115628 | Ga0395905_0115628_1359_2378 | 336 |
| 794 | 3300042007 | Ga0439449_0005572 | Ga0439449_0005572_3006_4022 | 336 |
| 795 | 3300042014 | Ga0439457_014730 | Ga0439457_014730_237_1274 | 336 |
| 796 | 3300046615 | Ga0495656_0003859 | Ga0495656_0003859_2308_3327 | 336 |
| 797 | 3300047318 | Ga0495636_0006456 | Ga0495636_0006456_3139_4158 | 336 |
| 798 | 3300049569 | Ga0501032_0115088 | Ga0501032_0115088_672_1706 | 336 |
| 799 | 3300049579 | Ga0501043_0034199 | Ga0501043_0034199_2849_3883 | 336 |
| 800 | 3300049581 | Ga0501047_0400771 | Ga0501047_0400771_115_1149 | 336 |
| 801 | 3300049586 | Ga0501070_0053490 | Ga0501070_0053490_1657_2691 | 336 |
| 802 | 3300049822 | Ga0501035_0013478 | Ga0501035_0013478_1532_2566 | 336 |
| 803 | 3300049823 | Ga0501044_0051173 | Ga0501044_0051173_2984_4018 | 336 |
| 804 | 3300009093 | Ga0105240_10004247 | Ga0105240_100042478 | 337 |
| 805 | 3300009174 | Ga0105241_10122713 | Ga0105241_101227132 | 337 |
| 806 | 3300013105 | Ga0157369_10273993 | Ga0157369_102739931 | 337 |
| 807 | 3300025913 | Ga0207695_10048332 | Ga0207695_100483323 | 337 |
| 808 | 3300027665 | Ga0209983_1001045 | Ga0209983_10010453 | 337 |
| 809 | 3300027682 | Ga0209971_1006224 | Ga0209971_10062242 | 337 |
| 810 | 3300027876 | Ga0209974_10004142 | Ga0209974_100041426 | 337 |
| 811 | 2162886007 | SwRhRL2b_contig_1097717 | SwRhRL2b_0990.00006070 | 338 |
| 812 | 3300003781 | Ga0055536_1010813 | Ga0055536_10108132 | 338 |
| 813 | 3300005289 | Ga0065704_10070850 | Ga0065704_100708502 | 338 |
| 814 | 3300013102 | Ga0157371_10053932 | Ga0157371_100539322 | 338 |
| 815 | 3300025292 | Ga0209676_1000360 | Ga0209676_100036022 | 338 |
| 816 | 3300031901 | Ga0307406_10003433 | Ga0307406_100034333 | 338 |
| 817 | 3300032004 | Ga0307414_10000928 | Ga0307414_100009284 | 338 |
| 818 | 3300039145 | Ga0237816_00007 | Ga0237816_00007_5909_6940 | 338 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4u0o-assembly1.cif.gz_B | crystal structure of thermosynechococcus elongatus lipoyl synthase 2 complexed with mta and dtt | 0.9124 | 49 | 323 |
| 4u0p-assembly1.cif.gz_B | the crystal structure of lipoyl synthase in complex with s-adenosyl homocysteine | 0.9072 | 47 | 323 |
| 5exk-assembly6.cif.gz_K | crystal structure of m. tuberculosis lipoyl synthase with 6-thiooctanoyl peptide intermediate | 0.9038 | 44 | 329 |
| 4u0o-assembly1.cif.gz_B | crystal structure of thermosynechococcus elongatus lipoyl synthase 2 complexed with mta and dtt | 0.9028 | 49 | 323 |
| 4u0p-assembly1.cif.gz_B | the crystal structure of lipoyl synthase in complex with s-adenosyl homocysteine | 0.8828 | 47 | 323 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P60716_82_298_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9409 | 92 | 310 | 3.20.20.70 |
| af_P60716_82_298_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9367 | 92 | 310 | 3.20.20.70 |
| af_Q2FZX4_3_265_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.927 | 40 | 303 | 3.20.20.70 |
| af_Q2FZX4_3_265_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9202 | 40 | 303 | 3.20.20.70 |
| af_P0CH67_115_331_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9081 | 94 | 298 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-T1A2Y7-F1-model_v4 | Lipoyl synthase | 0.9831 | 162 | 296 |
GO:0016992
GO:0046872 GO:0051539 |
| AF-A0A8A7QWW1-F1-model_v4 | deleted | 0.9764 | 189 | 305 |
|
| AF-T1A2Y7-F1-model_v4 | Lipoyl synthase | 0.9759 | 162 | 296 |
GO:0016992
GO:0046872 GO:0051539 |
| AF-A0A367LWG9-F1-model_v4 | Lipoyl synthase (EC 2.8.1.8) | 0.9758 | 161 | 279 |
GO:0016992
GO:0046872 GO:0051539 |
| AF-A0A1B1TG46-F1-model_v4 | Radical SAM core domain-containing protein | 0.968 | 222 | 320 |
GO:0016992
GO:0046872 GO:0051539 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar