F482020
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 815 | 406 | 815 | 123 |
Family's Representative Sequence
| Representative Sequence | 3300039453|Ga0436362_0217235|Ga0436362_0217235_93_461 |
| Length | 122 |
| Sequence | MHLNHDPDAPPAPPIDFDKFLAVDVRVGTIVAAEPFAEARKPSLKLRIDFGPGVGVKQSSAQIAQYDVAALVGRQVAAVVNFPPRQIGRFMSEVLTLGFPDENGAVVLFSPDRKVPDGARLF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 3 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 4 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 5 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 6 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 7 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 8 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 9 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 11 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 12 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 13 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 15 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 66 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 67 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 68 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 69 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 70 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 71 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 72 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 74 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 75 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 79 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 80 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 85 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 86 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 87 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 88 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 92 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 117 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 118 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 119 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 120 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 121 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 122 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 131 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 182 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 186 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 187 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 188 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 189 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 190 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 191 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 192 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 193 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 194 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 195 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 196 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 197 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 198 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 199 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 200 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 201 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 202 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 203 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 204 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 205 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 206 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 207 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 208 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 209 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 210 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 211 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 212 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 213 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 214 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 215 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 216 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 217 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 218 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 219 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 220 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 221 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 222 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 223 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 224 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 225 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 226 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 227 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 228 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 229 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 230 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 231 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 232 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 233 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 234 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 235 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 236 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 237 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 238 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 239 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 240 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 241 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 242 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 243 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 244 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 245 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 246 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 247 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 248 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 249 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 250 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 251 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 252 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 253 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 254 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 255 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 256 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 257 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 258 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 259 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 260 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 261 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 262 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 263 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 264 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 265 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 266 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 267 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 268 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 269 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 316 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 317 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 318 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 319 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 320 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 321 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 322 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 324 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 325 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 326 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 327 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 328 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 329 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 330 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 331 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 332 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 333 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 334 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 335 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 336 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 337 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 353 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 361 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 362 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 367 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 372 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 373 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 374 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 375 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 376 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 377 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 378 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 379 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 380 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 381 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 382 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 383 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 384 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 385 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 386 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 387 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 388 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 389 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 390 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 391 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 392 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 393 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 394 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 395 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 396 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 397 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 398 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 399 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 400 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 401 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 402 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 403 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 404 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 405 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 406 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.9 |
| Metatranscriptomes | 1.1 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.48 |
| Nodule | 0.25 |
| Rhizoplane | 3.44 |
| Rhizosphere | 70.31 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.53 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2144200 | 2162886007 | Bacteria | 7630 |
| 2 | JGI25150J39212_1000368 | 3300002774 | Bacteria | 21777 |
| 3 | Ga0006759J45824_1076213 | 3300003163 | Bacteria | 741 |
| 4 | JGI25151J46595_10070633 | 3300003187 | Bacteria | 1059 |
| 5 | JGI25153J46596_10000512 | 3300003215 | Bacteria | 24447 |
| 6 | Ga0006777J48905_1008095 | 3300003308 | Bacteria | 774 |
| 7 | Ga0007416J51690_1070775 | 3300003577 | Bacteria | 865 |
| 8 | Ga0007429J51699_1004743 | 3300003579 | Bacteria | 1257 |
| 9 | Ga0007429J51699_1114894 | 3300003579 | Bacteria | 832 |
| 10 | Ga0055529_1018251 | 3300003763 | Bacteria | 878 |
| 11 | Ga0055537_1002263 | 3300003773 | Bacteria | 6621 |
| 12 | Ga0055537_1004290 | 3300003773 | Bacteria | 4107 |
| 13 | Ga0055536_1006517 | 3300003781 | Bacteria | 5427 |
| 14 | Ga0055536_1007944 | 3300003781 | Bacteria | 4651 |
| 15 | Ga0055530_10000013 | 3300003791 | Bacteria | 153390 |
| 16 | Ga0055530_10050136 | 3300003791 | Bacteria | 974 |
| 17 | Ga0055531_10000792 | 3300003794 | Bacteria | 26275 |
| 18 | Ga0055531_10006790 | 3300003794 | Bacteria | 6389 |
| 19 | Ga0055531_10010629 | 3300003794 | Bacteria | 4549 |
| 20 | Ga0065165_1004494 | 3300005262 | Bacteria | 8580 |
| 21 | Ga0065165_1072659 | 3300005262 | Bacteria | 910 |
| 22 | Ga0065704_10070230 | 3300005289 | Bacteria | 55750 |
| 23 | Ga0065712_10452270 | 3300005290 | Bacteria | 685 |
| 24 | Ga0065712_10679218 | 3300005290 | Bacteria | 555 |
| 25 | Ga0070676_10046758 | 3300005328 | Bacteria | 2525 |
| 26 | Ga0070690_100061564 | 3300005330 | Bacteria | 2418 |
| 27 | Ga0068869_101432346 | 3300005334 | Bacteria | 612 |
| 28 | Ga0070666_10067868 | 3300005335 | Bacteria | 2422 |
| 29 | Ga0070666_10472965 | 3300005335 | Bacteria | 907 |
| 30 | Ga0070680_100175739 | 3300005336 | Bacteria | 1803 |
| 31 | Ga0070680_100195803 | 3300005336 | Bacteria | 1704 |
| 32 | Ga0070682_100090750 | 3300005337 | Bacteria | 1999 |
| 33 | Ga0068868_100049983 | 3300005338 | Bacteria | 3283 |
| 34 | Ga0070660_101092502 | 3300005339 | Bacteria | 675 |
| 35 | Ga0070691_10106883 | 3300005341 | Bacteria | 1396 |
| 36 | Ga0070687_100854571 | 3300005343 | Bacteria | 649 |
| 37 | Ga0070661_100615352 | 3300005344 | Bacteria | 879 |
| 38 | Ga0070668_100024056 | 3300005347 | Bacteria | 4613 |
| 39 | Ga0070668_100390240 | 3300005347 | Bacteria | 1187 |
| 40 | Ga0070668_100473182 | 3300005347 | Bacteria | 1081 |
| 41 | Ga0070668_100903627 | 3300005347 | Bacteria | 789 |
| 42 | Ga0070669_100001396 | 3300005353 | Bacteria | 17436 |
| 43 | Ga0070669_100011083 | 3300005353 | Bacteria | 6399 |
| 44 | Ga0070669_100442699 | 3300005353 | Bacteria | 1070 |
| 45 | Ga0070671_100029627 | 3300005355 | Bacteria | 4514 |
| 46 | Ga0070671_100045828 | 3300005355 | Bacteria | 3636 |
| 47 | Ga0070674_100187164 | 3300005356 | Bacteria | 1590 |
| 48 | Ga0070674_100607304 | 3300005356 | Bacteria | 925 |
| 49 | Ga0070673_100911838 | 3300005364 | Bacteria | 815 |
| 50 | Ga0070667_100001289 | 3300005367 | Bacteria | 22650 |
| 51 | Ga0070667_100019541 | 3300005367 | Bacteria | 5621 |
| 52 | Ga0070667_100069757 | 3300005367 | Bacteria | 2991 |
| 53 | Ga0070667_100897979 | 3300005367 | Bacteria | 825 |
| 54 | Ga0070709_10001423 | 3300005434 | Bacteria | 12946 |
| 55 | Ga0070709_10208027 | 3300005434 | Bacteria | 1389 |
| 56 | Ga0070714_100014682 | 3300005435 | Bacteria | 6294 |
| 57 | Ga0070714_100127032 | 3300005435 | Bacteria | 2275 |
| 58 | Ga0070714_100208010 | 3300005435 | Bacteria | 1792 |
| 59 | Ga0070714_100449290 | 3300005435 | Bacteria | 1224 |
| 60 | Ga0070713_100005847 | 3300005436 | Bacteria | 8457 |
| 61 | Ga0070713_100007642 | 3300005436 | Bacteria | 7608 |
| 62 | Ga0070713_100063091 | 3300005436 | Bacteria | 3105 |
| 63 | Ga0070713_100070335 | 3300005436 | Bacteria | 2954 |
| 64 | Ga0070710_10002139 | 3300005437 | Bacteria | 9367 |
| 65 | Ga0070710_10034735 | 3300005437 | Bacteria | 2745 |
| 66 | Ga0070711_100018016 | 3300005439 | Bacteria | 4503 |
| 67 | Ga0070711_100036221 | 3300005439 | Bacteria | 3305 |
| 68 | Ga0070711_100623857 | 3300005439 | Bacteria | 901 |
| 69 | Ga0070705_100079104 | 3300005440 | Bacteria | 2013 |
| 70 | Ga0070700_100004668 | 3300005441 | Bacteria | 7180 |
| 71 | Ga0070663_100006533 | 3300005455 | Bacteria | 7022 |
| 72 | Ga0070663_100261983 | 3300005455 | Bacteria | 1372 |
| 73 | Ga0070663_102106566 | 3300005455 | Bacteria | 508 |
| 74 | Ga0070678_100085495 | 3300005456 | Bacteria | 2404 |
| 75 | Ga0070678_101377533 | 3300005456 | Bacteria | 658 |
| 76 | Ga0070681_10498576 | 3300005458 | Bacteria | 1131 |
| 77 | Ga0070706_100003670 | 3300005467 | Bacteria | 15027 |
| 78 | Ga0070707_100019597 | 3300005468 | Bacteria | 6374 |
| 79 | Ga0070707_100673140 | 3300005468 | Bacteria | 997 |
| 80 | Ga0070698_100008160 | 3300005471 | Bacteria | 11322 |
| 81 | Ga0070699_100001192 | 3300005518 | Bacteria | 24008 |
| 82 | Ga0070699_100777744 | 3300005518 | Bacteria | 876 |
| 83 | Ga0070699_100827470 | 3300005518 | Bacteria | 847 |
| 84 | Ga0070679_100752268 | 3300005530 | Bacteria | 917 |
| 85 | Ga0070679_101786375 | 3300005530 | Bacteria | 563 |
| 86 | Ga0070697_100235244 | 3300005536 | Unclassified | 1563 |
| 87 | Ga0070697_100728931 | 3300005536 | Bacteria | 875 |
| 88 | Ga0068853_100306409 | 3300005539 | Bacteria | 1469 |
| 89 | Ga0068853_100439152 | 3300005539 | Bacteria | 1226 |
| 90 | Ga0068853_100443121 | 3300005539 | Bacteria | 1221 |
| 91 | Ga0068853_100629588 | 3300005539 | Bacteria | 1020 |
| 92 | Ga0070695_100003309 | 3300005545 | Bacteria | 9420 |
| 93 | Ga0070696_100013131 | 3300005546 | Bacteria | 5557 |
| 94 | Ga0070696_100364406 | 3300005546 | Bacteria | 1122 |
| 95 | Ga0070693_100286104 | 3300005547 | Bacteria | 1106 |
| 96 | Ga0070693_100555303 | 3300005547 | Bacteria | 822 |
| 97 | Ga0070665_100000107 | 3300005548 | Bacteria | 156048 |
| 98 | Ga0070665_100061489 | 3300005548 | Bacteria | 3765 |
| 99 | Ga0070665_100352307 | 3300005548 | Bacteria | 1478 |
| 100 | Ga0070665_100523629 | 3300005548 | Bacteria | 1197 |
| 101 | Ga0070665_102201547 | 3300005548 | Bacteria | 555 |
| 102 | Ga0070704_100046524 | 3300005549 | Bacteria | 3026 |
| 103 | Ga0068855_100067138 | 3300005563 | Bacteria | 4180 |
| 104 | Ga0068855_100381920 | 3300005563 | Bacteria | 1546 |
| 105 | Ga0068855_100850588 | 3300005563 | Bacteria | 967 |
| 106 | Ga0070664_100604535 | 3300005564 | Bacteria | 1017 |
| 107 | Ga0068857_100057015 | 3300005577 | Bacteria | 3467 |
| 108 | Ga0068857_100493001 | 3300005577 | Bacteria | 1149 |
| 109 | Ga0068857_101205282 | 3300005577 | Bacteria | 733 |
| 110 | Ga0068856_100341046 | 3300005614 | Bacteria | 1517 |
| 111 | Ga0068856_101438266 | 3300005614 | Bacteria | 704 |
| 112 | Ga0070702_101305134 | 3300005615 | Bacteria | 589 |
| 113 | Ga0068852_100252052 | 3300005616 | Bacteria | 1691 |
| 114 | Ga0068852_100319614 | 3300005616 | Bacteria | 1507 |
| 115 | Ga0068859_100132951 | 3300005617 | Bacteria | 2560 |
| 116 | Ga0068859_100810810 | 3300005617 | Bacteria | 1023 |
| 117 | Ga0068859_100915497 | 3300005617 | Bacteria | 961 |
| 118 | Ga0068859_101161340 | 3300005617 | Bacteria | 850 |
| 119 | Ga0068864_100153684 | 3300005618 | Bacteria | 2087 |
| 120 | Ga0068861_100062658 | 3300005719 | Bacteria | 2857 |
| 121 | Ga0068861_100105602 | 3300005719 | Bacteria | 2249 |
| 122 | Ga0068861_100743177 | 3300005719 | Bacteria | 916 |
| 123 | Ga0068863_100369401 | 3300005841 | Bacteria | 1400 |
| 124 | Ga0068863_100418005 | 3300005841 | Bacteria | 1313 |
| 125 | Ga0068863_100508869 | 3300005841 | Bacteria | 1186 |
| 126 | Ga0068858_100000191 | 3300005842 | Bacteria | 65267 |
| 127 | Ga0068858_100193011 | 3300005842 | Bacteria | 1924 |
| 128 | Ga0068858_100218585 | 3300005842 | Bacteria | 1804 |
| 129 | Ga0068858_100586328 | 3300005842 | Bacteria | 1081 |
| 130 | Ga0068858_100685177 | 3300005842 | Bacteria | 997 |
| 131 | Ga0068858_101741671 | 3300005842 | Bacteria | 615 |
| 132 | Ga0068860_100004803 | 3300005843 | Bacteria | 13760 |
| 133 | Ga0068860_100086315 | 3300005843 | Bacteria | 2986 |
| 134 | Ga0068860_100453064 | 3300005843 | Bacteria | 1276 |
| 135 | Ga0068860_101078900 | 3300005843 | Bacteria | 822 |
| 136 | Ga0068860_102693611 | 3300005843 | Bacteria | 516 |
| 137 | Ga0068862_100008499 | 3300005844 | Bacteria | 8492 |
| 138 | Ga0068862_100140692 | 3300005844 | Bacteria | 2141 |
| 139 | Ga0068862_100255458 | 3300005844 | Bacteria | 1598 |
| 140 | Ga0068862_100313131 | 3300005844 | Bacteria | 1447 |
| 141 | Ga0068862_101516253 | 3300005844 | Bacteria | 676 |
| 142 | Ga0081455_10000028 | 3300005937 | Bacteria | 155778 |
| 143 | Ga0081540_1146814 | 3300005983 | Bacteria | 937 |
| 144 | Ga0081539_10004186 | 3300005985 | Bacteria | 16343 |
| 145 | Ga0070717_10109011 | 3300006028 | Bacteria | 2360 |
| 146 | Ga0070717_10215566 | 3300006028 | Bacteria | 1686 |
| 147 | Ga0075365_10010971 | 3300006038 | Bacteria | 5308 |
| 148 | Ga0075363_100099126 | 3300006048 | Bacteria | 1611 |
| 149 | Ga0070715_10101757 | 3300006163 | Bacteria | 1341 |
| 150 | Ga0070716_100007382 | 3300006173 | Bacteria | 5407 |
| 151 | Ga0070716_100160910 | 3300006173 | Bacteria | 1454 |
| 152 | Ga0070716_101238386 | 3300006173 | Bacteria | 601 |
| 153 | Ga0070716_101635204 | 3300006173 | Bacteria | 530 |
| 154 | Ga0070712_100069079 | 3300006175 | Bacteria | 2519 |
| 155 | Ga0070712_100086611 | 3300006175 | Bacteria | 2283 |
| 156 | Ga0070712_100181203 | 3300006175 | Bacteria | 1641 |
| 157 | Ga0075362_10366830 | 3300006177 | Bacteria | 723 |
| 158 | Ga0075367_10419691 | 3300006178 | Bacteria | 847 |
| 159 | Ga0075369_10079358 | 3300006186 | Bacteria | 1454 |
| 160 | Ga0097621_100581405 | 3300006237 | Bacteria | 1022 |
| 161 | Ga0097621_100698468 | 3300006237 | Bacteria | 934 |
| 162 | Ga0075370_10616697 | 3300006353 | Bacteria | 658 |
| 163 | Ga0075370_10987169 | 3300006353 | Bacteria | 516 |
| 164 | Ga0068871_100909268 | 3300006358 | Bacteria | 816 |
| 165 | Ga0068871_100963154 | 3300006358 | Bacteria | 793 |
| 166 | Ga0068871_101045841 | 3300006358 | Bacteria | 762 |
| 167 | Ga0075428_100118734 | 3300006844 | Bacteria | 2880 |
| 168 | Ga0075428_100629506 | 3300006844 | Bacteria | 1145 |
| 169 | Ga0075428_100761957 | 3300006844 | Bacteria | 1030 |
| 170 | Ga0075430_100023915 | 3300006846 | Bacteria | 5202 |
| 171 | Ga0075431_100045525 | 3300006847 | Bacteria | 4523 |
| 172 | Ga0075433_10880284 | 3300006852 | Bacteria | 781 |
| 173 | Ga0075433_11097806 | 3300006852 | Bacteria | 692 |
| 174 | Ga0075429_100178803 | 3300006880 | Bacteria | 1859 |
| 175 | Ga0068865_100799318 | 3300006881 | Bacteria | 814 |
| 176 | Ga0097620_100132952 | 3300006931 | Bacteria | 2560 |
| 177 | Ga0097620_100810798 | 3300006931 | Bacteria | 1023 |
| 178 | Ga0097620_100915335 | 3300006931 | Bacteria | 961 |
| 179 | Ga0079104_1004974 | 3300006946 | Bacteria | 5469 |
| 180 | Ga0105251_10002928 | 3300009011 | Bacteria | 12798 |
| 181 | Ga0105240_10071684 | 3300009093 | Bacteria | 4284 |
| 182 | Ga0105240_10266334 | 3300009093 | Bacteria | 1975 |
| 183 | Ga0105240_10313742 | 3300009093 | Bacteria | 1789 |
| 184 | Ga0105240_10344568 | 3300009093 | Bacteria | 1692 |
| 185 | Ga0105240_10866579 | 3300009093 | Bacteria | 974 |
| 186 | Ga0105240_12066597 | 3300009093 | Bacteria | 592 |
| 187 | Ga0105240_12595983 | 3300009093 | Bacteria | 523 |
| 188 | Ga0105245_10038965 | 3300009098 | Bacteria | 4229 |
| 189 | Ga0105247_10042030 | 3300009101 | Bacteria | 2797 |
| 190 | Ga0105247_10091810 | 3300009101 | Bacteria | 1929 |
| 191 | Ga0105243_10221031 | 3300009148 | Bacteria | 1674 |
| 192 | Ga0105241_10511434 | 3300009174 | Bacteria | 1072 |
| 193 | Ga0105241_10977529 | 3300009174 | Unclassified | 791 |
| 194 | Ga0105241_11380320 | 3300009174 | Bacteria | 674 |
| 195 | Ga0105242_10235724 | 3300009176 | Bacteria | 1642 |
| 196 | Ga0105242_10940489 | 3300009176 | Bacteria | 867 |
| 197 | Ga0105242_12430828 | 3300009176 | Bacteria | 572 |
| 198 | Ga0105248_10009594 | 3300009177 | Bacteria | 10655 |
| 199 | Ga0105248_10128534 | 3300009177 | Bacteria | 2858 |
| 200 | Ga0105248_10840293 | 3300009177 | Bacteria | 1036 |
| 201 | Ga0105248_12128578 | 3300009177 | Bacteria | 638 |
| 202 | Ga0105237_10042034 | 3300009545 | Bacteria | 4609 |
| 203 | Ga0105237_10126238 | 3300009545 | Bacteria | 2553 |
| 204 | Ga0105237_10174659 | 3300009545 | Bacteria | 2149 |
| 205 | Ga0105237_10184617 | 3300009545 | Bacteria | 2086 |
| 206 | Ga0105237_10257587 | 3300009545 | Bacteria | 1747 |
| 207 | Ga0105237_10532929 | 3300009545 | Bacteria | 1181 |
| 208 | Ga0105237_10684654 | 3300009545 | Bacteria | 1032 |
| 209 | Ga0105238_10028484 | 3300009551 | Bacteria | 5691 |
| 210 | Ga0105238_10051155 | 3300009551 | Bacteria | 4156 |
| 211 | Ga0105238_10074351 | 3300009551 | Bacteria | 3391 |
| 212 | Ga0105238_10184388 | 3300009551 | Bacteria | 2064 |
| 213 | Ga0105238_10247466 | 3300009551 | Bacteria | 1760 |
| 214 | Ga0105238_10563976 | 3300009551 | Bacteria | 1144 |
| 215 | Ga0105238_10595445 | 3300009551 | Bacteria | 1113 |
| 216 | Ga0105238_12399678 | 3300009551 | Bacteria | 563 |
| 217 | Ga0105249_10016560 | 3300009553 | Bacteria | 6542 |
| 218 | Ga0105249_10035426 | 3300009553 | Bacteria | 4527 |
| 219 | Ga0105249_11263752 | 3300009553 | Bacteria | 810 |
| 220 | Ga0105249_12913368 | 3300009553 | Bacteria | 549 |
| 221 | Ga0105239_10057650 | 3300010375 | Bacteria | 4261 |
| 222 | Ga0105239_10297273 | 3300010375 | Bacteria | 1818 |
| 223 | Ga0105239_10492090 | 3300010375 | Bacteria | 1394 |
| 224 | Ga0105239_11243597 | 3300010375 | Bacteria | 858 |
| 225 | Ga0105246_10159677 | 3300011119 | Bacteria | 1716 |
| 226 | Ga0105246_11116964 | 3300011119 | Bacteria | 721 |
| 227 | Ga0157370_10437857 | 3300013104 | Bacteria | 1202 |
| 228 | Ga0157369_10221063 | 3300013105 | Bacteria | 1983 |
| 229 | Ga0157374_10217701 | 3300013296 | Bacteria | 1873 |
| 230 | Ga0157374_10425174 | 3300013296 | Bacteria | 1327 |
| 231 | Ga0163162_10311412 | 3300013306 | Bacteria | 1707 |
| 232 | Ga0157372_10244458 | 3300013307 | Bacteria | 2082 |
| 233 | Ga0163163_10073713 | 3300014325 | Bacteria | 3405 |
| 234 | Ga0157380_10008850 | 3300014326 | Bacteria | 7193 |
| 235 | Ga0157380_10269866 | 3300014326 | Bacteria | 1550 |
| 236 | Ga0157379_10062199 | 3300014968 | Bacteria | 3339 |
| 237 | Ga0157379_10377527 | 3300014968 | Bacteria | 1300 |
| 238 | Ga0157379_10959339 | 3300014968 | Bacteria | 814 |
| 239 | Ga0157376_10546009 | 3300014969 | Bacteria | 1146 |
| 240 | Ga0163161_10022467 | 3300017792 | Bacteria | 4443 |
| 241 | Ga0163161_10249882 | 3300017792 | Bacteria | 1382 |
| 242 | Ga0163161_10542000 | 3300017792 | Bacteria | 952 |
| 243 | Ga0206353_10448061 | 3300020082 | Bacteria | 769 |
| 244 | Ga0154015_1344946 | 3300020610 | Bacteria | 582 |
| 245 | Ga0213873_10013896 | 3300021358 | Bacteria | 1775 |
| 246 | Ga0213872_10000119 | 3300021361 | Bacteria | 73666 |
| 247 | Ga0213872_10000660 | 3300021361 | Bacteria | 26162 |
| 248 | Ga0213872_10002314 | 3300021361 | Bacteria | 11358 |
| 249 | Ga0213872_10003898 | 3300021361 | Bacteria | 8099 |
| 250 | Ga0213872_10032146 | 3300021361 | Bacteria | 2405 |
| 251 | Ga0213872_10061338 | 3300021361 | Bacteria | 1700 |
| 252 | Ga0213872_10095690 | 3300021361 | Bacteria | 1326 |
| 253 | Ga0213872_10156638 | 3300021361 | Bacteria | 992 |
| 254 | Ga0213874_10145920 | 3300021377 | Unclassified | 822 |
| 255 | Ga0213876_10008226 | 3300021384 | Bacteria | 5644 |
| 256 | Ga0213876_10161123 | 3300021384 | Bacteria | 1193 |
| 257 | Ga0213871_10014922 | 3300021441 | Bacteria | 1850 |
| 258 | Ga0209437_101642 | 3300025233 | Bacteria | 5074 |
| 259 | Ga0207425_1000461 | 3300025245 | Bacteria | 26109 |
| 260 | Ga0207425_1088317 | 3300025245 | Bacteria | 509 |
| 261 | Ga0209677_101787 | 3300025253 | Bacteria | 8887 |
| 262 | Ga0209148_1008207 | 3300025254 | Bacteria | 2111 |
| 263 | Ga0209148_1022875 | 3300025254 | Bacteria | 1000 |
| 264 | Ga0209129_1000327 | 3300025258 | Bacteria | 41506 |
| 265 | Ga0209233_1000044 | 3300025261 | Bacteria | 489783 |
| 266 | Ga0209233_1003858 | 3300025261 | Bacteria | 5219 |
| 267 | Ga0209565_1000052 | 3300025263 | Bacteria | 212056 |
| 268 | Ga0209565_1028698 | 3300025263 | Bacteria | 1097 |
| 269 | Ga0209455_1009381 | 3300025272 | Bacteria | 2575 |
| 270 | Ga0209455_1010385 | 3300025272 | Bacteria | 2370 |
| 271 | Ga0209673_1015739 | 3300025273 | Bacteria | 2857 |
| 272 | Ga0209675_1000025 | 3300025291 | Bacteria | 294102 |
| 273 | Ga0209676_1000221 | 3300025292 | Bacteria | 124715 |
| 274 | Ga0209676_1000228 | 3300025292 | Bacteria | 123024 |
| 275 | Ga0209676_1002468 | 3300025292 | Bacteria | 13057 |
| 276 | Ga0209676_1078273 | 3300025292 | Bacteria | 761 |
| 277 | Ga0209025_1001791 | 3300025294 | Bacteria | 25501 |
| 278 | Ga0209025_1035515 | 3300025294 | Bacteria | 2251 |
| 279 | Ga0209564_1009372 | 3300025295 | Bacteria | 4670 |
| 280 | Ga0209564_1013638 | 3300025295 | Bacteria | 3432 |
| 281 | Ga0209758_1000002 | 3300025297 | Bacteria | 1400310 |
| 282 | Ga0209758_1000005 | 3300025297 | Bacteria | 1368918 |
| 283 | Ga0209758_1000017 | 3300025297 | Bacteria | 754393 |
| 284 | Ga0209758_1016463 | 3300025297 | Bacteria | 3754 |
| 285 | Ga0209758_1028594 | 3300025297 | Bacteria | 2352 |
| 286 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 287 | Ga0209050_1000042 | 3300025298 | Bacteria | 402842 |
| 288 | Ga0209050_1000071 | 3300025298 | Bacteria | 295478 |
| 289 | Ga0209050_1001886 | 3300025298 | Bacteria | 20130 |
| 290 | Ga0209050_1015417 | 3300025298 | Bacteria | 3212 |
| 291 | Ga0209050_1029003 | 3300025298 | Bacteria | 1781 |
| 292 | Ga0207426_1011633 | 3300025302 | Bacteria | 3341 |
| 293 | Ga0207426_1105283 | 3300025302 | Bacteria | 721 |
| 294 | Ga0209051_1000297 | 3300025303 | Bacteria | 79062 |
| 295 | Ga0209257_1000027 | 3300025304 | Bacteria | 703541 |
| 296 | Ga0209257_1000135 | 3300025304 | Bacteria | 205668 |
| 297 | Ga0209257_1000229 | 3300025304 | Bacteria | 133121 |
| 298 | Ga0209257_1001829 | 3300025304 | Bacteria | 23270 |
| 299 | Ga0209257_1001894 | 3300025304 | Bacteria | 22612 |
| 300 | Ga0209257_1003342 | 3300025304 | Bacteria | 13875 |
| 301 | Ga0207713_1004263 | 3300025735 | Bacteria | 9336 |
| 302 | Ga0207713_1033482 | 3300025735 | Bacteria | 2244 |
| 303 | Ga0207692_10043937 | 3300025898 | Bacteria | 2227 |
| 304 | Ga0207692_10083142 | 3300025898 | Bacteria | 1717 |
| 305 | Ga0207710_10684554 | 3300025900 | Bacteria | 538 |
| 306 | Ga0207680_10071427 | 3300025903 | Bacteria | 2152 |
| 307 | Ga0207680_10138961 | 3300025903 | Bacteria | 1609 |
| 308 | Ga0207680_10203491 | 3300025903 | Bacteria | 1350 |
| 309 | Ga0207685_10028613 | 3300025905 | Bacteria | 1964 |
| 310 | Ga0207685_10655604 | 3300025905 | Bacteria | 568 |
| 311 | Ga0207699_10010077 | 3300025906 | Bacteria | 4728 |
| 312 | Ga0207699_10065501 | 3300025906 | Bacteria | 2203 |
| 313 | Ga0207699_11266092 | 3300025906 | Bacteria | 546 |
| 314 | Ga0207705_11032903 | 3300025909 | Bacteria | 634 |
| 315 | Ga0207707_10002658 | 3300025912 | Bacteria | 15980 |
| 316 | Ga0207707_10071401 | 3300025912 | Bacteria | 3025 |
| 317 | Ga0207707_10144774 | 3300025912 | Bacteria | 2077 |
| 318 | Ga0207695_10538634 | 3300025913 | Bacteria | 1049 |
| 319 | Ga0207695_11670869 | 3300025913 | Bacteria | 518 |
| 320 | Ga0207671_10067180 | 3300025914 | Bacteria | 2670 |
| 321 | Ga0207671_10168284 | 3300025914 | Bacteria | 1701 |
| 322 | Ga0207671_10475594 | 3300025914 | Bacteria | 996 |
| 323 | Ga0207671_10509367 | 3300025914 | Bacteria | 959 |
| 324 | Ga0207671_11461016 | 3300025914 | Bacteria | 529 |
| 325 | Ga0207693_10098570 | 3300025915 | Bacteria | 2292 |
| 326 | Ga0207693_10109179 | 3300025915 | Bacteria | 2170 |
| 327 | Ga0207693_10117782 | 3300025915 | Bacteria | 2085 |
| 328 | Ga0207693_10126768 | 3300025915 | Bacteria | 2006 |
| 329 | Ga0207693_10200851 | 3300025915 | Bacteria | 1568 |
| 330 | Ga0207663_10011331 | 3300025916 | Bacteria | 4786 |
| 331 | Ga0207663_10036387 | 3300025916 | Bacteria | 2961 |
| 332 | Ga0207660_10244669 | 3300025917 | Bacteria | 1414 |
| 333 | Ga0207657_10209412 | 3300025919 | Bacteria | 1565 |
| 334 | Ga0207657_10834300 | 3300025919 | Bacteria | 712 |
| 335 | Ga0207652_10280822 | 3300025921 | Bacteria | 1502 |
| 336 | Ga0207681_10000336 | 3300025923 | Bacteria | 33758 |
| 337 | Ga0207681_10001866 | 3300025923 | Bacteria | 13505 |
| 338 | Ga0207694_10015844 | 3300025924 | Bacteria | 5686 |
| 339 | Ga0207694_10046214 | 3300025924 | Bacteria | 3365 |
| 340 | Ga0207694_10293096 | 3300025924 | Bacteria | 1338 |
| 341 | Ga0207694_10547196 | 3300025924 | Bacteria | 971 |
| 342 | Ga0207694_10782955 | 3300025924 | Bacteria | 806 |
| 343 | Ga0207694_11403348 | 3300025924 | Bacteria | 590 |
| 344 | Ga0207650_10045454 | 3300025925 | Bacteria | 3230 |
| 345 | Ga0207687_10012572 | 3300025927 | Bacteria | 5529 |
| 346 | Ga0207700_10022828 | 3300025928 | Bacteria | 4299 |
| 347 | Ga0207700_10027564 | 3300025928 | Bacteria | 3981 |
| 348 | Ga0207700_10030799 | 3300025928 | Bacteria | 3804 |
| 349 | Ga0207700_10256606 | 3300025928 | Bacteria | 1495 |
| 350 | Ga0207664_10045578 | 3300025929 | Bacteria | 3439 |
| 351 | Ga0207664_10119582 | 3300025929 | Bacteria | 2203 |
| 352 | Ga0207664_10131807 | 3300025929 | Bacteria | 2105 |
| 353 | Ga0207644_10001624 | 3300025931 | Bacteria | 14492 |
| 354 | Ga0207644_10296244 | 3300025931 | Bacteria | 1302 |
| 355 | Ga0207644_10712744 | 3300025931 | Bacteria | 837 |
| 356 | Ga0207665_10000976 | 3300025939 | Bacteria | 19353 |
| 357 | Ga0207665_10160349 | 3300025939 | Bacteria | 1617 |
| 358 | Ga0207665_10976579 | 3300025939 | Bacteria | 673 |
| 359 | Ga0207711_10028200 | 3300025941 | Bacteria | 4723 |
| 360 | Ga0207711_10314840 | 3300025941 | Bacteria | 1445 |
| 361 | Ga0207711_10700835 | 3300025941 | Bacteria | 944 |
| 362 | Ga0207661_10258099 | 3300025944 | Bacteria | 1551 |
| 363 | Ga0207661_10475759 | 3300025944 | Bacteria | 1140 |
| 364 | Ga0207661_10934771 | 3300025944 | Bacteria | 799 |
| 365 | Ga0207679_10751363 | 3300025945 | Bacteria | 887 |
| 366 | Ga0207667_10634414 | 3300025949 | Bacteria | 1075 |
| 367 | Ga0207712_10008807 | 3300025961 | Bacteria | 6379 |
| 368 | Ga0207712_10067851 | 3300025961 | Bacteria | 2554 |
| 369 | Ga0207712_10207620 | 3300025961 | Bacteria | 1558 |
| 370 | Ga0207712_11536900 | 3300025961 | Bacteria | 596 |
| 371 | Ga0207668_10010776 | 3300025972 | Bacteria | 5536 |
| 372 | Ga0207668_10013861 | 3300025972 | Bacteria | 4978 |
| 373 | Ga0207668_10184044 | 3300025972 | Bacteria | 1650 |
| 374 | Ga0207668_10592281 | 3300025972 | Bacteria | 965 |
| 375 | Ga0207668_10818030 | 3300025972 | Bacteria | 825 |
| 376 | Ga0207640_10085705 | 3300025981 | Bacteria | 2167 |
| 377 | Ga0207640_10183096 | 3300025981 | Bacteria | 1572 |
| 378 | Ga0207658_10001483 | 3300025986 | Bacteria | 18220 |
| 379 | Ga0207658_10034488 | 3300025986 | Bacteria | 3617 |
| 380 | Ga0207658_10123356 | 3300025986 | Bacteria | 2069 |
| 381 | Ga0207658_10771279 | 3300025986 | Bacteria | 872 |
| 382 | Ga0207677_10248166 | 3300026023 | Bacteria | 1444 |
| 383 | Ga0207703_10007705 | 3300026035 | Bacteria | 8526 |
| 384 | Ga0207703_10188703 | 3300026035 | Bacteria | 1824 |
| 385 | Ga0207703_10592531 | 3300026035 | Bacteria | 1048 |
| 386 | Ga0207703_12265253 | 3300026035 | Bacteria | 519 |
| 387 | Ga0207639_10075641 | 3300026041 | Bacteria | 2648 |
| 388 | Ga0207639_10211713 | 3300026041 | Bacteria | 1669 |
| 389 | Ga0207639_10388792 | 3300026041 | Bacteria | 1254 |
| 390 | Ga0207639_10446323 | 3300026041 | Bacteria | 1174 |
| 391 | Ga0207639_10560160 | 3300026041 | Bacteria | 1050 |
| 392 | Ga0207678_10014682 | 3300026067 | Bacteria | 6891 |
| 393 | Ga0207678_10176765 | 3300026067 | Bacteria | 1823 |
| 394 | Ga0207702_10920852 | 3300026078 | Bacteria | 866 |
| 395 | Ga0207702_12063245 | 3300026078 | Bacteria | 560 |
| 396 | Ga0207641_10000078 | 3300026088 | Bacteria | 143842 |
| 397 | Ga0207641_10494114 | 3300026088 | Bacteria | 1187 |
| 398 | Ga0207676_10000420 | 3300026095 | Bacteria | 35827 |
| 399 | Ga0207676_10128799 | 3300026095 | Bacteria | 2148 |
| 400 | Ga0207676_10295353 | 3300026095 | Bacteria | 1477 |
| 401 | Ga0207674_10072137 | 3300026116 | Bacteria | 3469 |
| 402 | Ga0207674_10504362 | 3300026116 | Bacteria | 1169 |
| 403 | Ga0207675_100190919 | 3300026118 | Bacteria | 1965 |
| 404 | Ga0207698_10467043 | 3300026142 | Bacteria | 1221 |
| 405 | Ga0207698_11112089 | 3300026142 | Bacteria | 803 |
| 406 | Ga0209281_1010983 | 3300027111 | Bacteria | 2045 |
| 407 | Ga0268266_10000462 | 3300028379 | Bacteria | 59105 |
| 408 | Ga0268266_10177980 | 3300028379 | Bacteria | 1935 |
| 409 | Ga0268266_10197593 | 3300028379 | Bacteria | 1839 |
| 410 | Ga0268266_10228388 | 3300028379 | Bacteria | 1713 |
| 411 | Ga0268265_10624763 | 3300028380 | Bacteria | 1032 |
| 412 | Ga0268265_11506436 | 3300028380 | Bacteria | 676 |
| 413 | Ga0268264_10000380 | 3300028381 | Bacteria | 64910 |
| 414 | Ga0268264_10013595 | 3300028381 | Bacteria | 6700 |
| 415 | Ga0268264_10064855 | 3300028381 | Unclassified | 3075 |
| 416 | Ga0268264_11092426 | 3300028381 | Bacteria | 806 |
| 417 | Ga0268264_11893108 | 3300028381 | Bacteria | 606 |
| 418 | Ga0265337_1026672 | 3300028556 | Bacteria | 1748 |
| 419 | Ga0265326_10006199 | 3300028558 | Bacteria | 3730 |
| 420 | Ga0265319_1019753 | 3300028563 | Bacteria | 2509 |
| 421 | Ga0265334_10096688 | 3300028573 | Bacteria | 1072 |
| 422 | Ga0265318_10062097 | 3300028577 | Bacteria | 1391 |
| 423 | Ga0265323_10002721 | 3300028653 | Bacteria | 7967 |
| 424 | Ga0265336_10000661 | 3300028666 | Bacteria | 18756 |
| 425 | Ga0307517_10111281 | 3300028786 | Bacteria | 2082 |
| 426 | Ga0307517_10332500 | 3300028786 | Bacteria | 834 |
| 427 | Ga0265338_10004433 | 3300028800 | Bacteria | 18963 |
| 428 | Ga0265324_10003042 | 3300029957 | Bacteria | 8197 |
| 429 | Ga0307511_10078058 | 3300030521 | Bacteria | 2351 |
| 430 | Ga0314311_1103907 | 3300030733 | Bacteria | 1668 |
| 431 | Ga0265330_10067230 | 3300031235 | Bacteria | 1553 |
| 432 | Ga0265328_10302791 | 3300031239 | Bacteria | 617 |
| 433 | Ga0265340_10017095 | 3300031247 | Bacteria | 3751 |
| 434 | Ga0265339_10002135 | 3300031249 | Bacteria | 14404 |
| 435 | Ga0265316_10018719 | 3300031344 | Bacteria | 5946 |
| 436 | Ga0307513_10040717 | 3300031456 | Bacteria | 5135 |
| 437 | Ga0265313_10005700 | 3300031595 | Bacteria | 9082 |
| 438 | Ga0265342_10006876 | 3300031712 | Bacteria | 8406 |
| 439 | Ga0316576_10009408 | 3300031727 | Bacteria | 6303 |
| 440 | Ga0307413_10379862 | 3300031824 | Bacteria | 1100 |
| 441 | Ga0307413_12198305 | 3300031824 | Bacteria | 500 |
| 442 | Ga0307410_10599532 | 3300031852 | Bacteria | 919 |
| 443 | Ga0307410_11527634 | 3300031852 | Bacteria | 589 |
| 444 | Ga0307406_10130544 | 3300031901 | Bacteria | 1763 |
| 445 | Ga0307406_10379585 | 3300031901 | Bacteria | 1114 |
| 446 | Ga0307406_10814546 | 3300031901 | Bacteria | 789 |
| 447 | Ga0307416_100924604 | 3300032002 | Bacteria | 973 |
| 448 | Ga0307416_103599957 | 3300032002 | Bacteria | 518 |
| 449 | Ga0307414_10018906 | 3300032004 | Bacteria | 4257 |
| 450 | Ga0307414_10370884 | 3300032004 | Bacteria | 1234 |
| 451 | Ga0307414_10686162 | 3300032004 | Bacteria | 926 |
| 452 | Ga0307414_11039439 | 3300032004 | Bacteria | 755 |
| 453 | Ga0307411_10242061 | 3300032005 | Bacteria | 1413 |
| 454 | Ga0307411_10814350 | 3300032005 | Bacteria | 823 |
| 455 | Ga0307411_10930565 | 3300032005 | Bacteria | 774 |
| 456 | Ga0307510_10001188 | 3300033180 | Bacteria | 28138 |
| 457 | Ga0307510_10009411 | 3300033180 | Bacteria | 11641 |
| 458 | Ga0316596_1024383 | 3300033541 | Bacteria | 1553 |
| 459 | Ga0373923_0099251 | 3300035111 | Bacteria | 1282 |
| 460 | Ga0373936_0034305 | 3300035113 | Bacteria | 2015 |
| 461 | Ga0373936_0038214 | 3300035113 | Bacteria | 1918 |
| 462 | Ga0373945_0157692 | 3300035116 | Bacteria | 923 |
| 463 | Ga0373954_0044080 | 3300035118 | Bacteria | 2081 |
| 464 | Ga0373956_0010743 | 3300035119 | Bacteria | 3760 |
| 465 | Ga0373943_0031224 | 3300035170 | Bacteria | 2526 |
| 466 | Ga0373946_0330395 | 3300035171 | Bacteria | 759 |
| 467 | Ga0373955_0078991 | 3300035172 | Bacteria | 1855 |
| 468 | Ga0373924_0389448 | 3300035410 | Bacteria | 622 |
| 469 | Ga0373931_0676333 | 3300035691 | Bacteria | 680 |
| 470 | Ga0373935_0036452 | 3300035692 | Bacteria | 3075 |
| 471 | Ga0373935_0101394 | 3300035692 | Bacteria | 1898 |
| 472 | Ga0373935_0410667 | 3300035692 | Bacteria | 973 |
| 473 | Ga0373927_0071440 | 3300035695 | Bacteria | 2246 |
| 474 | Ga0373927_0141393 | 3300035695 | Bacteria | 1574 |
| 475 | Ga0373927_0744352 | 3300035695 | Bacteria | 647 |
| 476 | Ga0373933_0018114 | 3300035724 | Bacteria | 3957 |
| 477 | Ga0373947_0263042 | 3300035725 | Bacteria | 1143 |
| 478 | Ga0373937_0183822 | 3300036401 | Bacteria | 1963 |
| 479 | Ga0373937_0214072 | 3300036401 | Bacteria | 1813 |
| 480 | Ga0372808_033289 | 3300036459 | Bacteria | 739 |
| 481 | Ga0373925_0089108 | 3300037068 | Bacteria | 2356 |
| 482 | Ga0373925_0116422 | 3300037068 | Bacteria | 2070 |
| 483 | Ga0373925_0152205 | 3300037068 | Bacteria | 1817 |
| 484 | Ga0395899_0038201 | 3300037312 | Bacteria | 3597 |
| 485 | Ga0395900_0074422 | 3300037418 | Bacteria | 3492 |
| 486 | Ga0395900_0111866 | 3300037418 | Bacteria | 2804 |
| 487 | Ga0395898_0087501 | 3300037466 | Bacteria | 3001 |
| 488 | Ga0395905_0127369 | 3300037471 | Bacteria | 2394 |
| 489 | Ga0395905_0818640 | 3300037471 | Bacteria | 834 |
| 490 | Ga0436364_0701650 | 3300037853 | Bacteria | 8124 |
| 491 | Ga0395901_0008255 | 3300038443 | Bacteria | 10523 |
| 492 | Ga0395901_1059370 | 3300038443 | Bacteria | 783 |
| 493 | Ga0395901_1847133 | 3300038443 | Bacteria | 553 |
| 494 | Ga0400486_12864 | 3300038742 | Bacteria | 1962 |
| 495 | Ga0436365_0815982 | 3300039437 | Bacteria | 1305 |
| 496 | Ga0436365_1095754 | 3300039437 | Bacteria | 43052 |
| 497 | Ga0436365_1707348 | 3300039437 | Bacteria | 3485 |
| 498 | Ga0436360_0458992 | 3300039438 | Bacteria | 1121 |
| 499 | Ga0436360_0630509 | 3300039438 | Bacteria | 1511 |
| 500 | Ga0436360_0813945 | 3300039438 | Bacteria | 4345 |
| 501 | Ga0436360_1300343 | 3300039438 | Bacteria | 977 |
| 502 | Ga0436361_0033458 | 3300039447 | Bacteria | 563 |
| 503 | Ga0436361_0067631 | 3300039447 | Bacteria | 62801 |
| 504 | Ga0436361_0080624 | 3300039447 | Bacteria | 1826 |
| 505 | Ga0436361_0120999 | 3300039447 | Bacteria | 7582 |
| 506 | Ga0436361_0193989 | 3300039447 | Bacteria | 823 |
| 507 | Ga0436361_0229583 | 3300039447 | Bacteria | 1092 |
| 508 | Ga0436361_0241172 | 3300039447 | Bacteria | 1970 |
| 509 | Ga0436361_0419875 | 3300039447 | Bacteria | 3848 |
| 510 | Ga0436361_0430273 | 3300039447 | Bacteria | 992 |
| 511 | Ga0436361_0543398 | 3300039447 | Bacteria | 1054 |
| 512 | Ga0436361_0659391 | 3300039447 | Bacteria | 5192 |
| 513 | Ga0436361_0660497 | 3300039447 | Bacteria | 1569 |
| 514 | Ga0436361_0670518 | 3300039447 | Bacteria | 3422 |
| 515 | Ga0436361_0867004 | 3300039447 | Bacteria | 10526 |
| 516 | Ga0436361_0969043 | 3300039447 | Bacteria | 1038 |
| 517 | Ga0436361_1115532 | 3300039447 | Bacteria | 2477 |
| 518 | Ga0436361_1168992 | 3300039447 | Bacteria | 1260 |
| 519 | Ga0436361_1181218 | 3300039447 | Bacteria | 870 |
| 520 | Ga0436361_1193675 | 3300039447 | Bacteria | 723 |
| 521 | Ga0436363_0004057 | 3300039450 | Bacteria | 904 |
| 522 | Ga0436363_0243146 | 3300039450 | Bacteria | 1481 |
| 523 | Ga0436363_0368964 | 3300039450 | Bacteria | 4916 |
| 524 | Ga0436363_0592501 | 3300039450 | Bacteria | 656 |
| 525 | Ga0436363_0641523 | 3300039450 | Bacteria | 1051 |
| 526 | Ga0436363_1385665 | 3300039450 | Bacteria | 1133 |
| 527 | Ga0436362_0143304 | 3300039453 | Bacteria | 5230 |
| 528 | Ga0436362_0217235 | 3300039453 | Bacteria | 613 |
| 529 | Ga0436362_0616710 | 3300039453 | Bacteria | 568 |
| 530 | Ga0439461_0000157 | 3300041410 | Bacteria | 9230 |
| 531 | Ga0439466_0099166 | 3300041411 | Bacteria | 909 |
| 532 | Ga0439465_0001520 | 3300041413 | Bacteria | 7534 |
| 533 | Ga0451793_1167052 | 3300041452 | Bacteria | 887 |
| 534 | Ga0451800_0210168 | 3300041459 | Bacteria | 612 |
| 535 | Ga0451806_017109 | 3300041462 | Bacteria | 1268 |
| 536 | Ga0451807_1376495 | 3300041486 | Bacteria | 1447 |
| 537 | Ga0451833_0151526 | 3300041491 | Bacteria | 874 |
| 538 | Ga0451845_0678984 | 3300041501 | Bacteria | 1274 |
| 539 | Ga0451847_0607255 | 3300041503 | Bacteria | 1021 |
| 540 | Ga0451843_0743624 | 3300041509 | Bacteria | 1257 |
| 541 | Ga0451853_0787389 | 3300041512 | Bacteria | 1484 |
| 542 | Ga0451853_2451500 | 3300041512 | Bacteria | 988 |
| 543 | Ga0439431_0000015 | 3300041997 | Bacteria | 27396 |
| 544 | Ga0439442_001146 | 3300042002 | Bacteria | 5297 |
| 545 | Ga0439445_0000834 | 3300042004 | Bacteria | 6512 |
| 546 | Ga0439432_000156 | 3300042006 | Bacteria | 23244 |
| 547 | Ga0439452_029791 | 3300042010 | Bacteria | 1351 |
| 548 | Ga0439462_0000128 | 3300042015 | Bacteria | 11958 |
| 549 | Ga0439434_0001220 | 3300042435 | Bacteria | 7404 |
| 550 | Ga0451577_0948068 | 3300042876 | Bacteria | 774 |
| 551 | Ga0466966_0740239 | 3300044684 | Bacteria | 593 |
| 552 | Ga0466963_0511134 | 3300044694 | Bacteria | 848 |
| 553 | Ga0466964_0087797 | 3300044706 | Bacteria | 1348 |
| 554 | Ga0466959_0165881 | 3300045049 | Bacteria | 1551 |
| 555 | Ga0466959_0405516 | 3300045049 | Bacteria | 926 |
| 556 | Ga0466959_1177486 | 3300045049 | Bacteria | 509 |
| 557 | Ga0466958_0984210 | 3300045836 | Bacteria | 550 |
| 558 | Ga0466967_0302347 | 3300045976 | Bacteria | 1539 |
| 559 | Ga0466967_0328329 | 3300045976 | Bacteria | 1477 |
| 560 | Ga0466967_0379381 | 3300045976 | Bacteria | 1372 |
| 561 | Ga0466967_1859959 | 3300045976 | Bacteria | 599 |
| 562 | Ga0495603_0693965 | 3300046455 | Bacteria | 582 |
| 563 | Ga0495629_0052144 | 3300046459 | Bacteria | 2863 |
| 564 | Ga0495638_0226492 | 3300046460 | Bacteria | 1042 |
| 565 | Ga0495653_0304560 | 3300046463 | Bacteria | 1038 |
| 566 | Ga0495650_0002418 | 3300046471 | Bacteria | 15184 |
| 567 | Ga0495650_0188459 | 3300046471 | Bacteria | 722 |
| 568 | Ga0495580_0002795 | 3300046472 | Bacteria | 15019 |
| 569 | Ga0495582_0268381 | 3300046473 | Bacteria | 979 |
| 570 | Ga0495582_0469021 | 3300046473 | Bacteria | 727 |
| 571 | Ga0495664_0079627 | 3300046477 | Bacteria | 1963 |
| 572 | Ga0495664_0163724 | 3300046477 | Bacteria | 1349 |
| 573 | Ga0495664_0177960 | 3300046477 | Bacteria | 1290 |
| 574 | Ga0495583_0042528 | 3300046506 | Bacteria | 2121 |
| 575 | Ga0495606_0050886 | 3300046507 | Bacteria | 2706 |
| 576 | Ga0495606_0057434 | 3300046507 | Bacteria | 2506 |
| 577 | Ga0495610_0001298 | 3300046512 | Bacteria | 22266 |
| 578 | Ga0495610_0004939 | 3300046512 | Bacteria | 9667 |
| 579 | Ga0495618_0243287 | 3300046514 | Bacteria | 1130 |
| 580 | Ga0495620_0039396 | 3300046515 | Bacteria | 2088 |
| 581 | Ga0495630_0342175 | 3300046517 | Bacteria | 1144 |
| 582 | Ga0495632_0000989 | 3300046519 | Bacteria | 24804 |
| 583 | Ga0495632_0005897 | 3300046519 | Bacteria | 7997 |
| 584 | Ga0495632_0233036 | 3300046519 | Unclassified | 830 |
| 585 | Ga0495643_0000217 | 3300046522 | Bacteria | 88279 |
| 586 | Ga0495643_0059132 | 3300046522 | Bacteria | 2038 |
| 587 | Ga0495643_0239338 | 3300046522 | Bacteria | 852 |
| 588 | Ga0495648_0123539 | 3300046524 | Bacteria | 1387 |
| 589 | Ga0495663_0000020 | 3300046525 | Bacteria | 124560 |
| 590 | Ga0495666_0304448 | 3300046526 | Bacteria | 720 |
| 591 | Ga0495642_0180344 | 3300046528 | Bacteria | 919 |
| 592 | Ga0495654_0035543 | 3300046530 | Bacteria | 2508 |
| 593 | Ga0495665_0033419 | 3300046531 | Bacteria | 2751 |
| 594 | Ga0495640_0032013 | 3300046533 | Bacteria | 3749 |
| 595 | Ga0495597_0176609 | 3300046542 | Bacteria | 865 |
| 596 | Ga0495645_0068373 | 3300046543 | Bacteria | 2564 |
| 597 | Ga0495633_0002856 | 3300046558 | Bacteria | 11862 |
| 598 | Ga0495633_0006780 | 3300046558 | Bacteria | 6722 |
| 599 | Ga0495667_0337242 | 3300046559 | Bacteria | 953 |
| 600 | Ga0495668_0072625 | 3300046616 | Bacteria | 1890 |
| 601 | Ga0495625_0028456 | 3300046660 | Bacteria | 4191 |
| 602 | Ga0495625_0198397 | 3300046660 | Bacteria | 1326 |
| 603 | Ga0495625_0474738 | 3300046660 | Bacteria | 769 |
| 604 | Ga0495635_0026497 | 3300046663 | Bacteria | 4033 |
| 605 | Ga0495599_0325152 | 3300046678 | Bacteria | 925 |
| 606 | Ga0495647_0345779 | 3300046681 | Bacteria | 676 |
| 607 | Ga0495658_0006493 | 3300046683 | Bacteria | 5745 |
| 608 | Ga0495613_0753613 | 3300046689 | Bacteria | 638 |
| 609 | Ga0495624_0335536 | 3300046690 | Bacteria | 910 |
| 610 | Ga0495670_0000033 | 3300046691 | Bacteria | 81716 |
| 611 | Ga0495670_0032461 | 3300046691 | Bacteria | 2597 |
| 612 | Ga0495670_0044328 | 3300046691 | Bacteria | 2221 |
| 613 | Ga0495670_0334791 | 3300046691 | Bacteria | 813 |
| 614 | Ga0495581_0736715 | 3300047315 | Bacteria | 567 |
| 615 | Ga0495674_0158783 | 3300047319 | Bacteria | 1893 |
| 616 | Ga0495676_0153977 | 3300047321 | Bacteria | 1633 |
| 617 | Ga0495683_0221725 | 3300047323 | Bacteria | 843 |
| 618 | Ga0495677_0042316 | 3300047445 | Bacteria | 1668 |
| 619 | Ga0495681_0001886 | 3300047470 | Bacteria | 15394 |
| 620 | Ga0495684_0037420 | 3300047471 | Bacteria | 3721 |
| 621 | Ga0495686_0000182 | 3300047472 | Bacteria | 119682 |
| 622 | Ga0495686_0001777 | 3300047472 | Bacteria | 21960 |
| 623 | Ga0495686_0002610 | 3300047472 | Bacteria | 16704 |
| 624 | Ga0495686_0156238 | 3300047472 | Bacteria | 1336 |
| 625 | Ga0495686_0157289 | 3300047472 | Bacteria | 1330 |
| 626 | Ga0495593_0182816 | 3300047673 | Bacteria | 1056 |
| 627 | Ga0495593_0208084 | 3300047673 | Bacteria | 982 |
| 628 | Ga0495593_0602236 | 3300047673 | Bacteria | 552 |
| 629 | Ga0496100_0028246 | 3300048903 | Bacteria | 3458 |
| 630 | Ga0496100_0068809 | 3300048903 | Bacteria | 2356 |
| 631 | Ga0496100_0198944 | 3300048903 | Bacteria | 1459 |
| 632 | Ga0496100_0435705 | 3300048903 | Bacteria | 1003 |
| 633 | Ga0496101_0077983 | 3300048904 | Bacteria | 2442 |
| 634 | Ga0496101_0617338 | 3300048904 | Bacteria | 857 |
| 635 | Ga0496102_0001012 | 3300048905 | Bacteria | 26288 |
| 636 | Ga0496102_0150581 | 3300048905 | Bacteria | 2186 |
| 637 | Ga0496102_0969020 | 3300048905 | Bacteria | 771 |
| 638 | Ga0496103_0000246 | 3300048906 | Bacteria | 52692 |
| 639 | Ga0496103_0227163 | 3300048906 | Bacteria | 1200 |
| 640 | Ga0496103_0639758 | 3300048906 | Bacteria | 676 |
| 641 | Ga0496103_0818047 | 3300048906 | Bacteria | 587 |
| 642 | Ga0496104_0000227 | 3300048907 | Bacteria | 49451 |
| 643 | Ga0496105_0000158 | 3300048908 | Bacteria | 44955 |
| 644 | Ga0496106_0521103 | 3300048909 | Bacteria | 954 |
| 645 | Ga0496107_0112102 | 3300048910 | Bacteria | 2005 |
| 646 | Ga0496107_0229831 | 3300048910 | Bacteria | 1380 |
| 647 | Ga0496108_0002299 | 3300048911 | Bacteria | 15309 |
| 648 | Ga0496108_0350757 | 3300048911 | Bacteria | 1288 |
| 649 | Ga0496112_0002829 | 3300048915 | Bacteria | 14089 |
| 650 | Ga0496112_0380285 | 3300048915 | Bacteria | 1353 |
| 651 | Ga0496113_0000325 | 3300048916 | Bacteria | 22755 |
| 652 | Ga0496115_1021277 | 3300048918 | Bacteria | 631 |
| 653 | Ga0496116_0021850 | 3300048919 | Bacteria | 4813 |
| 654 | Ga0496116_0034688 | 3300048919 | Bacteria | 3555 |
| 655 | Ga0496116_0078456 | 3300048919 | Bacteria | 2059 |
| 656 | Ga0496116_0331149 | 3300048919 | Bacteria | 707 |
| 657 | Ga0496116_0400782 | 3300048919 | Bacteria | 607 |
| 658 | Ga0496117_0005510 | 3300048920 | Bacteria | 13257 |
| 659 | Ga0496117_0030787 | 3300048920 | Bacteria | 4109 |
| 660 | Ga0496117_0073876 | 3300048920 | Bacteria | 2273 |
| 661 | Ga0496117_0525765 | 3300048920 | Bacteria | 568 |
| 662 | Ga0496117_0611950 | 3300048920 | Bacteria | 508 |
| 663 | Ga0496118_0002103 | 3300048921 | Bacteria | 27954 |
| 664 | Ga0496118_0020790 | 3300048921 | Bacteria | 5809 |
| 665 | Ga0496118_0048902 | 3300048921 | Bacteria | 3261 |
| 666 | Ga0496118_0055157 | 3300048921 | Bacteria | 3002 |
| 667 | Ga0496118_0084326 | 3300048921 | Bacteria | 2217 |
| 668 | Ga0496118_0106434 | 3300048921 | Bacteria | 1876 |
| 669 | Ga0496118_0322036 | 3300048921 | Bacteria | 838 |
| 670 | Ga0496119_0000040 | 3300048922 | Bacteria | 208180 |
| 671 | Ga0496119_0015177 | 3300048922 | Bacteria | 5960 |
| 672 | Ga0496119_0020742 | 3300048922 | Bacteria | 4775 |
| 673 | Ga0496119_0026083 | 3300048922 | Bacteria | 4062 |
| 674 | Ga0496119_0171639 | 3300048922 | Bacteria | 1145 |
| 675 | Ga0496119_0174071 | 3300048922 | Bacteria | 1134 |
| 676 | Ga0496120_0000731 | 3300048923 | Bacteria | 48124 |
| 677 | Ga0496120_0016388 | 3300048923 | Bacteria | 4843 |
| 678 | Ga0496120_0147763 | 3300048923 | Bacteria | 1185 |
| 679 | Ga0496120_0187439 | 3300048923 | Bacteria | 1011 |
| 680 | Ga0496121_0000123 | 3300048924 | Bacteria | 172448 |
| 681 | Ga0496121_0004891 | 3300048924 | Bacteria | 17582 |
| 682 | Ga0496121_0007534 | 3300048924 | Bacteria | 13124 |
| 683 | Ga0496121_0039007 | 3300048924 | Bacteria | 4194 |
| 684 | Ga0496121_0072125 | 3300048924 | Bacteria | 2773 |
| 685 | Ga0496121_0091767 | 3300048924 | Bacteria | 2370 |
| 686 | Ga0496121_0095250 | 3300048924 | Bacteria | 2314 |
| 687 | Ga0496122_0002442 | 3300048925 | Bacteria | 26362 |
| 688 | Ga0496122_0003506 | 3300048925 | Bacteria | 20608 |
| 689 | Ga0496122_0141145 | 3300048925 | Bacteria | 1507 |
| 690 | Ga0496123_0001478 | 3300048926 | Bacteria | 32621 |
| 691 | Ga0496123_0004521 | 3300048926 | Bacteria | 14538 |
| 692 | Ga0496123_0294850 | 3300048926 | Bacteria | 777 |
| 693 | Ga0496124_0004810 | 3300048927 | Bacteria | 15546 |
| 694 | Ga0496124_0026551 | 3300048927 | Bacteria | 5219 |
| 695 | Ga0496124_0069946 | 3300048927 | Bacteria | 2912 |
| 696 | Ga0496124_0179411 | 3300048927 | Bacteria | 1631 |
| 697 | Ga0496124_0314881 | 3300048927 | Bacteria | 1123 |
| 698 | Ga0496124_0419387 | 3300048927 | Bacteria | 923 |
| 699 | Ga0496125_0000205 | 3300048928 | Bacteria | 124391 |
| 700 | Ga0496125_0006420 | 3300048928 | Bacteria | 12709 |
| 701 | Ga0496125_0009566 | 3300048928 | Bacteria | 9931 |
| 702 | Ga0496125_0017019 | 3300048928 | Bacteria | 6950 |
| 703 | Ga0496125_0051422 | 3300048928 | Bacteria | 3398 |
| 704 | Ga0496125_0060959 | 3300048928 | Bacteria | 3029 |
| 705 | Ga0496125_0147758 | 3300048928 | Bacteria | 1621 |
| 706 | Ga0496125_0148995 | 3300048928 | Bacteria | 1611 |
| 707 | Ga0496125_0260140 | 3300048928 | Bacteria | 1088 |
| 708 | Ga0496125_0270452 | 3300048928 | Bacteria | 1059 |
| 709 | Ga0496125_0333183 | 3300048928 | Bacteria | 914 |
| 710 | Ga0496125_0380740 | 3300048928 | Bacteria | 832 |
| 711 | Ga0496125_0428620 | 3300048928 | Bacteria | 764 |
| 712 | Ga0496126_0000044 | 3300048929 | Bacteria | 335904 |
| 713 | Ga0496126_0046438 | 3300048929 | Bacteria | 3983 |
| 714 | Ga0496126_0071283 | 3300048929 | Bacteria | 3093 |
| 715 | Ga0496126_0081674 | 3300048929 | Bacteria | 2857 |
| 716 | Ga0496126_0280298 | 3300048929 | Bacteria | 1381 |
| 717 | Ga0496126_0295856 | 3300048929 | Bacteria | 1337 |
| 718 | Ga0496126_0363117 | 3300048929 | Bacteria | 1182 |
| 719 | Ga0496126_0839145 | 3300048929 | Bacteria | 702 |
| 720 | Ga0501033_0096538 | 3300049570 | Bacteria | 2160 |
| 721 | Ga0501034_0074018 | 3300049571 | Bacteria | 3415 |
| 722 | Ga0501036_0207523 | 3300049572 | Bacteria | 1647 |
| 723 | Ga0501039_0052158 | 3300049575 | Bacteria | 3165 |
| 724 | Ga0501040_1440739 | 3300049576 | Bacteria | 500 |
| 725 | Ga0501041_0068976 | 3300049577 | Bacteria | 2168 |
| 726 | Ga0501042_0233453 | 3300049578 | Bacteria | 1327 |
| 727 | Ga0501042_0378532 | 3300049578 | Bacteria | 1025 |
| 728 | Ga0501043_1202228 | 3300049579 | Bacteria | 532 |
| 729 | Ga0501046_0350514 | 3300049580 | Bacteria | 1072 |
| 730 | Ga0501047_0044436 | 3300049581 | Bacteria | 4292 |
| 731 | Ga0501047_0257298 | 3300049581 | Bacteria | 1594 |
| 732 | Ga0501047_0846180 | 3300049581 | Bacteria | 729 |
| 733 | Ga0501048_0000652 | 3300049582 | Bacteria | 24980 |
| 734 | Ga0501070_0012367 | 3300049586 | Bacteria | 7199 |
| 735 | Ga0501074_0393242 | 3300049590 | Bacteria | 983 |
| 736 | Ga0501075_0151211 | 3300049591 | Bacteria | 1769 |
| 737 | Ga0501077_0210483 | 3300049593 | Bacteria | 1235 |
| 738 | Ga0501224_010896 | 3300049664 | Bacteria | 1335 |
| 739 | Ga0501079_0056414 | 3300049741 | Bacteria | 3031 |
| 740 | Ga0501080_0591613 | 3300049742 | Bacteria | 985 |
| 741 | Ga0501081_0043910 | 3300049743 | Bacteria | 3067 |
| 742 | Ga0501081_0104227 | 3300049743 | Bacteria | 2008 |
| 743 | Ga0501083_0890265 | 3300049744 | Bacteria | 579 |
| 744 | Ga0501035_0629207 | 3300049822 | Bacteria | 872 |
| 745 | Ga0501044_0463473 | 3300049823 | Bacteria | 1172 |
| 746 | Ga0501044_1021603 | 3300049823 | Bacteria | 698 |
| 747 | Ga0501045_0533993 | 3300049824 | Bacteria | 870 |
| 748 | nmdc:mga0yw44_152970_c1 | 3300050492 | Bacteria | 1506 |
| 749 | nmdc:mga0yw44_7389_c1 | 3300050492 | Bacteria | 5402 |
| 750 | nmdc:mga07m45_852321_c1 | 3300050496 | Bacteria | 522 |
| 751 | nmdc:mga07m45_895112_c1 | 3300050496 | Bacteria | 508 |
| 752 | nmdc:mga05p37_1186373_c1 | 3300050507 | Bacteria | 790 |
| 753 | nmdc:mga09592_59967_c1 | 3300050508 | Bacteria | 3217 |
| 754 | nmdc:mga0qj67_11371_c1 | 3300050509 | Bacteria | 6669 |
| 755 | nmdc:mga0qj67_676320_c1 | 3300050509 | Bacteria | 822 |
| 756 | nmdc:mga06r32_142172_c1 | 3300050510 | Bacteria | 2377 |
| 757 | nmdc:mga0sz30_75519_c1 | 3300050516 | Bacteria | 1454 |
| 758 | Ga0495601_0067983 | 3300053077 | Bacteria | 2270 |
| 759 | Ga0495601_0227859 | 3300053077 | Bacteria | 1217 |
| 760 | Ga0495612_0033254 | 3300053078 | Bacteria | 2086 |
| 761 | Ga0495612_0253370 | 3300053078 | Bacteria | 783 |
| 762 | Ga0495655_0298167 | 3300053083 | Bacteria | 553 |
| 763 | Ga0495619_0393005 | 3300053085 | Bacteria | 958 |
| 764 | Ga0495619_0679261 | 3300053085 | Bacteria | 701 |
| 765 | Ga0500578_0197257 | 3300053086 | Bacteria | 1233 |
| 766 | Ga0500643_002186 | 3300053087 | Bacteria | 10330 |
| 767 | Ga0500644_0141251 | 3300053088 | Bacteria | 957 |
| 768 | Ga0500644_0160254 | 3300053088 | Bacteria | 909 |
| 769 | Ga0500646_0055461 | 3300053090 | Bacteria | 1154 |
| 770 | Ga0500647_0225328 | 3300053091 | Bacteria | 837 |
| 771 | Ga0500647_0280580 | 3300053091 | Bacteria | 720 |
| 772 | Ga0500647_0340996 | 3300053091 | Bacteria | 627 |
| 773 | Ga0500583_0245709 | 3300053092 | Bacteria | 884 |
| 774 | Ga0500583_0320631 | 3300053092 | Bacteria | 755 |
| 775 | Ga0500651_0018767 | 3300053093 | Bacteria | 4284 |
| 776 | Ga0500651_0687012 | 3300053093 | Unclassified | 548 |
| 777 | Ga0500641_0013594 | 3300053096 | Bacteria | 2992 |
| 778 | Ga0500556_0004926 | 3300053104 | Bacteria | 3781 |
| 779 | Ga0500556_0136344 | 3300053104 | Bacteria | 963 |
| 780 | Ga0500562_022490 | 3300053108 | Bacteria | 1643 |
| 781 | Ga0500562_063979 | 3300053108 | Bacteria | 990 |
| 782 | Ga0500591_037645 | 3300053115 | Bacteria | 2316 |
| 783 | Ga0500592_058894 | 3300053116 | Bacteria | 627 |
| 784 | Ga0500594_0006551 | 3300053118 | Bacteria | 2620 |
| 785 | Ga0500594_0318946 | 3300053118 | Bacteria | 522 |
| 786 | Ga0500595_001175 | 3300053119 | Bacteria | 14475 |
| 787 | Ga0500595_103422 | 3300053119 | Bacteria | 814 |
| 788 | Ga0500608_000128 | 3300053122 | Bacteria | 30980 |
| 789 | Ga0500658_0302080 | 3300053134 | Unclassified | 736 |
| 790 | Ga0500559_0008678 | 3300053136 | Bacteria | 4441 |
| 791 | Ga0500559_0148768 | 3300053136 | Bacteria | 1098 |
| 792 | Ga0500564_001139 | 3300053138 | Bacteria | 8860 |
| 793 | Ga0500568_0001898 | 3300053139 | Bacteria | 12852 |
| 794 | Ga0500573_0159684 | 3300053140 | Bacteria | 1228 |
| 795 | Ga0500573_0217348 | 3300053140 | Bacteria | 1005 |
| 796 | Ga0500603_010373 | 3300053150 | Bacteria | 2103 |
| 797 | Ga0500604_0055717 | 3300053151 | Bacteria | 1230 |
| 798 | Ga0500616_0010388 | 3300053153 | Bacteria | 5573 |
| 799 | Ga0500616_0061287 | 3300053153 | Bacteria | 1948 |
| 800 | Ga0500622_0040507 | 3300053156 | Bacteria | 2425 |
| 801 | Ga0500627_0000031 | 3300053158 | Bacteria | 90831 |
| 802 | Ga0500627_0081936 | 3300053158 | Bacteria | 1439 |
| 803 | Ga0500639_110383 | 3300053163 | Bacteria | 1339 |
| 804 | Ga0500636_0179420 | 3300053177 | Bacteria | 1138 |
| 805 | Ga0500567_002483 | 3300053723 | Bacteria | 7930 |
| 806 | Ga0500611_123954 | 3300053727 | Bacteria | 691 |
| 807 | Ga0500625_000051 | 3300053729 | Bacteria | 24610 |
| 808 | Ga0500645_000234 | 3300053730 | Bacteria | 41931 |
| 809 | Ga0500645_054265 | 3300053730 | Bacteria | 1166 |
| 810 | Ga0500601_004546 | 3300053737 | Bacteria | 1513 |
| 811 | Ga0501084_1119772 | 3300054114 | Bacteria | 661 |
| 812 | Ga0500661_005233 | 3300055283 | Bacteria | 2427 |
| 813 | Ga0500661_111799 | 3300055283 | Bacteria | 524 |
| 814 | Ga0590077_066733 | 3300059426 | Bacteria | 819 |
| 815 | Ga0530510_0345981 | 3300061734 | Bacteria | 1116 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005356 | Ga0070674_100187164 | Ga0070674_1001871642 | 112 |
| 2 | 3300005456 | Ga0070678_100085495 | Ga0070678_1000854952 | 112 |
| 3 | 3300005440 | Ga0070705_100079104 | Ga0070705_1000791042 | 117 |
| 4 | 3300005546 | Ga0070696_100013131 | Ga0070696_1000131314 | 117 |
| 5 | 3300005549 | Ga0070704_100046524 | Ga0070704_1000465244 | 117 |
| 6 | 3300005844 | Ga0068862_100255458 | Ga0068862_1002554582 | 117 |
| 7 | 3300009553 | Ga0105249_10016560 | Ga0105249_100165603 | 117 |
| 8 | 3300025961 | Ga0207712_10008807 | Ga0207712_100088074 | 117 |
| 9 | 3300028380 | Ga0268265_11506436 | Ga0268265_115064362 | 117 |
| 10 | 3300054114 | Ga0501084_1119772 | Ga0501084_1119772_262_615 | 117 |
| 11 | 3300005456 | Ga0070678_101377533 | Ga0070678_1013775331 | 118 |
| 12 | 3300031235 | Ga0265330_10067230 | Ga0265330_100672302 | 118 |
| 13 | 3300031239 | Ga0265328_10302791 | Ga0265328_103027912 | 118 |
| 14 | 3300031247 | Ga0265340_10017095 | Ga0265340_100170952 | 118 |
| 15 | 3300031249 | Ga0265339_10002135 | Ga0265339_1000213510 | 118 |
| 16 | 3300031344 | Ga0265316_10018719 | Ga0265316_100187197 | 118 |
| 17 | 3300031595 | Ga0265313_10005700 | Ga0265313_1000570010 | 118 |
| 18 | 3300031712 | Ga0265342_10006876 | Ga0265342_100068762 | 118 |
| 19 | 3300031824 | Ga0307413_12198305 | Ga0307413_121983051 | 118 |
| 20 | 3300049571 | Ga0501034_0074018 | Ga0501034_0074018_1488_1844 | 118 |
| 21 | 3300049572 | Ga0501036_0207523 | Ga0501036_0207523_552_908 | 118 |
| 22 | 3300049576 | Ga0501040_1440739 | Ga0501040_1440739_89_445 | 118 |
| 23 | 3300049577 | Ga0501041_0068976 | Ga0501041_0068976_1778_2134 | 118 |
| 24 | 3300049578 | Ga0501042_0233453 | Ga0501042_0233453_697_1053 | 118 |
| 25 | 3300049591 | Ga0501075_0151211 | Ga0501075_0151211_658_1014 | 118 |
| 26 | 3300049741 | Ga0501079_0056414 | Ga0501079_0056414_1088_1444 | 118 |
| 27 | 3300049743 | Ga0501081_0104227 | Ga0501081_0104227_744_1100 | 118 |
| 28 | 3300049822 | Ga0501035_0629207 | Ga0501035_0629207_313_669 | 118 |
| 29 | 3300049824 | Ga0501045_0533993 | Ga0501045_0533993_352_708 | 118 |
| 30 | 3300061734 | Ga0530510_0345981 | Ga0530510_0345981_360_716 | 118 |
| 31 | 3300005290 | Ga0065712_10452270 | Ga0065712_104522701 | 119 |
| 32 | 3300005290 | Ga0065712_10679218 | Ga0065712_106792181 | 119 |
| 33 | 3300005328 | Ga0070676_10046758 | Ga0070676_100467583 | 119 |
| 34 | 3300005334 | Ga0068869_101432346 | Ga0068869_1014323461 | 119 |
| 35 | 3300005343 | Ga0070687_100854571 | Ga0070687_1008545712 | 119 |
| 36 | 3300005347 | Ga0070668_100903627 | Ga0070668_1009036271 | 119 |
| 37 | 3300005356 | Ga0070674_100607304 | Ga0070674_1006073042 | 119 |
| 38 | 3300005367 | Ga0070667_100897979 | Ga0070667_1008979792 | 119 |
| 39 | 3300005441 | Ga0070700_100004668 | Ga0070700_1000046688 | 119 |
| 40 | 3300005468 | Ga0070707_100019597 | Ga0070707_1000195972 | 119 |
| 41 | 3300005518 | Ga0070699_100827470 | Ga0070699_1008274702 | 119 |
| 42 | 3300005530 | Ga0070679_101786375 | Ga0070679_1017863751 | 119 |
| 43 | 3300005536 | Ga0070697_100728931 | Ga0070697_1007289311 | 119 |
| 44 | 3300005539 | Ga0068853_100439152 | Ga0068853_1004391523 | 119 |
| 45 | 3300005545 | Ga0070695_100003309 | Ga0070695_1000033091 | 119 |
| 46 | 3300005548 | Ga0070665_100523629 | Ga0070665_1005236292 | 119 |
| 47 | 3300005577 | Ga0068857_101205282 | Ga0068857_1012052822 | 119 |
| 48 | 3300005615 | Ga0070702_101305134 | Ga0070702_1013051341 | 119 |
| 49 | 3300005719 | Ga0068861_100105602 | Ga0068861_1001056021 | 119 |
| 50 | 3300005719 | Ga0068861_100743177 | Ga0068861_1007431772 | 119 |
| 51 | 3300005843 | Ga0068860_100453064 | Ga0068860_1004530641 | 119 |
| 52 | 3300005843 | Ga0068860_102693611 | Ga0068860_1026936112 | 119 |
| 53 | 3300005844 | Ga0068862_100140692 | Ga0068862_1001406924 | 119 |
| 54 | 3300005844 | Ga0068862_101516253 | Ga0068862_1015162532 | 119 |
| 55 | 3300005937 | Ga0081455_10000028 | Ga0081455_1000002894 | 119 |
| 56 | 3300006048 | Ga0075363_100099126 | Ga0075363_1000991263 | 119 |
| 57 | 3300006177 | Ga0075362_10366830 | Ga0075362_103668302 | 119 |
| 58 | 3300006178 | Ga0075367_10419691 | Ga0075367_104196912 | 119 |
| 59 | 3300006844 | Ga0075428_100118734 | Ga0075428_1001187343 | 119 |
| 60 | 3300006844 | Ga0075428_100761957 | Ga0075428_1007619572 | 119 |
| 61 | 3300006846 | Ga0075430_100023915 | Ga0075430_1000239156 | 119 |
| 62 | 3300006847 | Ga0075431_100045525 | Ga0075431_1000455252 | 119 |
| 63 | 3300006852 | Ga0075433_10880284 | Ga0075433_108802842 | 119 |
| 64 | 3300006852 | Ga0075433_11097806 | Ga0075433_110978062 | 119 |
| 65 | 3300006880 | Ga0075429_100178803 | Ga0075429_1001788033 | 119 |
| 66 | 3300009093 | Ga0105240_12066597 | Ga0105240_120665972 | 119 |
| 67 | 3300009148 | Ga0105243_10221031 | Ga0105243_102210313 | 119 |
| 68 | 3300009176 | Ga0105242_10940489 | Ga0105242_109404892 | 119 |
| 69 | 3300009177 | Ga0105248_12128578 | Ga0105248_121285781 | 119 |
| 70 | 3300009551 | Ga0105238_10247466 | Ga0105238_102474662 | 119 |
| 71 | 3300013104 | Ga0157370_10437857 | Ga0157370_104378572 | 119 |
| 72 | 3300014326 | Ga0157380_10008850 | Ga0157380_100088506 | 119 |
| 73 | 3300014326 | Ga0157380_10269866 | Ga0157380_102698662 | 119 |
| 74 | 3300014968 | Ga0157379_10959339 | Ga0157379_109593391 | 119 |
| 75 | 3300050507 | nmdc:mga05p37_1186373_c1 | nmdc:mga05p37_1186373_c1_16_393 | 119 |
| 76 | 3300050508 | nmdc:mga09592_59967_c1 | nmdc:mga09592_59967_c1_1394_1771 | 119 |
| 77 | 3300050509 | nmdc:mga0qj67_11371_c1 | nmdc:mga0qj67_11371_c1_2894_3271 | 119 |
| 78 | 3300050510 | nmdc:mga06r32_142172_c1 | nmdc:mga06r32_142172_c1_722_1099 | 119 |
| 79 | 3300003163 | Ga0006759J45824_1076213 | Ga0006759J45824_10762131 | 120 |
| 80 | 3300003308 | Ga0006777J48905_1008095 | Ga0006777J48905_10080952 | 120 |
| 81 | 3300003577 | Ga0007416J51690_1070775 | Ga0007416J51690_10707751 | 120 |
| 82 | 3300003579 | Ga0007429J51699_1004743 | Ga0007429J51699_10047432 | 120 |
| 83 | 3300005518 | Ga0070699_100777744 | Ga0070699_1007777442 | 120 |
| 84 | 3300005546 | Ga0070696_100364406 | Ga0070696_1003644062 | 120 |
| 85 | 3300005983 | Ga0081540_1146814 | Ga0081540_11468142 | 120 |
| 86 | 3300006844 | Ga0075428_100629506 | Ga0075428_1006295062 | 120 |
| 87 | 3300009174 | Ga0105241_11380320 | Ga0105241_113803202 | 120 |
| 88 | 3300025297 | Ga0209758_1000005 | Ga0209758_1000005947 | 120 |
| 89 | 3300025297 | Ga0209758_1016463 | Ga0209758_10164632 | 120 |
| 90 | 3300025919 | Ga0207657_10209412 | Ga0207657_102094121 | 120 |
| 91 | 3300028786 | Ga0307517_10111281 | Ga0307517_101112813 | 120 |
| 92 | 3300031456 | Ga0307513_10040717 | Ga0307513_100407173 | 120 |
| 93 | 3300031852 | Ga0307410_10599532 | Ga0307410_105995322 | 120 |
| 94 | 3300031852 | Ga0307410_11527634 | Ga0307410_115276341 | 120 |
| 95 | 3300031901 | Ga0307406_10130544 | Ga0307406_101305441 | 120 |
| 96 | 3300048927 | Ga0496124_0069946 | Ga0496124_0069946_1544_1906 | 120 |
| 97 | 3300049578 | Ga0501042_0378532 | Ga0501042_0378532_97_459 | 120 |
| 98 | 3300049744 | Ga0501083_0890265 | Ga0501083_0890265_50_412 | 120 |
| 99 | 3300053086 | Ga0500578_0197257 | Ga0500578_0197257_273_635 | 120 |
| 100 | 3300053088 | Ga0500644_0160254 | Ga0500644_0160254_487_849 | 120 |
| 101 | 3300053092 | Ga0500583_0245709 | Ga0500583_0245709_435_797 | 120 |
| 102 | 3300053093 | Ga0500651_0018767 | Ga0500651_0018767_993_1355 | 120 |
| 103 | 3300059426 | Ga0590077_066733 | Ga0590077_066733_287_652 | 120 |
| 104 | 3300003579 | Ga0007429J51699_1114894 | Ga0007429J51699_11148942 | 121 |
| 105 | 3300005330 | Ga0070690_100061564 | Ga0070690_1000615642 | 121 |
| 106 | 3300005435 | Ga0070714_100014682 | Ga0070714_1000146823 | 121 |
| 107 | 3300005435 | Ga0070714_100449290 | Ga0070714_1004492902 | 121 |
| 108 | 3300005436 | Ga0070713_100063091 | Ga0070713_1000630914 | 121 |
| 109 | 3300005436 | Ga0070713_100070335 | Ga0070713_1000703354 | 121 |
| 110 | 3300006028 | Ga0070717_10109011 | Ga0070717_101090113 | 121 |
| 111 | 3300006175 | Ga0070712_100181203 | Ga0070712_1001812032 | 121 |
| 112 | 3300006186 | Ga0075369_10079358 | Ga0075369_100793583 | 121 |
| 113 | 3300009093 | Ga0105240_10344568 | Ga0105240_103445683 | 121 |
| 114 | 3300021361 | Ga0213872_10061338 | Ga0213872_100613382 | 121 |
| 115 | 3300025906 | Ga0207699_10065501 | Ga0207699_100655012 | 121 |
| 116 | 3300025912 | Ga0207707_10071401 | Ga0207707_100714013 | 121 |
| 117 | 3300025915 | Ga0207693_10126768 | Ga0207693_101267683 | 121 |
| 118 | 3300025928 | Ga0207700_10030799 | Ga0207700_100307994 | 121 |
| 119 | 3300025928 | Ga0207700_10256606 | Ga0207700_102566062 | 121 |
| 120 | 3300025929 | Ga0207664_10131807 | Ga0207664_101318073 | 121 |
| 121 | 3300025986 | Ga0207658_10771279 | Ga0207658_107712791 | 121 |
| 122 | 3300028381 | Ga0268264_10064855 | Ga0268264_100648552 | 121 |
| 123 | 3300035692 | Ga0373935_0101394 | Ga0373935_0101394_1383_1748 | 121 |
| 124 | 3300039447 | Ga0436361_0067631 | Ga0436361_0067631_37133_37498 | 121 |
| 125 | 3300039447 | Ga0436361_0659391 | Ga0436361_0659391_497_862 | 121 |
| 126 | 3300039447 | Ga0436361_0670518 | Ga0436361_0670518_2407_2772 | 121 |
| 127 | 3300039447 | Ga0436361_0867004 | Ga0436361_0867004_8351_8716 | 121 |
| 128 | 3300039447 | Ga0436361_1181218 | Ga0436361_1181218_434_799 | 121 |
| 129 | 3300044694 | Ga0466963_0511134 | Ga0466963_0511134_259_624 | 121 |
| 130 | 3300045049 | Ga0466959_0405516 | Ga0466959_0405516_361_726 | 121 |
| 131 | 3300045836 | Ga0466958_0984210 | Ga0466958_0984210_59_424 | 121 |
| 132 | 3300048911 | Ga0496108_0002299 | Ga0496108_0002299_12269_12634 | 121 |
| 133 | 3300048919 | Ga0496116_0034688 | Ga0496116_0034688_2122_2487 | 121 |
| 134 | 3300048925 | Ga0496122_0141145 | Ga0496122_0141145_324_689 | 121 |
| 135 | 3300048926 | Ga0496123_0294850 | Ga0496123_0294850_24_389 | 121 |
| 136 | 3300048928 | Ga0496125_0051422 | Ga0496125_0051422_421_786 | 121 |
| 137 | 3300049570 | Ga0501033_0096538 | Ga0501033_0096538_1347_1712 | 121 |
| 138 | 3300049579 | Ga0501043_1202228 | Ga0501043_1202228_151_516 | 121 |
| 139 | 3300049593 | Ga0501077_0210483 | Ga0501077_0210483_589_954 | 121 |
| 140 | 3300049743 | Ga0501081_0043910 | Ga0501081_0043910_905_1270 | 121 |
| 141 | 3300049823 | Ga0501044_1021603 | Ga0501044_1021603_188_553 | 121 |
| 142 | 3300038742 | Ga0400486_12864 | Ga0400486_12864_930_1298 | 122 |
| 143 | 3300039438 | Ga0436360_0458992 | Ga0436360_0458992_387_755 | 122 |
| 144 | 3300039453 | Ga0436362_0217235 | Ga0436362_0217235_93_461 | 122 |
| 145 | 3300050516 | nmdc:mga0sz30_75519_c1 | nmdc:mga0sz30_75519_c1_442_810 | 122 |
| 146 | 2162886007 | SwRhRL2b_contig_2144200 | SwRhRL2b_0221.00003450 | 123 |
| 147 | 3300002774 | JGI25150J39212_1000368 | JGI25150J39212_100036819 | 123 |
| 148 | 3300003187 | JGI25151J46595_10070633 | JGI25151J46595_100706332 | 123 |
| 149 | 3300003215 | JGI25153J46596_10000512 | JGI25153J46596_1000051213 | 123 |
| 150 | 3300003763 | Ga0055529_1018251 | Ga0055529_10182511 | 123 |
| 151 | 3300003773 | Ga0055537_1002263 | Ga0055537_100226310 | 123 |
| 152 | 3300003773 | Ga0055537_1004290 | Ga0055537_10042901 | 123 |
| 153 | 3300003781 | Ga0055536_1006517 | Ga0055536_10065175 | 123 |
| 154 | 3300003781 | Ga0055536_1007944 | Ga0055536_10079444 | 123 |
| 155 | 3300003791 | Ga0055530_10000013 | Ga0055530_1000001340 | 123 |
| 156 | 3300003791 | Ga0055530_10050136 | Ga0055530_100501363 | 123 |
| 157 | 3300003794 | Ga0055531_10000792 | Ga0055531_100007924 | 123 |
| 158 | 3300003794 | Ga0055531_10006790 | Ga0055531_100067905 | 123 |
| 159 | 3300003794 | Ga0055531_10010629 | Ga0055531_100106294 | 123 |
| 160 | 3300005262 | Ga0065165_1004494 | Ga0065165_10044949 | 123 |
| 161 | 3300005262 | Ga0065165_1072659 | Ga0065165_10726592 | 123 |
| 162 | 3300005289 | Ga0065704_10070230 | Ga0065704_100702303 | 123 |
| 163 | 3300005335 | Ga0070666_10067868 | Ga0070666_100678682 | 123 |
| 164 | 3300005335 | Ga0070666_10472965 | Ga0070666_104729652 | 123 |
| 165 | 3300005336 | Ga0070680_100175739 | Ga0070680_1001757392 | 123 |
| 166 | 3300005336 | Ga0070680_100195803 | Ga0070680_1001958031 | 123 |
| 167 | 3300005337 | Ga0070682_100090750 | Ga0070682_1000907502 | 123 |
| 168 | 3300005338 | Ga0068868_100049983 | Ga0068868_1000499833 | 123 |
| 169 | 3300005339 | Ga0070660_101092502 | Ga0070660_1010925022 | 123 |
| 170 | 3300005341 | Ga0070691_10106883 | Ga0070691_101068833 | 123 |
| 171 | 3300005344 | Ga0070661_100615352 | Ga0070661_1006153522 | 123 |
| 172 | 3300005347 | Ga0070668_100024056 | Ga0070668_1000240567 | 123 |
| 173 | 3300005347 | Ga0070668_100390240 | Ga0070668_1003902402 | 123 |
| 174 | 3300005347 | Ga0070668_100473182 | Ga0070668_1004731822 | 123 |
| 175 | 3300005353 | Ga0070669_100001396 | Ga0070669_1000013965 | 123 |
| 176 | 3300005353 | Ga0070669_100011083 | Ga0070669_1000110836 | 123 |
| 177 | 3300005353 | Ga0070669_100442699 | Ga0070669_1004426992 | 123 |
| 178 | 3300005355 | Ga0070671_100029627 | Ga0070671_1000296274 | 123 |
| 179 | 3300005355 | Ga0070671_100045828 | Ga0070671_1000458284 | 123 |
| 180 | 3300005364 | Ga0070673_100911838 | Ga0070673_1009118382 | 123 |
| 181 | 3300005367 | Ga0070667_100001289 | Ga0070667_10000128914 | 123 |
| 182 | 3300005367 | Ga0070667_100019541 | Ga0070667_1000195414 | 123 |
| 183 | 3300005367 | Ga0070667_100069757 | Ga0070667_1000697572 | 123 |
| 184 | 3300005434 | Ga0070709_10001423 | Ga0070709_100014238 | 123 |
| 185 | 3300005434 | Ga0070709_10208027 | Ga0070709_102080272 | 123 |
| 186 | 3300005435 | Ga0070714_100127032 | Ga0070714_1001270323 | 123 |
| 187 | 3300005435 | Ga0070714_100208010 | Ga0070714_1002080102 | 123 |
| 188 | 3300005436 | Ga0070713_100005847 | Ga0070713_1000058474 | 123 |
| 189 | 3300005436 | Ga0070713_100007642 | Ga0070713_1000076424 | 123 |
| 190 | 3300005437 | Ga0070710_10002139 | Ga0070710_100021394 | 123 |
| 191 | 3300005437 | Ga0070710_10034735 | Ga0070710_100347353 | 123 |
| 192 | 3300005439 | Ga0070711_100018016 | Ga0070711_1000180162 | 123 |
| 193 | 3300005439 | Ga0070711_100036221 | Ga0070711_1000362213 | 123 |
| 194 | 3300005439 | Ga0070711_100623857 | Ga0070711_1006238571 | 123 |
| 195 | 3300005455 | Ga0070663_100006533 | Ga0070663_1000065332 | 123 |
| 196 | 3300005455 | Ga0070663_100261983 | Ga0070663_1002619832 | 123 |
| 197 | 3300005455 | Ga0070663_102106566 | Ga0070663_1021065661 | 123 |
| 198 | 3300005458 | Ga0070681_10498576 | Ga0070681_104985762 | 123 |
| 199 | 3300005467 | Ga0070706_100003670 | Ga0070706_10000367011 | 123 |
| 200 | 3300005468 | Ga0070707_100673140 | Ga0070707_1006731402 | 123 |
| 201 | 3300005471 | Ga0070698_100008160 | Ga0070698_1000081602 | 123 |
| 202 | 3300005518 | Ga0070699_100001192 | Ga0070699_10000119210 | 123 |
| 203 | 3300005530 | Ga0070679_100752268 | Ga0070679_1007522682 | 123 |
| 204 | 3300005536 | Ga0070697_100235244 | Ga0070697_1002352441 | 123 |
| 205 | 3300005539 | Ga0068853_100306409 | Ga0068853_1003064092 | 123 |
| 206 | 3300005539 | Ga0068853_100443121 | Ga0068853_1004431212 | 123 |
| 207 | 3300005539 | Ga0068853_100629588 | Ga0068853_1006295882 | 123 |
| 208 | 3300005547 | Ga0070693_100286104 | Ga0070693_1002861042 | 123 |
| 209 | 3300005547 | Ga0070693_100555303 | Ga0070693_1005553031 | 123 |
| 210 | 3300005548 | Ga0070665_100000107 | Ga0070665_10000010746 | 123 |
| 211 | 3300005548 | Ga0070665_100061489 | Ga0070665_1000614893 | 123 |
| 212 | 3300005548 | Ga0070665_100352307 | Ga0070665_1003523072 | 123 |
| 213 | 3300005548 | Ga0070665_102201547 | Ga0070665_1022015472 | 123 |
| 214 | 3300005563 | Ga0068855_100067138 | Ga0068855_1000671382 | 123 |
| 215 | 3300005563 | Ga0068855_100381920 | Ga0068855_1003819202 | 123 |
| 216 | 3300005563 | Ga0068855_100850588 | Ga0068855_1008505882 | 123 |
| 217 | 3300005564 | Ga0070664_100604535 | Ga0070664_1006045352 | 123 |
| 218 | 3300005577 | Ga0068857_100057015 | Ga0068857_1000570153 | 123 |
| 219 | 3300005577 | Ga0068857_100493001 | Ga0068857_1004930012 | 123 |
| 220 | 3300005614 | Ga0068856_100341046 | Ga0068856_1003410462 | 123 |
| 221 | 3300005614 | Ga0068856_101438266 | Ga0068856_1014382662 | 123 |
| 222 | 3300005616 | Ga0068852_100252052 | Ga0068852_1002520522 | 123 |
| 223 | 3300005616 | Ga0068852_100319614 | Ga0068852_1003196142 | 123 |
| 224 | 3300005617 | Ga0068859_100132951 | Ga0068859_1001329513 | 123 |
| 225 | 3300005617 | Ga0068859_100810810 | Ga0068859_1008108102 | 123 |
| 226 | 3300005617 | Ga0068859_100915497 | Ga0068859_1009154972 | 123 |
| 227 | 3300005617 | Ga0068859_101161340 | Ga0068859_1011613402 | 123 |
| 228 | 3300005618 | Ga0068864_100153684 | Ga0068864_1001536842 | 123 |
| 229 | 3300005719 | Ga0068861_100062658 | Ga0068861_1000626582 | 123 |
| 230 | 3300005841 | Ga0068863_100369401 | Ga0068863_1003694012 | 123 |
| 231 | 3300005841 | Ga0068863_100418005 | Ga0068863_1004180052 | 123 |
| 232 | 3300005841 | Ga0068863_100508869 | Ga0068863_1005088692 | 123 |
| 233 | 3300005842 | Ga0068858_100000191 | Ga0068858_10000019124 | 123 |
| 234 | 3300005842 | Ga0068858_100193011 | Ga0068858_1001930112 | 123 |
| 235 | 3300005842 | Ga0068858_100218585 | Ga0068858_1002185851 | 123 |
| 236 | 3300005842 | Ga0068858_100586328 | Ga0068858_1005863282 | 123 |
| 237 | 3300005842 | Ga0068858_100685177 | Ga0068858_1006851772 | 123 |
| 238 | 3300005842 | Ga0068858_101741671 | Ga0068858_1017416712 | 123 |
| 239 | 3300005843 | Ga0068860_100004803 | Ga0068860_10000480313 | 123 |
| 240 | 3300005843 | Ga0068860_100086315 | Ga0068860_1000863153 | 123 |
| 241 | 3300005843 | Ga0068860_101078900 | Ga0068860_1010789002 | 123 |
| 242 | 3300005844 | Ga0068862_100008499 | Ga0068862_10000849910 | 123 |
| 243 | 3300005844 | Ga0068862_100313131 | Ga0068862_1003131312 | 123 |
| 244 | 3300005985 | Ga0081539_10004186 | Ga0081539_100041862 | 123 |
| 245 | 3300006028 | Ga0070717_10215566 | Ga0070717_102155663 | 123 |
| 246 | 3300006038 | Ga0075365_10010971 | Ga0075365_100109718 | 123 |
| 247 | 3300006163 | Ga0070715_10101757 | Ga0070715_101017571 | 123 |
| 248 | 3300006173 | Ga0070716_100007382 | Ga0070716_1000073822 | 123 |
| 249 | 3300006173 | Ga0070716_100160910 | Ga0070716_1001609101 | 123 |
| 250 | 3300006173 | Ga0070716_101238386 | Ga0070716_1012383861 | 123 |
| 251 | 3300006173 | Ga0070716_101635204 | Ga0070716_1016352041 | 123 |
| 252 | 3300006175 | Ga0070712_100069079 | Ga0070712_1000690793 | 123 |
| 253 | 3300006175 | Ga0070712_100086611 | Ga0070712_1000866112 | 123 |
| 254 | 3300006237 | Ga0097621_100581405 | Ga0097621_1005814051 | 123 |
| 255 | 3300006237 | Ga0097621_100698468 | Ga0097621_1006984682 | 123 |
| 256 | 3300006353 | Ga0075370_10616697 | Ga0075370_106166971 | 123 |
| 257 | 3300006353 | Ga0075370_10987169 | Ga0075370_109871691 | 123 |
| 258 | 3300006358 | Ga0068871_100909268 | Ga0068871_1009092682 | 123 |
| 259 | 3300006358 | Ga0068871_100963154 | Ga0068871_1009631541 | 123 |
| 260 | 3300006358 | Ga0068871_101045841 | Ga0068871_1010458412 | 123 |
| 261 | 3300006881 | Ga0068865_100799318 | Ga0068865_1007993182 | 123 |
| 262 | 3300006931 | Ga0097620_100132952 | Ga0097620_1001329522 | 123 |
| 263 | 3300006931 | Ga0097620_100810798 | Ga0097620_1008107982 | 123 |
| 264 | 3300006931 | Ga0097620_100915335 | Ga0097620_1009153352 | 123 |
| 265 | 3300006946 | Ga0079104_1004974 | Ga0079104_10049743 | 123 |
| 266 | 3300009011 | Ga0105251_10002928 | Ga0105251_100029282 | 123 |
| 267 | 3300009093 | Ga0105240_10071684 | Ga0105240_100716845 | 123 |
| 268 | 3300009093 | Ga0105240_10266334 | Ga0105240_102663342 | 123 |
| 269 | 3300009093 | Ga0105240_10313742 | Ga0105240_103137422 | 123 |
| 270 | 3300009093 | Ga0105240_10866579 | Ga0105240_108665791 | 123 |
| 271 | 3300009093 | Ga0105240_12595983 | Ga0105240_125959831 | 123 |
| 272 | 3300009098 | Ga0105245_10038965 | Ga0105245_100389652 | 123 |
| 273 | 3300009101 | Ga0105247_10042030 | Ga0105247_100420302 | 123 |
| 274 | 3300009101 | Ga0105247_10091810 | Ga0105247_100918102 | 123 |
| 275 | 3300009174 | Ga0105241_10511434 | Ga0105241_105114342 | 123 |
| 276 | 3300009174 | Ga0105241_10977529 | Ga0105241_109775291 | 123 |
| 277 | 3300009176 | Ga0105242_10235724 | Ga0105242_102357242 | 123 |
| 278 | 3300009176 | Ga0105242_12430828 | Ga0105242_124308281 | 123 |
| 279 | 3300009177 | Ga0105248_10009594 | Ga0105248_100095943 | 123 |
| 280 | 3300009177 | Ga0105248_10128534 | Ga0105248_101285343 | 123 |
| 281 | 3300009177 | Ga0105248_10840293 | Ga0105248_108402932 | 123 |
| 282 | 3300009545 | Ga0105237_10042034 | Ga0105237_100420342 | 123 |
| 283 | 3300009545 | Ga0105237_10126238 | Ga0105237_101262385 | 123 |
| 284 | 3300009545 | Ga0105237_10174659 | Ga0105237_101746592 | 123 |
| 285 | 3300009545 | Ga0105237_10184617 | Ga0105237_101846172 | 123 |
| 286 | 3300009545 | Ga0105237_10257587 | Ga0105237_102575872 | 123 |
| 287 | 3300009545 | Ga0105237_10532929 | Ga0105237_105329292 | 123 |
| 288 | 3300009545 | Ga0105237_10684654 | Ga0105237_106846542 | 123 |
| 289 | 3300009551 | Ga0105238_10028484 | Ga0105238_100284843 | 123 |
| 290 | 3300009551 | Ga0105238_10051155 | Ga0105238_100511552 | 123 |
| 291 | 3300009551 | Ga0105238_10074351 | Ga0105238_100743513 | 123 |
| 292 | 3300009551 | Ga0105238_10184388 | Ga0105238_101843882 | 123 |
| 293 | 3300009551 | Ga0105238_10563976 | Ga0105238_105639762 | 123 |
| 294 | 3300009551 | Ga0105238_10595445 | Ga0105238_105954452 | 123 |
| 295 | 3300009551 | Ga0105238_12399678 | Ga0105238_123996781 | 123 |
| 296 | 3300009553 | Ga0105249_10035426 | Ga0105249_100354263 | 123 |
| 297 | 3300009553 | Ga0105249_11263752 | Ga0105249_112637522 | 123 |
| 298 | 3300009553 | Ga0105249_12913368 | Ga0105249_129133682 | 123 |
| 299 | 3300010375 | Ga0105239_10057650 | Ga0105239_100576503 | 123 |
| 300 | 3300010375 | Ga0105239_10297273 | Ga0105239_102972732 | 123 |
| 301 | 3300010375 | Ga0105239_10492090 | Ga0105239_104920902 | 123 |
| 302 | 3300010375 | Ga0105239_11243597 | Ga0105239_112435971 | 123 |
| 303 | 3300011119 | Ga0105246_10159677 | Ga0105246_101596772 | 123 |
| 304 | 3300011119 | Ga0105246_11116964 | Ga0105246_111169642 | 123 |
| 305 | 3300013105 | Ga0157369_10221063 | Ga0157369_102210632 | 123 |
| 306 | 3300013296 | Ga0157374_10217701 | Ga0157374_102177012 | 123 |
| 307 | 3300013296 | Ga0157374_10425174 | Ga0157374_104251742 | 123 |
| 308 | 3300013306 | Ga0163162_10311412 | Ga0163162_103114122 | 123 |
| 309 | 3300013307 | Ga0157372_10244458 | Ga0157372_102444582 | 123 |
| 310 | 3300014325 | Ga0163163_10073713 | Ga0163163_100737132 | 123 |
| 311 | 3300014968 | Ga0157379_10062199 | Ga0157379_100621993 | 123 |
| 312 | 3300014968 | Ga0157379_10377527 | Ga0157379_103775272 | 123 |
| 313 | 3300014969 | Ga0157376_10546009 | Ga0157376_105460092 | 123 |
| 314 | 3300017792 | Ga0163161_10022467 | Ga0163161_100224673 | 123 |
| 315 | 3300017792 | Ga0163161_10249882 | Ga0163161_102498822 | 123 |
| 316 | 3300017792 | Ga0163161_10542000 | Ga0163161_105420002 | 123 |
| 317 | 3300020082 | Ga0206353_10448061 | Ga0206353_104480612 | 123 |
| 318 | 3300020610 | Ga0154015_1344946 | Ga0154015_13449462 | 123 |
| 319 | 3300021358 | Ga0213873_10013896 | Ga0213873_100138963 | 123 |
| 320 | 3300021361 | Ga0213872_10000119 | Ga0213872_1000011959 | 123 |
| 321 | 3300021361 | Ga0213872_10000660 | Ga0213872_1000066016 | 123 |
| 322 | 3300021361 | Ga0213872_10002314 | Ga0213872_100023149 | 123 |
| 323 | 3300021361 | Ga0213872_10003898 | Ga0213872_100038989 | 123 |
| 324 | 3300021361 | Ga0213872_10032146 | Ga0213872_100321463 | 123 |
| 325 | 3300021361 | Ga0213872_10095690 | Ga0213872_100956902 | 123 |
| 326 | 3300021361 | Ga0213872_10156638 | Ga0213872_101566382 | 123 |
| 327 | 3300021377 | Ga0213874_10145920 | Ga0213874_101459201 | 123 |
| 328 | 3300021384 | Ga0213876_10008226 | Ga0213876_100082265 | 123 |
| 329 | 3300021384 | Ga0213876_10161123 | Ga0213876_101611231 | 123 |
| 330 | 3300021441 | Ga0213871_10014922 | Ga0213871_100149222 | 123 |
| 331 | 3300025233 | Ga0209437_101642 | Ga0209437_1016423 | 123 |
| 332 | 3300025245 | Ga0207425_1000461 | Ga0207425_100046119 | 123 |
| 333 | 3300025245 | Ga0207425_1088317 | Ga0207425_10883171 | 123 |
| 334 | 3300025253 | Ga0209677_101787 | Ga0209677_1017873 | 123 |
| 335 | 3300025254 | Ga0209148_1008207 | Ga0209148_10082072 | 123 |
| 336 | 3300025254 | Ga0209148_1022875 | Ga0209148_10228752 | 123 |
| 337 | 3300025258 | Ga0209129_1000327 | Ga0209129_100032719 | 123 |
| 338 | 3300025261 | Ga0209233_1000044 | Ga0209233_100004435 | 123 |
| 339 | 3300025261 | Ga0209233_1003858 | Ga0209233_10038581 | 123 |
| 340 | 3300025263 | Ga0209565_1000052 | Ga0209565_1000052123 | 123 |
| 341 | 3300025263 | Ga0209565_1028698 | Ga0209565_10286981 | 123 |
| 342 | 3300025272 | Ga0209455_1009381 | Ga0209455_10093811 | 123 |
| 343 | 3300025272 | Ga0209455_1010385 | Ga0209455_10103852 | 123 |
| 344 | 3300025273 | Ga0209673_1015739 | Ga0209673_10157392 | 123 |
| 345 | 3300025291 | Ga0209675_1000025 | Ga0209675_100002522 | 123 |
| 346 | 3300025292 | Ga0209676_1000221 | Ga0209676_100022140 | 123 |
| 347 | 3300025292 | Ga0209676_1000228 | Ga0209676_100022880 | 123 |
| 348 | 3300025292 | Ga0209676_1002468 | Ga0209676_10024683 | 123 |
| 349 | 3300025292 | Ga0209676_1078273 | Ga0209676_10782732 | 123 |
| 350 | 3300025294 | Ga0209025_1001791 | Ga0209025_10017914 | 123 |
| 351 | 3300025294 | Ga0209025_1035515 | Ga0209025_10355152 | 123 |
| 352 | 3300025295 | Ga0209564_1009372 | Ga0209564_10093724 | 123 |
| 353 | 3300025295 | Ga0209564_1013638 | Ga0209564_10136383 | 123 |
| 354 | 3300025297 | Ga0209758_1000002 | Ga0209758_1000002421 | 123 |
| 355 | 3300025297 | Ga0209758_1000017 | Ga0209758_1000017283 | 123 |
| 356 | 3300025297 | Ga0209758_1028594 | Ga0209758_10285942 | 123 |
| 357 | 3300025298 | Ga0209050_1000001 | Ga0209050_1000001364 | 123 |
| 358 | 3300025298 | Ga0209050_1000042 | Ga0209050_1000042347 | 123 |
| 359 | 3300025298 | Ga0209050_1000071 | Ga0209050_100007122 | 123 |
| 360 | 3300025298 | Ga0209050_1001886 | Ga0209050_10018867 | 123 |
| 361 | 3300025298 | Ga0209050_1015417 | Ga0209050_10154174 | 123 |
| 362 | 3300025298 | Ga0209050_1029003 | Ga0209050_10290032 | 123 |
| 363 | 3300025302 | Ga0207426_1011633 | Ga0207426_10116335 | 123 |
| 364 | 3300025302 | Ga0207426_1105283 | Ga0207426_11052832 | 123 |
| 365 | 3300025303 | Ga0209051_1000297 | Ga0209051_100029770 | 123 |
| 366 | 3300025304 | Ga0209257_1000027 | Ga0209257_1000027281 | 123 |
| 367 | 3300025304 | Ga0209257_1000135 | Ga0209257_100013540 | 123 |
| 368 | 3300025304 | Ga0209257_1000229 | Ga0209257_100022938 | 123 |
| 369 | 3300025304 | Ga0209257_1001829 | Ga0209257_100182910 | 123 |
| 370 | 3300025304 | Ga0209257_1001894 | Ga0209257_100189412 | 123 |
| 371 | 3300025304 | Ga0209257_1003342 | Ga0209257_100334214 | 123 |
| 372 | 3300025735 | Ga0207713_1004263 | Ga0207713_10042638 | 123 |
| 373 | 3300025735 | Ga0207713_1033482 | Ga0207713_10334822 | 123 |
| 374 | 3300025898 | Ga0207692_10043937 | Ga0207692_100439372 | 123 |
| 375 | 3300025898 | Ga0207692_10083142 | Ga0207692_100831422 | 123 |
| 376 | 3300025900 | Ga0207710_10684554 | Ga0207710_106845542 | 123 |
| 377 | 3300025903 | Ga0207680_10071427 | Ga0207680_100714273 | 123 |
| 378 | 3300025903 | Ga0207680_10138961 | Ga0207680_101389612 | 123 |
| 379 | 3300025903 | Ga0207680_10203491 | Ga0207680_102034912 | 123 |
| 380 | 3300025905 | Ga0207685_10028613 | Ga0207685_100286133 | 123 |
| 381 | 3300025905 | Ga0207685_10655604 | Ga0207685_106556042 | 123 |
| 382 | 3300025906 | Ga0207699_10010077 | Ga0207699_100100775 | 123 |
| 383 | 3300025906 | Ga0207699_11266092 | Ga0207699_112660921 | 123 |
| 384 | 3300025909 | Ga0207705_11032903 | Ga0207705_110329031 | 123 |
| 385 | 3300025912 | Ga0207707_10002658 | Ga0207707_100026583 | 123 |
| 386 | 3300025912 | Ga0207707_10144774 | Ga0207707_101447742 | 123 |
| 387 | 3300025913 | Ga0207695_10538634 | Ga0207695_105386341 | 123 |
| 388 | 3300025913 | Ga0207695_11670869 | Ga0207695_116708692 | 123 |
| 389 | 3300025914 | Ga0207671_10067180 | Ga0207671_100671804 | 123 |
| 390 | 3300025914 | Ga0207671_10168284 | Ga0207671_101682842 | 123 |
| 391 | 3300025914 | Ga0207671_10475594 | Ga0207671_104755943 | 123 |
| 392 | 3300025914 | Ga0207671_10509367 | Ga0207671_105093672 | 123 |
| 393 | 3300025914 | Ga0207671_11461016 | Ga0207671_114610161 | 123 |
| 394 | 3300025915 | Ga0207693_10098570 | Ga0207693_100985703 | 123 |
| 395 | 3300025915 | Ga0207693_10109179 | Ga0207693_101091792 | 123 |
| 396 | 3300025915 | Ga0207693_10117782 | Ga0207693_101177823 | 123 |
| 397 | 3300025915 | Ga0207693_10200851 | Ga0207693_102008511 | 123 |
| 398 | 3300025916 | Ga0207663_10011331 | Ga0207663_100113315 | 123 |
| 399 | 3300025916 | Ga0207663_10036387 | Ga0207663_100363873 | 123 |
| 400 | 3300025917 | Ga0207660_10244669 | Ga0207660_102446692 | 123 |
| 401 | 3300025919 | Ga0207657_10834300 | Ga0207657_108343002 | 123 |
| 402 | 3300025921 | Ga0207652_10280822 | Ga0207652_102808222 | 123 |
| 403 | 3300025923 | Ga0207681_10000336 | Ga0207681_1000033627 | 123 |
| 404 | 3300025923 | Ga0207681_10001866 | Ga0207681_100018667 | 123 |
| 405 | 3300025924 | Ga0207694_10015844 | Ga0207694_100158443 | 123 |
| 406 | 3300025924 | Ga0207694_10046214 | Ga0207694_100462142 | 123 |
| 407 | 3300025924 | Ga0207694_10293096 | Ga0207694_102930962 | 123 |
| 408 | 3300025924 | Ga0207694_10547196 | Ga0207694_105471962 | 123 |
| 409 | 3300025924 | Ga0207694_10782955 | Ga0207694_107829552 | 123 |
| 410 | 3300025924 | Ga0207694_11403348 | Ga0207694_114033481 | 123 |
| 411 | 3300025925 | Ga0207650_10045454 | Ga0207650_100454542 | 123 |
| 412 | 3300025927 | Ga0207687_10012572 | Ga0207687_100125727 | 123 |
| 413 | 3300025928 | Ga0207700_10022828 | Ga0207700_100228284 | 123 |
| 414 | 3300025928 | Ga0207700_10027564 | Ga0207700_100275644 | 123 |
| 415 | 3300025929 | Ga0207664_10045578 | Ga0207664_100455782 | 123 |
| 416 | 3300025929 | Ga0207664_10119582 | Ga0207664_101195823 | 123 |
| 417 | 3300025931 | Ga0207644_10001624 | Ga0207644_1000162416 | 123 |
| 418 | 3300025931 | Ga0207644_10296244 | Ga0207644_102962443 | 123 |
| 419 | 3300025931 | Ga0207644_10712744 | Ga0207644_107127442 | 123 |
| 420 | 3300025939 | Ga0207665_10000976 | Ga0207665_100009768 | 123 |
| 421 | 3300025939 | Ga0207665_10160349 | Ga0207665_101603493 | 123 |
| 422 | 3300025939 | Ga0207665_10976579 | Ga0207665_109765792 | 123 |
| 423 | 3300025941 | Ga0207711_10028200 | Ga0207711_100282004 | 123 |
| 424 | 3300025941 | Ga0207711_10314840 | Ga0207711_103148402 | 123 |
| 425 | 3300025941 | Ga0207711_10700835 | Ga0207711_107008351 | 123 |
| 426 | 3300025944 | Ga0207661_10258099 | Ga0207661_102580992 | 123 |
| 427 | 3300025944 | Ga0207661_10475759 | Ga0207661_104757593 | 123 |
| 428 | 3300025944 | Ga0207661_10934771 | Ga0207661_109347712 | 123 |
| 429 | 3300025945 | Ga0207679_10751363 | Ga0207679_107513631 | 123 |
| 430 | 3300025949 | Ga0207667_10634414 | Ga0207667_106344142 | 123 |
| 431 | 3300025961 | Ga0207712_10067851 | Ga0207712_100678512 | 123 |
| 432 | 3300025961 | Ga0207712_10207620 | Ga0207712_102076202 | 123 |
| 433 | 3300025961 | Ga0207712_11536900 | Ga0207712_115369002 | 123 |
| 434 | 3300025972 | Ga0207668_10010776 | Ga0207668_100107764 | 123 |
| 435 | 3300025972 | Ga0207668_10013861 | Ga0207668_100138617 | 123 |
| 436 | 3300025972 | Ga0207668_10184044 | Ga0207668_101840443 | 123 |
| 437 | 3300025972 | Ga0207668_10592281 | Ga0207668_105922812 | 123 |
| 438 | 3300025972 | Ga0207668_10818030 | Ga0207668_108180302 | 123 |
| 439 | 3300025981 | Ga0207640_10085705 | Ga0207640_100857053 | 123 |
| 440 | 3300025981 | Ga0207640_10183096 | Ga0207640_101830962 | 123 |
| 441 | 3300025986 | Ga0207658_10001483 | Ga0207658_1000148313 | 123 |
| 442 | 3300025986 | Ga0207658_10034488 | Ga0207658_100344882 | 123 |
| 443 | 3300025986 | Ga0207658_10123356 | Ga0207658_101233562 | 123 |
| 444 | 3300026023 | Ga0207677_10248166 | Ga0207677_102481661 | 123 |
| 445 | 3300026035 | Ga0207703_10007705 | Ga0207703_100077055 | 123 |
| 446 | 3300026035 | Ga0207703_10188703 | Ga0207703_101887033 | 123 |
| 447 | 3300026035 | Ga0207703_10592531 | Ga0207703_105925312 | 123 |
| 448 | 3300026035 | Ga0207703_12265253 | Ga0207703_122652531 | 123 |
| 449 | 3300026041 | Ga0207639_10075641 | Ga0207639_100756412 | 123 |
| 450 | 3300026041 | Ga0207639_10211713 | Ga0207639_102117133 | 123 |
| 451 | 3300026041 | Ga0207639_10388792 | Ga0207639_103887921 | 123 |
| 452 | 3300026041 | Ga0207639_10446323 | Ga0207639_104463232 | 123 |
| 453 | 3300026041 | Ga0207639_10560160 | Ga0207639_105601601 | 123 |
| 454 | 3300026067 | Ga0207678_10014682 | Ga0207678_100146828 | 123 |
| 455 | 3300026067 | Ga0207678_10176765 | Ga0207678_101767652 | 123 |
| 456 | 3300026078 | Ga0207702_10920852 | Ga0207702_109208522 | 123 |
| 457 | 3300026078 | Ga0207702_12063245 | Ga0207702_120632451 | 123 |
| 458 | 3300026088 | Ga0207641_10000078 | Ga0207641_10000078115 | 123 |
| 459 | 3300026088 | Ga0207641_10494114 | Ga0207641_104941142 | 123 |
| 460 | 3300026095 | Ga0207676_10000420 | Ga0207676_1000042010 | 123 |
| 461 | 3300026095 | Ga0207676_10128799 | Ga0207676_101287992 | 123 |
| 462 | 3300026095 | Ga0207676_10295353 | Ga0207676_102953532 | 123 |
| 463 | 3300026116 | Ga0207674_10072137 | Ga0207674_100721373 | 123 |
| 464 | 3300026116 | Ga0207674_10504362 | Ga0207674_105043622 | 123 |
| 465 | 3300026118 | Ga0207675_100190919 | Ga0207675_1001909192 | 123 |
| 466 | 3300026142 | Ga0207698_10467043 | Ga0207698_104670432 | 123 |
| 467 | 3300026142 | Ga0207698_11112089 | Ga0207698_111120891 | 123 |
| 468 | 3300027111 | Ga0209281_1010983 | Ga0209281_10109832 | 123 |
| 469 | 3300028379 | Ga0268266_10000462 | Ga0268266_1000046219 | 123 |
| 470 | 3300028379 | Ga0268266_10177980 | Ga0268266_101779801 | 123 |
| 471 | 3300028379 | Ga0268266_10197593 | Ga0268266_101975933 | 123 |
| 472 | 3300028379 | Ga0268266_10228388 | Ga0268266_102283883 | 123 |
| 473 | 3300028380 | Ga0268265_10624763 | Ga0268265_106247632 | 123 |
| 474 | 3300028381 | Ga0268264_10000380 | Ga0268264_1000038035 | 123 |
| 475 | 3300028381 | Ga0268264_10013595 | Ga0268264_100135957 | 123 |
| 476 | 3300028381 | Ga0268264_11092426 | Ga0268264_110924262 | 123 |
| 477 | 3300028381 | Ga0268264_11893108 | Ga0268264_118931082 | 123 |
| 478 | 3300028556 | Ga0265337_1026672 | Ga0265337_10266721 | 123 |
| 479 | 3300028558 | Ga0265326_10006199 | Ga0265326_100061992 | 123 |
| 480 | 3300028563 | Ga0265319_1019753 | Ga0265319_10197532 | 123 |
| 481 | 3300028573 | Ga0265334_10096688 | Ga0265334_100966882 | 123 |
| 482 | 3300028577 | Ga0265318_10062097 | Ga0265318_100620972 | 123 |
| 483 | 3300028653 | Ga0265323_10002721 | Ga0265323_100027214 | 123 |
| 484 | 3300028666 | Ga0265336_10000661 | Ga0265336_1000066115 | 123 |
| 485 | 3300028786 | Ga0307517_10332500 | Ga0307517_103325002 | 123 |
| 486 | 3300028800 | Ga0265338_10004433 | Ga0265338_1000443315 | 123 |
| 487 | 3300029957 | Ga0265324_10003042 | Ga0265324_100030424 | 123 |
| 488 | 3300030521 | Ga0307511_10078058 | Ga0307511_100780583 | 123 |
| 489 | 3300030733 | Ga0314311_1103907 | Ga0314311_11039073 | 123 |
| 490 | 3300031727 | Ga0316576_10009408 | Ga0316576_100094086 | 123 |
| 491 | 3300031824 | Ga0307413_10379862 | Ga0307413_103798622 | 123 |
| 492 | 3300031901 | Ga0307406_10379585 | Ga0307406_103795852 | 123 |
| 493 | 3300031901 | Ga0307406_10814546 | Ga0307406_108145462 | 123 |
| 494 | 3300032002 | Ga0307416_100924604 | Ga0307416_1009246042 | 123 |
| 495 | 3300032002 | Ga0307416_103599957 | Ga0307416_1035999571 | 123 |
| 496 | 3300032004 | Ga0307414_10018906 | Ga0307414_100189063 | 123 |
| 497 | 3300032004 | Ga0307414_10370884 | Ga0307414_103708842 | 123 |
| 498 | 3300032004 | Ga0307414_10686162 | Ga0307414_106861621 | 123 |
| 499 | 3300032004 | Ga0307414_11039439 | Ga0307414_110394391 | 123 |
| 500 | 3300032005 | Ga0307411_10242061 | Ga0307411_102420611 | 123 |
| 501 | 3300032005 | Ga0307411_10814350 | Ga0307411_108143502 | 123 |
| 502 | 3300032005 | Ga0307411_10930565 | Ga0307411_109305651 | 123 |
| 503 | 3300033180 | Ga0307510_10001188 | Ga0307510_1000118816 | 123 |
| 504 | 3300033180 | Ga0307510_10009411 | Ga0307510_1000941112 | 123 |
| 505 | 3300033541 | Ga0316596_1024383 | Ga0316596_10243833 | 123 |
| 506 | 3300035111 | Ga0373923_0099251 | Ga0373923_0099251_881_1252 | 123 |
| 507 | 3300035113 | Ga0373936_0034305 | Ga0373936_0034305_1171_1542 | 123 |
| 508 | 3300035113 | Ga0373936_0038214 | Ga0373936_0038214_1307_1678 | 123 |
| 509 | 3300035116 | Ga0373945_0157692 | Ga0373945_0157692_526_897 | 123 |
| 510 | 3300035118 | Ga0373954_0044080 | Ga0373954_0044080_764_1135 | 123 |
| 511 | 3300035119 | Ga0373956_0010743 | Ga0373956_0010743_292_663 | 123 |
| 512 | 3300035170 | Ga0373943_0031224 | Ga0373943_0031224_1922_2293 | 123 |
| 513 | 3300035171 | Ga0373946_0330395 | Ga0373946_0330395_58_429 | 123 |
| 514 | 3300035172 | Ga0373955_0078991 | Ga0373955_0078991_193_564 | 123 |
| 515 | 3300035410 | Ga0373924_0389448 | Ga0373924_0389448_21_392 | 123 |
| 516 | 3300035691 | Ga0373931_0676333 | Ga0373931_0676333_38_409 | 123 |
| 517 | 3300035692 | Ga0373935_0036452 | Ga0373935_0036452_880_1251 | 123 |
| 518 | 3300035692 | Ga0373935_0410667 | Ga0373935_0410667_179_550 | 123 |
| 519 | 3300035695 | Ga0373927_0071440 | Ga0373927_0071440_968_1339 | 123 |
| 520 | 3300035695 | Ga0373927_0141393 | Ga0373927_0141393_1061_1432 | 123 |
| 521 | 3300035695 | Ga0373927_0744352 | Ga0373927_0744352_175_546 | 123 |
| 522 | 3300035724 | Ga0373933_0018114 | Ga0373933_0018114_1895_2266 | 123 |
| 523 | 3300035725 | Ga0373947_0263042 | Ga0373947_0263042_668_1039 | 123 |
| 524 | 3300036401 | Ga0373937_0183822 | Ga0373937_0183822_573_944 | 123 |
| 525 | 3300036401 | Ga0373937_0214072 | Ga0373937_0214072_203_574 | 123 |
| 526 | 3300036459 | Ga0372808_033289 | Ga0372808_033289_269_640 | 123 |
| 527 | 3300037068 | Ga0373925_0089108 | Ga0373925_0089108_182_553 | 123 |
| 528 | 3300037068 | Ga0373925_0116422 | Ga0373925_0116422_353_724 | 123 |
| 529 | 3300037068 | Ga0373925_0152205 | Ga0373925_0152205_654_1025 | 123 |
| 530 | 3300037312 | Ga0395899_0038201 | Ga0395899_0038201_834_1205 | 123 |
| 531 | 3300037418 | Ga0395900_0074422 | Ga0395900_0074422_570_941 | 123 |
| 532 | 3300037418 | Ga0395900_0111866 | Ga0395900_0111866_2222_2593 | 123 |
| 533 | 3300037466 | Ga0395898_0087501 | Ga0395898_0087501_2488_2859 | 123 |
| 534 | 3300037471 | Ga0395905_0127369 | Ga0395905_0127369_1660_2031 | 123 |
| 535 | 3300037471 | Ga0395905_0818640 | Ga0395905_0818640_230_601 | 123 |
| 536 | 3300037853 | Ga0436364_0701650 | Ga0436364_0701650_3532_3903 | 123 |
| 537 | 3300038443 | Ga0395901_0008255 | Ga0395901_0008255_7325_7696 | 123 |
| 538 | 3300038443 | Ga0395901_1059370 | Ga0395901_1059370_12_383 | 123 |
| 539 | 3300038443 | Ga0395901_1847133 | Ga0395901_1847133_117_488 | 123 |
| 540 | 3300039437 | Ga0436365_0815982 | Ga0436365_0815982_577_996 | 123 |
| 541 | 3300039437 | Ga0436365_1095754 | Ga0436365_1095754_4791_5162 | 123 |
| 542 | 3300039437 | Ga0436365_1707348 | Ga0436365_1707348_909_1280 | 123 |
| 543 | 3300039438 | Ga0436360_0630509 | Ga0436360_0630509_153_524 | 123 |
| 544 | 3300039438 | Ga0436360_0813945 | Ga0436360_0813945_1368_1739 | 123 |
| 545 | 3300039438 | Ga0436360_1300343 | Ga0436360_1300343_431_844 | 123 |
| 546 | 3300039447 | Ga0436361_0033458 | Ga0436361_0033458_143_523 | 123 |
| 547 | 3300039447 | Ga0436361_0080624 | Ga0436361_0080624_585_956 | 123 |
| 548 | 3300039447 | Ga0436361_0120999 | Ga0436361_0120999_4985_5356 | 123 |
| 549 | 3300039447 | Ga0436361_0193989 | Ga0436361_0193989_364_735 | 123 |
| 550 | 3300039447 | Ga0436361_0229583 | Ga0436361_0229583_554_925 | 123 |
| 551 | 3300039447 | Ga0436361_0241172 | Ga0436361_0241172_1432_1803 | 123 |
| 552 | 3300039447 | Ga0436361_0419875 | Ga0436361_0419875_65_436 | 123 |
| 553 | 3300039447 | Ga0436361_0430273 | Ga0436361_0430273_252_623 | 123 |
| 554 | 3300039447 | Ga0436361_0543398 | Ga0436361_0543398_501_872 | 123 |
| 555 | 3300039447 | Ga0436361_0660497 | Ga0436361_0660497_507_878 | 123 |
| 556 | 3300039447 | Ga0436361_0969043 | Ga0436361_0969043_252_623 | 123 |
| 557 | 3300039447 | Ga0436361_1115532 | Ga0436361_1115532_1352_1723 | 123 |
| 558 | 3300039447 | Ga0436361_1168992 | Ga0436361_1168992_336_707 | 123 |
| 559 | 3300039447 | Ga0436361_1193675 | Ga0436361_1193675_179_643 | 123 |
| 560 | 3300039450 | Ga0436363_0004057 | Ga0436363_0004057_293_664 | 123 |
| 561 | 3300039450 | Ga0436363_0243146 | Ga0436363_0243146_207_578 | 123 |
| 562 | 3300039450 | Ga0436363_0368964 | Ga0436363_0368964_2383_2754 | 123 |
| 563 | 3300039450 | Ga0436363_0592501 | Ga0436363_0592501_120_491 | 123 |
| 564 | 3300039450 | Ga0436363_0641523 | Ga0436363_0641523_374_745 | 123 |
| 565 | 3300039450 | Ga0436363_1385665 | Ga0436363_1385665_565_936 | 123 |
| 566 | 3300039453 | Ga0436362_0143304 | Ga0436362_0143304_1494_1865 | 123 |
| 567 | 3300039453 | Ga0436362_0616710 | Ga0436362_0616710_104_475 | 123 |
| 568 | 3300041410 | Ga0439461_0000157 | Ga0439461_0000157_2533_2904 | 123 |
| 569 | 3300041411 | Ga0439466_0099166 | Ga0439466_0099166_120_491 | 123 |
| 570 | 3300041413 | Ga0439465_0001520 | Ga0439465_0001520_4968_5339 | 123 |
| 571 | 3300041452 | Ga0451793_1167052 | Ga0451793_1167052_140_511 | 123 |
| 572 | 3300041459 | Ga0451800_0210168 | Ga0451800_0210168_94_465 | 123 |
| 573 | 3300041462 | Ga0451806_017109 | Ga0451806_017109_631_1002 | 123 |
| 574 | 3300041486 | Ga0451807_1376495 | Ga0451807_1376495_762_1133 | 123 |
| 575 | 3300041491 | Ga0451833_0151526 | Ga0451833_0151526_422_796 | 123 |
| 576 | 3300041501 | Ga0451845_0678984 | Ga0451845_0678984_586_957 | 123 |
| 577 | 3300041503 | Ga0451847_0607255 | Ga0451847_0607255_242_613 | 123 |
| 578 | 3300041509 | Ga0451843_0743624 | Ga0451843_0743624_55_429 | 123 |
| 579 | 3300041512 | Ga0451853_0787389 | Ga0451853_0787389_990_1361 | 123 |
| 580 | 3300041512 | Ga0451853_2451500 | Ga0451853_2451500_340_711 | 123 |
| 581 | 3300041997 | Ga0439431_0000015 | Ga0439431_0000015_21968_22339 | 123 |
| 582 | 3300042002 | Ga0439442_001146 | Ga0439442_001146_2532_2903 | 123 |
| 583 | 3300042004 | Ga0439445_0000834 | Ga0439445_0000834_6018_6389 | 123 |
| 584 | 3300042006 | Ga0439432_000156 | Ga0439432_000156_20806_21177 | 123 |
| 585 | 3300042010 | Ga0439452_029791 | Ga0439452_029791_691_1062 | 123 |
| 586 | 3300042015 | Ga0439462_0000128 | Ga0439462_0000128_5581_5952 | 123 |
| 587 | 3300042435 | Ga0439434_0001220 | Ga0439434_0001220_2196_2567 | 123 |
| 588 | 3300042876 | Ga0451577_0948068 | Ga0451577_0948068_11_382 | 123 |
| 589 | 3300044684 | Ga0466966_0740239 | Ga0466966_0740239_13_384 | 123 |
| 590 | 3300044706 | Ga0466964_0087797 | Ga0466964_0087797_626_997 | 123 |
| 591 | 3300045049 | Ga0466959_0165881 | Ga0466959_0165881_273_644 | 123 |
| 592 | 3300045049 | Ga0466959_1177486 | Ga0466959_1177486_119_490 | 123 |
| 593 | 3300045976 | Ga0466967_0302347 | Ga0466967_0302347_878_1249 | 123 |
| 594 | 3300045976 | Ga0466967_0328329 | Ga0466967_0328329_327_779 | 123 |
| 595 | 3300045976 | Ga0466967_0379381 | Ga0466967_0379381_49_498 | 123 |
| 596 | 3300045976 | Ga0466967_1859959 | Ga0466967_1859959_199_570 | 123 |
| 597 | 3300046455 | Ga0495603_0693965 | Ga0495603_0693965_28_399 | 123 |
| 598 | 3300046459 | Ga0495629_0052144 | Ga0495629_0052144_2382_2753 | 123 |
| 599 | 3300046460 | Ga0495638_0226492 | Ga0495638_0226492_142_513 | 123 |
| 600 | 3300046463 | Ga0495653_0304560 | Ga0495653_0304560_236_607 | 123 |
| 601 | 3300046471 | Ga0495650_0002418 | Ga0495650_0002418_5958_6329 | 123 |
| 602 | 3300046471 | Ga0495650_0188459 | Ga0495650_0188459_139_510 | 123 |
| 603 | 3300046472 | Ga0495580_0002795 | Ga0495580_0002795_117_488 | 123 |
| 604 | 3300046473 | Ga0495582_0268381 | Ga0495582_0268381_239_610 | 123 |
| 605 | 3300046473 | Ga0495582_0469021 | Ga0495582_0469021_20_391 | 123 |
| 606 | 3300046477 | Ga0495664_0079627 | Ga0495664_0079627_1400_1771 | 123 |
| 607 | 3300046477 | Ga0495664_0163724 | Ga0495664_0163724_270_641 | 123 |
| 608 | 3300046477 | Ga0495664_0177960 | Ga0495664_0177960_531_902 | 123 |
| 609 | 3300046506 | Ga0495583_0042528 | Ga0495583_0042528_402_773 | 123 |
| 610 | 3300046507 | Ga0495606_0050886 | Ga0495606_0050886_2147_2518 | 123 |
| 611 | 3300046507 | Ga0495606_0057434 | Ga0495606_0057434_1591_1962 | 123 |
| 612 | 3300046512 | Ga0495610_0001298 | Ga0495610_0001298_4031_4402 | 123 |
| 613 | 3300046512 | Ga0495610_0004939 | Ga0495610_0004939_3506_3877 | 123 |
| 614 | 3300046514 | Ga0495618_0243287 | Ga0495618_0243287_492_863 | 123 |
| 615 | 3300046515 | Ga0495620_0039396 | Ga0495620_0039396_597_968 | 123 |
| 616 | 3300046517 | Ga0495630_0342175 | Ga0495630_0342175_268_639 | 123 |
| 617 | 3300046519 | Ga0495632_0000989 | Ga0495632_0000989_4795_5166 | 123 |
| 618 | 3300046519 | Ga0495632_0005897 | Ga0495632_0005897_1178_1549 | 123 |
| 619 | 3300046519 | Ga0495632_0233036 | Ga0495632_0233036_240_611 | 123 |
| 620 | 3300046522 | Ga0495643_0000217 | Ga0495643_0000217_39116_39487 | 123 |
| 621 | 3300046522 | Ga0495643_0059132 | Ga0495643_0059132_869_1240 | 123 |
| 622 | 3300046522 | Ga0495643_0239338 | Ga0495643_0239338_400_771 | 123 |
| 623 | 3300046524 | Ga0495648_0123539 | Ga0495648_0123539_815_1186 | 123 |
| 624 | 3300046525 | Ga0495663_0000020 | Ga0495663_0000020_46126_46497 | 123 |
| 625 | 3300046526 | Ga0495666_0304448 | Ga0495666_0304448_64_435 | 123 |
| 626 | 3300046528 | Ga0495642_0180344 | Ga0495642_0180344_144_515 | 123 |
| 627 | 3300046530 | Ga0495654_0035543 | Ga0495654_0035543_1118_1489 | 123 |
| 628 | 3300046531 | Ga0495665_0033419 | Ga0495665_0033419_75_446 | 123 |
| 629 | 3300046533 | Ga0495640_0032013 | Ga0495640_0032013_3169_3540 | 123 |
| 630 | 3300046542 | Ga0495597_0176609 | Ga0495597_0176609_295_666 | 123 |
| 631 | 3300046543 | Ga0495645_0068373 | Ga0495645_0068373_2036_2407 | 123 |
| 632 | 3300046558 | Ga0495633_0002856 | Ga0495633_0002856_4903_5274 | 123 |
| 633 | 3300046558 | Ga0495633_0006780 | Ga0495633_0006780_3369_3740 | 123 |
| 634 | 3300046559 | Ga0495667_0337242 | Ga0495667_0337242_184_555 | 123 |
| 635 | 3300046616 | Ga0495668_0072625 | Ga0495668_0072625_333_704 | 123 |
| 636 | 3300046660 | Ga0495625_0028456 | Ga0495625_0028456_2063_2434 | 123 |
| 637 | 3300046660 | Ga0495625_0198397 | Ga0495625_0198397_631_1002 | 123 |
| 638 | 3300046660 | Ga0495625_0474738 | Ga0495625_0474738_111_482 | 123 |
| 639 | 3300046663 | Ga0495635_0026497 | Ga0495635_0026497_169_540 | 123 |
| 640 | 3300046678 | Ga0495599_0325152 | Ga0495599_0325152_372_743 | 123 |
| 641 | 3300046681 | Ga0495647_0345779 | Ga0495647_0345779_295_666 | 123 |
| 642 | 3300046683 | Ga0495658_0006493 | Ga0495658_0006493_140_511 | 123 |
| 643 | 3300046689 | Ga0495613_0753613 | Ga0495613_0753613_101_472 | 123 |
| 644 | 3300046690 | Ga0495624_0335536 | Ga0495624_0335536_240_611 | 123 |
| 645 | 3300046691 | Ga0495670_0000033 | Ga0495670_0000033_68378_68749 | 123 |
| 646 | 3300046691 | Ga0495670_0032461 | Ga0495670_0032461_722_1093 | 123 |
| 647 | 3300046691 | Ga0495670_0044328 | Ga0495670_0044328_999_1370 | 123 |
| 648 | 3300046691 | Ga0495670_0334791 | Ga0495670_0334791_262_633 | 123 |
| 649 | 3300047315 | Ga0495581_0736715 | Ga0495581_0736715_57_428 | 123 |
| 650 | 3300047319 | Ga0495674_0158783 | Ga0495674_0158783_797_1168 | 123 |
| 651 | 3300047321 | Ga0495676_0153977 | Ga0495676_0153977_1049_1420 | 123 |
| 652 | 3300047323 | Ga0495683_0221725 | Ga0495683_0221725_287_658 | 123 |
| 653 | 3300047445 | Ga0495677_0042316 | Ga0495677_0042316_186_557 | 123 |
| 654 | 3300047470 | Ga0495681_0001886 | Ga0495681_0001886_8824_9195 | 123 |
| 655 | 3300047471 | Ga0495684_0037420 | Ga0495684_0037420_3169_3540 | 123 |
| 656 | 3300047472 | Ga0495686_0000182 | Ga0495686_0000182_52517_52888 | 123 |
| 657 | 3300047472 | Ga0495686_0001777 | Ga0495686_0001777_13226_13597 | 123 |
| 658 | 3300047472 | Ga0495686_0002610 | Ga0495686_0002610_10324_10695 | 123 |
| 659 | 3300047472 | Ga0495686_0156238 | Ga0495686_0156238_868_1239 | 123 |
| 660 | 3300047472 | Ga0495686_0157289 | Ga0495686_0157289_10_381 | 123 |
| 661 | 3300047673 | Ga0495593_0182816 | Ga0495593_0182816_414_785 | 123 |
| 662 | 3300047673 | Ga0495593_0208084 | Ga0495593_0208084_168_539 | 123 |
| 663 | 3300047673 | Ga0495593_0602236 | Ga0495593_0602236_171_542 | 123 |
| 664 | 3300048903 | Ga0496100_0028246 | Ga0496100_0028246_1693_2064 | 123 |
| 665 | 3300048903 | Ga0496100_0068809 | Ga0496100_0068809_1871_2242 | 123 |
| 666 | 3300048903 | Ga0496100_0198944 | Ga0496100_0198944_374_745 | 123 |
| 667 | 3300048903 | Ga0496100_0435705 | Ga0496100_0435705_280_729 | 123 |
| 668 | 3300048904 | Ga0496101_0077983 | Ga0496101_0077983_1042_1413 | 123 |
| 669 | 3300048904 | Ga0496101_0617338 | Ga0496101_0617338_133_504 | 123 |
| 670 | 3300048905 | Ga0496102_0001012 | Ga0496102_0001012_11845_12216 | 123 |
| 671 | 3300048905 | Ga0496102_0150581 | Ga0496102_0150581_1337_1708 | 123 |
| 672 | 3300048905 | Ga0496102_0969020 | Ga0496102_0969020_32_403 | 123 |
| 673 | 3300048906 | Ga0496103_0000246 | Ga0496103_0000246_40939_41310 | 123 |
| 674 | 3300048906 | Ga0496103_0227163 | Ga0496103_0227163_797_1168 | 123 |
| 675 | 3300048906 | Ga0496103_0639758 | Ga0496103_0639758_174_545 | 123 |
| 676 | 3300048906 | Ga0496103_0818047 | Ga0496103_0818047_179_550 | 123 |
| 677 | 3300048907 | Ga0496104_0000227 | Ga0496104_0000227_32602_32973 | 123 |
| 678 | 3300048908 | Ga0496105_0000158 | Ga0496105_0000158_8250_8621 | 123 |
| 679 | 3300048909 | Ga0496106_0521103 | Ga0496106_0521103_75_446 | 123 |
| 680 | 3300048910 | Ga0496107_0112102 | Ga0496107_0112102_1117_1488 | 123 |
| 681 | 3300048910 | Ga0496107_0229831 | Ga0496107_0229831_997_1368 | 123 |
| 682 | 3300048911 | Ga0496108_0350757 | Ga0496108_0350757_832_1203 | 123 |
| 683 | 3300048915 | Ga0496112_0002829 | Ga0496112_0002829_6946_7317 | 123 |
| 684 | 3300048915 | Ga0496112_0380285 | Ga0496112_0380285_274_645 | 123 |
| 685 | 3300048916 | Ga0496113_0000325 | Ga0496113_0000325_8191_8562 | 123 |
| 686 | 3300048918 | Ga0496115_1021277 | Ga0496115_1021277_227_598 | 123 |
| 687 | 3300048919 | Ga0496116_0021850 | Ga0496116_0021850_433_804 | 123 |
| 688 | 3300048919 | Ga0496116_0078456 | Ga0496116_0078456_160_531 | 123 |
| 689 | 3300048919 | Ga0496116_0331149 | Ga0496116_0331149_286_657 | 123 |
| 690 | 3300048919 | Ga0496116_0400782 | Ga0496116_0400782_25_396 | 123 |
| 691 | 3300048920 | Ga0496117_0005510 | Ga0496117_0005510_7150_7521 | 123 |
| 692 | 3300048920 | Ga0496117_0030787 | Ga0496117_0030787_1605_1976 | 123 |
| 693 | 3300048920 | Ga0496117_0073876 | Ga0496117_0073876_1016_1387 | 123 |
| 694 | 3300048920 | Ga0496117_0525765 | Ga0496117_0525765_38_409 | 123 |
| 695 | 3300048920 | Ga0496117_0611950 | Ga0496117_0611950_38_409 | 123 |
| 696 | 3300048921 | Ga0496118_0002103 | Ga0496118_0002103_26545_26916 | 123 |
| 697 | 3300048921 | Ga0496118_0020790 | Ga0496118_0020790_3874_4299 | 123 |
| 698 | 3300048921 | Ga0496118_0048902 | Ga0496118_0048902_2591_2962 | 123 |
| 699 | 3300048921 | Ga0496118_0055157 | Ga0496118_0055157_1912_2283 | 123 |
| 700 | 3300048921 | Ga0496118_0084326 | Ga0496118_0084326_986_1357 | 123 |
| 701 | 3300048921 | Ga0496118_0106434 | Ga0496118_0106434_412_783 | 123 |
| 702 | 3300048921 | Ga0496118_0322036 | Ga0496118_0322036_267_638 | 123 |
| 703 | 3300048922 | Ga0496119_0000040 | Ga0496119_0000040_116147_116518 | 123 |
| 704 | 3300048922 | Ga0496119_0015177 | Ga0496119_0015177_1426_1851 | 123 |
| 705 | 3300048922 | Ga0496119_0020742 | Ga0496119_0020742_2558_2929 | 123 |
| 706 | 3300048922 | Ga0496119_0026083 | Ga0496119_0026083_3528_3899 | 123 |
| 707 | 3300048922 | Ga0496119_0171639 | Ga0496119_0171639_394_765 | 123 |
| 708 | 3300048922 | Ga0496119_0174071 | Ga0496119_0174071_197_568 | 123 |
| 709 | 3300048923 | Ga0496120_0000731 | Ga0496120_0000731_32428_32799 | 123 |
| 710 | 3300048923 | Ga0496120_0016388 | Ga0496120_0016388_2087_2458 | 123 |
| 711 | 3300048923 | Ga0496120_0147763 | Ga0496120_0147763_660_1031 | 123 |
| 712 | 3300048923 | Ga0496120_0187439 | Ga0496120_0187439_11_382 | 123 |
| 713 | 3300048924 | Ga0496121_0000123 | Ga0496121_0000123_1918_2289 | 123 |
| 714 | 3300048924 | Ga0496121_0004891 | Ga0496121_0004891_11192_11563 | 123 |
| 715 | 3300048924 | Ga0496121_0007534 | Ga0496121_0007534_7209_7580 | 123 |
| 716 | 3300048924 | Ga0496121_0039007 | Ga0496121_0039007_2034_2459 | 123 |
| 717 | 3300048924 | Ga0496121_0072125 | Ga0496121_0072125_2205_2576 | 123 |
| 718 | 3300048924 | Ga0496121_0091767 | Ga0496121_0091767_1834_2205 | 123 |
| 719 | 3300048924 | Ga0496121_0095250 | Ga0496121_0095250_303_674 | 123 |
| 720 | 3300048925 | Ga0496122_0002442 | Ga0496122_0002442_20663_21034 | 123 |
| 721 | 3300048925 | Ga0496122_0003506 | Ga0496122_0003506_11724_12095 | 123 |
| 722 | 3300048926 | Ga0496123_0001478 | Ga0496123_0001478_11724_12095 | 123 |
| 723 | 3300048926 | Ga0496123_0004521 | Ga0496123_0004521_10357_10728 | 123 |
| 724 | 3300048927 | Ga0496124_0004810 | Ga0496124_0004810_13969_14340 | 123 |
| 725 | 3300048927 | Ga0496124_0026551 | Ga0496124_0026551_2961_3332 | 123 |
| 726 | 3300048927 | Ga0496124_0179411 | Ga0496124_0179411_672_1043 | 123 |
| 727 | 3300048927 | Ga0496124_0314881 | Ga0496124_0314881_525_896 | 123 |
| 728 | 3300048927 | Ga0496124_0419387 | Ga0496124_0419387_300_725 | 123 |
| 729 | 3300048928 | Ga0496125_0000205 | Ga0496125_0000205_42342_42713 | 123 |
| 730 | 3300048928 | Ga0496125_0006420 | Ga0496125_0006420_4840_5211 | 123 |
| 731 | 3300048928 | Ga0496125_0009566 | Ga0496125_0009566_7383_7754 | 123 |
| 732 | 3300048928 | Ga0496125_0017019 | Ga0496125_0017019_1747_2118 | 123 |
| 733 | 3300048928 | Ga0496125_0060959 | Ga0496125_0060959_1137_1508 | 123 |
| 734 | 3300048928 | Ga0496125_0147758 | Ga0496125_0147758_1139_1510 | 123 |
| 735 | 3300048928 | Ga0496125_0148995 | Ga0496125_0148995_728_1099 | 123 |
| 736 | 3300048928 | Ga0496125_0260140 | Ga0496125_0260140_14_439 | 123 |
| 737 | 3300048928 | Ga0496125_0270452 | Ga0496125_0270452_30_401 | 123 |
| 738 | 3300048928 | Ga0496125_0333183 | Ga0496125_0333183_510_881 | 123 |
| 739 | 3300048928 | Ga0496125_0380740 | Ga0496125_0380740_407_778 | 123 |
| 740 | 3300048928 | Ga0496125_0428620 | Ga0496125_0428620_264_635 | 123 |
| 741 | 3300048929 | Ga0496126_0000044 | Ga0496126_0000044_211758_212129 | 123 |
| 742 | 3300048929 | Ga0496126_0046438 | Ga0496126_0046438_3552_3923 | 123 |
| 743 | 3300048929 | Ga0496126_0071283 | Ga0496126_0071283_2687_3058 | 123 |
| 744 | 3300048929 | Ga0496126_0081674 | Ga0496126_0081674_1139_1510 | 123 |
| 745 | 3300048929 | Ga0496126_0280298 | Ga0496126_0280298_142_513 | 123 |
| 746 | 3300048929 | Ga0496126_0295856 | Ga0496126_0295856_122_493 | 123 |
| 747 | 3300048929 | Ga0496126_0363117 | Ga0496126_0363117_163_534 | 123 |
| 748 | 3300048929 | Ga0496126_0839145 | Ga0496126_0839145_105_476 | 123 |
| 749 | 3300049575 | Ga0501039_0052158 | Ga0501039_0052158_2235_2606 | 123 |
| 750 | 3300049580 | Ga0501046_0350514 | Ga0501046_0350514_430_801 | 123 |
| 751 | 3300049581 | Ga0501047_0044436 | Ga0501047_0044436_3610_3981 | 123 |
| 752 | 3300049581 | Ga0501047_0257298 | Ga0501047_0257298_1100_1471 | 123 |
| 753 | 3300049581 | Ga0501047_0846180 | Ga0501047_0846180_71_442 | 123 |
| 754 | 3300049582 | Ga0501048_0000652 | Ga0501048_0000652_11602_11973 | 123 |
| 755 | 3300049586 | Ga0501070_0012367 | Ga0501070_0012367_1811_2182 | 123 |
| 756 | 3300049590 | Ga0501074_0393242 | Ga0501074_0393242_332_703 | 123 |
| 757 | 3300049664 | Ga0501224_010896 | Ga0501224_010896_352_723 | 123 |
| 758 | 3300049742 | Ga0501080_0591613 | Ga0501080_0591613_55_426 | 123 |
| 759 | 3300049823 | Ga0501044_0463473 | Ga0501044_0463473_217_588 | 123 |
| 760 | 3300050492 | nmdc:mga0yw44_152970_c1 | nmdc:mga0yw44_152970_c1_844_1215 | 123 |
| 761 | 3300050492 | nmdc:mga0yw44_7389_c1 | nmdc:mga0yw44_7389_c1_342_713 | 123 |
| 762 | 3300050496 | nmdc:mga07m45_852321_c1 | nmdc:mga07m45_852321_c1_48_497 | 123 |
| 763 | 3300050496 | nmdc:mga07m45_895112_c1 | nmdc:mga07m45_895112_c1_94_465 | 123 |
| 764 | 3300050509 | nmdc:mga0qj67_676320_c1 | nmdc:mga0qj67_676320_c1_166_537 | 123 |
| 765 | 3300053077 | Ga0495601_0067983 | Ga0495601_0067983_1632_2003 | 123 |
| 766 | 3300053077 | Ga0495601_0227859 | Ga0495601_0227859_275_646 | 123 |
| 767 | 3300053078 | Ga0495612_0033254 | Ga0495612_0033254_877_1248 | 123 |
| 768 | 3300053078 | Ga0495612_0253370 | Ga0495612_0253370_28_399 | 123 |
| 769 | 3300053083 | Ga0495655_0298167 | Ga0495655_0298167_80_451 | 123 |
| 770 | 3300053085 | Ga0495619_0393005 | Ga0495619_0393005_22_393 | 123 |
| 771 | 3300053085 | Ga0495619_0679261 | Ga0495619_0679261_48_419 | 123 |
| 772 | 3300053087 | Ga0500643_002186 | Ga0500643_002186_802_1173 | 123 |
| 773 | 3300053088 | Ga0500644_0141251 | Ga0500644_0141251_416_787 | 123 |
| 774 | 3300053090 | Ga0500646_0055461 | Ga0500646_0055461_36_407 | 123 |
| 775 | 3300053091 | Ga0500647_0225328 | Ga0500647_0225328_44_415 | 123 |
| 776 | 3300053091 | Ga0500647_0280580 | Ga0500647_0280580_17_388 | 123 |
| 777 | 3300053091 | Ga0500647_0340996 | Ga0500647_0340996_224_595 | 123 |
| 778 | 3300053092 | Ga0500583_0320631 | Ga0500583_0320631_221_592 | 123 |
| 779 | 3300053093 | Ga0500651_0687012 | Ga0500651_0687012_144_515 | 123 |
| 780 | 3300053096 | Ga0500641_0013594 | Ga0500641_0013594_1833_2204 | 123 |
| 781 | 3300053104 | Ga0500556_0004926 | Ga0500556_0004926_1460_1831 | 123 |
| 782 | 3300053104 | Ga0500556_0136344 | Ga0500556_0136344_305_676 | 123 |
| 783 | 3300053108 | Ga0500562_022490 | Ga0500562_022490_1211_1582 | 123 |
| 784 | 3300053108 | Ga0500562_063979 | Ga0500562_063979_193_564 | 123 |
| 785 | 3300053115 | Ga0500591_037645 | Ga0500591_037645_565_936 | 123 |
| 786 | 3300053116 | Ga0500592_058894 | Ga0500592_058894_180_551 | 123 |
| 787 | 3300053118 | Ga0500594_0006551 | Ga0500594_0006551_778_1149 | 123 |
| 788 | 3300053118 | Ga0500594_0318946 | Ga0500594_0318946_123_494 | 123 |
| 789 | 3300053119 | Ga0500595_001175 | Ga0500595_001175_6533_6904 | 123 |
| 790 | 3300053119 | Ga0500595_103422 | Ga0500595_103422_45_416 | 123 |
| 791 | 3300053122 | Ga0500608_000128 | Ga0500608_000128_2094_2465 | 123 |
| 792 | 3300053134 | Ga0500658_0302080 | Ga0500658_0302080_234_605 | 123 |
| 793 | 3300053136 | Ga0500559_0008678 | Ga0500559_0008678_2974_3345 | 123 |
| 794 | 3300053136 | Ga0500559_0148768 | Ga0500559_0148768_653_1024 | 123 |
| 795 | 3300053138 | Ga0500564_001139 | Ga0500564_001139_3544_3915 | 123 |
| 796 | 3300053139 | Ga0500568_0001898 | Ga0500568_0001898_10791_11162 | 123 |
| 797 | 3300053140 | Ga0500573_0159684 | Ga0500573_0159684_459_830 | 123 |
| 798 | 3300053140 | Ga0500573_0217348 | Ga0500573_0217348_418_789 | 123 |
| 799 | 3300053150 | Ga0500603_010373 | Ga0500603_010373_1450_1821 | 123 |
| 800 | 3300053151 | Ga0500604_0055717 | Ga0500604_0055717_177_548 | 123 |
| 801 | 3300053153 | Ga0500616_0010388 | Ga0500616_0010388_1062_1433 | 123 |
| 802 | 3300053153 | Ga0500616_0061287 | Ga0500616_0061287_550_921 | 123 |
| 803 | 3300053156 | Ga0500622_0040507 | Ga0500622_0040507_801_1172 | 123 |
| 804 | 3300053158 | Ga0500627_0000031 | Ga0500627_0000031_1493_1864 | 123 |
| 805 | 3300053158 | Ga0500627_0081936 | Ga0500627_0081936_1000_1371 | 123 |
| 806 | 3300053163 | Ga0500639_110383 | Ga0500639_110383_264_635 | 123 |
| 807 | 3300053177 | Ga0500636_0179420 | Ga0500636_0179420_351_722 | 123 |
| 808 | 3300053723 | Ga0500567_002483 | Ga0500567_002483_4631_5002 | 123 |
| 809 | 3300053727 | Ga0500611_123954 | Ga0500611_123954_79_450 | 123 |
| 810 | 3300053729 | Ga0500625_000051 | Ga0500625_000051_21280_21651 | 123 |
| 811 | 3300053730 | Ga0500645_000234 | Ga0500645_000234_14254_14625 | 123 |
| 812 | 3300053730 | Ga0500645_054265 | Ga0500645_054265_193_564 | 123 |
| 813 | 3300053737 | Ga0500601_004546 | Ga0500601_004546_1060_1431 | 123 |
| 814 | 3300055283 | Ga0500661_005233 | Ga0500661_005233_1807_2178 | 123 |
| 815 | 3300055283 | Ga0500661_111799 | Ga0500661_111799_33_404 | 123 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2q2i-assembly1.cif.gz_A | crystal structure of the protein secretion chaperone csaa from agrobacterium tumefaciens. | 0.9818 | 12 | 123 |
| 2q2i-assembly1.cif.gz_A | crystal structure of the protein secretion chaperone csaa from agrobacterium tumefaciens. | 0.9732 | 12 | 123 |
| 2q2h-assembly1.cif.gz_B | crystal structure of the protein secretion chaperone csaa from agrobacterium tumefaciens with a genetically fused phage-display derived peptide substrate at the n-terminus. | 0.9643 | 13 | 123 |
| 1gd7-assembly1.cif.gz_B | crystal structure of a bifunctional protein (csaa) with export-related chaperone and trna-binding activities. | 0.9582 | 14 | 123 |
| 2q2h-assembly1.cif.gz_B | crystal structure of the protein secretion chaperone csaa from agrobacterium tumefaciens with a genetically fused phage-display derived peptide substrate at the n-terminus. | 0.9555 | 13 | 123 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1gd7A00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9568 | 14 | 123 | 2.40.50.140 |
| 1gd7A00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9483 | 14 | 123 | 2.40.50.140 |
| 2q2iB00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9474 | 12 | 123 | 2.40.50.140 |
| 2q2iB00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.939 | 12 | 123 | 2.40.50.140 |
| af_Q54B13_2_117_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9269 | 10 | 123 | 2.40.50.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V5CWR8-F1-model_v4 | deleted | 0.9971 | 2 | 123 |
|
| AF-A0A521LCG2-F1-model_v4 | tRNA-binding protein | 0.9927 | 41 | 123 |
GO:0000049
|
| AF-C6XQR0-F1-model_v4 | Export-related chaperone CsaA | 0.9924 | 1 | 123 |
GO:0000049
|
| AF-A0A6A5LB44-F1-model_v4 | deleted | 0.9916 | 13 | 123 |
|
| AF-A0A356R983-F1-model_v4 | tRNA-binding protein | 0.9905 | 24 | 123 |
GO:0000049
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar