F482020

General Info

Members Datasets Scaffolds Average Seq Length
815 406 815 123

Family's Representative Sequence

Representative Sequence 3300039453|Ga0436362_0217235|Ga0436362_0217235_93_461
Length 122
Sequence MHLNHDPDAPPAPPIDFDKFLAVDVRVGTIVAAEPFAEARKPSLKLRIDFGPGVGVKQSSAQIAQYDVAALVGRQVAAVVNFPPRQIGRFMSEVLTLGFPDENGAVVLFSPDRKVPDGARLF

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
3 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
10 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
92 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
118 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
119 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
120 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
121 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
122 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
123 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
124 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
127 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
128 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
134 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
136 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
138 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
182 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
186 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
187 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
188 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
189 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
190 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
191 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
192 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
193 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
194 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
195 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
196 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
197 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
198 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
199 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
200 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
201 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
202 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
203 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
204 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
205 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
206 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
207 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
208 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
209 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
210 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
211 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
212 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
213 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
215 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
216 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
217 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
218 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
219 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
220 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
221 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
222 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
223 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
224 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
225 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
226 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
227 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
228 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
229 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
230 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
231 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
232 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
233 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
234 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
235 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
236 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
237 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
238 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
239 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
240 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
241 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
242 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
243 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
244 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
245 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
246 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
247 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
248 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
249 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
250 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
251 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
252 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
253 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
254 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
255 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
256 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
257 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
258 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
259 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
260 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
261 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
262 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
263 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
264 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
265 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
266 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
267 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
268 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
269 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
270 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
271 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
272 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
273 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
274 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
275 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
276 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
277 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
278 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
279 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
280 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
281 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
282 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
283 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
284 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
285 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
286 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
287 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
288 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
289 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
290 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
291 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
292 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
293 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
294 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
295 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
296 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
297 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
298 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
299 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
300 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
301 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
302 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
303 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
304 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
305 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
306 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
307 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
308 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
309 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
310 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
311 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
312 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
313 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
314 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
315 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
316 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
317 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
318 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
319 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
320 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
321 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
322 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
323 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
324 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
325 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
326 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
327 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
328 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
329 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
330 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
331 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
332 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
333 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
334 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
335 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
336 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
337 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
341 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
344 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
348 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
349 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
350 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
351 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
352 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
353 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
354 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
355 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
356 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
357 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
360 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
361 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
362 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
363 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
364 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
365 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
366 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
367 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
368 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
369 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
370 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
371 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
372 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
373 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
374 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
375 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
376 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
377 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
378 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
379 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
380 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
381 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
382 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
383 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
384 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
385 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
386 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
387 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
388 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
389 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
390 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
391 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
392 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
393 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
394 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
395 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
396 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
397 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
398 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
399 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
400 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
401 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
402 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
403 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
404 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
405 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
406 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.9
Metatranscriptomes 1.1
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.48
Nodule 0.25
Rhizoplane 3.44
Rhizosphere 70.31
Stem 0
Stem Tuber 0
Unclassified 11.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2144200 2162886007 Bacteria 7630
2 JGI25150J39212_1000368 3300002774 Bacteria 21777
3 Ga0006759J45824_1076213 3300003163 Bacteria 741
4 JGI25151J46595_10070633 3300003187 Bacteria 1059
5 JGI25153J46596_10000512 3300003215 Bacteria 24447
6 Ga0006777J48905_1008095 3300003308 Bacteria 774
7 Ga0007416J51690_1070775 3300003577 Bacteria 865
8 Ga0007429J51699_1004743 3300003579 Bacteria 1257
9 Ga0007429J51699_1114894 3300003579 Bacteria 832
10 Ga0055529_1018251 3300003763 Bacteria 878
11 Ga0055537_1002263 3300003773 Bacteria 6621
12 Ga0055537_1004290 3300003773 Bacteria 4107
13 Ga0055536_1006517 3300003781 Bacteria 5427
14 Ga0055536_1007944 3300003781 Bacteria 4651
15 Ga0055530_10000013 3300003791 Bacteria 153390
16 Ga0055530_10050136 3300003791 Bacteria 974
17 Ga0055531_10000792 3300003794 Bacteria 26275
18 Ga0055531_10006790 3300003794 Bacteria 6389
19 Ga0055531_10010629 3300003794 Bacteria 4549
20 Ga0065165_1004494 3300005262 Bacteria 8580
21 Ga0065165_1072659 3300005262 Bacteria 910
22 Ga0065704_10070230 3300005289 Bacteria 55750
23 Ga0065712_10452270 3300005290 Bacteria 685
24 Ga0065712_10679218 3300005290 Bacteria 555
25 Ga0070676_10046758 3300005328 Bacteria 2525
26 Ga0070690_100061564 3300005330 Bacteria 2418
27 Ga0068869_101432346 3300005334 Bacteria 612
28 Ga0070666_10067868 3300005335 Bacteria 2422
29 Ga0070666_10472965 3300005335 Bacteria 907
30 Ga0070680_100175739 3300005336 Bacteria 1803
31 Ga0070680_100195803 3300005336 Bacteria 1704
32 Ga0070682_100090750 3300005337 Bacteria 1999
33 Ga0068868_100049983 3300005338 Bacteria 3283
34 Ga0070660_101092502 3300005339 Bacteria 675
35 Ga0070691_10106883 3300005341 Bacteria 1396
36 Ga0070687_100854571 3300005343 Bacteria 649
37 Ga0070661_100615352 3300005344 Bacteria 879
38 Ga0070668_100024056 3300005347 Bacteria 4613
39 Ga0070668_100390240 3300005347 Bacteria 1187
40 Ga0070668_100473182 3300005347 Bacteria 1081
41 Ga0070668_100903627 3300005347 Bacteria 789
42 Ga0070669_100001396 3300005353 Bacteria 17436
43 Ga0070669_100011083 3300005353 Bacteria 6399
44 Ga0070669_100442699 3300005353 Bacteria 1070
45 Ga0070671_100029627 3300005355 Bacteria 4514
46 Ga0070671_100045828 3300005355 Bacteria 3636
47 Ga0070674_100187164 3300005356 Bacteria 1590
48 Ga0070674_100607304 3300005356 Bacteria 925
49 Ga0070673_100911838 3300005364 Bacteria 815
50 Ga0070667_100001289 3300005367 Bacteria 22650
51 Ga0070667_100019541 3300005367 Bacteria 5621
52 Ga0070667_100069757 3300005367 Bacteria 2991
53 Ga0070667_100897979 3300005367 Bacteria 825
54 Ga0070709_10001423 3300005434 Bacteria 12946
55 Ga0070709_10208027 3300005434 Bacteria 1389
56 Ga0070714_100014682 3300005435 Bacteria 6294
57 Ga0070714_100127032 3300005435 Bacteria 2275
58 Ga0070714_100208010 3300005435 Bacteria 1792
59 Ga0070714_100449290 3300005435 Bacteria 1224
60 Ga0070713_100005847 3300005436 Bacteria 8457
61 Ga0070713_100007642 3300005436 Bacteria 7608
62 Ga0070713_100063091 3300005436 Bacteria 3105
63 Ga0070713_100070335 3300005436 Bacteria 2954
64 Ga0070710_10002139 3300005437 Bacteria 9367
65 Ga0070710_10034735 3300005437 Bacteria 2745
66 Ga0070711_100018016 3300005439 Bacteria 4503
67 Ga0070711_100036221 3300005439 Bacteria 3305
68 Ga0070711_100623857 3300005439 Bacteria 901
69 Ga0070705_100079104 3300005440 Bacteria 2013
70 Ga0070700_100004668 3300005441 Bacteria 7180
71 Ga0070663_100006533 3300005455 Bacteria 7022
72 Ga0070663_100261983 3300005455 Bacteria 1372
73 Ga0070663_102106566 3300005455 Bacteria 508
74 Ga0070678_100085495 3300005456 Bacteria 2404
75 Ga0070678_101377533 3300005456 Bacteria 658
76 Ga0070681_10498576 3300005458 Bacteria 1131
77 Ga0070706_100003670 3300005467 Bacteria 15027
78 Ga0070707_100019597 3300005468 Bacteria 6374
79 Ga0070707_100673140 3300005468 Bacteria 997
80 Ga0070698_100008160 3300005471 Bacteria 11322
81 Ga0070699_100001192 3300005518 Bacteria 24008
82 Ga0070699_100777744 3300005518 Bacteria 876
83 Ga0070699_100827470 3300005518 Bacteria 847
84 Ga0070679_100752268 3300005530 Bacteria 917
85 Ga0070679_101786375 3300005530 Bacteria 563
86 Ga0070697_100235244 3300005536 Unclassified 1563
87 Ga0070697_100728931 3300005536 Bacteria 875
88 Ga0068853_100306409 3300005539 Bacteria 1469
89 Ga0068853_100439152 3300005539 Bacteria 1226
90 Ga0068853_100443121 3300005539 Bacteria 1221
91 Ga0068853_100629588 3300005539 Bacteria 1020
92 Ga0070695_100003309 3300005545 Bacteria 9420
93 Ga0070696_100013131 3300005546 Bacteria 5557
94 Ga0070696_100364406 3300005546 Bacteria 1122
95 Ga0070693_100286104 3300005547 Bacteria 1106
96 Ga0070693_100555303 3300005547 Bacteria 822
97 Ga0070665_100000107 3300005548 Bacteria 156048
98 Ga0070665_100061489 3300005548 Bacteria 3765
99 Ga0070665_100352307 3300005548 Bacteria 1478
100 Ga0070665_100523629 3300005548 Bacteria 1197
101 Ga0070665_102201547 3300005548 Bacteria 555
102 Ga0070704_100046524 3300005549 Bacteria 3026
103 Ga0068855_100067138 3300005563 Bacteria 4180
104 Ga0068855_100381920 3300005563 Bacteria 1546
105 Ga0068855_100850588 3300005563 Bacteria 967
106 Ga0070664_100604535 3300005564 Bacteria 1017
107 Ga0068857_100057015 3300005577 Bacteria 3467
108 Ga0068857_100493001 3300005577 Bacteria 1149
109 Ga0068857_101205282 3300005577 Bacteria 733
110 Ga0068856_100341046 3300005614 Bacteria 1517
111 Ga0068856_101438266 3300005614 Bacteria 704
112 Ga0070702_101305134 3300005615 Bacteria 589
113 Ga0068852_100252052 3300005616 Bacteria 1691
114 Ga0068852_100319614 3300005616 Bacteria 1507
115 Ga0068859_100132951 3300005617 Bacteria 2560
116 Ga0068859_100810810 3300005617 Bacteria 1023
117 Ga0068859_100915497 3300005617 Bacteria 961
118 Ga0068859_101161340 3300005617 Bacteria 850
119 Ga0068864_100153684 3300005618 Bacteria 2087
120 Ga0068861_100062658 3300005719 Bacteria 2857
121 Ga0068861_100105602 3300005719 Bacteria 2249
122 Ga0068861_100743177 3300005719 Bacteria 916
123 Ga0068863_100369401 3300005841 Bacteria 1400
124 Ga0068863_100418005 3300005841 Bacteria 1313
125 Ga0068863_100508869 3300005841 Bacteria 1186
126 Ga0068858_100000191 3300005842 Bacteria 65267
127 Ga0068858_100193011 3300005842 Bacteria 1924
128 Ga0068858_100218585 3300005842 Bacteria 1804
129 Ga0068858_100586328 3300005842 Bacteria 1081
130 Ga0068858_100685177 3300005842 Bacteria 997
131 Ga0068858_101741671 3300005842 Bacteria 615
132 Ga0068860_100004803 3300005843 Bacteria 13760
133 Ga0068860_100086315 3300005843 Bacteria 2986
134 Ga0068860_100453064 3300005843 Bacteria 1276
135 Ga0068860_101078900 3300005843 Bacteria 822
136 Ga0068860_102693611 3300005843 Bacteria 516
137 Ga0068862_100008499 3300005844 Bacteria 8492
138 Ga0068862_100140692 3300005844 Bacteria 2141
139 Ga0068862_100255458 3300005844 Bacteria 1598
140 Ga0068862_100313131 3300005844 Bacteria 1447
141 Ga0068862_101516253 3300005844 Bacteria 676
142 Ga0081455_10000028 3300005937 Bacteria 155778
143 Ga0081540_1146814 3300005983 Bacteria 937
144 Ga0081539_10004186 3300005985 Bacteria 16343
145 Ga0070717_10109011 3300006028 Bacteria 2360
146 Ga0070717_10215566 3300006028 Bacteria 1686
147 Ga0075365_10010971 3300006038 Bacteria 5308
148 Ga0075363_100099126 3300006048 Bacteria 1611
149 Ga0070715_10101757 3300006163 Bacteria 1341
150 Ga0070716_100007382 3300006173 Bacteria 5407
151 Ga0070716_100160910 3300006173 Bacteria 1454
152 Ga0070716_101238386 3300006173 Bacteria 601
153 Ga0070716_101635204 3300006173 Bacteria 530
154 Ga0070712_100069079 3300006175 Bacteria 2519
155 Ga0070712_100086611 3300006175 Bacteria 2283
156 Ga0070712_100181203 3300006175 Bacteria 1641
157 Ga0075362_10366830 3300006177 Bacteria 723
158 Ga0075367_10419691 3300006178 Bacteria 847
159 Ga0075369_10079358 3300006186 Bacteria 1454
160 Ga0097621_100581405 3300006237 Bacteria 1022
161 Ga0097621_100698468 3300006237 Bacteria 934
162 Ga0075370_10616697 3300006353 Bacteria 658
163 Ga0075370_10987169 3300006353 Bacteria 516
164 Ga0068871_100909268 3300006358 Bacteria 816
165 Ga0068871_100963154 3300006358 Bacteria 793
166 Ga0068871_101045841 3300006358 Bacteria 762
167 Ga0075428_100118734 3300006844 Bacteria 2880
168 Ga0075428_100629506 3300006844 Bacteria 1145
169 Ga0075428_100761957 3300006844 Bacteria 1030
170 Ga0075430_100023915 3300006846 Bacteria 5202
171 Ga0075431_100045525 3300006847 Bacteria 4523
172 Ga0075433_10880284 3300006852 Bacteria 781
173 Ga0075433_11097806 3300006852 Bacteria 692
174 Ga0075429_100178803 3300006880 Bacteria 1859
175 Ga0068865_100799318 3300006881 Bacteria 814
176 Ga0097620_100132952 3300006931 Bacteria 2560
177 Ga0097620_100810798 3300006931 Bacteria 1023
178 Ga0097620_100915335 3300006931 Bacteria 961
179 Ga0079104_1004974 3300006946 Bacteria 5469
180 Ga0105251_10002928 3300009011 Bacteria 12798
181 Ga0105240_10071684 3300009093 Bacteria 4284
182 Ga0105240_10266334 3300009093 Bacteria 1975
183 Ga0105240_10313742 3300009093 Bacteria 1789
184 Ga0105240_10344568 3300009093 Bacteria 1692
185 Ga0105240_10866579 3300009093 Bacteria 974
186 Ga0105240_12066597 3300009093 Bacteria 592
187 Ga0105240_12595983 3300009093 Bacteria 523
188 Ga0105245_10038965 3300009098 Bacteria 4229
189 Ga0105247_10042030 3300009101 Bacteria 2797
190 Ga0105247_10091810 3300009101 Bacteria 1929
191 Ga0105243_10221031 3300009148 Bacteria 1674
192 Ga0105241_10511434 3300009174 Bacteria 1072
193 Ga0105241_10977529 3300009174 Unclassified 791
194 Ga0105241_11380320 3300009174 Bacteria 674
195 Ga0105242_10235724 3300009176 Bacteria 1642
196 Ga0105242_10940489 3300009176 Bacteria 867
197 Ga0105242_12430828 3300009176 Bacteria 572
198 Ga0105248_10009594 3300009177 Bacteria 10655
199 Ga0105248_10128534 3300009177 Bacteria 2858
200 Ga0105248_10840293 3300009177 Bacteria 1036
201 Ga0105248_12128578 3300009177 Bacteria 638
202 Ga0105237_10042034 3300009545 Bacteria 4609
203 Ga0105237_10126238 3300009545 Bacteria 2553
204 Ga0105237_10174659 3300009545 Bacteria 2149
205 Ga0105237_10184617 3300009545 Bacteria 2086
206 Ga0105237_10257587 3300009545 Bacteria 1747
207 Ga0105237_10532929 3300009545 Bacteria 1181
208 Ga0105237_10684654 3300009545 Bacteria 1032
209 Ga0105238_10028484 3300009551 Bacteria 5691
210 Ga0105238_10051155 3300009551 Bacteria 4156
211 Ga0105238_10074351 3300009551 Bacteria 3391
212 Ga0105238_10184388 3300009551 Bacteria 2064
213 Ga0105238_10247466 3300009551 Bacteria 1760
214 Ga0105238_10563976 3300009551 Bacteria 1144
215 Ga0105238_10595445 3300009551 Bacteria 1113
216 Ga0105238_12399678 3300009551 Bacteria 563
217 Ga0105249_10016560 3300009553 Bacteria 6542
218 Ga0105249_10035426 3300009553 Bacteria 4527
219 Ga0105249_11263752 3300009553 Bacteria 810
220 Ga0105249_12913368 3300009553 Bacteria 549
221 Ga0105239_10057650 3300010375 Bacteria 4261
222 Ga0105239_10297273 3300010375 Bacteria 1818
223 Ga0105239_10492090 3300010375 Bacteria 1394
224 Ga0105239_11243597 3300010375 Bacteria 858
225 Ga0105246_10159677 3300011119 Bacteria 1716
226 Ga0105246_11116964 3300011119 Bacteria 721
227 Ga0157370_10437857 3300013104 Bacteria 1202
228 Ga0157369_10221063 3300013105 Bacteria 1983
229 Ga0157374_10217701 3300013296 Bacteria 1873
230 Ga0157374_10425174 3300013296 Bacteria 1327
231 Ga0163162_10311412 3300013306 Bacteria 1707
232 Ga0157372_10244458 3300013307 Bacteria 2082
233 Ga0163163_10073713 3300014325 Bacteria 3405
234 Ga0157380_10008850 3300014326 Bacteria 7193
235 Ga0157380_10269866 3300014326 Bacteria 1550
236 Ga0157379_10062199 3300014968 Bacteria 3339
237 Ga0157379_10377527 3300014968 Bacteria 1300
238 Ga0157379_10959339 3300014968 Bacteria 814
239 Ga0157376_10546009 3300014969 Bacteria 1146
240 Ga0163161_10022467 3300017792 Bacteria 4443
241 Ga0163161_10249882 3300017792 Bacteria 1382
242 Ga0163161_10542000 3300017792 Bacteria 952
243 Ga0206353_10448061 3300020082 Bacteria 769
244 Ga0154015_1344946 3300020610 Bacteria 582
245 Ga0213873_10013896 3300021358 Bacteria 1775
246 Ga0213872_10000119 3300021361 Bacteria 73666
247 Ga0213872_10000660 3300021361 Bacteria 26162
248 Ga0213872_10002314 3300021361 Bacteria 11358
249 Ga0213872_10003898 3300021361 Bacteria 8099
250 Ga0213872_10032146 3300021361 Bacteria 2405
251 Ga0213872_10061338 3300021361 Bacteria 1700
252 Ga0213872_10095690 3300021361 Bacteria 1326
253 Ga0213872_10156638 3300021361 Bacteria 992
254 Ga0213874_10145920 3300021377 Unclassified 822
255 Ga0213876_10008226 3300021384 Bacteria 5644
256 Ga0213876_10161123 3300021384 Bacteria 1193
257 Ga0213871_10014922 3300021441 Bacteria 1850
258 Ga0209437_101642 3300025233 Bacteria 5074
259 Ga0207425_1000461 3300025245 Bacteria 26109
260 Ga0207425_1088317 3300025245 Bacteria 509
261 Ga0209677_101787 3300025253 Bacteria 8887
262 Ga0209148_1008207 3300025254 Bacteria 2111
263 Ga0209148_1022875 3300025254 Bacteria 1000
264 Ga0209129_1000327 3300025258 Bacteria 41506
265 Ga0209233_1000044 3300025261 Bacteria 489783
266 Ga0209233_1003858 3300025261 Bacteria 5219
267 Ga0209565_1000052 3300025263 Bacteria 212056
268 Ga0209565_1028698 3300025263 Bacteria 1097
269 Ga0209455_1009381 3300025272 Bacteria 2575
270 Ga0209455_1010385 3300025272 Bacteria 2370
271 Ga0209673_1015739 3300025273 Bacteria 2857
272 Ga0209675_1000025 3300025291 Bacteria 294102
273 Ga0209676_1000221 3300025292 Bacteria 124715
274 Ga0209676_1000228 3300025292 Bacteria 123024
275 Ga0209676_1002468 3300025292 Bacteria 13057
276 Ga0209676_1078273 3300025292 Bacteria 761
277 Ga0209025_1001791 3300025294 Bacteria 25501
278 Ga0209025_1035515 3300025294 Bacteria 2251
279 Ga0209564_1009372 3300025295 Bacteria 4670
280 Ga0209564_1013638 3300025295 Bacteria 3432
281 Ga0209758_1000002 3300025297 Bacteria 1400310
282 Ga0209758_1000005 3300025297 Bacteria 1368918
283 Ga0209758_1000017 3300025297 Bacteria 754393
284 Ga0209758_1016463 3300025297 Bacteria 3754
285 Ga0209758_1028594 3300025297 Bacteria 2352
286 Ga0209050_1000001 3300025298 Bacteria 3563507
287 Ga0209050_1000042 3300025298 Bacteria 402842
288 Ga0209050_1000071 3300025298 Bacteria 295478
289 Ga0209050_1001886 3300025298 Bacteria 20130
290 Ga0209050_1015417 3300025298 Bacteria 3212
291 Ga0209050_1029003 3300025298 Bacteria 1781
292 Ga0207426_1011633 3300025302 Bacteria 3341
293 Ga0207426_1105283 3300025302 Bacteria 721
294 Ga0209051_1000297 3300025303 Bacteria 79062
295 Ga0209257_1000027 3300025304 Bacteria 703541
296 Ga0209257_1000135 3300025304 Bacteria 205668
297 Ga0209257_1000229 3300025304 Bacteria 133121
298 Ga0209257_1001829 3300025304 Bacteria 23270
299 Ga0209257_1001894 3300025304 Bacteria 22612
300 Ga0209257_1003342 3300025304 Bacteria 13875
301 Ga0207713_1004263 3300025735 Bacteria 9336
302 Ga0207713_1033482 3300025735 Bacteria 2244
303 Ga0207692_10043937 3300025898 Bacteria 2227
304 Ga0207692_10083142 3300025898 Bacteria 1717
305 Ga0207710_10684554 3300025900 Bacteria 538
306 Ga0207680_10071427 3300025903 Bacteria 2152
307 Ga0207680_10138961 3300025903 Bacteria 1609
308 Ga0207680_10203491 3300025903 Bacteria 1350
309 Ga0207685_10028613 3300025905 Bacteria 1964
310 Ga0207685_10655604 3300025905 Bacteria 568
311 Ga0207699_10010077 3300025906 Bacteria 4728
312 Ga0207699_10065501 3300025906 Bacteria 2203
313 Ga0207699_11266092 3300025906 Bacteria 546
314 Ga0207705_11032903 3300025909 Bacteria 634
315 Ga0207707_10002658 3300025912 Bacteria 15980
316 Ga0207707_10071401 3300025912 Bacteria 3025
317 Ga0207707_10144774 3300025912 Bacteria 2077
318 Ga0207695_10538634 3300025913 Bacteria 1049
319 Ga0207695_11670869 3300025913 Bacteria 518
320 Ga0207671_10067180 3300025914 Bacteria 2670
321 Ga0207671_10168284 3300025914 Bacteria 1701
322 Ga0207671_10475594 3300025914 Bacteria 996
323 Ga0207671_10509367 3300025914 Bacteria 959
324 Ga0207671_11461016 3300025914 Bacteria 529
325 Ga0207693_10098570 3300025915 Bacteria 2292
326 Ga0207693_10109179 3300025915 Bacteria 2170
327 Ga0207693_10117782 3300025915 Bacteria 2085
328 Ga0207693_10126768 3300025915 Bacteria 2006
329 Ga0207693_10200851 3300025915 Bacteria 1568
330 Ga0207663_10011331 3300025916 Bacteria 4786
331 Ga0207663_10036387 3300025916 Bacteria 2961
332 Ga0207660_10244669 3300025917 Bacteria 1414
333 Ga0207657_10209412 3300025919 Bacteria 1565
334 Ga0207657_10834300 3300025919 Bacteria 712
335 Ga0207652_10280822 3300025921 Bacteria 1502
336 Ga0207681_10000336 3300025923 Bacteria 33758
337 Ga0207681_10001866 3300025923 Bacteria 13505
338 Ga0207694_10015844 3300025924 Bacteria 5686
339 Ga0207694_10046214 3300025924 Bacteria 3365
340 Ga0207694_10293096 3300025924 Bacteria 1338
341 Ga0207694_10547196 3300025924 Bacteria 971
342 Ga0207694_10782955 3300025924 Bacteria 806
343 Ga0207694_11403348 3300025924 Bacteria 590
344 Ga0207650_10045454 3300025925 Bacteria 3230
345 Ga0207687_10012572 3300025927 Bacteria 5529
346 Ga0207700_10022828 3300025928 Bacteria 4299
347 Ga0207700_10027564 3300025928 Bacteria 3981
348 Ga0207700_10030799 3300025928 Bacteria 3804
349 Ga0207700_10256606 3300025928 Bacteria 1495
350 Ga0207664_10045578 3300025929 Bacteria 3439
351 Ga0207664_10119582 3300025929 Bacteria 2203
352 Ga0207664_10131807 3300025929 Bacteria 2105
353 Ga0207644_10001624 3300025931 Bacteria 14492
354 Ga0207644_10296244 3300025931 Bacteria 1302
355 Ga0207644_10712744 3300025931 Bacteria 837
356 Ga0207665_10000976 3300025939 Bacteria 19353
357 Ga0207665_10160349 3300025939 Bacteria 1617
358 Ga0207665_10976579 3300025939 Bacteria 673
359 Ga0207711_10028200 3300025941 Bacteria 4723
360 Ga0207711_10314840 3300025941 Bacteria 1445
361 Ga0207711_10700835 3300025941 Bacteria 944
362 Ga0207661_10258099 3300025944 Bacteria 1551
363 Ga0207661_10475759 3300025944 Bacteria 1140
364 Ga0207661_10934771 3300025944 Bacteria 799
365 Ga0207679_10751363 3300025945 Bacteria 887
366 Ga0207667_10634414 3300025949 Bacteria 1075
367 Ga0207712_10008807 3300025961 Bacteria 6379
368 Ga0207712_10067851 3300025961 Bacteria 2554
369 Ga0207712_10207620 3300025961 Bacteria 1558
370 Ga0207712_11536900 3300025961 Bacteria 596
371 Ga0207668_10010776 3300025972 Bacteria 5536
372 Ga0207668_10013861 3300025972 Bacteria 4978
373 Ga0207668_10184044 3300025972 Bacteria 1650
374 Ga0207668_10592281 3300025972 Bacteria 965
375 Ga0207668_10818030 3300025972 Bacteria 825
376 Ga0207640_10085705 3300025981 Bacteria 2167
377 Ga0207640_10183096 3300025981 Bacteria 1572
378 Ga0207658_10001483 3300025986 Bacteria 18220
379 Ga0207658_10034488 3300025986 Bacteria 3617
380 Ga0207658_10123356 3300025986 Bacteria 2069
381 Ga0207658_10771279 3300025986 Bacteria 872
382 Ga0207677_10248166 3300026023 Bacteria 1444
383 Ga0207703_10007705 3300026035 Bacteria 8526
384 Ga0207703_10188703 3300026035 Bacteria 1824
385 Ga0207703_10592531 3300026035 Bacteria 1048
386 Ga0207703_12265253 3300026035 Bacteria 519
387 Ga0207639_10075641 3300026041 Bacteria 2648
388 Ga0207639_10211713 3300026041 Bacteria 1669
389 Ga0207639_10388792 3300026041 Bacteria 1254
390 Ga0207639_10446323 3300026041 Bacteria 1174
391 Ga0207639_10560160 3300026041 Bacteria 1050
392 Ga0207678_10014682 3300026067 Bacteria 6891
393 Ga0207678_10176765 3300026067 Bacteria 1823
394 Ga0207702_10920852 3300026078 Bacteria 866
395 Ga0207702_12063245 3300026078 Bacteria 560
396 Ga0207641_10000078 3300026088 Bacteria 143842
397 Ga0207641_10494114 3300026088 Bacteria 1187
398 Ga0207676_10000420 3300026095 Bacteria 35827
399 Ga0207676_10128799 3300026095 Bacteria 2148
400 Ga0207676_10295353 3300026095 Bacteria 1477
401 Ga0207674_10072137 3300026116 Bacteria 3469
402 Ga0207674_10504362 3300026116 Bacteria 1169
403 Ga0207675_100190919 3300026118 Bacteria 1965
404 Ga0207698_10467043 3300026142 Bacteria 1221
405 Ga0207698_11112089 3300026142 Bacteria 803
406 Ga0209281_1010983 3300027111 Bacteria 2045
407 Ga0268266_10000462 3300028379 Bacteria 59105
408 Ga0268266_10177980 3300028379 Bacteria 1935
409 Ga0268266_10197593 3300028379 Bacteria 1839
410 Ga0268266_10228388 3300028379 Bacteria 1713
411 Ga0268265_10624763 3300028380 Bacteria 1032
412 Ga0268265_11506436 3300028380 Bacteria 676
413 Ga0268264_10000380 3300028381 Bacteria 64910
414 Ga0268264_10013595 3300028381 Bacteria 6700
415 Ga0268264_10064855 3300028381 Unclassified 3075
416 Ga0268264_11092426 3300028381 Bacteria 806
417 Ga0268264_11893108 3300028381 Bacteria 606
418 Ga0265337_1026672 3300028556 Bacteria 1748
419 Ga0265326_10006199 3300028558 Bacteria 3730
420 Ga0265319_1019753 3300028563 Bacteria 2509
421 Ga0265334_10096688 3300028573 Bacteria 1072
422 Ga0265318_10062097 3300028577 Bacteria 1391
423 Ga0265323_10002721 3300028653 Bacteria 7967
424 Ga0265336_10000661 3300028666 Bacteria 18756
425 Ga0307517_10111281 3300028786 Bacteria 2082
426 Ga0307517_10332500 3300028786 Bacteria 834
427 Ga0265338_10004433 3300028800 Bacteria 18963
428 Ga0265324_10003042 3300029957 Bacteria 8197
429 Ga0307511_10078058 3300030521 Bacteria 2351
430 Ga0314311_1103907 3300030733 Bacteria 1668
431 Ga0265330_10067230 3300031235 Bacteria 1553
432 Ga0265328_10302791 3300031239 Bacteria 617
433 Ga0265340_10017095 3300031247 Bacteria 3751
434 Ga0265339_10002135 3300031249 Bacteria 14404
435 Ga0265316_10018719 3300031344 Bacteria 5946
436 Ga0307513_10040717 3300031456 Bacteria 5135
437 Ga0265313_10005700 3300031595 Bacteria 9082
438 Ga0265342_10006876 3300031712 Bacteria 8406
439 Ga0316576_10009408 3300031727 Bacteria 6303
440 Ga0307413_10379862 3300031824 Bacteria 1100
441 Ga0307413_12198305 3300031824 Bacteria 500
442 Ga0307410_10599532 3300031852 Bacteria 919
443 Ga0307410_11527634 3300031852 Bacteria 589
444 Ga0307406_10130544 3300031901 Bacteria 1763
445 Ga0307406_10379585 3300031901 Bacteria 1114
446 Ga0307406_10814546 3300031901 Bacteria 789
447 Ga0307416_100924604 3300032002 Bacteria 973
448 Ga0307416_103599957 3300032002 Bacteria 518
449 Ga0307414_10018906 3300032004 Bacteria 4257
450 Ga0307414_10370884 3300032004 Bacteria 1234
451 Ga0307414_10686162 3300032004 Bacteria 926
452 Ga0307414_11039439 3300032004 Bacteria 755
453 Ga0307411_10242061 3300032005 Bacteria 1413
454 Ga0307411_10814350 3300032005 Bacteria 823
455 Ga0307411_10930565 3300032005 Bacteria 774
456 Ga0307510_10001188 3300033180 Bacteria 28138
457 Ga0307510_10009411 3300033180 Bacteria 11641
458 Ga0316596_1024383 3300033541 Bacteria 1553
459 Ga0373923_0099251 3300035111 Bacteria 1282
460 Ga0373936_0034305 3300035113 Bacteria 2015
461 Ga0373936_0038214 3300035113 Bacteria 1918
462 Ga0373945_0157692 3300035116 Bacteria 923
463 Ga0373954_0044080 3300035118 Bacteria 2081
464 Ga0373956_0010743 3300035119 Bacteria 3760
465 Ga0373943_0031224 3300035170 Bacteria 2526
466 Ga0373946_0330395 3300035171 Bacteria 759
467 Ga0373955_0078991 3300035172 Bacteria 1855
468 Ga0373924_0389448 3300035410 Bacteria 622
469 Ga0373931_0676333 3300035691 Bacteria 680
470 Ga0373935_0036452 3300035692 Bacteria 3075
471 Ga0373935_0101394 3300035692 Bacteria 1898
472 Ga0373935_0410667 3300035692 Bacteria 973
473 Ga0373927_0071440 3300035695 Bacteria 2246
474 Ga0373927_0141393 3300035695 Bacteria 1574
475 Ga0373927_0744352 3300035695 Bacteria 647
476 Ga0373933_0018114 3300035724 Bacteria 3957
477 Ga0373947_0263042 3300035725 Bacteria 1143
478 Ga0373937_0183822 3300036401 Bacteria 1963
479 Ga0373937_0214072 3300036401 Bacteria 1813
480 Ga0372808_033289 3300036459 Bacteria 739
481 Ga0373925_0089108 3300037068 Bacteria 2356
482 Ga0373925_0116422 3300037068 Bacteria 2070
483 Ga0373925_0152205 3300037068 Bacteria 1817
484 Ga0395899_0038201 3300037312 Bacteria 3597
485 Ga0395900_0074422 3300037418 Bacteria 3492
486 Ga0395900_0111866 3300037418 Bacteria 2804
487 Ga0395898_0087501 3300037466 Bacteria 3001
488 Ga0395905_0127369 3300037471 Bacteria 2394
489 Ga0395905_0818640 3300037471 Bacteria 834
490 Ga0436364_0701650 3300037853 Bacteria 8124
491 Ga0395901_0008255 3300038443 Bacteria 10523
492 Ga0395901_1059370 3300038443 Bacteria 783
493 Ga0395901_1847133 3300038443 Bacteria 553
494 Ga0400486_12864 3300038742 Bacteria 1962
495 Ga0436365_0815982 3300039437 Bacteria 1305
496 Ga0436365_1095754 3300039437 Bacteria 43052
497 Ga0436365_1707348 3300039437 Bacteria 3485
498 Ga0436360_0458992 3300039438 Bacteria 1121
499 Ga0436360_0630509 3300039438 Bacteria 1511
500 Ga0436360_0813945 3300039438 Bacteria 4345
501 Ga0436360_1300343 3300039438 Bacteria 977
502 Ga0436361_0033458 3300039447 Bacteria 563
503 Ga0436361_0067631 3300039447 Bacteria 62801
504 Ga0436361_0080624 3300039447 Bacteria 1826
505 Ga0436361_0120999 3300039447 Bacteria 7582
506 Ga0436361_0193989 3300039447 Bacteria 823
507 Ga0436361_0229583 3300039447 Bacteria 1092
508 Ga0436361_0241172 3300039447 Bacteria 1970
509 Ga0436361_0419875 3300039447 Bacteria 3848
510 Ga0436361_0430273 3300039447 Bacteria 992
511 Ga0436361_0543398 3300039447 Bacteria 1054
512 Ga0436361_0659391 3300039447 Bacteria 5192
513 Ga0436361_0660497 3300039447 Bacteria 1569
514 Ga0436361_0670518 3300039447 Bacteria 3422
515 Ga0436361_0867004 3300039447 Bacteria 10526
516 Ga0436361_0969043 3300039447 Bacteria 1038
517 Ga0436361_1115532 3300039447 Bacteria 2477
518 Ga0436361_1168992 3300039447 Bacteria 1260
519 Ga0436361_1181218 3300039447 Bacteria 870
520 Ga0436361_1193675 3300039447 Bacteria 723
521 Ga0436363_0004057 3300039450 Bacteria 904
522 Ga0436363_0243146 3300039450 Bacteria 1481
523 Ga0436363_0368964 3300039450 Bacteria 4916
524 Ga0436363_0592501 3300039450 Bacteria 656
525 Ga0436363_0641523 3300039450 Bacteria 1051
526 Ga0436363_1385665 3300039450 Bacteria 1133
527 Ga0436362_0143304 3300039453 Bacteria 5230
528 Ga0436362_0217235 3300039453 Bacteria 613
529 Ga0436362_0616710 3300039453 Bacteria 568
530 Ga0439461_0000157 3300041410 Bacteria 9230
531 Ga0439466_0099166 3300041411 Bacteria 909
532 Ga0439465_0001520 3300041413 Bacteria 7534
533 Ga0451793_1167052 3300041452 Bacteria 887
534 Ga0451800_0210168 3300041459 Bacteria 612
535 Ga0451806_017109 3300041462 Bacteria 1268
536 Ga0451807_1376495 3300041486 Bacteria 1447
537 Ga0451833_0151526 3300041491 Bacteria 874
538 Ga0451845_0678984 3300041501 Bacteria 1274
539 Ga0451847_0607255 3300041503 Bacteria 1021
540 Ga0451843_0743624 3300041509 Bacteria 1257
541 Ga0451853_0787389 3300041512 Bacteria 1484
542 Ga0451853_2451500 3300041512 Bacteria 988
543 Ga0439431_0000015 3300041997 Bacteria 27396
544 Ga0439442_001146 3300042002 Bacteria 5297
545 Ga0439445_0000834 3300042004 Bacteria 6512
546 Ga0439432_000156 3300042006 Bacteria 23244
547 Ga0439452_029791 3300042010 Bacteria 1351
548 Ga0439462_0000128 3300042015 Bacteria 11958
549 Ga0439434_0001220 3300042435 Bacteria 7404
550 Ga0451577_0948068 3300042876 Bacteria 774
551 Ga0466966_0740239 3300044684 Bacteria 593
552 Ga0466963_0511134 3300044694 Bacteria 848
553 Ga0466964_0087797 3300044706 Bacteria 1348
554 Ga0466959_0165881 3300045049 Bacteria 1551
555 Ga0466959_0405516 3300045049 Bacteria 926
556 Ga0466959_1177486 3300045049 Bacteria 509
557 Ga0466958_0984210 3300045836 Bacteria 550
558 Ga0466967_0302347 3300045976 Bacteria 1539
559 Ga0466967_0328329 3300045976 Bacteria 1477
560 Ga0466967_0379381 3300045976 Bacteria 1372
561 Ga0466967_1859959 3300045976 Bacteria 599
562 Ga0495603_0693965 3300046455 Bacteria 582
563 Ga0495629_0052144 3300046459 Bacteria 2863
564 Ga0495638_0226492 3300046460 Bacteria 1042
565 Ga0495653_0304560 3300046463 Bacteria 1038
566 Ga0495650_0002418 3300046471 Bacteria 15184
567 Ga0495650_0188459 3300046471 Bacteria 722
568 Ga0495580_0002795 3300046472 Bacteria 15019
569 Ga0495582_0268381 3300046473 Bacteria 979
570 Ga0495582_0469021 3300046473 Bacteria 727
571 Ga0495664_0079627 3300046477 Bacteria 1963
572 Ga0495664_0163724 3300046477 Bacteria 1349
573 Ga0495664_0177960 3300046477 Bacteria 1290
574 Ga0495583_0042528 3300046506 Bacteria 2121
575 Ga0495606_0050886 3300046507 Bacteria 2706
576 Ga0495606_0057434 3300046507 Bacteria 2506
577 Ga0495610_0001298 3300046512 Bacteria 22266
578 Ga0495610_0004939 3300046512 Bacteria 9667
579 Ga0495618_0243287 3300046514 Bacteria 1130
580 Ga0495620_0039396 3300046515 Bacteria 2088
581 Ga0495630_0342175 3300046517 Bacteria 1144
582 Ga0495632_0000989 3300046519 Bacteria 24804
583 Ga0495632_0005897 3300046519 Bacteria 7997
584 Ga0495632_0233036 3300046519 Unclassified 830
585 Ga0495643_0000217 3300046522 Bacteria 88279
586 Ga0495643_0059132 3300046522 Bacteria 2038
587 Ga0495643_0239338 3300046522 Bacteria 852
588 Ga0495648_0123539 3300046524 Bacteria 1387
589 Ga0495663_0000020 3300046525 Bacteria 124560
590 Ga0495666_0304448 3300046526 Bacteria 720
591 Ga0495642_0180344 3300046528 Bacteria 919
592 Ga0495654_0035543 3300046530 Bacteria 2508
593 Ga0495665_0033419 3300046531 Bacteria 2751
594 Ga0495640_0032013 3300046533 Bacteria 3749
595 Ga0495597_0176609 3300046542 Bacteria 865
596 Ga0495645_0068373 3300046543 Bacteria 2564
597 Ga0495633_0002856 3300046558 Bacteria 11862
598 Ga0495633_0006780 3300046558 Bacteria 6722
599 Ga0495667_0337242 3300046559 Bacteria 953
600 Ga0495668_0072625 3300046616 Bacteria 1890
601 Ga0495625_0028456 3300046660 Bacteria 4191
602 Ga0495625_0198397 3300046660 Bacteria 1326
603 Ga0495625_0474738 3300046660 Bacteria 769
604 Ga0495635_0026497 3300046663 Bacteria 4033
605 Ga0495599_0325152 3300046678 Bacteria 925
606 Ga0495647_0345779 3300046681 Bacteria 676
607 Ga0495658_0006493 3300046683 Bacteria 5745
608 Ga0495613_0753613 3300046689 Bacteria 638
609 Ga0495624_0335536 3300046690 Bacteria 910
610 Ga0495670_0000033 3300046691 Bacteria 81716
611 Ga0495670_0032461 3300046691 Bacteria 2597
612 Ga0495670_0044328 3300046691 Bacteria 2221
613 Ga0495670_0334791 3300046691 Bacteria 813
614 Ga0495581_0736715 3300047315 Bacteria 567
615 Ga0495674_0158783 3300047319 Bacteria 1893
616 Ga0495676_0153977 3300047321 Bacteria 1633
617 Ga0495683_0221725 3300047323 Bacteria 843
618 Ga0495677_0042316 3300047445 Bacteria 1668
619 Ga0495681_0001886 3300047470 Bacteria 15394
620 Ga0495684_0037420 3300047471 Bacteria 3721
621 Ga0495686_0000182 3300047472 Bacteria 119682
622 Ga0495686_0001777 3300047472 Bacteria 21960
623 Ga0495686_0002610 3300047472 Bacteria 16704
624 Ga0495686_0156238 3300047472 Bacteria 1336
625 Ga0495686_0157289 3300047472 Bacteria 1330
626 Ga0495593_0182816 3300047673 Bacteria 1056
627 Ga0495593_0208084 3300047673 Bacteria 982
628 Ga0495593_0602236 3300047673 Bacteria 552
629 Ga0496100_0028246 3300048903 Bacteria 3458
630 Ga0496100_0068809 3300048903 Bacteria 2356
631 Ga0496100_0198944 3300048903 Bacteria 1459
632 Ga0496100_0435705 3300048903 Bacteria 1003
633 Ga0496101_0077983 3300048904 Bacteria 2442
634 Ga0496101_0617338 3300048904 Bacteria 857
635 Ga0496102_0001012 3300048905 Bacteria 26288
636 Ga0496102_0150581 3300048905 Bacteria 2186
637 Ga0496102_0969020 3300048905 Bacteria 771
638 Ga0496103_0000246 3300048906 Bacteria 52692
639 Ga0496103_0227163 3300048906 Bacteria 1200
640 Ga0496103_0639758 3300048906 Bacteria 676
641 Ga0496103_0818047 3300048906 Bacteria 587
642 Ga0496104_0000227 3300048907 Bacteria 49451
643 Ga0496105_0000158 3300048908 Bacteria 44955
644 Ga0496106_0521103 3300048909 Bacteria 954
645 Ga0496107_0112102 3300048910 Bacteria 2005
646 Ga0496107_0229831 3300048910 Bacteria 1380
647 Ga0496108_0002299 3300048911 Bacteria 15309
648 Ga0496108_0350757 3300048911 Bacteria 1288
649 Ga0496112_0002829 3300048915 Bacteria 14089
650 Ga0496112_0380285 3300048915 Bacteria 1353
651 Ga0496113_0000325 3300048916 Bacteria 22755
652 Ga0496115_1021277 3300048918 Bacteria 631
653 Ga0496116_0021850 3300048919 Bacteria 4813
654 Ga0496116_0034688 3300048919 Bacteria 3555
655 Ga0496116_0078456 3300048919 Bacteria 2059
656 Ga0496116_0331149 3300048919 Bacteria 707
657 Ga0496116_0400782 3300048919 Bacteria 607
658 Ga0496117_0005510 3300048920 Bacteria 13257
659 Ga0496117_0030787 3300048920 Bacteria 4109
660 Ga0496117_0073876 3300048920 Bacteria 2273
661 Ga0496117_0525765 3300048920 Bacteria 568
662 Ga0496117_0611950 3300048920 Bacteria 508
663 Ga0496118_0002103 3300048921 Bacteria 27954
664 Ga0496118_0020790 3300048921 Bacteria 5809
665 Ga0496118_0048902 3300048921 Bacteria 3261
666 Ga0496118_0055157 3300048921 Bacteria 3002
667 Ga0496118_0084326 3300048921 Bacteria 2217
668 Ga0496118_0106434 3300048921 Bacteria 1876
669 Ga0496118_0322036 3300048921 Bacteria 838
670 Ga0496119_0000040 3300048922 Bacteria 208180
671 Ga0496119_0015177 3300048922 Bacteria 5960
672 Ga0496119_0020742 3300048922 Bacteria 4775
673 Ga0496119_0026083 3300048922 Bacteria 4062
674 Ga0496119_0171639 3300048922 Bacteria 1145
675 Ga0496119_0174071 3300048922 Bacteria 1134
676 Ga0496120_0000731 3300048923 Bacteria 48124
677 Ga0496120_0016388 3300048923 Bacteria 4843
678 Ga0496120_0147763 3300048923 Bacteria 1185
679 Ga0496120_0187439 3300048923 Bacteria 1011
680 Ga0496121_0000123 3300048924 Bacteria 172448
681 Ga0496121_0004891 3300048924 Bacteria 17582
682 Ga0496121_0007534 3300048924 Bacteria 13124
683 Ga0496121_0039007 3300048924 Bacteria 4194
684 Ga0496121_0072125 3300048924 Bacteria 2773
685 Ga0496121_0091767 3300048924 Bacteria 2370
686 Ga0496121_0095250 3300048924 Bacteria 2314
687 Ga0496122_0002442 3300048925 Bacteria 26362
688 Ga0496122_0003506 3300048925 Bacteria 20608
689 Ga0496122_0141145 3300048925 Bacteria 1507
690 Ga0496123_0001478 3300048926 Bacteria 32621
691 Ga0496123_0004521 3300048926 Bacteria 14538
692 Ga0496123_0294850 3300048926 Bacteria 777
693 Ga0496124_0004810 3300048927 Bacteria 15546
694 Ga0496124_0026551 3300048927 Bacteria 5219
695 Ga0496124_0069946 3300048927 Bacteria 2912
696 Ga0496124_0179411 3300048927 Bacteria 1631
697 Ga0496124_0314881 3300048927 Bacteria 1123
698 Ga0496124_0419387 3300048927 Bacteria 923
699 Ga0496125_0000205 3300048928 Bacteria 124391
700 Ga0496125_0006420 3300048928 Bacteria 12709
701 Ga0496125_0009566 3300048928 Bacteria 9931
702 Ga0496125_0017019 3300048928 Bacteria 6950
703 Ga0496125_0051422 3300048928 Bacteria 3398
704 Ga0496125_0060959 3300048928 Bacteria 3029
705 Ga0496125_0147758 3300048928 Bacteria 1621
706 Ga0496125_0148995 3300048928 Bacteria 1611
707 Ga0496125_0260140 3300048928 Bacteria 1088
708 Ga0496125_0270452 3300048928 Bacteria 1059
709 Ga0496125_0333183 3300048928 Bacteria 914
710 Ga0496125_0380740 3300048928 Bacteria 832
711 Ga0496125_0428620 3300048928 Bacteria 764
712 Ga0496126_0000044 3300048929 Bacteria 335904
713 Ga0496126_0046438 3300048929 Bacteria 3983
714 Ga0496126_0071283 3300048929 Bacteria 3093
715 Ga0496126_0081674 3300048929 Bacteria 2857
716 Ga0496126_0280298 3300048929 Bacteria 1381
717 Ga0496126_0295856 3300048929 Bacteria 1337
718 Ga0496126_0363117 3300048929 Bacteria 1182
719 Ga0496126_0839145 3300048929 Bacteria 702
720 Ga0501033_0096538 3300049570 Bacteria 2160
721 Ga0501034_0074018 3300049571 Bacteria 3415
722 Ga0501036_0207523 3300049572 Bacteria 1647
723 Ga0501039_0052158 3300049575 Bacteria 3165
724 Ga0501040_1440739 3300049576 Bacteria 500
725 Ga0501041_0068976 3300049577 Bacteria 2168
726 Ga0501042_0233453 3300049578 Bacteria 1327
727 Ga0501042_0378532 3300049578 Bacteria 1025
728 Ga0501043_1202228 3300049579 Bacteria 532
729 Ga0501046_0350514 3300049580 Bacteria 1072
730 Ga0501047_0044436 3300049581 Bacteria 4292
731 Ga0501047_0257298 3300049581 Bacteria 1594
732 Ga0501047_0846180 3300049581 Bacteria 729
733 Ga0501048_0000652 3300049582 Bacteria 24980
734 Ga0501070_0012367 3300049586 Bacteria 7199
735 Ga0501074_0393242 3300049590 Bacteria 983
736 Ga0501075_0151211 3300049591 Bacteria 1769
737 Ga0501077_0210483 3300049593 Bacteria 1235
738 Ga0501224_010896 3300049664 Bacteria 1335
739 Ga0501079_0056414 3300049741 Bacteria 3031
740 Ga0501080_0591613 3300049742 Bacteria 985
741 Ga0501081_0043910 3300049743 Bacteria 3067
742 Ga0501081_0104227 3300049743 Bacteria 2008
743 Ga0501083_0890265 3300049744 Bacteria 579
744 Ga0501035_0629207 3300049822 Bacteria 872
745 Ga0501044_0463473 3300049823 Bacteria 1172
746 Ga0501044_1021603 3300049823 Bacteria 698
747 Ga0501045_0533993 3300049824 Bacteria 870
748 nmdc:mga0yw44_152970_c1 3300050492 Bacteria 1506
749 nmdc:mga0yw44_7389_c1 3300050492 Bacteria 5402
750 nmdc:mga07m45_852321_c1 3300050496 Bacteria 522
751 nmdc:mga07m45_895112_c1 3300050496 Bacteria 508
752 nmdc:mga05p37_1186373_c1 3300050507 Bacteria 790
753 nmdc:mga09592_59967_c1 3300050508 Bacteria 3217
754 nmdc:mga0qj67_11371_c1 3300050509 Bacteria 6669
755 nmdc:mga0qj67_676320_c1 3300050509 Bacteria 822
756 nmdc:mga06r32_142172_c1 3300050510 Bacteria 2377
757 nmdc:mga0sz30_75519_c1 3300050516 Bacteria 1454
758 Ga0495601_0067983 3300053077 Bacteria 2270
759 Ga0495601_0227859 3300053077 Bacteria 1217
760 Ga0495612_0033254 3300053078 Bacteria 2086
761 Ga0495612_0253370 3300053078 Bacteria 783
762 Ga0495655_0298167 3300053083 Bacteria 553
763 Ga0495619_0393005 3300053085 Bacteria 958
764 Ga0495619_0679261 3300053085 Bacteria 701
765 Ga0500578_0197257 3300053086 Bacteria 1233
766 Ga0500643_002186 3300053087 Bacteria 10330
767 Ga0500644_0141251 3300053088 Bacteria 957
768 Ga0500644_0160254 3300053088 Bacteria 909
769 Ga0500646_0055461 3300053090 Bacteria 1154
770 Ga0500647_0225328 3300053091 Bacteria 837
771 Ga0500647_0280580 3300053091 Bacteria 720
772 Ga0500647_0340996 3300053091 Bacteria 627
773 Ga0500583_0245709 3300053092 Bacteria 884
774 Ga0500583_0320631 3300053092 Bacteria 755
775 Ga0500651_0018767 3300053093 Bacteria 4284
776 Ga0500651_0687012 3300053093 Unclassified 548
777 Ga0500641_0013594 3300053096 Bacteria 2992
778 Ga0500556_0004926 3300053104 Bacteria 3781
779 Ga0500556_0136344 3300053104 Bacteria 963
780 Ga0500562_022490 3300053108 Bacteria 1643
781 Ga0500562_063979 3300053108 Bacteria 990
782 Ga0500591_037645 3300053115 Bacteria 2316
783 Ga0500592_058894 3300053116 Bacteria 627
784 Ga0500594_0006551 3300053118 Bacteria 2620
785 Ga0500594_0318946 3300053118 Bacteria 522
786 Ga0500595_001175 3300053119 Bacteria 14475
787 Ga0500595_103422 3300053119 Bacteria 814
788 Ga0500608_000128 3300053122 Bacteria 30980
789 Ga0500658_0302080 3300053134 Unclassified 736
790 Ga0500559_0008678 3300053136 Bacteria 4441
791 Ga0500559_0148768 3300053136 Bacteria 1098
792 Ga0500564_001139 3300053138 Bacteria 8860
793 Ga0500568_0001898 3300053139 Bacteria 12852
794 Ga0500573_0159684 3300053140 Bacteria 1228
795 Ga0500573_0217348 3300053140 Bacteria 1005
796 Ga0500603_010373 3300053150 Bacteria 2103
797 Ga0500604_0055717 3300053151 Bacteria 1230
798 Ga0500616_0010388 3300053153 Bacteria 5573
799 Ga0500616_0061287 3300053153 Bacteria 1948
800 Ga0500622_0040507 3300053156 Bacteria 2425
801 Ga0500627_0000031 3300053158 Bacteria 90831
802 Ga0500627_0081936 3300053158 Bacteria 1439
803 Ga0500639_110383 3300053163 Bacteria 1339
804 Ga0500636_0179420 3300053177 Bacteria 1138
805 Ga0500567_002483 3300053723 Bacteria 7930
806 Ga0500611_123954 3300053727 Bacteria 691
807 Ga0500625_000051 3300053729 Bacteria 24610
808 Ga0500645_000234 3300053730 Bacteria 41931
809 Ga0500645_054265 3300053730 Bacteria 1166
810 Ga0500601_004546 3300053737 Bacteria 1513
811 Ga0501084_1119772 3300054114 Bacteria 661
812 Ga0500661_005233 3300055283 Bacteria 2427
813 Ga0500661_111799 3300055283 Bacteria 524
814 Ga0590077_066733 3300059426 Bacteria 819
815 Ga0530510_0345981 3300061734 Bacteria 1116

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005356 Ga0070674_100187164 Ga0070674_1001871642 112
2 3300005456 Ga0070678_100085495 Ga0070678_1000854952 112
3 3300005440 Ga0070705_100079104 Ga0070705_1000791042 117
4 3300005546 Ga0070696_100013131 Ga0070696_1000131314 117
5 3300005549 Ga0070704_100046524 Ga0070704_1000465244 117
6 3300005844 Ga0068862_100255458 Ga0068862_1002554582 117
7 3300009553 Ga0105249_10016560 Ga0105249_100165603 117
8 3300025961 Ga0207712_10008807 Ga0207712_100088074 117
9 3300028380 Ga0268265_11506436 Ga0268265_115064362 117
10 3300054114 Ga0501084_1119772 Ga0501084_1119772_262_615 117
11 3300005456 Ga0070678_101377533 Ga0070678_1013775331 118
12 3300031235 Ga0265330_10067230 Ga0265330_100672302 118
13 3300031239 Ga0265328_10302791 Ga0265328_103027912 118
14 3300031247 Ga0265340_10017095 Ga0265340_100170952 118
15 3300031249 Ga0265339_10002135 Ga0265339_1000213510 118
16 3300031344 Ga0265316_10018719 Ga0265316_100187197 118
17 3300031595 Ga0265313_10005700 Ga0265313_1000570010 118
18 3300031712 Ga0265342_10006876 Ga0265342_100068762 118
19 3300031824 Ga0307413_12198305 Ga0307413_121983051 118
20 3300049571 Ga0501034_0074018 Ga0501034_0074018_1488_1844 118
21 3300049572 Ga0501036_0207523 Ga0501036_0207523_552_908 118
22 3300049576 Ga0501040_1440739 Ga0501040_1440739_89_445 118
23 3300049577 Ga0501041_0068976 Ga0501041_0068976_1778_2134 118
24 3300049578 Ga0501042_0233453 Ga0501042_0233453_697_1053 118
25 3300049591 Ga0501075_0151211 Ga0501075_0151211_658_1014 118
26 3300049741 Ga0501079_0056414 Ga0501079_0056414_1088_1444 118
27 3300049743 Ga0501081_0104227 Ga0501081_0104227_744_1100 118
28 3300049822 Ga0501035_0629207 Ga0501035_0629207_313_669 118
29 3300049824 Ga0501045_0533993 Ga0501045_0533993_352_708 118
30 3300061734 Ga0530510_0345981 Ga0530510_0345981_360_716 118
31 3300005290 Ga0065712_10452270 Ga0065712_104522701 119
32 3300005290 Ga0065712_10679218 Ga0065712_106792181 119
33 3300005328 Ga0070676_10046758 Ga0070676_100467583 119
34 3300005334 Ga0068869_101432346 Ga0068869_1014323461 119
35 3300005343 Ga0070687_100854571 Ga0070687_1008545712 119
36 3300005347 Ga0070668_100903627 Ga0070668_1009036271 119
37 3300005356 Ga0070674_100607304 Ga0070674_1006073042 119
38 3300005367 Ga0070667_100897979 Ga0070667_1008979792 119
39 3300005441 Ga0070700_100004668 Ga0070700_1000046688 119
40 3300005468 Ga0070707_100019597 Ga0070707_1000195972 119
41 3300005518 Ga0070699_100827470 Ga0070699_1008274702 119
42 3300005530 Ga0070679_101786375 Ga0070679_1017863751 119
43 3300005536 Ga0070697_100728931 Ga0070697_1007289311 119
44 3300005539 Ga0068853_100439152 Ga0068853_1004391523 119
45 3300005545 Ga0070695_100003309 Ga0070695_1000033091 119
46 3300005548 Ga0070665_100523629 Ga0070665_1005236292 119
47 3300005577 Ga0068857_101205282 Ga0068857_1012052822 119
48 3300005615 Ga0070702_101305134 Ga0070702_1013051341 119
49 3300005719 Ga0068861_100105602 Ga0068861_1001056021 119
50 3300005719 Ga0068861_100743177 Ga0068861_1007431772 119
51 3300005843 Ga0068860_100453064 Ga0068860_1004530641 119
52 3300005843 Ga0068860_102693611 Ga0068860_1026936112 119
53 3300005844 Ga0068862_100140692 Ga0068862_1001406924 119
54 3300005844 Ga0068862_101516253 Ga0068862_1015162532 119
55 3300005937 Ga0081455_10000028 Ga0081455_1000002894 119
56 3300006048 Ga0075363_100099126 Ga0075363_1000991263 119
57 3300006177 Ga0075362_10366830 Ga0075362_103668302 119
58 3300006178 Ga0075367_10419691 Ga0075367_104196912 119
59 3300006844 Ga0075428_100118734 Ga0075428_1001187343 119
60 3300006844 Ga0075428_100761957 Ga0075428_1007619572 119
61 3300006846 Ga0075430_100023915 Ga0075430_1000239156 119
62 3300006847 Ga0075431_100045525 Ga0075431_1000455252 119
63 3300006852 Ga0075433_10880284 Ga0075433_108802842 119
64 3300006852 Ga0075433_11097806 Ga0075433_110978062 119
65 3300006880 Ga0075429_100178803 Ga0075429_1001788033 119
66 3300009093 Ga0105240_12066597 Ga0105240_120665972 119
67 3300009148 Ga0105243_10221031 Ga0105243_102210313 119
68 3300009176 Ga0105242_10940489 Ga0105242_109404892 119
69 3300009177 Ga0105248_12128578 Ga0105248_121285781 119
70 3300009551 Ga0105238_10247466 Ga0105238_102474662 119
71 3300013104 Ga0157370_10437857 Ga0157370_104378572 119
72 3300014326 Ga0157380_10008850 Ga0157380_100088506 119
73 3300014326 Ga0157380_10269866 Ga0157380_102698662 119
74 3300014968 Ga0157379_10959339 Ga0157379_109593391 119
75 3300050507 nmdc:mga05p37_1186373_c1 nmdc:mga05p37_1186373_c1_16_393 119
76 3300050508 nmdc:mga09592_59967_c1 nmdc:mga09592_59967_c1_1394_1771 119
77 3300050509 nmdc:mga0qj67_11371_c1 nmdc:mga0qj67_11371_c1_2894_3271 119
78 3300050510 nmdc:mga06r32_142172_c1 nmdc:mga06r32_142172_c1_722_1099 119
79 3300003163 Ga0006759J45824_1076213 Ga0006759J45824_10762131 120
80 3300003308 Ga0006777J48905_1008095 Ga0006777J48905_10080952 120
81 3300003577 Ga0007416J51690_1070775 Ga0007416J51690_10707751 120
82 3300003579 Ga0007429J51699_1004743 Ga0007429J51699_10047432 120
83 3300005518 Ga0070699_100777744 Ga0070699_1007777442 120
84 3300005546 Ga0070696_100364406 Ga0070696_1003644062 120
85 3300005983 Ga0081540_1146814 Ga0081540_11468142 120
86 3300006844 Ga0075428_100629506 Ga0075428_1006295062 120
87 3300009174 Ga0105241_11380320 Ga0105241_113803202 120
88 3300025297 Ga0209758_1000005 Ga0209758_1000005947 120
89 3300025297 Ga0209758_1016463 Ga0209758_10164632 120
90 3300025919 Ga0207657_10209412 Ga0207657_102094121 120
91 3300028786 Ga0307517_10111281 Ga0307517_101112813 120
92 3300031456 Ga0307513_10040717 Ga0307513_100407173 120
93 3300031852 Ga0307410_10599532 Ga0307410_105995322 120
94 3300031852 Ga0307410_11527634 Ga0307410_115276341 120
95 3300031901 Ga0307406_10130544 Ga0307406_101305441 120
96 3300048927 Ga0496124_0069946 Ga0496124_0069946_1544_1906 120
97 3300049578 Ga0501042_0378532 Ga0501042_0378532_97_459 120
98 3300049744 Ga0501083_0890265 Ga0501083_0890265_50_412 120
99 3300053086 Ga0500578_0197257 Ga0500578_0197257_273_635 120
100 3300053088 Ga0500644_0160254 Ga0500644_0160254_487_849 120
101 3300053092 Ga0500583_0245709 Ga0500583_0245709_435_797 120
102 3300053093 Ga0500651_0018767 Ga0500651_0018767_993_1355 120
103 3300059426 Ga0590077_066733 Ga0590077_066733_287_652 120
104 3300003579 Ga0007429J51699_1114894 Ga0007429J51699_11148942 121
105 3300005330 Ga0070690_100061564 Ga0070690_1000615642 121
106 3300005435 Ga0070714_100014682 Ga0070714_1000146823 121
107 3300005435 Ga0070714_100449290 Ga0070714_1004492902 121
108 3300005436 Ga0070713_100063091 Ga0070713_1000630914 121
109 3300005436 Ga0070713_100070335 Ga0070713_1000703354 121
110 3300006028 Ga0070717_10109011 Ga0070717_101090113 121
111 3300006175 Ga0070712_100181203 Ga0070712_1001812032 121
112 3300006186 Ga0075369_10079358 Ga0075369_100793583 121
113 3300009093 Ga0105240_10344568 Ga0105240_103445683 121
114 3300021361 Ga0213872_10061338 Ga0213872_100613382 121
115 3300025906 Ga0207699_10065501 Ga0207699_100655012 121
116 3300025912 Ga0207707_10071401 Ga0207707_100714013 121
117 3300025915 Ga0207693_10126768 Ga0207693_101267683 121
118 3300025928 Ga0207700_10030799 Ga0207700_100307994 121
119 3300025928 Ga0207700_10256606 Ga0207700_102566062 121
120 3300025929 Ga0207664_10131807 Ga0207664_101318073 121
121 3300025986 Ga0207658_10771279 Ga0207658_107712791 121
122 3300028381 Ga0268264_10064855 Ga0268264_100648552 121
123 3300035692 Ga0373935_0101394 Ga0373935_0101394_1383_1748 121
124 3300039447 Ga0436361_0067631 Ga0436361_0067631_37133_37498 121
125 3300039447 Ga0436361_0659391 Ga0436361_0659391_497_862 121
126 3300039447 Ga0436361_0670518 Ga0436361_0670518_2407_2772 121
127 3300039447 Ga0436361_0867004 Ga0436361_0867004_8351_8716 121
128 3300039447 Ga0436361_1181218 Ga0436361_1181218_434_799 121
129 3300044694 Ga0466963_0511134 Ga0466963_0511134_259_624 121
130 3300045049 Ga0466959_0405516 Ga0466959_0405516_361_726 121
131 3300045836 Ga0466958_0984210 Ga0466958_0984210_59_424 121
132 3300048911 Ga0496108_0002299 Ga0496108_0002299_12269_12634 121
133 3300048919 Ga0496116_0034688 Ga0496116_0034688_2122_2487 121
134 3300048925 Ga0496122_0141145 Ga0496122_0141145_324_689 121
135 3300048926 Ga0496123_0294850 Ga0496123_0294850_24_389 121
136 3300048928 Ga0496125_0051422 Ga0496125_0051422_421_786 121
137 3300049570 Ga0501033_0096538 Ga0501033_0096538_1347_1712 121
138 3300049579 Ga0501043_1202228 Ga0501043_1202228_151_516 121
139 3300049593 Ga0501077_0210483 Ga0501077_0210483_589_954 121
140 3300049743 Ga0501081_0043910 Ga0501081_0043910_905_1270 121
141 3300049823 Ga0501044_1021603 Ga0501044_1021603_188_553 121
142 3300038742 Ga0400486_12864 Ga0400486_12864_930_1298 122
143 3300039438 Ga0436360_0458992 Ga0436360_0458992_387_755 122
144 3300039453 Ga0436362_0217235 Ga0436362_0217235_93_461 122
145 3300050516 nmdc:mga0sz30_75519_c1 nmdc:mga0sz30_75519_c1_442_810 122
146 2162886007 SwRhRL2b_contig_2144200 SwRhRL2b_0221.00003450 123
147 3300002774 JGI25150J39212_1000368 JGI25150J39212_100036819 123
148 3300003187 JGI25151J46595_10070633 JGI25151J46595_100706332 123
149 3300003215 JGI25153J46596_10000512 JGI25153J46596_1000051213 123
150 3300003763 Ga0055529_1018251 Ga0055529_10182511 123
151 3300003773 Ga0055537_1002263 Ga0055537_100226310 123
152 3300003773 Ga0055537_1004290 Ga0055537_10042901 123
153 3300003781 Ga0055536_1006517 Ga0055536_10065175 123
154 3300003781 Ga0055536_1007944 Ga0055536_10079444 123
155 3300003791 Ga0055530_10000013 Ga0055530_1000001340 123
156 3300003791 Ga0055530_10050136 Ga0055530_100501363 123
157 3300003794 Ga0055531_10000792 Ga0055531_100007924 123
158 3300003794 Ga0055531_10006790 Ga0055531_100067905 123
159 3300003794 Ga0055531_10010629 Ga0055531_100106294 123
160 3300005262 Ga0065165_1004494 Ga0065165_10044949 123
161 3300005262 Ga0065165_1072659 Ga0065165_10726592 123
162 3300005289 Ga0065704_10070230 Ga0065704_100702303 123
163 3300005335 Ga0070666_10067868 Ga0070666_100678682 123
164 3300005335 Ga0070666_10472965 Ga0070666_104729652 123
165 3300005336 Ga0070680_100175739 Ga0070680_1001757392 123
166 3300005336 Ga0070680_100195803 Ga0070680_1001958031 123
167 3300005337 Ga0070682_100090750 Ga0070682_1000907502 123
168 3300005338 Ga0068868_100049983 Ga0068868_1000499833 123
169 3300005339 Ga0070660_101092502 Ga0070660_1010925022 123
170 3300005341 Ga0070691_10106883 Ga0070691_101068833 123
171 3300005344 Ga0070661_100615352 Ga0070661_1006153522 123
172 3300005347 Ga0070668_100024056 Ga0070668_1000240567 123
173 3300005347 Ga0070668_100390240 Ga0070668_1003902402 123
174 3300005347 Ga0070668_100473182 Ga0070668_1004731822 123
175 3300005353 Ga0070669_100001396 Ga0070669_1000013965 123
176 3300005353 Ga0070669_100011083 Ga0070669_1000110836 123
177 3300005353 Ga0070669_100442699 Ga0070669_1004426992 123
178 3300005355 Ga0070671_100029627 Ga0070671_1000296274 123
179 3300005355 Ga0070671_100045828 Ga0070671_1000458284 123
180 3300005364 Ga0070673_100911838 Ga0070673_1009118382 123
181 3300005367 Ga0070667_100001289 Ga0070667_10000128914 123
182 3300005367 Ga0070667_100019541 Ga0070667_1000195414 123
183 3300005367 Ga0070667_100069757 Ga0070667_1000697572 123
184 3300005434 Ga0070709_10001423 Ga0070709_100014238 123
185 3300005434 Ga0070709_10208027 Ga0070709_102080272 123
186 3300005435 Ga0070714_100127032 Ga0070714_1001270323 123
187 3300005435 Ga0070714_100208010 Ga0070714_1002080102 123
188 3300005436 Ga0070713_100005847 Ga0070713_1000058474 123
189 3300005436 Ga0070713_100007642 Ga0070713_1000076424 123
190 3300005437 Ga0070710_10002139 Ga0070710_100021394 123
191 3300005437 Ga0070710_10034735 Ga0070710_100347353 123
192 3300005439 Ga0070711_100018016 Ga0070711_1000180162 123
193 3300005439 Ga0070711_100036221 Ga0070711_1000362213 123
194 3300005439 Ga0070711_100623857 Ga0070711_1006238571 123
195 3300005455 Ga0070663_100006533 Ga0070663_1000065332 123
196 3300005455 Ga0070663_100261983 Ga0070663_1002619832 123
197 3300005455 Ga0070663_102106566 Ga0070663_1021065661 123
198 3300005458 Ga0070681_10498576 Ga0070681_104985762 123
199 3300005467 Ga0070706_100003670 Ga0070706_10000367011 123
200 3300005468 Ga0070707_100673140 Ga0070707_1006731402 123
201 3300005471 Ga0070698_100008160 Ga0070698_1000081602 123
202 3300005518 Ga0070699_100001192 Ga0070699_10000119210 123
203 3300005530 Ga0070679_100752268 Ga0070679_1007522682 123
204 3300005536 Ga0070697_100235244 Ga0070697_1002352441 123
205 3300005539 Ga0068853_100306409 Ga0068853_1003064092 123
206 3300005539 Ga0068853_100443121 Ga0068853_1004431212 123
207 3300005539 Ga0068853_100629588 Ga0068853_1006295882 123
208 3300005547 Ga0070693_100286104 Ga0070693_1002861042 123
209 3300005547 Ga0070693_100555303 Ga0070693_1005553031 123
210 3300005548 Ga0070665_100000107 Ga0070665_10000010746 123
211 3300005548 Ga0070665_100061489 Ga0070665_1000614893 123
212 3300005548 Ga0070665_100352307 Ga0070665_1003523072 123
213 3300005548 Ga0070665_102201547 Ga0070665_1022015472 123
214 3300005563 Ga0068855_100067138 Ga0068855_1000671382 123
215 3300005563 Ga0068855_100381920 Ga0068855_1003819202 123
216 3300005563 Ga0068855_100850588 Ga0068855_1008505882 123
217 3300005564 Ga0070664_100604535 Ga0070664_1006045352 123
218 3300005577 Ga0068857_100057015 Ga0068857_1000570153 123
219 3300005577 Ga0068857_100493001 Ga0068857_1004930012 123
220 3300005614 Ga0068856_100341046 Ga0068856_1003410462 123
221 3300005614 Ga0068856_101438266 Ga0068856_1014382662 123
222 3300005616 Ga0068852_100252052 Ga0068852_1002520522 123
223 3300005616 Ga0068852_100319614 Ga0068852_1003196142 123
224 3300005617 Ga0068859_100132951 Ga0068859_1001329513 123
225 3300005617 Ga0068859_100810810 Ga0068859_1008108102 123
226 3300005617 Ga0068859_100915497 Ga0068859_1009154972 123
227 3300005617 Ga0068859_101161340 Ga0068859_1011613402 123
228 3300005618 Ga0068864_100153684 Ga0068864_1001536842 123
229 3300005719 Ga0068861_100062658 Ga0068861_1000626582 123
230 3300005841 Ga0068863_100369401 Ga0068863_1003694012 123
231 3300005841 Ga0068863_100418005 Ga0068863_1004180052 123
232 3300005841 Ga0068863_100508869 Ga0068863_1005088692 123
233 3300005842 Ga0068858_100000191 Ga0068858_10000019124 123
234 3300005842 Ga0068858_100193011 Ga0068858_1001930112 123
235 3300005842 Ga0068858_100218585 Ga0068858_1002185851 123
236 3300005842 Ga0068858_100586328 Ga0068858_1005863282 123
237 3300005842 Ga0068858_100685177 Ga0068858_1006851772 123
238 3300005842 Ga0068858_101741671 Ga0068858_1017416712 123
239 3300005843 Ga0068860_100004803 Ga0068860_10000480313 123
240 3300005843 Ga0068860_100086315 Ga0068860_1000863153 123
241 3300005843 Ga0068860_101078900 Ga0068860_1010789002 123
242 3300005844 Ga0068862_100008499 Ga0068862_10000849910 123
243 3300005844 Ga0068862_100313131 Ga0068862_1003131312 123
244 3300005985 Ga0081539_10004186 Ga0081539_100041862 123
245 3300006028 Ga0070717_10215566 Ga0070717_102155663 123
246 3300006038 Ga0075365_10010971 Ga0075365_100109718 123
247 3300006163 Ga0070715_10101757 Ga0070715_101017571 123
248 3300006173 Ga0070716_100007382 Ga0070716_1000073822 123
249 3300006173 Ga0070716_100160910 Ga0070716_1001609101 123
250 3300006173 Ga0070716_101238386 Ga0070716_1012383861 123
251 3300006173 Ga0070716_101635204 Ga0070716_1016352041 123
252 3300006175 Ga0070712_100069079 Ga0070712_1000690793 123
253 3300006175 Ga0070712_100086611 Ga0070712_1000866112 123
254 3300006237 Ga0097621_100581405 Ga0097621_1005814051 123
255 3300006237 Ga0097621_100698468 Ga0097621_1006984682 123
256 3300006353 Ga0075370_10616697 Ga0075370_106166971 123
257 3300006353 Ga0075370_10987169 Ga0075370_109871691 123
258 3300006358 Ga0068871_100909268 Ga0068871_1009092682 123
259 3300006358 Ga0068871_100963154 Ga0068871_1009631541 123
260 3300006358 Ga0068871_101045841 Ga0068871_1010458412 123
261 3300006881 Ga0068865_100799318 Ga0068865_1007993182 123
262 3300006931 Ga0097620_100132952 Ga0097620_1001329522 123
263 3300006931 Ga0097620_100810798 Ga0097620_1008107982 123
264 3300006931 Ga0097620_100915335 Ga0097620_1009153352 123
265 3300006946 Ga0079104_1004974 Ga0079104_10049743 123
266 3300009011 Ga0105251_10002928 Ga0105251_100029282 123
267 3300009093 Ga0105240_10071684 Ga0105240_100716845 123
268 3300009093 Ga0105240_10266334 Ga0105240_102663342 123
269 3300009093 Ga0105240_10313742 Ga0105240_103137422 123
270 3300009093 Ga0105240_10866579 Ga0105240_108665791 123
271 3300009093 Ga0105240_12595983 Ga0105240_125959831 123
272 3300009098 Ga0105245_10038965 Ga0105245_100389652 123
273 3300009101 Ga0105247_10042030 Ga0105247_100420302 123
274 3300009101 Ga0105247_10091810 Ga0105247_100918102 123
275 3300009174 Ga0105241_10511434 Ga0105241_105114342 123
276 3300009174 Ga0105241_10977529 Ga0105241_109775291 123
277 3300009176 Ga0105242_10235724 Ga0105242_102357242 123
278 3300009176 Ga0105242_12430828 Ga0105242_124308281 123
279 3300009177 Ga0105248_10009594 Ga0105248_100095943 123
280 3300009177 Ga0105248_10128534 Ga0105248_101285343 123
281 3300009177 Ga0105248_10840293 Ga0105248_108402932 123
282 3300009545 Ga0105237_10042034 Ga0105237_100420342 123
283 3300009545 Ga0105237_10126238 Ga0105237_101262385 123
284 3300009545 Ga0105237_10174659 Ga0105237_101746592 123
285 3300009545 Ga0105237_10184617 Ga0105237_101846172 123
286 3300009545 Ga0105237_10257587 Ga0105237_102575872 123
287 3300009545 Ga0105237_10532929 Ga0105237_105329292 123
288 3300009545 Ga0105237_10684654 Ga0105237_106846542 123
289 3300009551 Ga0105238_10028484 Ga0105238_100284843 123
290 3300009551 Ga0105238_10051155 Ga0105238_100511552 123
291 3300009551 Ga0105238_10074351 Ga0105238_100743513 123
292 3300009551 Ga0105238_10184388 Ga0105238_101843882 123
293 3300009551 Ga0105238_10563976 Ga0105238_105639762 123
294 3300009551 Ga0105238_10595445 Ga0105238_105954452 123
295 3300009551 Ga0105238_12399678 Ga0105238_123996781 123
296 3300009553 Ga0105249_10035426 Ga0105249_100354263 123
297 3300009553 Ga0105249_11263752 Ga0105249_112637522 123
298 3300009553 Ga0105249_12913368 Ga0105249_129133682 123
299 3300010375 Ga0105239_10057650 Ga0105239_100576503 123
300 3300010375 Ga0105239_10297273 Ga0105239_102972732 123
301 3300010375 Ga0105239_10492090 Ga0105239_104920902 123
302 3300010375 Ga0105239_11243597 Ga0105239_112435971 123
303 3300011119 Ga0105246_10159677 Ga0105246_101596772 123
304 3300011119 Ga0105246_11116964 Ga0105246_111169642 123
305 3300013105 Ga0157369_10221063 Ga0157369_102210632 123
306 3300013296 Ga0157374_10217701 Ga0157374_102177012 123
307 3300013296 Ga0157374_10425174 Ga0157374_104251742 123
308 3300013306 Ga0163162_10311412 Ga0163162_103114122 123
309 3300013307 Ga0157372_10244458 Ga0157372_102444582 123
310 3300014325 Ga0163163_10073713 Ga0163163_100737132 123
311 3300014968 Ga0157379_10062199 Ga0157379_100621993 123
312 3300014968 Ga0157379_10377527 Ga0157379_103775272 123
313 3300014969 Ga0157376_10546009 Ga0157376_105460092 123
314 3300017792 Ga0163161_10022467 Ga0163161_100224673 123
315 3300017792 Ga0163161_10249882 Ga0163161_102498822 123
316 3300017792 Ga0163161_10542000 Ga0163161_105420002 123
317 3300020082 Ga0206353_10448061 Ga0206353_104480612 123
318 3300020610 Ga0154015_1344946 Ga0154015_13449462 123
319 3300021358 Ga0213873_10013896 Ga0213873_100138963 123
320 3300021361 Ga0213872_10000119 Ga0213872_1000011959 123
321 3300021361 Ga0213872_10000660 Ga0213872_1000066016 123
322 3300021361 Ga0213872_10002314 Ga0213872_100023149 123
323 3300021361 Ga0213872_10003898 Ga0213872_100038989 123
324 3300021361 Ga0213872_10032146 Ga0213872_100321463 123
325 3300021361 Ga0213872_10095690 Ga0213872_100956902 123
326 3300021361 Ga0213872_10156638 Ga0213872_101566382 123
327 3300021377 Ga0213874_10145920 Ga0213874_101459201 123
328 3300021384 Ga0213876_10008226 Ga0213876_100082265 123
329 3300021384 Ga0213876_10161123 Ga0213876_101611231 123
330 3300021441 Ga0213871_10014922 Ga0213871_100149222 123
331 3300025233 Ga0209437_101642 Ga0209437_1016423 123
332 3300025245 Ga0207425_1000461 Ga0207425_100046119 123
333 3300025245 Ga0207425_1088317 Ga0207425_10883171 123
334 3300025253 Ga0209677_101787 Ga0209677_1017873 123
335 3300025254 Ga0209148_1008207 Ga0209148_10082072 123
336 3300025254 Ga0209148_1022875 Ga0209148_10228752 123
337 3300025258 Ga0209129_1000327 Ga0209129_100032719 123
338 3300025261 Ga0209233_1000044 Ga0209233_100004435 123
339 3300025261 Ga0209233_1003858 Ga0209233_10038581 123
340 3300025263 Ga0209565_1000052 Ga0209565_1000052123 123
341 3300025263 Ga0209565_1028698 Ga0209565_10286981 123
342 3300025272 Ga0209455_1009381 Ga0209455_10093811 123
343 3300025272 Ga0209455_1010385 Ga0209455_10103852 123
344 3300025273 Ga0209673_1015739 Ga0209673_10157392 123
345 3300025291 Ga0209675_1000025 Ga0209675_100002522 123
346 3300025292 Ga0209676_1000221 Ga0209676_100022140 123
347 3300025292 Ga0209676_1000228 Ga0209676_100022880 123
348 3300025292 Ga0209676_1002468 Ga0209676_10024683 123
349 3300025292 Ga0209676_1078273 Ga0209676_10782732 123
350 3300025294 Ga0209025_1001791 Ga0209025_10017914 123
351 3300025294 Ga0209025_1035515 Ga0209025_10355152 123
352 3300025295 Ga0209564_1009372 Ga0209564_10093724 123
353 3300025295 Ga0209564_1013638 Ga0209564_10136383 123
354 3300025297 Ga0209758_1000002 Ga0209758_1000002421 123
355 3300025297 Ga0209758_1000017 Ga0209758_1000017283 123
356 3300025297 Ga0209758_1028594 Ga0209758_10285942 123
357 3300025298 Ga0209050_1000001 Ga0209050_1000001364 123
358 3300025298 Ga0209050_1000042 Ga0209050_1000042347 123
359 3300025298 Ga0209050_1000071 Ga0209050_100007122 123
360 3300025298 Ga0209050_1001886 Ga0209050_10018867 123
361 3300025298 Ga0209050_1015417 Ga0209050_10154174 123
362 3300025298 Ga0209050_1029003 Ga0209050_10290032 123
363 3300025302 Ga0207426_1011633 Ga0207426_10116335 123
364 3300025302 Ga0207426_1105283 Ga0207426_11052832 123
365 3300025303 Ga0209051_1000297 Ga0209051_100029770 123
366 3300025304 Ga0209257_1000027 Ga0209257_1000027281 123
367 3300025304 Ga0209257_1000135 Ga0209257_100013540 123
368 3300025304 Ga0209257_1000229 Ga0209257_100022938 123
369 3300025304 Ga0209257_1001829 Ga0209257_100182910 123
370 3300025304 Ga0209257_1001894 Ga0209257_100189412 123
371 3300025304 Ga0209257_1003342 Ga0209257_100334214 123
372 3300025735 Ga0207713_1004263 Ga0207713_10042638 123
373 3300025735 Ga0207713_1033482 Ga0207713_10334822 123
374 3300025898 Ga0207692_10043937 Ga0207692_100439372 123
375 3300025898 Ga0207692_10083142 Ga0207692_100831422 123
376 3300025900 Ga0207710_10684554 Ga0207710_106845542 123
377 3300025903 Ga0207680_10071427 Ga0207680_100714273 123
378 3300025903 Ga0207680_10138961 Ga0207680_101389612 123
379 3300025903 Ga0207680_10203491 Ga0207680_102034912 123
380 3300025905 Ga0207685_10028613 Ga0207685_100286133 123
381 3300025905 Ga0207685_10655604 Ga0207685_106556042 123
382 3300025906 Ga0207699_10010077 Ga0207699_100100775 123
383 3300025906 Ga0207699_11266092 Ga0207699_112660921 123
384 3300025909 Ga0207705_11032903 Ga0207705_110329031 123
385 3300025912 Ga0207707_10002658 Ga0207707_100026583 123
386 3300025912 Ga0207707_10144774 Ga0207707_101447742 123
387 3300025913 Ga0207695_10538634 Ga0207695_105386341 123
388 3300025913 Ga0207695_11670869 Ga0207695_116708692 123
389 3300025914 Ga0207671_10067180 Ga0207671_100671804 123
390 3300025914 Ga0207671_10168284 Ga0207671_101682842 123
391 3300025914 Ga0207671_10475594 Ga0207671_104755943 123
392 3300025914 Ga0207671_10509367 Ga0207671_105093672 123
393 3300025914 Ga0207671_11461016 Ga0207671_114610161 123
394 3300025915 Ga0207693_10098570 Ga0207693_100985703 123
395 3300025915 Ga0207693_10109179 Ga0207693_101091792 123
396 3300025915 Ga0207693_10117782 Ga0207693_101177823 123
397 3300025915 Ga0207693_10200851 Ga0207693_102008511 123
398 3300025916 Ga0207663_10011331 Ga0207663_100113315 123
399 3300025916 Ga0207663_10036387 Ga0207663_100363873 123
400 3300025917 Ga0207660_10244669 Ga0207660_102446692 123
401 3300025919 Ga0207657_10834300 Ga0207657_108343002 123
402 3300025921 Ga0207652_10280822 Ga0207652_102808222 123
403 3300025923 Ga0207681_10000336 Ga0207681_1000033627 123
404 3300025923 Ga0207681_10001866 Ga0207681_100018667 123
405 3300025924 Ga0207694_10015844 Ga0207694_100158443 123
406 3300025924 Ga0207694_10046214 Ga0207694_100462142 123
407 3300025924 Ga0207694_10293096 Ga0207694_102930962 123
408 3300025924 Ga0207694_10547196 Ga0207694_105471962 123
409 3300025924 Ga0207694_10782955 Ga0207694_107829552 123
410 3300025924 Ga0207694_11403348 Ga0207694_114033481 123
411 3300025925 Ga0207650_10045454 Ga0207650_100454542 123
412 3300025927 Ga0207687_10012572 Ga0207687_100125727 123
413 3300025928 Ga0207700_10022828 Ga0207700_100228284 123
414 3300025928 Ga0207700_10027564 Ga0207700_100275644 123
415 3300025929 Ga0207664_10045578 Ga0207664_100455782 123
416 3300025929 Ga0207664_10119582 Ga0207664_101195823 123
417 3300025931 Ga0207644_10001624 Ga0207644_1000162416 123
418 3300025931 Ga0207644_10296244 Ga0207644_102962443 123
419 3300025931 Ga0207644_10712744 Ga0207644_107127442 123
420 3300025939 Ga0207665_10000976 Ga0207665_100009768 123
421 3300025939 Ga0207665_10160349 Ga0207665_101603493 123
422 3300025939 Ga0207665_10976579 Ga0207665_109765792 123
423 3300025941 Ga0207711_10028200 Ga0207711_100282004 123
424 3300025941 Ga0207711_10314840 Ga0207711_103148402 123
425 3300025941 Ga0207711_10700835 Ga0207711_107008351 123
426 3300025944 Ga0207661_10258099 Ga0207661_102580992 123
427 3300025944 Ga0207661_10475759 Ga0207661_104757593 123
428 3300025944 Ga0207661_10934771 Ga0207661_109347712 123
429 3300025945 Ga0207679_10751363 Ga0207679_107513631 123
430 3300025949 Ga0207667_10634414 Ga0207667_106344142 123
431 3300025961 Ga0207712_10067851 Ga0207712_100678512 123
432 3300025961 Ga0207712_10207620 Ga0207712_102076202 123
433 3300025961 Ga0207712_11536900 Ga0207712_115369002 123
434 3300025972 Ga0207668_10010776 Ga0207668_100107764 123
435 3300025972 Ga0207668_10013861 Ga0207668_100138617 123
436 3300025972 Ga0207668_10184044 Ga0207668_101840443 123
437 3300025972 Ga0207668_10592281 Ga0207668_105922812 123
438 3300025972 Ga0207668_10818030 Ga0207668_108180302 123
439 3300025981 Ga0207640_10085705 Ga0207640_100857053 123
440 3300025981 Ga0207640_10183096 Ga0207640_101830962 123
441 3300025986 Ga0207658_10001483 Ga0207658_1000148313 123
442 3300025986 Ga0207658_10034488 Ga0207658_100344882 123
443 3300025986 Ga0207658_10123356 Ga0207658_101233562 123
444 3300026023 Ga0207677_10248166 Ga0207677_102481661 123
445 3300026035 Ga0207703_10007705 Ga0207703_100077055 123
446 3300026035 Ga0207703_10188703 Ga0207703_101887033 123
447 3300026035 Ga0207703_10592531 Ga0207703_105925312 123
448 3300026035 Ga0207703_12265253 Ga0207703_122652531 123
449 3300026041 Ga0207639_10075641 Ga0207639_100756412 123
450 3300026041 Ga0207639_10211713 Ga0207639_102117133 123
451 3300026041 Ga0207639_10388792 Ga0207639_103887921 123
452 3300026041 Ga0207639_10446323 Ga0207639_104463232 123
453 3300026041 Ga0207639_10560160 Ga0207639_105601601 123
454 3300026067 Ga0207678_10014682 Ga0207678_100146828 123
455 3300026067 Ga0207678_10176765 Ga0207678_101767652 123
456 3300026078 Ga0207702_10920852 Ga0207702_109208522 123
457 3300026078 Ga0207702_12063245 Ga0207702_120632451 123
458 3300026088 Ga0207641_10000078 Ga0207641_10000078115 123
459 3300026088 Ga0207641_10494114 Ga0207641_104941142 123
460 3300026095 Ga0207676_10000420 Ga0207676_1000042010 123
461 3300026095 Ga0207676_10128799 Ga0207676_101287992 123
462 3300026095 Ga0207676_10295353 Ga0207676_102953532 123
463 3300026116 Ga0207674_10072137 Ga0207674_100721373 123
464 3300026116 Ga0207674_10504362 Ga0207674_105043622 123
465 3300026118 Ga0207675_100190919 Ga0207675_1001909192 123
466 3300026142 Ga0207698_10467043 Ga0207698_104670432 123
467 3300026142 Ga0207698_11112089 Ga0207698_111120891 123
468 3300027111 Ga0209281_1010983 Ga0209281_10109832 123
469 3300028379 Ga0268266_10000462 Ga0268266_1000046219 123
470 3300028379 Ga0268266_10177980 Ga0268266_101779801 123
471 3300028379 Ga0268266_10197593 Ga0268266_101975933 123
472 3300028379 Ga0268266_10228388 Ga0268266_102283883 123
473 3300028380 Ga0268265_10624763 Ga0268265_106247632 123
474 3300028381 Ga0268264_10000380 Ga0268264_1000038035 123
475 3300028381 Ga0268264_10013595 Ga0268264_100135957 123
476 3300028381 Ga0268264_11092426 Ga0268264_110924262 123
477 3300028381 Ga0268264_11893108 Ga0268264_118931082 123
478 3300028556 Ga0265337_1026672 Ga0265337_10266721 123
479 3300028558 Ga0265326_10006199 Ga0265326_100061992 123
480 3300028563 Ga0265319_1019753 Ga0265319_10197532 123
481 3300028573 Ga0265334_10096688 Ga0265334_100966882 123
482 3300028577 Ga0265318_10062097 Ga0265318_100620972 123
483 3300028653 Ga0265323_10002721 Ga0265323_100027214 123
484 3300028666 Ga0265336_10000661 Ga0265336_1000066115 123
485 3300028786 Ga0307517_10332500 Ga0307517_103325002 123
486 3300028800 Ga0265338_10004433 Ga0265338_1000443315 123
487 3300029957 Ga0265324_10003042 Ga0265324_100030424 123
488 3300030521 Ga0307511_10078058 Ga0307511_100780583 123
489 3300030733 Ga0314311_1103907 Ga0314311_11039073 123
490 3300031727 Ga0316576_10009408 Ga0316576_100094086 123
491 3300031824 Ga0307413_10379862 Ga0307413_103798622 123
492 3300031901 Ga0307406_10379585 Ga0307406_103795852 123
493 3300031901 Ga0307406_10814546 Ga0307406_108145462 123
494 3300032002 Ga0307416_100924604 Ga0307416_1009246042 123
495 3300032002 Ga0307416_103599957 Ga0307416_1035999571 123
496 3300032004 Ga0307414_10018906 Ga0307414_100189063 123
497 3300032004 Ga0307414_10370884 Ga0307414_103708842 123
498 3300032004 Ga0307414_10686162 Ga0307414_106861621 123
499 3300032004 Ga0307414_11039439 Ga0307414_110394391 123
500 3300032005 Ga0307411_10242061 Ga0307411_102420611 123
501 3300032005 Ga0307411_10814350 Ga0307411_108143502 123
502 3300032005 Ga0307411_10930565 Ga0307411_109305651 123
503 3300033180 Ga0307510_10001188 Ga0307510_1000118816 123
504 3300033180 Ga0307510_10009411 Ga0307510_1000941112 123
505 3300033541 Ga0316596_1024383 Ga0316596_10243833 123
506 3300035111 Ga0373923_0099251 Ga0373923_0099251_881_1252 123
507 3300035113 Ga0373936_0034305 Ga0373936_0034305_1171_1542 123
508 3300035113 Ga0373936_0038214 Ga0373936_0038214_1307_1678 123
509 3300035116 Ga0373945_0157692 Ga0373945_0157692_526_897 123
510 3300035118 Ga0373954_0044080 Ga0373954_0044080_764_1135 123
511 3300035119 Ga0373956_0010743 Ga0373956_0010743_292_663 123
512 3300035170 Ga0373943_0031224 Ga0373943_0031224_1922_2293 123
513 3300035171 Ga0373946_0330395 Ga0373946_0330395_58_429 123
514 3300035172 Ga0373955_0078991 Ga0373955_0078991_193_564 123
515 3300035410 Ga0373924_0389448 Ga0373924_0389448_21_392 123
516 3300035691 Ga0373931_0676333 Ga0373931_0676333_38_409 123
517 3300035692 Ga0373935_0036452 Ga0373935_0036452_880_1251 123
518 3300035692 Ga0373935_0410667 Ga0373935_0410667_179_550 123
519 3300035695 Ga0373927_0071440 Ga0373927_0071440_968_1339 123
520 3300035695 Ga0373927_0141393 Ga0373927_0141393_1061_1432 123
521 3300035695 Ga0373927_0744352 Ga0373927_0744352_175_546 123
522 3300035724 Ga0373933_0018114 Ga0373933_0018114_1895_2266 123
523 3300035725 Ga0373947_0263042 Ga0373947_0263042_668_1039 123
524 3300036401 Ga0373937_0183822 Ga0373937_0183822_573_944 123
525 3300036401 Ga0373937_0214072 Ga0373937_0214072_203_574 123
526 3300036459 Ga0372808_033289 Ga0372808_033289_269_640 123
527 3300037068 Ga0373925_0089108 Ga0373925_0089108_182_553 123
528 3300037068 Ga0373925_0116422 Ga0373925_0116422_353_724 123
529 3300037068 Ga0373925_0152205 Ga0373925_0152205_654_1025 123
530 3300037312 Ga0395899_0038201 Ga0395899_0038201_834_1205 123
531 3300037418 Ga0395900_0074422 Ga0395900_0074422_570_941 123
532 3300037418 Ga0395900_0111866 Ga0395900_0111866_2222_2593 123
533 3300037466 Ga0395898_0087501 Ga0395898_0087501_2488_2859 123
534 3300037471 Ga0395905_0127369 Ga0395905_0127369_1660_2031 123
535 3300037471 Ga0395905_0818640 Ga0395905_0818640_230_601 123
536 3300037853 Ga0436364_0701650 Ga0436364_0701650_3532_3903 123
537 3300038443 Ga0395901_0008255 Ga0395901_0008255_7325_7696 123
538 3300038443 Ga0395901_1059370 Ga0395901_1059370_12_383 123
539 3300038443 Ga0395901_1847133 Ga0395901_1847133_117_488 123
540 3300039437 Ga0436365_0815982 Ga0436365_0815982_577_996 123
541 3300039437 Ga0436365_1095754 Ga0436365_1095754_4791_5162 123
542 3300039437 Ga0436365_1707348 Ga0436365_1707348_909_1280 123
543 3300039438 Ga0436360_0630509 Ga0436360_0630509_153_524 123
544 3300039438 Ga0436360_0813945 Ga0436360_0813945_1368_1739 123
545 3300039438 Ga0436360_1300343 Ga0436360_1300343_431_844 123
546 3300039447 Ga0436361_0033458 Ga0436361_0033458_143_523 123
547 3300039447 Ga0436361_0080624 Ga0436361_0080624_585_956 123
548 3300039447 Ga0436361_0120999 Ga0436361_0120999_4985_5356 123
549 3300039447 Ga0436361_0193989 Ga0436361_0193989_364_735 123
550 3300039447 Ga0436361_0229583 Ga0436361_0229583_554_925 123
551 3300039447 Ga0436361_0241172 Ga0436361_0241172_1432_1803 123
552 3300039447 Ga0436361_0419875 Ga0436361_0419875_65_436 123
553 3300039447 Ga0436361_0430273 Ga0436361_0430273_252_623 123
554 3300039447 Ga0436361_0543398 Ga0436361_0543398_501_872 123
555 3300039447 Ga0436361_0660497 Ga0436361_0660497_507_878 123
556 3300039447 Ga0436361_0969043 Ga0436361_0969043_252_623 123
557 3300039447 Ga0436361_1115532 Ga0436361_1115532_1352_1723 123
558 3300039447 Ga0436361_1168992 Ga0436361_1168992_336_707 123
559 3300039447 Ga0436361_1193675 Ga0436361_1193675_179_643 123
560 3300039450 Ga0436363_0004057 Ga0436363_0004057_293_664 123
561 3300039450 Ga0436363_0243146 Ga0436363_0243146_207_578 123
562 3300039450 Ga0436363_0368964 Ga0436363_0368964_2383_2754 123
563 3300039450 Ga0436363_0592501 Ga0436363_0592501_120_491 123
564 3300039450 Ga0436363_0641523 Ga0436363_0641523_374_745 123
565 3300039450 Ga0436363_1385665 Ga0436363_1385665_565_936 123
566 3300039453 Ga0436362_0143304 Ga0436362_0143304_1494_1865 123
567 3300039453 Ga0436362_0616710 Ga0436362_0616710_104_475 123
568 3300041410 Ga0439461_0000157 Ga0439461_0000157_2533_2904 123
569 3300041411 Ga0439466_0099166 Ga0439466_0099166_120_491 123
570 3300041413 Ga0439465_0001520 Ga0439465_0001520_4968_5339 123
571 3300041452 Ga0451793_1167052 Ga0451793_1167052_140_511 123
572 3300041459 Ga0451800_0210168 Ga0451800_0210168_94_465 123
573 3300041462 Ga0451806_017109 Ga0451806_017109_631_1002 123
574 3300041486 Ga0451807_1376495 Ga0451807_1376495_762_1133 123
575 3300041491 Ga0451833_0151526 Ga0451833_0151526_422_796 123
576 3300041501 Ga0451845_0678984 Ga0451845_0678984_586_957 123
577 3300041503 Ga0451847_0607255 Ga0451847_0607255_242_613 123
578 3300041509 Ga0451843_0743624 Ga0451843_0743624_55_429 123
579 3300041512 Ga0451853_0787389 Ga0451853_0787389_990_1361 123
580 3300041512 Ga0451853_2451500 Ga0451853_2451500_340_711 123
581 3300041997 Ga0439431_0000015 Ga0439431_0000015_21968_22339 123
582 3300042002 Ga0439442_001146 Ga0439442_001146_2532_2903 123
583 3300042004 Ga0439445_0000834 Ga0439445_0000834_6018_6389 123
584 3300042006 Ga0439432_000156 Ga0439432_000156_20806_21177 123
585 3300042010 Ga0439452_029791 Ga0439452_029791_691_1062 123
586 3300042015 Ga0439462_0000128 Ga0439462_0000128_5581_5952 123
587 3300042435 Ga0439434_0001220 Ga0439434_0001220_2196_2567 123
588 3300042876 Ga0451577_0948068 Ga0451577_0948068_11_382 123
589 3300044684 Ga0466966_0740239 Ga0466966_0740239_13_384 123
590 3300044706 Ga0466964_0087797 Ga0466964_0087797_626_997 123
591 3300045049 Ga0466959_0165881 Ga0466959_0165881_273_644 123
592 3300045049 Ga0466959_1177486 Ga0466959_1177486_119_490 123
593 3300045976 Ga0466967_0302347 Ga0466967_0302347_878_1249 123
594 3300045976 Ga0466967_0328329 Ga0466967_0328329_327_779 123
595 3300045976 Ga0466967_0379381 Ga0466967_0379381_49_498 123
596 3300045976 Ga0466967_1859959 Ga0466967_1859959_199_570 123
597 3300046455 Ga0495603_0693965 Ga0495603_0693965_28_399 123
598 3300046459 Ga0495629_0052144 Ga0495629_0052144_2382_2753 123
599 3300046460 Ga0495638_0226492 Ga0495638_0226492_142_513 123
600 3300046463 Ga0495653_0304560 Ga0495653_0304560_236_607 123
601 3300046471 Ga0495650_0002418 Ga0495650_0002418_5958_6329 123
602 3300046471 Ga0495650_0188459 Ga0495650_0188459_139_510 123
603 3300046472 Ga0495580_0002795 Ga0495580_0002795_117_488 123
604 3300046473 Ga0495582_0268381 Ga0495582_0268381_239_610 123
605 3300046473 Ga0495582_0469021 Ga0495582_0469021_20_391 123
606 3300046477 Ga0495664_0079627 Ga0495664_0079627_1400_1771 123
607 3300046477 Ga0495664_0163724 Ga0495664_0163724_270_641 123
608 3300046477 Ga0495664_0177960 Ga0495664_0177960_531_902 123
609 3300046506 Ga0495583_0042528 Ga0495583_0042528_402_773 123
610 3300046507 Ga0495606_0050886 Ga0495606_0050886_2147_2518 123
611 3300046507 Ga0495606_0057434 Ga0495606_0057434_1591_1962 123
612 3300046512 Ga0495610_0001298 Ga0495610_0001298_4031_4402 123
613 3300046512 Ga0495610_0004939 Ga0495610_0004939_3506_3877 123
614 3300046514 Ga0495618_0243287 Ga0495618_0243287_492_863 123
615 3300046515 Ga0495620_0039396 Ga0495620_0039396_597_968 123
616 3300046517 Ga0495630_0342175 Ga0495630_0342175_268_639 123
617 3300046519 Ga0495632_0000989 Ga0495632_0000989_4795_5166 123
618 3300046519 Ga0495632_0005897 Ga0495632_0005897_1178_1549 123
619 3300046519 Ga0495632_0233036 Ga0495632_0233036_240_611 123
620 3300046522 Ga0495643_0000217 Ga0495643_0000217_39116_39487 123
621 3300046522 Ga0495643_0059132 Ga0495643_0059132_869_1240 123
622 3300046522 Ga0495643_0239338 Ga0495643_0239338_400_771 123
623 3300046524 Ga0495648_0123539 Ga0495648_0123539_815_1186 123
624 3300046525 Ga0495663_0000020 Ga0495663_0000020_46126_46497 123
625 3300046526 Ga0495666_0304448 Ga0495666_0304448_64_435 123
626 3300046528 Ga0495642_0180344 Ga0495642_0180344_144_515 123
627 3300046530 Ga0495654_0035543 Ga0495654_0035543_1118_1489 123
628 3300046531 Ga0495665_0033419 Ga0495665_0033419_75_446 123
629 3300046533 Ga0495640_0032013 Ga0495640_0032013_3169_3540 123
630 3300046542 Ga0495597_0176609 Ga0495597_0176609_295_666 123
631 3300046543 Ga0495645_0068373 Ga0495645_0068373_2036_2407 123
632 3300046558 Ga0495633_0002856 Ga0495633_0002856_4903_5274 123
633 3300046558 Ga0495633_0006780 Ga0495633_0006780_3369_3740 123
634 3300046559 Ga0495667_0337242 Ga0495667_0337242_184_555 123
635 3300046616 Ga0495668_0072625 Ga0495668_0072625_333_704 123
636 3300046660 Ga0495625_0028456 Ga0495625_0028456_2063_2434 123
637 3300046660 Ga0495625_0198397 Ga0495625_0198397_631_1002 123
638 3300046660 Ga0495625_0474738 Ga0495625_0474738_111_482 123
639 3300046663 Ga0495635_0026497 Ga0495635_0026497_169_540 123
640 3300046678 Ga0495599_0325152 Ga0495599_0325152_372_743 123
641 3300046681 Ga0495647_0345779 Ga0495647_0345779_295_666 123
642 3300046683 Ga0495658_0006493 Ga0495658_0006493_140_511 123
643 3300046689 Ga0495613_0753613 Ga0495613_0753613_101_472 123
644 3300046690 Ga0495624_0335536 Ga0495624_0335536_240_611 123
645 3300046691 Ga0495670_0000033 Ga0495670_0000033_68378_68749 123
646 3300046691 Ga0495670_0032461 Ga0495670_0032461_722_1093 123
647 3300046691 Ga0495670_0044328 Ga0495670_0044328_999_1370 123
648 3300046691 Ga0495670_0334791 Ga0495670_0334791_262_633 123
649 3300047315 Ga0495581_0736715 Ga0495581_0736715_57_428 123
650 3300047319 Ga0495674_0158783 Ga0495674_0158783_797_1168 123
651 3300047321 Ga0495676_0153977 Ga0495676_0153977_1049_1420 123
652 3300047323 Ga0495683_0221725 Ga0495683_0221725_287_658 123
653 3300047445 Ga0495677_0042316 Ga0495677_0042316_186_557 123
654 3300047470 Ga0495681_0001886 Ga0495681_0001886_8824_9195 123
655 3300047471 Ga0495684_0037420 Ga0495684_0037420_3169_3540 123
656 3300047472 Ga0495686_0000182 Ga0495686_0000182_52517_52888 123
657 3300047472 Ga0495686_0001777 Ga0495686_0001777_13226_13597 123
658 3300047472 Ga0495686_0002610 Ga0495686_0002610_10324_10695 123
659 3300047472 Ga0495686_0156238 Ga0495686_0156238_868_1239 123
660 3300047472 Ga0495686_0157289 Ga0495686_0157289_10_381 123
661 3300047673 Ga0495593_0182816 Ga0495593_0182816_414_785 123
662 3300047673 Ga0495593_0208084 Ga0495593_0208084_168_539 123
663 3300047673 Ga0495593_0602236 Ga0495593_0602236_171_542 123
664 3300048903 Ga0496100_0028246 Ga0496100_0028246_1693_2064 123
665 3300048903 Ga0496100_0068809 Ga0496100_0068809_1871_2242 123
666 3300048903 Ga0496100_0198944 Ga0496100_0198944_374_745 123
667 3300048903 Ga0496100_0435705 Ga0496100_0435705_280_729 123
668 3300048904 Ga0496101_0077983 Ga0496101_0077983_1042_1413 123
669 3300048904 Ga0496101_0617338 Ga0496101_0617338_133_504 123
670 3300048905 Ga0496102_0001012 Ga0496102_0001012_11845_12216 123
671 3300048905 Ga0496102_0150581 Ga0496102_0150581_1337_1708 123
672 3300048905 Ga0496102_0969020 Ga0496102_0969020_32_403 123
673 3300048906 Ga0496103_0000246 Ga0496103_0000246_40939_41310 123
674 3300048906 Ga0496103_0227163 Ga0496103_0227163_797_1168 123
675 3300048906 Ga0496103_0639758 Ga0496103_0639758_174_545 123
676 3300048906 Ga0496103_0818047 Ga0496103_0818047_179_550 123
677 3300048907 Ga0496104_0000227 Ga0496104_0000227_32602_32973 123
678 3300048908 Ga0496105_0000158 Ga0496105_0000158_8250_8621 123
679 3300048909 Ga0496106_0521103 Ga0496106_0521103_75_446 123
680 3300048910 Ga0496107_0112102 Ga0496107_0112102_1117_1488 123
681 3300048910 Ga0496107_0229831 Ga0496107_0229831_997_1368 123
682 3300048911 Ga0496108_0350757 Ga0496108_0350757_832_1203 123
683 3300048915 Ga0496112_0002829 Ga0496112_0002829_6946_7317 123
684 3300048915 Ga0496112_0380285 Ga0496112_0380285_274_645 123
685 3300048916 Ga0496113_0000325 Ga0496113_0000325_8191_8562 123
686 3300048918 Ga0496115_1021277 Ga0496115_1021277_227_598 123
687 3300048919 Ga0496116_0021850 Ga0496116_0021850_433_804 123
688 3300048919 Ga0496116_0078456 Ga0496116_0078456_160_531 123
689 3300048919 Ga0496116_0331149 Ga0496116_0331149_286_657 123
690 3300048919 Ga0496116_0400782 Ga0496116_0400782_25_396 123
691 3300048920 Ga0496117_0005510 Ga0496117_0005510_7150_7521 123
692 3300048920 Ga0496117_0030787 Ga0496117_0030787_1605_1976 123
693 3300048920 Ga0496117_0073876 Ga0496117_0073876_1016_1387 123
694 3300048920 Ga0496117_0525765 Ga0496117_0525765_38_409 123
695 3300048920 Ga0496117_0611950 Ga0496117_0611950_38_409 123
696 3300048921 Ga0496118_0002103 Ga0496118_0002103_26545_26916 123
697 3300048921 Ga0496118_0020790 Ga0496118_0020790_3874_4299 123
698 3300048921 Ga0496118_0048902 Ga0496118_0048902_2591_2962 123
699 3300048921 Ga0496118_0055157 Ga0496118_0055157_1912_2283 123
700 3300048921 Ga0496118_0084326 Ga0496118_0084326_986_1357 123
701 3300048921 Ga0496118_0106434 Ga0496118_0106434_412_783 123
702 3300048921 Ga0496118_0322036 Ga0496118_0322036_267_638 123
703 3300048922 Ga0496119_0000040 Ga0496119_0000040_116147_116518 123
704 3300048922 Ga0496119_0015177 Ga0496119_0015177_1426_1851 123
705 3300048922 Ga0496119_0020742 Ga0496119_0020742_2558_2929 123
706 3300048922 Ga0496119_0026083 Ga0496119_0026083_3528_3899 123
707 3300048922 Ga0496119_0171639 Ga0496119_0171639_394_765 123
708 3300048922 Ga0496119_0174071 Ga0496119_0174071_197_568 123
709 3300048923 Ga0496120_0000731 Ga0496120_0000731_32428_32799 123
710 3300048923 Ga0496120_0016388 Ga0496120_0016388_2087_2458 123
711 3300048923 Ga0496120_0147763 Ga0496120_0147763_660_1031 123
712 3300048923 Ga0496120_0187439 Ga0496120_0187439_11_382 123
713 3300048924 Ga0496121_0000123 Ga0496121_0000123_1918_2289 123
714 3300048924 Ga0496121_0004891 Ga0496121_0004891_11192_11563 123
715 3300048924 Ga0496121_0007534 Ga0496121_0007534_7209_7580 123
716 3300048924 Ga0496121_0039007 Ga0496121_0039007_2034_2459 123
717 3300048924 Ga0496121_0072125 Ga0496121_0072125_2205_2576 123
718 3300048924 Ga0496121_0091767 Ga0496121_0091767_1834_2205 123
719 3300048924 Ga0496121_0095250 Ga0496121_0095250_303_674 123
720 3300048925 Ga0496122_0002442 Ga0496122_0002442_20663_21034 123
721 3300048925 Ga0496122_0003506 Ga0496122_0003506_11724_12095 123
722 3300048926 Ga0496123_0001478 Ga0496123_0001478_11724_12095 123
723 3300048926 Ga0496123_0004521 Ga0496123_0004521_10357_10728 123
724 3300048927 Ga0496124_0004810 Ga0496124_0004810_13969_14340 123
725 3300048927 Ga0496124_0026551 Ga0496124_0026551_2961_3332 123
726 3300048927 Ga0496124_0179411 Ga0496124_0179411_672_1043 123
727 3300048927 Ga0496124_0314881 Ga0496124_0314881_525_896 123
728 3300048927 Ga0496124_0419387 Ga0496124_0419387_300_725 123
729 3300048928 Ga0496125_0000205 Ga0496125_0000205_42342_42713 123
730 3300048928 Ga0496125_0006420 Ga0496125_0006420_4840_5211 123
731 3300048928 Ga0496125_0009566 Ga0496125_0009566_7383_7754 123
732 3300048928 Ga0496125_0017019 Ga0496125_0017019_1747_2118 123
733 3300048928 Ga0496125_0060959 Ga0496125_0060959_1137_1508 123
734 3300048928 Ga0496125_0147758 Ga0496125_0147758_1139_1510 123
735 3300048928 Ga0496125_0148995 Ga0496125_0148995_728_1099 123
736 3300048928 Ga0496125_0260140 Ga0496125_0260140_14_439 123
737 3300048928 Ga0496125_0270452 Ga0496125_0270452_30_401 123
738 3300048928 Ga0496125_0333183 Ga0496125_0333183_510_881 123
739 3300048928 Ga0496125_0380740 Ga0496125_0380740_407_778 123
740 3300048928 Ga0496125_0428620 Ga0496125_0428620_264_635 123
741 3300048929 Ga0496126_0000044 Ga0496126_0000044_211758_212129 123
742 3300048929 Ga0496126_0046438 Ga0496126_0046438_3552_3923 123
743 3300048929 Ga0496126_0071283 Ga0496126_0071283_2687_3058 123
744 3300048929 Ga0496126_0081674 Ga0496126_0081674_1139_1510 123
745 3300048929 Ga0496126_0280298 Ga0496126_0280298_142_513 123
746 3300048929 Ga0496126_0295856 Ga0496126_0295856_122_493 123
747 3300048929 Ga0496126_0363117 Ga0496126_0363117_163_534 123
748 3300048929 Ga0496126_0839145 Ga0496126_0839145_105_476 123
749 3300049575 Ga0501039_0052158 Ga0501039_0052158_2235_2606 123
750 3300049580 Ga0501046_0350514 Ga0501046_0350514_430_801 123
751 3300049581 Ga0501047_0044436 Ga0501047_0044436_3610_3981 123
752 3300049581 Ga0501047_0257298 Ga0501047_0257298_1100_1471 123
753 3300049581 Ga0501047_0846180 Ga0501047_0846180_71_442 123
754 3300049582 Ga0501048_0000652 Ga0501048_0000652_11602_11973 123
755 3300049586 Ga0501070_0012367 Ga0501070_0012367_1811_2182 123
756 3300049590 Ga0501074_0393242 Ga0501074_0393242_332_703 123
757 3300049664 Ga0501224_010896 Ga0501224_010896_352_723 123
758 3300049742 Ga0501080_0591613 Ga0501080_0591613_55_426 123
759 3300049823 Ga0501044_0463473 Ga0501044_0463473_217_588 123
760 3300050492 nmdc:mga0yw44_152970_c1 nmdc:mga0yw44_152970_c1_844_1215 123
761 3300050492 nmdc:mga0yw44_7389_c1 nmdc:mga0yw44_7389_c1_342_713 123
762 3300050496 nmdc:mga07m45_852321_c1 nmdc:mga07m45_852321_c1_48_497 123
763 3300050496 nmdc:mga07m45_895112_c1 nmdc:mga07m45_895112_c1_94_465 123
764 3300050509 nmdc:mga0qj67_676320_c1 nmdc:mga0qj67_676320_c1_166_537 123
765 3300053077 Ga0495601_0067983 Ga0495601_0067983_1632_2003 123
766 3300053077 Ga0495601_0227859 Ga0495601_0227859_275_646 123
767 3300053078 Ga0495612_0033254 Ga0495612_0033254_877_1248 123
768 3300053078 Ga0495612_0253370 Ga0495612_0253370_28_399 123
769 3300053083 Ga0495655_0298167 Ga0495655_0298167_80_451 123
770 3300053085 Ga0495619_0393005 Ga0495619_0393005_22_393 123
771 3300053085 Ga0495619_0679261 Ga0495619_0679261_48_419 123
772 3300053087 Ga0500643_002186 Ga0500643_002186_802_1173 123
773 3300053088 Ga0500644_0141251 Ga0500644_0141251_416_787 123
774 3300053090 Ga0500646_0055461 Ga0500646_0055461_36_407 123
775 3300053091 Ga0500647_0225328 Ga0500647_0225328_44_415 123
776 3300053091 Ga0500647_0280580 Ga0500647_0280580_17_388 123
777 3300053091 Ga0500647_0340996 Ga0500647_0340996_224_595 123
778 3300053092 Ga0500583_0320631 Ga0500583_0320631_221_592 123
779 3300053093 Ga0500651_0687012 Ga0500651_0687012_144_515 123
780 3300053096 Ga0500641_0013594 Ga0500641_0013594_1833_2204 123
781 3300053104 Ga0500556_0004926 Ga0500556_0004926_1460_1831 123
782 3300053104 Ga0500556_0136344 Ga0500556_0136344_305_676 123
783 3300053108 Ga0500562_022490 Ga0500562_022490_1211_1582 123
784 3300053108 Ga0500562_063979 Ga0500562_063979_193_564 123
785 3300053115 Ga0500591_037645 Ga0500591_037645_565_936 123
786 3300053116 Ga0500592_058894 Ga0500592_058894_180_551 123
787 3300053118 Ga0500594_0006551 Ga0500594_0006551_778_1149 123
788 3300053118 Ga0500594_0318946 Ga0500594_0318946_123_494 123
789 3300053119 Ga0500595_001175 Ga0500595_001175_6533_6904 123
790 3300053119 Ga0500595_103422 Ga0500595_103422_45_416 123
791 3300053122 Ga0500608_000128 Ga0500608_000128_2094_2465 123
792 3300053134 Ga0500658_0302080 Ga0500658_0302080_234_605 123
793 3300053136 Ga0500559_0008678 Ga0500559_0008678_2974_3345 123
794 3300053136 Ga0500559_0148768 Ga0500559_0148768_653_1024 123
795 3300053138 Ga0500564_001139 Ga0500564_001139_3544_3915 123
796 3300053139 Ga0500568_0001898 Ga0500568_0001898_10791_11162 123
797 3300053140 Ga0500573_0159684 Ga0500573_0159684_459_830 123
798 3300053140 Ga0500573_0217348 Ga0500573_0217348_418_789 123
799 3300053150 Ga0500603_010373 Ga0500603_010373_1450_1821 123
800 3300053151 Ga0500604_0055717 Ga0500604_0055717_177_548 123
801 3300053153 Ga0500616_0010388 Ga0500616_0010388_1062_1433 123
802 3300053153 Ga0500616_0061287 Ga0500616_0061287_550_921 123
803 3300053156 Ga0500622_0040507 Ga0500622_0040507_801_1172 123
804 3300053158 Ga0500627_0000031 Ga0500627_0000031_1493_1864 123
805 3300053158 Ga0500627_0081936 Ga0500627_0081936_1000_1371 123
806 3300053163 Ga0500639_110383 Ga0500639_110383_264_635 123
807 3300053177 Ga0500636_0179420 Ga0500636_0179420_351_722 123
808 3300053723 Ga0500567_002483 Ga0500567_002483_4631_5002 123
809 3300053727 Ga0500611_123954 Ga0500611_123954_79_450 123
810 3300053729 Ga0500625_000051 Ga0500625_000051_21280_21651 123
811 3300053730 Ga0500645_000234 Ga0500645_000234_14254_14625 123
812 3300053730 Ga0500645_054265 Ga0500645_054265_193_564 123
813 3300053737 Ga0500601_004546 Ga0500601_004546_1060_1431 123
814 3300055283 Ga0500661_005233 Ga0500661_005233_1807_2178 123
815 3300055283 Ga0500661_111799 Ga0500661_111799_33_404 123

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01588

tRNA_bind

Putative tRNA binding domain

25

120

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2q2i-assembly1.cif.gz_A crystal structure of the protein secretion chaperone csaa from agrobacterium tumefaciens. 0.9818 12 123
2q2i-assembly1.cif.gz_A crystal structure of the protein secretion chaperone csaa from agrobacterium tumefaciens. 0.9732 12 123
2q2h-assembly1.cif.gz_B crystal structure of the protein secretion chaperone csaa from agrobacterium tumefaciens with a genetically fused phage-display derived peptide substrate at the n-terminus. 0.9643 13 123
1gd7-assembly1.cif.gz_B crystal structure of a bifunctional protein (csaa) with export-related chaperone and trna-binding activities. 0.9582 14 123
2q2h-assembly1.cif.gz_B crystal structure of the protein secretion chaperone csaa from agrobacterium tumefaciens with a genetically fused phage-display derived peptide substrate at the n-terminus. 0.9555 13 123
ID Description Score Start End Superfamily
1gd7A00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9568 14 123 2.40.50.140
1gd7A00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9483 14 123 2.40.50.140
2q2iB00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9474 12 123 2.40.50.140
2q2iB00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.939 12 123 2.40.50.140
af_Q54B13_2_117_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9269 10 123 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A2V5CWR8-F1-model_v4 deleted 0.9971 2 123
AF-A0A521LCG2-F1-model_v4 tRNA-binding protein 0.9927 41 123 GO:0000049
AF-C6XQR0-F1-model_v4 Export-related chaperone CsaA 0.9924 1 123 GO:0000049
AF-A0A6A5LB44-F1-model_v4 deleted 0.9916 13 123
AF-A0A356R983-F1-model_v4 tRNA-binding protein 0.9905 24 123 GO:0000049

Feature Viewer

pLDDT pTM Quality
93.28 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map