F481947

General Info

Members Datasets Scaffolds Average Seq Length
813 395 1626 133

Family's Representative Sequence

Representative Sequence 3300035724|Ga0373933_0579159|Ga0373933_0579159_226_708
Length 160
Sequence MPNMSSAHGYSRARHPAYQPKTFCEVTMTKLPEGAPNLDEILIQSENVAWREKSLKGVHEKMLWRNEETGASIALIKFDKGAGIPQPHLHSSNQFMFCLKGRYEYTSTGVVLTPGCFYCNPKGNVHGPAVAHEETIVVEMYDGPHYPQKPSWYTDERDAH

Samples

Sample ID Description Type Environment
1 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
72 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
78 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
79 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
94 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
123 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
124 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
125 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
126 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
128 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
197 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
201 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
202 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
203 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
204 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
205 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
206 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
207 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
208 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
209 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
210 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
211 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
212 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
213 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
214 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
215 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
216 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
217 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
218 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
219 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
220 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
221 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
222 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
223 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
224 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
225 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
226 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
227 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
228 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
229 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
230 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
231 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
232 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
233 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
234 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
235 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
236 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
237 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
238 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
239 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
240 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
241 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
242 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
243 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
244 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
245 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
246 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
247 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
248 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
249 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
250 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
251 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
252 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
253 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
254 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
255 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
256 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
257 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
258 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
259 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
260 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
261 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
262 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
263 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
264 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
265 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
266 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
267 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
268 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
269 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
270 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
271 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
272 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
273 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
274 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
275 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
276 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
277 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
278 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
279 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
280 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
281 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
282 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
283 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
284 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
285 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
286 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
287 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
288 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
289 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
290 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
291 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
292 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
293 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
294 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
295 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
296 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
297 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
298 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
299 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
300 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
301 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
302 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
303 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
304 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
305 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
306 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
307 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
308 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
309 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
310 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
311 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
312 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
313 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
314 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
315 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
316 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
317 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
318 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
319 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
320 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
321 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
322 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
323 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
324 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
325 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
326 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
327 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
343 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
344 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
345 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
346 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
347 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
348 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
349 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
350 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
351 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
352 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
353 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
354 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
355 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
356 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
357 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
360 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
361 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
362 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
363 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
364 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
365 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
366 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
367 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
368 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
369 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
370 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
371 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
372 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
373 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
374 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
375 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
376 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
377 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
378 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
379 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
380 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
381 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
382 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
383 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
384 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
385 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
386 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
387 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
388 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
389 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
390 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
391 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
392 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
393 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
394 2844104063 Bosea sp. Tri-39 Isolate Nodule
395 2851246043 Bosea sp. Tri-54 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.63
Metatranscriptomes 0
Isolates 0.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.89
Nodule 0.37
Rhizoplane 5.54
Rhizosphere 84.38
Stem 0
Stem Tuber 0
Unclassified 8.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373933_0579159 3300035724 Bacteria 737
2 JGI24034J26672_10083737 3300002239 Bacteria 585
3 JGI24742J22300_10015791 3300002244 Bacteria 1271
4 JGI25159J45721_1006261 3300002987 Bacteria 3592
5 JGI25153J46596_10068095 3300003215 Bacteria 934
6 rootH2_10204788 3300003320 Bacteria 1874
7 Ga0065165_1000252 3300005262 Bacteria 93001
8 Ga0065712_10101621 3300005290 Unclassified 2029
9 Ga0065707_10380427 3300005295 Bacteria 878
10 Ga0070658_10033975 3300005327 Bacteria 4104
11 Ga0070658_10034304 3300005327 Bacteria 4083
12 Ga0070658_10042826 3300005327 Bacteria 3657
13 Ga0070658_11505979 3300005327 Bacteria 583
14 Ga0070676_10002158 3300005328 Bacteria 10022
15 Ga0070676_10074160 3300005328 Bacteria 2049
16 Ga0070676_11131129 3300005328 Bacteria 593
17 Ga0070683_100891532 3300005329 Bacteria 853
18 Ga0070690_101556951 3300005330 Unclassified 535
19 Ga0070670_100032423 3300005331 Bacteria 4500
20 Ga0070677_10027994 3300005333 Bacteria 2126
21 Ga0070666_10492444 3300005335 Bacteria 888
22 Ga0070680_100001601 3300005336 Bacteria 16529
23 Ga0070680_100009773 3300005336 Bacteria 7385
24 Ga0070680_100071036 3300005336 Bacteria 2860
25 Ga0070682_100064000 3300005337 Unclassified 2334
26 Ga0070682_101172104 3300005337 Bacteria 647
27 Ga0070660_100016798 3300005339 Bacteria 5322
28 Ga0070660_100031291 3300005339 Bacteria 3996
29 Ga0070660_100243892 3300005339 Bacteria 1464
30 Ga0070660_100744947 3300005339 Bacteria 823
31 Ga0070689_100002623 3300005340 Bacteria 11777
32 Ga0070689_100250628 3300005340 Bacteria 1461
33 Ga0070689_100391007 3300005340 Bacteria 1174
34 Ga0070691_10471144 3300005341 Bacteria 721
35 Ga0070691_11027124 3300005341 Bacteria 516
36 Ga0070687_100008281 3300005343 Bacteria 4394
37 Ga0070661_100518556 3300005344 Bacteria 956
38 Ga0070661_100821056 3300005344 Bacteria 764
39 Ga0070661_101277997 3300005344 Bacteria 615
40 Ga0070692_10051196 3300005345 Bacteria 2147
41 Ga0070668_100292585 3300005347 Bacteria 1363
42 Ga0070668_100858678 3300005347 Bacteria 809
43 Ga0070669_100352456 3300005353 Bacteria 1195
44 Ga0070675_100057623 3300005354 Bacteria 3203
45 Ga0070675_100255170 3300005354 Bacteria 1535
46 Ga0070675_101685171 3300005354 Bacteria 585
47 Ga0070674_100007410 3300005356 Bacteria 6474
48 Ga0070674_100011321 3300005356 Bacteria 5428
49 Ga0070674_100391867 3300005356 Bacteria 1133
50 Ga0070674_101968038 3300005356 Bacteria 532
51 Ga0070673_101778823 3300005364 Bacteria 584
52 Ga0070688_100049632 3300005365 Bacteria 2612
53 Ga0070688_100059204 3300005365 Unclassified 2415
54 Ga0070688_101082071 3300005365 Bacteria 640
55 Ga0070659_100036085 3300005366 Bacteria 3852
56 Ga0070659_101297206 3300005366 Bacteria 646
57 Ga0070659_101486442 3300005366 Unclassified 603
58 Ga0070667_100262738 3300005367 Unclassified 1546
59 Ga0070667_100718774 3300005367 Bacteria 925
60 Ga0070709_10550628 3300005434 Bacteria 883
61 Ga0070710_10006614 3300005437 Bacteria 5573
62 Ga0070701_10094468 3300005438 Bacteria 1645
63 Ga0070701_10720022 3300005438 Bacteria 673
64 Ga0070711_100388417 3300005439 Bacteria 1130
65 Ga0070705_100195589 3300005440 Bacteria 1382
66 Ga0070700_100303814 3300005441 Bacteria 1166
67 Ga0070663_100024640 3300005455 Bacteria 4053
68 Ga0070663_100290303 3300005455 Bacteria 1306
69 Ga0070663_100435269 3300005455 Unclassified 1078
70 Ga0070678_100059946 3300005456 Bacteria 2799
71 Ga0070678_102280635 3300005456 Bacteria 514
72 Ga0070662_100001368 3300005457 Bacteria 14987
73 Ga0070662_101305033 3300005457 Unclassified 625
74 Ga0070681_10022672 3300005458 Bacteria 6308
75 Ga0070681_10128499 3300005458 Bacteria 2467
76 Ga0070681_10739992 3300005458 Bacteria 900
77 Ga0070681_11159933 3300005458 Unclassified 694
78 Ga0070681_11894284 3300005458 Bacteria 524
79 Ga0068867_100164904 3300005459 Bacteria 1750
80 Ga0068867_100267564 3300005459 Bacteria 1396
81 Ga0068867_100445811 3300005459 Bacteria 1102
82 Ga0070707_101209743 3300005468 Unclassified 722
83 Ga0070699_100001407 3300005518 Bacteria 22118
84 Ga0070699_100580663 3300005518 Bacteria 1021
85 Ga0070679_100003445 3300005530 Bacteria 14489
86 Ga0070679_100019745 3300005530 Bacteria 6559
87 Ga0070679_100020739 3300005530 Bacteria 6410
88 Ga0070679_100237543 3300005530 Unclassified 1781
89 Ga0070679_100281729 3300005530 Bacteria 1615
90 Ga0070679_100392718 3300005530 Bacteria 1333
91 Ga0070679_100763375 3300005530 Bacteria 910
92 Ga0070697_101492672 3300005536 Bacteria 604
93 Ga0068853_100046852 3300005539 Bacteria 3709
94 Ga0068853_100864005 3300005539 Bacteria 868
95 Ga0070672_100208057 3300005543 Bacteria 1638
96 Ga0070672_100284018 3300005543 Bacteria 1400
97 Ga0070686_100020392 3300005544 Bacteria 3921
98 Ga0070686_100096739 3300005544 Bacteria 1986
99 Ga0070686_100175935 3300005544 Bacteria 1517
100 Ga0070686_101184116 3300005544 Unclassified 634
101 Ga0070695_100103257 3300005545 Bacteria 1923
102 Ga0070695_100316003 3300005545 Bacteria 1159
103 Ga0070696_100108627 3300005546 Bacteria 1996
104 Ga0070693_100024318 3300005547 Unclassified 3247
105 Ga0070693_100042724 3300005547 Bacteria 2555
106 Ga0070693_100065823 3300005547 Bacteria 2119
107 Ga0070693_100628001 3300005547 Bacteria 779
108 Ga0070693_101327728 3300005547 Bacteria 557
109 Ga0068855_100009581 3300005563 Bacteria 11686
110 Ga0068855_100016599 3300005563 Bacteria 8855
111 Ga0068855_100053715 3300005563 Bacteria 4738
112 Ga0068855_101226261 3300005563 Bacteria 779
113 Ga0070664_100006915 3300005564 Bacteria 9141
114 Ga0070664_100260021 3300005564 Unclassified 1562
115 Ga0070664_101173008 3300005564 Unclassified 724
116 Ga0070664_101532026 3300005564 Bacteria 631
117 Ga0068857_100650273 3300005577 Unclassified 999
118 Ga0068857_101062125 3300005577 Bacteria 781
119 Ga0068854_100088292 3300005578 Bacteria 2302
120 Ga0068854_100110628 3300005578 Bacteria 2072
121 Ga0068854_100427550 3300005578 Unclassified 1101
122 Ga0068856_100014389 3300005614 Bacteria 7647
123 Ga0068856_100125585 3300005614 Bacteria 2569
124 Ga0068856_100282672 3300005614 Bacteria 1676
125 Ga0068856_101378194 3300005614 Bacteria 720
126 Ga0068856_102640591 3300005614 Bacteria 508
127 Ga0070702_100008673 3300005615 Bacteria 4937
128 Ga0070702_100668604 3300005615 Bacteria 788
129 Ga0070702_100759475 3300005615 Unclassified 745
130 Ga0068852_100006787 3300005616 Bacteria 8306
131 Ga0068852_100069978 3300005616 Bacteria 3077
132 Ga0068852_100422446 3300005616 Bacteria 1315
133 Ga0068852_100595194 3300005616 Bacteria 1110
134 Ga0068852_102240342 3300005616 Bacteria 568
135 Ga0068859_101898084 3300005617 Bacteria 658
136 Ga0068859_102324726 3300005617 Unclassified 591
137 Ga0068864_100225158 3300005618 Unclassified 1732
138 Ga0068866_10024832 3300005718 Bacteria 2810
139 Ga0068866_10085145 3300005718 Bacteria 1708
140 Ga0068866_10863355 3300005718 Bacteria 634
141 Ga0068861_100003655 3300005719 Bacteria 10253
142 Ga0068870_10020737 3300005840 Bacteria 3206
143 Ga0068863_100259422 3300005841 Unclassified 1680
144 Ga0068858_100286358 3300005842 Bacteria 1570
145 Ga0068858_100791176 3300005842 Unclassified 925
146 Ga0068860_100232399 3300005843 Unclassified 1792
147 Ga0068860_100791152 3300005843 Bacteria 962
148 Ga0068860_100900616 3300005843 Bacteria 901
149 Ga0068862_101266319 3300005844 Bacteria 738
150 Ga0081455_10058479 3300005937 Bacteria 3262
151 Ga0081455_10168792 3300005937 Bacteria 1669
152 Ga0081455_10399170 3300005937 Unclassified 955
153 Ga0081538_10145108 3300005981 Bacteria 1086
154 Ga0081538_10245061 3300005981 Bacteria 688
155 Ga0081540_1000008 3300005983 Bacteria 203702
156 Ga0081540_1010264 3300005983 Bacteria 6359
157 Ga0070717_10909935 3300006028 Bacteria 801
158 Ga0075365_10019352 3300006038 Bacteria 4201
159 Ga0075364_10289018 3300006051 Bacteria 1116
160 Ga0070712_100009678 3300006175 Bacteria 6075
161 Ga0075362_10210113 3300006177 Bacteria 949
162 Ga0075362_10388184 3300006177 Bacteria 703
163 Ga0075367_10408953 3300006178 Bacteria 858
164 Ga0075369_10259886 3300006186 Bacteria 807
165 Ga0075366_10004258 3300006195 Bacteria 7675
166 Ga0097621_100587578 3300006237 Bacteria 1017
167 Ga0097621_100721769 3300006237 Bacteria 919
168 Ga0075370_10099159 3300006353 Bacteria 1685
169 Ga0075370_10128609 3300006353 Bacteria 1477
170 Ga0075370_10361293 3300006353 Bacteria 868
171 Ga0075370_10369390 3300006353 Bacteria 858
172 Ga0075370_10480356 3300006353 Bacteria 749
173 Ga0068871_101269738 3300006358 Bacteria 692
174 Ga0068871_101429892 3300006358 Unclassified 652
175 Ga0068871_102013976 3300006358 Bacteria 550
176 Ga0075428_101746456 3300006844 Bacteria 648
177 Ga0075430_100720076 3300006846 Bacteria 823
178 Ga0075431_100028860 3300006847 Bacteria 5705
179 Ga0075433_10678731 3300006852 Bacteria 903
180 Ga0075434_100190026 3300006871 Bacteria 2074
181 Ga0075434_100393750 3300006871 Bacteria 1406
182 Ga0075434_100527115 3300006871 Bacteria 1202
183 Ga0075434_100531893 3300006871 Bacteria 1196
184 Ga0075434_100687358 3300006871 Bacteria 1041
185 Ga0075434_100876201 3300006871 Bacteria 913
186 Ga0075434_101219859 3300006871 Unclassified 764
187 Ga0075429_100067818 3300006880 Bacteria 3105
188 Ga0068865_100068693 3300006881 Unclassified 2506
189 Ga0068865_100093021 3300006881 Bacteria 2191
190 Ga0068865_102036662 3300006881 Bacteria 521
191 Ga0075436_100311395 3300006914 Bacteria 1130
192 Ga0097620_101897863 3300006931 Bacteria 658
193 Ga0097620_102324752 3300006931 Unclassified 591
194 Ga0099794_10390002 3300007265 Unclassified 727
195 Ga0099795_10188616 3300007788 Bacteria 864
196 Ga0105240_10137210 3300009093 Bacteria 2928
197 Ga0105240_10583982 3300009093 Bacteria 1232
198 Ga0105240_12351567 3300009093 Bacteria 552
199 Ga0111539_10041276 3300009094 Bacteria 5548
200 Ga0111539_10053885 3300009094 Bacteria 4788
201 Ga0111539_11767679 3300009094 Bacteria 717
202 Ga0105245_10063674 3300009098 Bacteria 3331
203 Ga0105245_10114776 3300009098 Unclassified 2509
204 Ga0105245_10906062 3300009098 Bacteria 923
205 Ga0105245_11151273 3300009098 Bacteria 823
206 Ga0105245_12802732 3300009098 Bacteria 540
207 Ga0105247_10031959 3300009101 Bacteria 3196
208 Ga0105243_10009046 3300009148 Bacteria 7607
209 Ga0105243_11099519 3300009148 Bacteria 803
210 Ga0105243_12034137 3300009148 Bacteria 609
211 Ga0105241_10209323 3300009174 Bacteria 1633
212 Ga0105241_10426105 3300009174 Bacteria 1169
213 Ga0105242_10080334 3300009176 Bacteria 2725
214 Ga0105248_10053729 3300009177 Bacteria 4519
215 Ga0105248_10438264 3300009177 Bacteria 1472
216 Ga0105248_10582409 3300009177 Bacteria 1262
217 Ga0105237_10947964 3300009545 Bacteria 867
218 Ga0105238_10037799 3300009551 Bacteria 4905
219 Ga0105249_11020217 3300009553 Bacteria 896
220 Ga0105249_12616729 3300009553 Bacteria 577
221 Ga0105239_10023991 3300010375 Bacteria 6718
222 Ga0105239_11315555 3300010375 Bacteria 834
223 Ga0105246_10055194 3300011119 Bacteria 2741
224 Ga0105246_10125534 3300011119 Bacteria 1909
225 Ga0105246_11871549 3300011119 Bacteria 575
226 Ga0157371_10015899 3300013102 Bacteria 5629
227 Ga0157371_10272524 3300013102 Bacteria 1222
228 Ga0157370_10072403 3300013104 Bacteria 3252
229 Ga0157370_10265840 3300013104 Bacteria 1585
230 Ga0157370_10864263 3300013104 Bacteria 822
231 Ga0157369_10046677 3300013105 Bacteria 4707
232 Ga0157369_10351603 3300013105 Bacteria 1530
233 Ga0157374_10188413 3300013296 Bacteria 2018
234 Ga0157374_12121422 3300013296 Bacteria 589
235 Ga0157378_10016031 3300013297 Bacteria 6563
236 Ga0157378_11197654 3300013297 Bacteria 799
237 Ga0163162_10166464 3300013306 Bacteria 2328
238 Ga0163162_10170248 3300013306 Bacteria 2303
239 Ga0163162_10325436 3300013306 Bacteria 1670
240 Ga0163162_10723815 3300013306 Bacteria 1116
241 Ga0157372_10067256 3300013307 Bacteria 4026
242 Ga0157375_10181245 3300013308 Bacteria 2258
243 Ga0157375_10636263 3300013308 Bacteria 1224
244 Ga0157375_13627422 3300013308 Bacteria 513
245 Ga0163163_10007654 3300014325 Bacteria 9544
246 Ga0163163_10136977 3300014325 Bacteria 2489
247 Ga0163163_10498886 3300014325 Bacteria 1279
248 Ga0157380_10064848 3300014326 Bacteria 2933
249 Ga0157380_10072237 3300014326 Bacteria 2794
250 Ga0157380_10096347 3300014326 Bacteria 2453
251 Ga0157380_10119312 3300014326 Bacteria 2231
252 Ga0157377_10025518 3300014745 Bacteria 3152
253 Ga0157377_10608872 3300014745 Bacteria 780
254 Ga0157379_10032221 3300014968 Bacteria 4672
255 Ga0157379_10041477 3300014968 Bacteria 4109
256 Ga0157379_10425989 3300014968 Bacteria 1222
257 Ga0157379_11285886 3300014968 Bacteria 706
258 Ga0157376_10077505 3300014969 Bacteria 2843
259 Ga0163161_10271510 3300017792 Bacteria 1327
260 Ga0163161_11197723 3300017792 Bacteria 657
261 Ga0213876_10030905 3300021384 Bacteria 2826
262 Ga0213876_10298079 3300021384 Bacteria 857
263 Ga0209130_1000116 3300025284 Bacteria 129549
264 Ga0209025_1001149 3300025294 Bacteria 37669
265 Ga0209758_1000128 3300025297 Bacteria 186771
266 Ga0209758_1012076 3300025297 Bacteria 4892
267 Ga0209758_1023850 3300025297 Bacteria 2749
268 Ga0209256_1010977 3300025299 Bacteria 3700
269 Ga0207426_1026746 3300025302 Bacteria 1928
270 Ga0207697_10008778 3300025315 Bacteria 4400
271 Ga0207692_10281944 3300025898 Bacteria 1006
272 Ga0207642_10021820 3300025899 Bacteria 2528
273 Ga0207642_10049617 3300025899 Bacteria 1888
274 Ga0207642_10350411 3300025899 Bacteria 871
275 Ga0207710_10187088 3300025900 Bacteria 1018
276 Ga0207688_10304749 3300025901 Bacteria 975
277 Ga0207680_10694218 3300025903 Bacteria 729
278 Ga0207680_11133172 3300025903 Bacteria 559
279 Ga0207647_10266009 3300025904 Bacteria 981
280 Ga0207685_10311962 3300025905 Bacteria 782
281 Ga0207699_10079785 3300025906 Bacteria 2026
282 Ga0207645_10019118 3300025907 Bacteria 4498
283 Ga0207645_10072304 3300025907 Bacteria 2207
284 Ga0207643_10021957 3300025908 Bacteria 3512
285 Ga0207705_10053193 3300025909 Bacteria 2916
286 Ga0207705_10057860 3300025909 Bacteria 2797
287 Ga0207705_10289132 3300025909 Bacteria 1256
288 Ga0207654_10178426 3300025911 Bacteria 1384
289 Ga0207654_10252610 3300025911 Bacteria 1182
290 Ga0207707_10031324 3300025912 Bacteria 4653
291 Ga0207707_10039823 3300025912 Bacteria 4106
292 Ga0207707_10608919 3300025912 Unclassified 924
293 Ga0207707_10997331 3300025912 Bacteria 687
294 Ga0207707_11271753 3300025912 Bacteria 592
295 Ga0207707_11586409 3300025912 Unclassified 516
296 Ga0207695_10083704 3300025913 Bacteria 3222
297 Ga0207693_10001267 3300025915 Bacteria 22522
298 Ga0207663_10889292 3300025916 Bacteria 712
299 Ga0207660_10110586 3300025917 Bacteria 2067
300 Ga0207660_10113188 3300025917 Bacteria 2045
301 Ga0207660_10404813 3300025917 Bacteria 1099
302 Ga0207660_11358036 3300025917 Bacteria 576
303 Ga0207662_10019234 3300025918 Bacteria 3883
304 Ga0207662_10024737 3300025918 Bacteria 3456
305 Ga0207657_10019761 3300025919 Bacteria 6385
306 Ga0207657_10101374 3300025919 Bacteria 2389
307 Ga0207657_10123363 3300025919 Bacteria 2130
308 Ga0207657_10413438 3300025919 Bacteria 1060
309 Ga0207649_10185717 3300025920 Bacteria 1458
310 Ga0207649_10233672 3300025920 Bacteria 1316
311 Ga0207652_10045629 3300025921 Bacteria 3736
312 Ga0207652_10091063 3300025921 Plasmid 2681
313 Ga0207652_10117905 3300025921 Bacteria 2359
314 Ga0207652_10179168 3300025921 Bacteria 1904
315 Ga0207652_10195690 3300025921 Bacteria 1819
316 Ga0207652_10260518 3300025921 Bacteria 1564
317 Ga0207646_11096795 3300025922 Unclassified 701
318 Ga0207694_10026945 3300025924 Bacteria 4377
319 Ga0207694_11474616 3300025924 Bacteria 574
320 Ga0207659_10008275 3300025926 Bacteria 6448
321 Ga0207659_10061776 3300025926 Bacteria 2702
322 Ga0207687_10057742 3300025927 Bacteria 2727
323 Ga0207687_10076947 3300025927 Bacteria 2398
324 Ga0207687_10442099 3300025927 Bacteria 1077
325 Ga0207664_10281425 3300025929 Bacteria 1459
326 Ga0207664_10615043 3300025929 Bacteria 976
327 Ga0207664_10725908 3300025929 Bacteria 893
328 Ga0207664_10957342 3300025929 Bacteria 768
329 Ga0207644_10038091 3300025931 Bacteria 3385
330 Ga0207644_10333100 3300025931 Bacteria 1229
331 Ga0207644_10383845 3300025931 Bacteria 1146
332 Ga0207690_10331711 3300025932 Bacteria 1198
333 Ga0207706_10002037 3300025933 Bacteria 19832
334 Ga0207706_10600788 3300025933 Bacteria 945
335 Ga0207686_10024322 3300025934 Bacteria 3509
336 Ga0207686_11386954 3300025934 Bacteria 578
337 Ga0207709_10125289 3300025935 Bacteria 1741
338 Ga0207709_10203284 3300025935 Bacteria 1416
339 Ga0207670_10001005 3300025936 Bacteria 14897
340 Ga0207670_10257347 3300025936 Bacteria 1351
341 Ga0207669_10015894 3300025937 Bacteria 3809
342 Ga0207669_10032049 3300025937 Bacteria 2946
343 Ga0207704_10832896 3300025938 Unclassified 772
344 Ga0207704_11609334 3300025938 Bacteria 558
345 Ga0207665_11381775 3300025939 Bacteria 561
346 Ga0207691_10114148 3300025940 Bacteria 2400
347 Ga0207711_10118986 3300025941 Bacteria 2357
348 Ga0207711_10307776 3300025941 Unclassified 1462
349 Ga0207689_10200840 3300025942 Bacteria 1645
350 Ga0207661_10186233 3300025944 Bacteria 1817
351 Ga0207679_10028476 3300025945 Bacteria 3877
352 Ga0207679_10071269 3300025945 Unclassified 2621
353 Ga0207679_10154704 3300025945 Unclassified 1871
354 Ga0207667_10020484 3300025949 Bacteria 7354
355 Ga0207667_10047980 3300025949 Bacteria 4517
356 Ga0207651_10873270 3300025960 Unclassified 800
357 Ga0207651_11417415 3300025960 Bacteria 625
358 Ga0207712_10538394 3300025961 Bacteria 1003
359 Ga0207712_10604913 3300025961 Bacteria 949
360 Ga0207668_10064971 3300025972 Bacteria 2581
361 Ga0207668_10148924 3300025972 Bacteria 1809
362 Ga0207668_10871015 3300025972 Bacteria 800
363 Ga0207640_10127323 3300025981 Bacteria 1835
364 Ga0207640_10166402 3300025981 Bacteria 1638
365 Ga0207658_10181315 3300025986 Bacteria 1743
366 Ga0207658_10186159 3300025986 Unclassified 1722
367 Ga0207658_10204383 3300025986 Bacteria 1651
368 Ga0207658_10294312 3300025986 Bacteria 1396
369 Ga0207677_11068854 3300026023 Bacteria 734
370 Ga0207703_10173294 3300026035 Unclassified 1899
371 Ga0207703_10983644 3300026035 Bacteria 809
372 Ga0207639_11230432 3300026041 Bacteria 703
373 Ga0207639_11414312 3300026041 Bacteria 653
374 Ga0207678_10015006 3300026067 Bacteria 6816
375 Ga0207678_10020543 3300026067 Bacteria 5789
376 Ga0207678_10828636 3300026067 Bacteria 817
377 Ga0207678_11132339 3300026067 Unclassified 693
378 Ga0207708_10055615 3300026075 Bacteria 3017
379 Ga0207708_10801314 3300026075 Bacteria 811
380 Ga0207702_10014801 3300026078 Bacteria 6471
381 Ga0207702_10257749 3300026078 Bacteria 1641
382 Ga0207702_10526112 3300026078 Unclassified 1155
383 Ga0207702_11174528 3300026078 Bacteria 762
384 Ga0207702_11754954 3300026078 Unclassified 613
385 Ga0207641_10637129 3300026088 Bacteria 1046
386 Ga0207641_10853064 3300026088 Bacteria 903
387 Ga0207648_10015546 3300026089 Bacteria 6995
388 Ga0207648_10121927 3300026089 Bacteria 2292
389 Ga0207676_10004263 3300026095 Bacteria 10109
390 Ga0207676_10182033 3300026095 Unclassified 1841
391 Ga0207674_10616951 3300026116 Bacteria 1048
392 Ga0207674_11287979 3300026116 Bacteria 700
393 Ga0207675_100005484 3300026118 Bacteria 12153
394 Ga0207675_100272248 3300026118 Bacteria 1643
395 Ga0207683_10008970 3300026121 Bacteria 8518
396 Ga0207683_10121790 3300026121 Bacteria 2343
397 Ga0207683_10214004 3300026121 Bacteria 1754
398 Ga0207698_10005805 3300026142 Bacteria 7662
399 Ga0207698_10118243 3300026142 Bacteria 2238
400 Ga0207698_10875515 3300026142 Bacteria 904
401 Ga0207698_11947008 3300026142 Bacteria 602
402 Ga0209973_1012449 3300027252 Bacteria 1035
403 Ga0209996_1059049 3300027395 Bacteria 588
404 Ga0209995_1019382 3300027471 Bacteria 1123
405 Ga0209968_1024191 3300027526 Unclassified 996
406 Ga0209971_1007381 3300027682 Bacteria 2608
407 Ga0209966_1018871 3300027695 Bacteria 1324
408 Ga0209998_10043064 3300027717 Unclassified 1029
409 Ga0209974_10017709 3300027876 Bacteria 2362
410 Ga0209974_10026726 3300027876 Bacteria 1910
411 Ga0207428_10289875 3300027907 Unclassified 1213
412 Ga0268266_10852994 3300028379 Bacteria 880
413 Ga0268266_12094415 3300028379 Bacteria 539
414 Ga0268265_10907500 3300028380 Bacteria 865
415 Ga0268264_10313559 3300028381 Unclassified 1481
416 Ga0268264_10841606 3300028381 Bacteria 918
417 Ga0268264_11320954 3300028381 Bacteria 731
418 Ga0265334_10058121 3300028573 Bacteria 1464
419 Ga0265336_10199003 3300028666 Bacteria 595
420 Ga0265338_10020423 3300028800 Bacteria 6965
421 Ga0265330_10007320 3300031235 Bacteria 5388
422 Ga0265330_10224419 3300031235 Bacteria 793
423 Ga0265332_10001666 3300031238 Bacteria 12142
424 Ga0265325_10000492 3300031241 Bacteria 28656
425 Ga0265325_10015746 3300031241 Bacteria 4243
426 Ga0265325_10089471 3300031241 Bacteria 1520
427 Ga0265329_10029197 3300031242 Bacteria 1803
428 Ga0265340_10000923 3300031247 Bacteria 16698
429 Ga0265340_10028447 3300031247 Bacteria 2811
430 Ga0265339_10001666 3300031249 Bacteria 16403
431 Ga0265339_10005557 3300031249 Bacteria 8381
432 Ga0265339_10022893 3300031249 Bacteria 3614
433 Ga0265339_10328822 3300031249 Bacteria 724
434 Ga0265339_10349987 3300031249 Bacteria 697
435 Ga0265331_10004223 3300031250 Bacteria 8998
436 Ga0265331_10505864 3300031250 Bacteria 544
437 Ga0265327_10077537 3300031251 Bacteria 1648
438 Ga0307513_10529529 3300031456 Bacteria 893
439 Ga0265313_10000358 3300031595 Bacteria 49794
440 Ga0265313_10051016 3300031595 Bacteria 1982
441 Ga0265313_10240677 3300031595 Unclassified 741
442 Ga0265313_10269094 3300031595 Unclassified 691
443 Ga0307508_10379942 3300031616 Bacteria 1003
444 Ga0265314_10003834 3300031711 Bacteria 14354
445 Ga0265342_10000024 3300031712 Bacteria 171500
446 Ga0265342_10005591 3300031712 Bacteria 9529
447 Ga0307412_10801122 3300031911 Bacteria 818
448 Ga0307412_11786644 3300031911 Bacteria 565
449 Ga0307411_11464206 3300032005 Bacteria 627
450 Ga0373948_0090211 3300034817 Bacteria 710
451 Ga0373958_0100371 3300034819 Bacteria 678
452 Ga0373959_0026085 3300034820 Bacteria 1153
453 Ga0373938_0002965 3300034957 Bacteria 2747
454 Ga0373938_0006294 3300034957 Bacteria 2047
455 Ga0373926_0045399 3300035083 Bacteria 1575
456 Ga0373928_0200419 3300035084 Bacteria 576
457 Ga0373929_0013145 3300035085 Bacteria 1583
458 Ga0373940_0026216 3300035088 Bacteria 1524
459 Ga0373944_0058086 3300035089 Bacteria 1235
460 Ga0373949_0005336 3300035090 Bacteria 2871
461 Ga0373949_0125273 3300035090 Bacteria 725
462 Ga0373951_0036665 3300035091 Bacteria 1171
463 Ga0373932_0011261 3300035112 Bacteria 2182
464 Ga0373932_0094193 3300035112 Bacteria 966
465 Ga0373936_0016132 3300035113 Bacteria 2871
466 Ga0373936_0215467 3300035113 Bacteria 851
467 Ga0373939_0047072 3300035114 Bacteria 1323
468 Ga0373941_0106512 3300035115 Bacteria 983
469 Ga0373945_0086407 3300035116 Bacteria 1209
470 Ga0373945_0319028 3300035116 Bacteria 668
471 Ga0373953_0244037 3300035117 Unclassified 780
472 Ga0373960_0337849 3300035121 Bacteria 568
473 Ga0373960_0378761 3300035121 Bacteria 542
474 Ga0373943_0095759 3300035170 Bacteria 1544
475 Ga0373943_0188075 3300035170 Unclassified 1138
476 Ga0373943_0349901 3300035170 Bacteria 847
477 Ga0373946_0009198 3300035171 Bacteria 3635
478 Ga0373946_0069193 3300035171 Bacteria 1520
479 Ga0373955_0177272 3300035172 Bacteria 1264
480 Ga0373961_0018760 3300035241 Unclassified 1810
481 Ga0373961_0038889 3300035241 Bacteria 1365
482 Ga0373961_0152505 3300035241 Bacteria 788
483 Ga0373962_0018431 3300035242 Bacteria 1816
484 Ga0373962_0156845 3300035242 Bacteria 749
485 Ga0373931_0002725 3300035691 Bacteria 7855
486 Ga0373931_0003050 3300035691 Bacteria 7484
487 Ga0373931_0012810 3300035691 Bacteria 4071
488 Ga0373931_0428373 3300035691 Bacteria 842
489 Ga0373935_0342792 3300035692 Bacteria 1064
490 Ga0373935_0421912 3300035692 Bacteria 960
491 Ga0373935_0603964 3300035692 Bacteria 802
492 Ga0373927_0026497 3300035695 Bacteria 3788
493 Ga0373927_0173840 3300035695 Bacteria 1412
494 Ga0373933_0326700 3300035724 Bacteria 995
495 Ga0373933_0858847 3300035724 Unclassified 597
496 Ga0373947_0014157 3300035725 Bacteria 4574
497 Ga0373947_0078858 3300035725 Bacteria 2034
498 Ga0373937_0581303 3300036401 Unclassified 1064
499 Ga0373925_0138490 3300037068 Bacteria 1903
500 Ga0373925_0152676 3300037068 Bacteria 1814
501 Ga0373925_0159242 3300037068 Bacteria 1777
502 Ga0373925_0166255 3300037068 Bacteria 1740
503 Ga0373925_0321782 3300037068 Bacteria 1252
504 Ga0373925_1666464 3300037068 Bacteria 521
505 Ga0395898_1889033 3300037466 Bacteria 517
506 Ga0436364_0177955 3300037853 Bacteria 3192
507 Ga0436365_0014752 3300039437 Bacteria 19903
508 Ga0436365_0290395 3300039437 Bacteria 1997
509 Ga0436365_1701135 3300039437 Bacteria 585
510 Ga0436363_0060130 3300039450 Unclassified 860
511 Ga0436363_0204911 3300039450 Bacteria 511
512 Ga0436362_0469105 3300039453 Unclassified 1707
513 Ga0436362_0563505 3300039453 Bacteria 538
514 Ga0436362_0724136 3300039453 Bacteria 670
515 Ga0439453_0010014 3300041408 Bacteria 1554
516 Ga0451798_1067770 3300041458 Bacteria 639
517 Ga0451837_0033816 3300041494 Bacteria 907
518 Ga0451839_0876901 3300041496 Bacteria 677
519 Ga0439441_058305 3300042001 Bacteria 808
520 Ga0439455_0003616 3300042012 Bacteria 2976
521 Ga0439458_0029905 3300042157 Bacteria 1295
522 Ga0439435_0128760 3300042436 Bacteria 798
523 Ga0439435_0157275 3300042436 Bacteria 732
524 Ga0439444_0041023 3300042437 Bacteria 909
525 Ga0450893_0019745 3300042532 Bacteria 1154
526 Ga0466965_0557349 3300044683 Bacteria 648
527 Ga0466963_0039686 3300044694 Unclassified 3084
528 Ga0466963_0076019 3300044694 Bacteria 2267
529 Ga0466963_0826397 3300044694 Bacteria 653
530 Ga0466957_0096843 3300044842 Bacteria 1855
531 Ga0466957_0142902 3300044842 Unclassified 1543
532 Ga0451576_0575023 3300045051 Bacteria 1184
533 Ga0466958_0065037 3300045836 Bacteria 2225
534 Ga0466958_0438209 3300045836 Bacteria 845
535 Ga0466967_0104069 3300045976 Unclassified 2598
536 Ga0466967_0325533 3300045976 Bacteria 1483
537 Ga0466967_0618446 3300045976 Bacteria 1070
538 Ga0466967_1211014 3300045976 Bacteria 752
539 Ga0495592_0016172 3300046454 Bacteria 5660
540 Ga0495603_0124778 3300046455 Bacteria 1500
541 Ga0495629_0083706 3300046459 Bacteria 2226
542 Ga0495629_0084796 3300046459 Bacteria 2210
543 Ga0495641_0054482 3300046461 Bacteria 1817
544 Ga0495653_0132708 3300046463 Bacteria 1761
545 Ga0495653_0446601 3300046463 Bacteria 814
546 Ga0495582_0025433 3300046473 Bacteria 3243
547 Ga0495664_0119030 3300046477 Bacteria 1597
548 Ga0495664_0234704 3300046477 Bacteria 1109
549 Ga0495584_0052478 3300046491 Bacteria 2052
550 Ga0495584_0544145 3300046491 Bacteria 592
551 Ga0495594_0140265 3300046499 Bacteria 1371
552 Ga0495608_0129306 3300046511 Bacteria 1617
553 Ga0495618_0044381 3300046514 Bacteria 2804
554 Ga0495618_0821920 3300046514 Bacteria 540
555 Ga0495628_0002489 3300046516 Bacteria 16582
556 Ga0495628_0342249 3300046516 Bacteria 1101
557 Ga0495630_0329188 3300046517 Bacteria 1168
558 Ga0495637_0142762 3300046520 Bacteria 908
559 Ga0495652_0014505 3300046529 Bacteria 7073
560 Ga0495652_0064118 3300046529 Bacteria 3091
561 Ga0495640_0112736 3300046533 Bacteria 1775
562 Ga0495640_0254010 3300046533 Bacteria 1100
563 Ga0495598_0088642 3300046537 Bacteria 1005
564 Ga0495609_0223811 3300046538 Bacteria 781
565 Ga0495645_0028961 3300046543 Bacteria 4025
566 Ga0495645_0037608 3300046543 Bacteria 3529
567 Ga0495667_0284628 3300046559 Bacteria 1049
568 Ga0495656_0027060 3300046615 Bacteria 2288
569 Ga0495634_0017010 3300046642 Bacteria 5195
570 Ga0495634_0584766 3300046642 Bacteria 649
571 Ga0495635_0012481 3300046663 Bacteria 5953
572 Ga0495635_0057078 3300046663 Bacteria 2687
573 Ga0495635_0118803 3300046663 Bacteria 1804
574 Ga0495659_0100970 3300046664 Bacteria 1118
575 Ga0495599_0004241 3300046678 Bacteria 8471
576 Ga0495599_0110108 3300046678 Bacteria 1716
577 Ga0495658_0333358 3300046683 Bacteria 963
578 Ga0495658_0409448 3300046683 Unclassified 865
579 Ga0495669_0189501 3300046684 Bacteria 982
580 Ga0495613_0107155 3300046689 Bacteria 2016
581 Ga0495604_0007651 3300047317 Bacteria 8557
582 Ga0495674_0287215 3300047319 Bacteria 1346
583 Ga0495676_0129398 3300047321 Bacteria 1825
584 Ga0495680_0074838 3300047322 Bacteria 2571
585 Ga0495680_0111604 3300047322 Bacteria 2026
586 Ga0495680_0826619 3300047322 Bacteria 603
587 Ga0495675_0110185 3300047444 Bacteria 1719
588 Ga0495675_0367601 3300047444 Bacteria 843
589 Ga0495673_0158796 3300047469 Bacteria 869
590 Ga0495684_0126217 3300047471 Bacteria 1925
591 Ga0495684_0654973 3300047471 Bacteria 702
592 Ga0495684_0842781 3300047471 Bacteria 595
593 Ga0495602_0145116 3300048088 Bacteria 1874
594 Ga0496100_0471662 3300048903 Bacteria 964
595 Ga0496101_0007138 3300048904 Bacteria 7224
596 Ga0496101_0016017 3300048904 Bacteria 5060
597 Ga0496101_0065089 3300048904 Bacteria 2657
598 Ga0496101_1199397 3300048904 Bacteria 595
599 Ga0496102_0002400 3300048905 Bacteria 15988
600 Ga0496102_0002500 3300048905 Bacteria 15700
601 Ga0496102_0081410 3300048905 Bacteria 2985
602 Ga0496103_0003226 3300048906 Bacteria 10008
603 Ga0496103_0403217 3300048906 Bacteria 878
604 Ga0496104_0111088 3300048907 Bacteria 2628
605 Ga0496104_0184249 3300048907 Bacteria 1998
606 Ga0496105_0049379 3300048908 Bacteria 3474
607 Ga0496105_0715028 3300048908 Bacteria 768
608 Ga0496106_0009068 3300048909 Bacteria 7354
609 Ga0496106_0110656 3300048909 Bacteria 2138
610 Ga0496106_0115292 3300048909 Unclassified 2095
611 Ga0496106_0228889 3300048909 Bacteria 1484
612 Ga0496106_0246801 3300048909 Bacteria 1427
613 Ga0496107_0011801 3300048910 Bacteria 6100
614 Ga0496107_0014283 3300048910 Bacteria 5561
615 Ga0496107_0015101 3300048910 Bacteria 5411
616 Ga0496107_0041367 3300048910 Bacteria 3309
617 Ga0496108_0180400 3300048911 Bacteria 1828
618 Ga0496108_0257459 3300048911 Bacteria 1518
619 Ga0496109_0065002 3300048912 Bacteria 3339
620 Ga0496109_0327295 3300048912 Bacteria 1446
621 Ga0496109_1063588 3300048912 Bacteria 746
622 Ga0496110_0013983 3300048913 Bacteria 6651
623 Ga0496110_0132067 3300048913 Bacteria 2255
624 Ga0496111_0014207 3300048914 Bacteria 5434
625 Ga0496111_0055800 3300048914 Bacteria 2857
626 Ga0496112_0023942 3300048915 Bacteria 5841
627 Ga0496112_0055030 3300048915 Bacteria 3910
628 Ga0496112_0070138 3300048915 Bacteria 3463
629 Ga0496112_0195162 3300048915 Bacteria 1985
630 Ga0496113_0018073 3300048916 Bacteria 4906
631 Ga0496113_1150941 3300048916 Bacteria 607
632 Ga0496114_0026919 3300048917 Bacteria 4711
633 Ga0496114_0475596 3300048917 Bacteria 1105
634 Ga0496115_0002443 3300048918 Bacteria 13348
635 Ga0496115_0050936 3300048918 Bacteria 3319
636 Ga0496115_0093020 3300048918 Bacteria 2465
637 Ga0496115_0228653 3300048918 Bacteria 1534
638 Ga0496117_0584359 3300048920 Bacteria 525
639 Ga0496118_0043445 3300048921 Bacteria 3533
640 Ga0496118_0185503 3300048921 Bacteria 1251
641 Ga0496119_0078889 3300048922 Bacteria 1903
642 Ga0496120_0000642 3300048923 Bacteria 51691
643 Ga0496120_0152277 3300048923 Bacteria 1161
644 Ga0496121_0004775 3300048924 Bacteria 17874
645 Ga0496124_0000784 3300048927 Bacteria 51859
646 Ga0496126_0282277 3300048929 Bacteria 1375
647 Ga0496126_0356320 3300048929 Bacteria 1196
648 Ga0501031_0026061 3300049568 Bacteria 3813
649 Ga0501031_0878510 3300049568 Bacteria 574
650 Ga0501032_0130849 3300049569 Bacteria 1656
651 Ga0501033_0015175 3300049570 Bacteria 5847
652 Ga0501033_0186350 3300049570 Bacteria 1486
653 Ga0501034_0302043 3300049571 Bacteria 1537
654 Ga0501034_0647365 3300049571 Bacteria 959
655 Ga0501034_1554463 3300049571 Bacteria 535
656 Ga0501036_0012228 3300049572 Bacteria 7110
657 Ga0501036_0022578 3300049572 Bacteria 5294
658 Ga0501036_0164096 3300049572 Bacteria 1873
659 Ga0501036_0740697 3300049572 Unclassified 811
660 Ga0501037_0022595 3300049573 Bacteria 4652
661 Ga0501038_0010730 3300049574 Bacteria 8375
662 Ga0501038_0022971 3300049574 Bacteria 5582
663 Ga0501038_0025182 3300049574 Bacteria 5305
664 Ga0501038_0735047 3300049574 Bacteria 737
665 Ga0501038_0936072 3300049574 Bacteria 638
666 Ga0501039_0078326 3300049575 Bacteria 2571
667 Ga0501039_0162061 3300049575 Bacteria 1758
668 Ga0501039_0313638 3300049575 Bacteria 1233
669 Ga0501039_0329149 3300049575 Bacteria 1201
670 Ga0501039_0482040 3300049575 Bacteria 974
671 Ga0501040_0265394 3300049576 Bacteria 1225
672 Ga0501040_0986546 3300049576 Bacteria 611
673 Ga0501041_0020140 3300049577 Bacteria 3985
674 Ga0501041_0098426 3300049577 Bacteria 1809
675 Ga0501041_0580986 3300049577 Bacteria 715
676 Ga0501042_0054635 3300049578 Bacteria 2849
677 Ga0501043_0325567 3300049579 Bacteria 1171
678 Ga0501043_0391011 3300049579 Bacteria 1052
679 Ga0501046_0103884 3300049580 Bacteria 2178
680 Ga0501047_0067132 3300049581 Bacteria 3457
681 Ga0501047_0076545 3300049581 Bacteria 3220
682 Ga0501047_0214676 3300049581 Bacteria 1781
683 Ga0501047_0233446 3300049581 Bacteria 1692
684 Ga0501047_0417708 3300049581 Bacteria 1173
685 Ga0501048_0098220 3300049582 Bacteria 2066
686 Ga0501048_0486568 3300049582 Bacteria 885
687 Ga0501067_0028072 3300049583 Bacteria 3118
688 Ga0501068_0117429 3300049584 Bacteria 1657
689 Ga0501069_0157450 3300049585 Bacteria 1307
690 Ga0501069_0293169 3300049585 Bacteria 953
691 Ga0501069_0809129 3300049585 Bacteria 568
692 Ga0501070_0006459 3300049586 Bacteria 9980
693 Ga0501070_0027881 3300049586 Bacteria 4737
694 Ga0501070_0579053 3300049586 Bacteria 896
695 Ga0501070_0604987 3300049586 Bacteria 873
696 Ga0501070_0769240 3300049586 Bacteria 758
697 Ga0501070_0814695 3300049586 Bacteria 732
698 Ga0501071_0046623 3300049587 Bacteria 3113
699 Ga0501071_0136141 3300049587 Bacteria 1828
700 Ga0501071_0384522 3300049587 Bacteria 1070
701 Ga0501071_0517914 3300049587 Bacteria 915
702 Ga0501072_0034067 3300049588 Bacteria 3990
703 Ga0501072_0055945 3300049588 Bacteria 3109
704 Ga0501073_0452387 3300049589 Bacteria 888
705 Ga0501073_0797885 3300049589 Bacteria 651
706 Ga0501074_0033072 3300049590 Bacteria 3747
707 Ga0501074_0041740 3300049590 Bacteria 3321
708 Ga0501075_0027980 3300049591 Bacteria 4157
709 Ga0501075_0395415 3300049591 Bacteria 1054
710 Ga0501075_0443413 3300049591 Bacteria 990
711 Ga0501075_1194700 3300049591 Bacteria 577
712 Ga0501076_0016602 3300049592 Bacteria 5582
713 Ga0501076_0072987 3300049592 Bacteria 2747
714 Ga0501076_0198088 3300049592 Bacteria 1640
715 Ga0501076_0319849 3300049592 Bacteria 1273
716 Ga0501076_0609062 3300049592 Bacteria 901
717 Ga0501077_0017382 3300049593 Bacteria 4539
718 Ga0501077_0159199 3300049593 Bacteria 1433
719 Ga0501077_0671491 3300049593 Bacteria 666
720 Ga0501079_0021115 3300049741 Bacteria 4977
721 Ga0501079_0607592 3300049741 Unclassified 861
722 Ga0501080_0036722 3300049742 Bacteria 4574
723 Ga0501080_0064615 3300049742 Bacteria 3403
724 Ga0501080_0194344 3300049742 Bacteria 1864
725 Ga0501080_0926708 3300049742 Bacteria 758
726 Ga0501080_1417861 3300049742 Bacteria 592
727 Ga0501081_0109177 3300049743 Bacteria 1962
728 Ga0501081_0124627 3300049743 Bacteria 1837
729 Ga0501081_0439436 3300049743 Bacteria 968
730 Ga0501081_0961855 3300049743 Unclassified 645
731 Ga0501083_0407647 3300049744 Bacteria 884
732 Ga0501035_0000505 3300049822 Bacteria 44014
733 Ga0501035_0108044 3300049822 Bacteria 2439
734 Ga0501035_0251865 3300049822 Bacteria 1499
735 Ga0501035_0419894 3300049822 Bacteria 1110
736 Ga0501044_0024995 3300049823 Bacteria 6333
737 Ga0501044_0095932 3300049823 Bacteria 2988
738 Ga0501044_0242296 3300049823 Bacteria 1746
739 Ga0501044_0960060 3300049823 Bacteria 728
740 Ga0501044_1097656 3300049823 Bacteria 665
741 Ga0501045_0031454 3300049824 Bacteria 3844
742 nmdc:mga03683_127555_c1 3300050489 Bacteria 1136
743 nmdc:mga03683_30724_c1 3300050489 Bacteria 2151
744 nmdc:mga03n38_574364_c1 3300050490 Bacteria 640
745 nmdc:mga00v17_827549_c1 3300050491 Bacteria 589
746 nmdc:mga0yw44_10863_c1 3300050492 Bacteria 4668
747 nmdc:mga0k408_10258_c1 3300050493 Bacteria 5064
748 nmdc:mga0k408_242404_c1 3300050493 Bacteria 1076
749 nmdc:mga0k408_753730_c1 3300050493 Bacteria 569
750 nmdc:mga06z11_175385_c1 3300050494 Bacteria 1233
751 nmdc:mga06z11_344327_c1 3300050494 Bacteria 892
752 nmdc:mga06z11_530506_c1 3300050494 Bacteria 714
753 nmdc:mga06z11_734273_c1 3300050494 Bacteria 602
754 nmdc:mga06z11_850057_c1 3300050494 Bacteria 556
755 nmdc:mga07m45_157667_c1 3300050496 Bacteria 1317
756 nmdc:mga07m45_174607_c1 3300050496 Unclassified 1249
757 nmdc:mga07m45_436351_c1 3300050496 Bacteria 760
758 nmdc:mga07m45_447210_c1 3300050496 Bacteria 749
759 nmdc:mga05p37_272569_c1 3300050507 Bacteria 2021
760 nmdc:mga08y16_42358_c1 3300050511 Bacteria 4768
761 nmdc:mga08y16_45372_c1 3300050511 Bacteria 4605
762 nmdc:mga0n895_170680_c1 3300050512 Bacteria 2207
763 nmdc:mga0n895_334101_c1 3300050512 Bacteria 1535
764 nmdc:mga0n895_533865_c1 3300050512 Bacteria 1180
765 nmdc:mga0n895_714982_c1 3300050512 Bacteria 997
766 nmdc:mga0n895_90039_c1 3300050512 Bacteria 3069
767 Ga0495601_0000030 3300053077 Bacteria 106632
768 Ga0495601_0000674 3300053077 Bacteria 18216
769 Ga0495601_0006331 3300053077 Bacteria 6918
770 Ga0495601_0116093 3300053077 Bacteria 1736
771 Ga0495612_0003281 3300053078 Bacteria 6708
772 Ga0495612_0028040 3300053078 Bacteria 2266
773 Ga0495612_0217396 3300053078 Unclassified 846
774 Ga0495655_0231921 3300053083 Bacteria 615
775 Ga0495595_0063262 3300053084 Bacteria 1737
776 Ga0495595_0076999 3300053084 Bacteria 1584
777 Ga0495619_0000128 3300053085 Bacteria 55938
778 Ga0495619_0092275 3300053085 Bacteria 2051
779 Ga0495619_0140694 3300053085 Bacteria 1661
780 Ga0500651_0055577 3300053093 Bacteria 2479
781 Ga0500641_0039215 3300053096 Bacteria 1907
782 Ga0500650_0083212 3300053098 Bacteria 1497
783 Ga0500562_101867 3300053108 Bacteria 782
784 Ga0500594_0009076 3300053118 Bacteria 2282
785 Ga0500595_003481 3300053119 Bacteria 7328
786 Ga0500595_046894 3300053119 Bacteria 1356
787 Ga0500595_052365 3300053119 Bacteria 1260
788 Ga0500597_342766 3300053120 Bacteria 584
789 Ga0500642_0002354 3300053130 Bacteria 5533
790 Ga0500568_0102878 3300053139 Bacteria 1071
791 Ga0500568_0331758 3300053139 Bacteria 552
792 Ga0500577_0034857 3300053142 Bacteria 1791
793 Ga0500577_0244671 3300053142 Bacteria 779
794 Ga0500622_0195877 3300053156 Bacteria 922
795 Ga0500627_0032261 3300053158 Bacteria 2207
796 Ga0500636_0047538 3300053177 Bacteria 2527
797 Ga0501084_0035059 3300054114 Bacteria 4194
798 Ga0501084_0095289 3300054114 Bacteria 2500
799 Ga0501084_0119889 3300054114 Bacteria 2212
800 Ga0501084_0725402 3300054114 Bacteria 838
801 Ga0590077_033941 3300059426 Bacteria 1121
802 Ga0501082_0152955 3300060353 Bacteria 2004
803 Ga0501082_0274706 3300060353 Bacteria 1467
804 Ga0501082_0320763 3300060353 Bacteria 1350
805 Ga0501082_0342090 3300060353 Bacteria 1304
806 Ga0501082_0694078 3300060353 Unclassified 891
807 Ga0466962_0234700 3300061719 Unclassified 900
808 Ga0466962_0254293 3300061719 Bacteria 864
809 Ga0530510_0005595 3300061734 Bacteria 8708
810 Ga0530510_0062852 3300061734 Bacteria 2688
811 2524441135 2524023205 Bacteria 8918781
812 2844107502 2844104063 Bacteria 6440972
813 2851249542 2851246043 Bacteria 6439203
814 Ga0373933_0579159
815 JGI24034J26672_10083737
816 JGI24742J22300_10015791
817 JGI25159J45721_1006261
818 JGI25153J46596_10068095
819 rootH2_10204788
820 Ga0065165_1000252
821 Ga0065712_10101621
822 Ga0065707_10380427
823 Ga0070658_10033975
824 Ga0070658_10034304
825 Ga0070658_10042826
826 Ga0070658_11505979
827 Ga0070676_10002158
828 Ga0070676_10074160
829 Ga0070676_11131129
830 Ga0070683_100891532
831 Ga0070690_101556951
832 Ga0070670_100032423
833 Ga0070677_10027994
834 Ga0070666_10492444
835 Ga0070680_100001601
836 Ga0070680_100009773
837 Ga0070680_100071036
838 Ga0070682_100064000
839 Ga0070682_101172104
840 Ga0070660_100016798
841 Ga0070660_100031291
842 Ga0070660_100243892
843 Ga0070660_100744947
844 Ga0070689_100002623
845 Ga0070689_100250628
846 Ga0070689_100391007
847 Ga0070691_10471144
848 Ga0070691_11027124
849 Ga0070687_100008281
850 Ga0070661_100518556
851 Ga0070661_100821056
852 Ga0070661_101277997
853 Ga0070692_10051196
854 Ga0070668_100292585
855 Ga0070668_100858678
856 Ga0070669_100352456
857 Ga0070675_100057623
858 Ga0070675_100255170
859 Ga0070675_101685171
860 Ga0070674_100007410
861 Ga0070674_100011321
862 Ga0070674_100391867
863 Ga0070674_101968038
864 Ga0070673_101778823
865 Ga0070688_100049632
866 Ga0070688_100059204
867 Ga0070688_101082071
868 Ga0070659_100036085
869 Ga0070659_101297206
870 Ga0070659_101486442
871 Ga0070667_100262738
872 Ga0070667_100718774
873 Ga0070709_10550628
874 Ga0070710_10006614
875 Ga0070701_10094468
876 Ga0070701_10720022
877 Ga0070711_100388417
878 Ga0070705_100195589
879 Ga0070700_100303814
880 Ga0070663_100024640
881 Ga0070663_100290303
882 Ga0070663_100435269
883 Ga0070678_100059946
884 Ga0070678_102280635
885 Ga0070662_100001368
886 Ga0070662_101305033
887 Ga0070681_10022672
888 Ga0070681_10128499
889 Ga0070681_10739992
890 Ga0070681_11159933
891 Ga0070681_11894284
892 Ga0068867_100164904
893 Ga0068867_100267564
894 Ga0068867_100445811
895 Ga0070707_101209743
896 Ga0070699_100001407
897 Ga0070699_100580663
898 Ga0070679_100003445
899 Ga0070679_100019745
900 Ga0070679_100020739
901 Ga0070679_100237543
902 Ga0070679_100281729
903 Ga0070679_100392718
904 Ga0070679_100763375
905 Ga0070697_101492672
906 Ga0068853_100046852
907 Ga0068853_100864005
908 Ga0070672_100208057
909 Ga0070672_100284018
910 Ga0070686_100020392
911 Ga0070686_100096739
912 Ga0070686_100175935
913 Ga0070686_101184116
914 Ga0070695_100103257
915 Ga0070695_100316003
916 Ga0070696_100108627
917 Ga0070693_100024318
918 Ga0070693_100042724
919 Ga0070693_100065823
920 Ga0070693_100628001
921 Ga0070693_101327728
922 Ga0068855_100009581
923 Ga0068855_100016599
924 Ga0068855_100053715
925 Ga0068855_101226261
926 Ga0070664_100006915
927 Ga0070664_100260021
928 Ga0070664_101173008
929 Ga0070664_101532026
930 Ga0068857_100650273
931 Ga0068857_101062125
932 Ga0068854_100088292
933 Ga0068854_100110628
934 Ga0068854_100427550
935 Ga0068856_100014389
936 Ga0068856_100125585
937 Ga0068856_100282672
938 Ga0068856_101378194
939 Ga0068856_102640591
940 Ga0070702_100008673
941 Ga0070702_100668604
942 Ga0070702_100759475
943 Ga0068852_100006787
944 Ga0068852_100069978
945 Ga0068852_100422446
946 Ga0068852_100595194
947 Ga0068852_102240342
948 Ga0068859_101898084
949 Ga0068859_102324726
950 Ga0068864_100225158
951 Ga0068866_10024832
952 Ga0068866_10085145
953 Ga0068866_10863355
954 Ga0068861_100003655
955 Ga0068870_10020737
956 Ga0068863_100259422
957 Ga0068858_100286358
958 Ga0068858_100791176
959 Ga0068860_100232399
960 Ga0068860_100791152
961 Ga0068860_100900616
962 Ga0068862_101266319
963 Ga0081455_10058479
964 Ga0081455_10168792
965 Ga0081455_10399170
966 Ga0081538_10145108
967 Ga0081538_10245061
968 Ga0081540_1000008
969 Ga0081540_1010264
970 Ga0070717_10909935
971 Ga0075365_10019352
972 Ga0075364_10289018
973 Ga0070712_100009678
974 Ga0075362_10210113
975 Ga0075362_10388184
976 Ga0075367_10408953
977 Ga0075369_10259886
978 Ga0075366_10004258
979 Ga0097621_100587578
980 Ga0097621_100721769
981 Ga0075370_10099159
982 Ga0075370_10128609
983 Ga0075370_10361293
984 Ga0075370_10369390
985 Ga0075370_10480356
986 Ga0068871_101269738
987 Ga0068871_101429892
988 Ga0068871_102013976
989 Ga0075428_101746456
990 Ga0075430_100720076
991 Ga0075431_100028860
992 Ga0075433_10678731
993 Ga0075434_100190026
994 Ga0075434_100393750
995 Ga0075434_100527115
996 Ga0075434_100531893
997 Ga0075434_100687358
998 Ga0075434_100876201
999 Ga0075434_101219859
1000 Ga0075429_100067818
1001 Ga0068865_100068693
1002 Ga0068865_100093021
1003 Ga0068865_102036662
1004 Ga0075436_100311395
1005 Ga0097620_101897863
1006 Ga0097620_102324752
1007 Ga0099794_10390002
1008 Ga0099795_10188616
1009 Ga0105240_10137210
1010 Ga0105240_10583982
1011 Ga0105240_12351567
1012 Ga0111539_10041276
1013 Ga0111539_10053885
1014 Ga0111539_11767679
1015 Ga0105245_10063674
1016 Ga0105245_10114776
1017 Ga0105245_10906062
1018 Ga0105245_11151273
1019 Ga0105245_12802732
1020 Ga0105247_10031959
1021 Ga0105243_10009046
1022 Ga0105243_11099519
1023 Ga0105243_12034137
1024 Ga0105241_10209323
1025 Ga0105241_10426105
1026 Ga0105242_10080334
1027 Ga0105248_10053729
1028 Ga0105248_10438264
1029 Ga0105248_10582409
1030 Ga0105237_10947964
1031 Ga0105238_10037799
1032 Ga0105249_11020217
1033 Ga0105249_12616729
1034 Ga0105239_10023991
1035 Ga0105239_11315555
1036 Ga0105246_10055194
1037 Ga0105246_10125534
1038 Ga0105246_11871549
1039 Ga0157371_10015899
1040 Ga0157371_10272524
1041 Ga0157370_10072403
1042 Ga0157370_10265840
1043 Ga0157370_10864263
1044 Ga0157369_10046677
1045 Ga0157369_10351603
1046 Ga0157374_10188413
1047 Ga0157374_12121422
1048 Ga0157378_10016031
1049 Ga0157378_11197654
1050 Ga0163162_10166464
1051 Ga0163162_10170248
1052 Ga0163162_10325436
1053 Ga0163162_10723815
1054 Ga0157372_10067256
1055 Ga0157375_10181245
1056 Ga0157375_10636263
1057 Ga0157375_13627422
1058 Ga0163163_10007654
1059 Ga0163163_10136977
1060 Ga0163163_10498886
1061 Ga0157380_10064848
1062 Ga0157380_10072237
1063 Ga0157380_10096347
1064 Ga0157380_10119312
1065 Ga0157377_10025518
1066 Ga0157377_10608872
1067 Ga0157379_10032221
1068 Ga0157379_10041477
1069 Ga0157379_10425989
1070 Ga0157379_11285886
1071 Ga0157376_10077505
1072 Ga0163161_10271510
1073 Ga0163161_11197723
1074 Ga0213876_10030905
1075 Ga0213876_10298079
1076 Ga0209130_1000116
1077 Ga0209025_1001149
1078 Ga0209758_1000128
1079 Ga0209758_1012076
1080 Ga0209758_1023850
1081 Ga0209256_1010977
1082 Ga0207426_1026746
1083 Ga0207697_10008778
1084 Ga0207692_10281944
1085 Ga0207642_10021820
1086 Ga0207642_10049617
1087 Ga0207642_10350411
1088 Ga0207710_10187088
1089 Ga0207688_10304749
1090 Ga0207680_10694218
1091 Ga0207680_11133172
1092 Ga0207647_10266009
1093 Ga0207685_10311962
1094 Ga0207699_10079785
1095 Ga0207645_10019118
1096 Ga0207645_10072304
1097 Ga0207643_10021957
1098 Ga0207705_10053193
1099 Ga0207705_10057860
1100 Ga0207705_10289132
1101 Ga0207654_10178426
1102 Ga0207654_10252610
1103 Ga0207707_10031324
1104 Ga0207707_10039823
1105 Ga0207707_10608919
1106 Ga0207707_10997331
1107 Ga0207707_11271753
1108 Ga0207707_11586409
1109 Ga0207695_10083704
1110 Ga0207693_10001267
1111 Ga0207663_10889292
1112 Ga0207660_10110586
1113 Ga0207660_10113188
1114 Ga0207660_10404813
1115 Ga0207660_11358036
1116 Ga0207662_10019234
1117 Ga0207662_10024737
1118 Ga0207657_10019761
1119 Ga0207657_10101374
1120 Ga0207657_10123363
1121 Ga0207657_10413438
1122 Ga0207649_10185717
1123 Ga0207649_10233672
1124 Ga0207652_10045629
1125 Ga0207652_10091063
1126 Ga0207652_10117905
1127 Ga0207652_10179168
1128 Ga0207652_10195690
1129 Ga0207652_10260518
1130 Ga0207646_11096795
1131 Ga0207694_10026945
1132 Ga0207694_11474616
1133 Ga0207659_10008275
1134 Ga0207659_10061776
1135 Ga0207687_10057742
1136 Ga0207687_10076947
1137 Ga0207687_10442099
1138 Ga0207664_10281425
1139 Ga0207664_10615043
1140 Ga0207664_10725908
1141 Ga0207664_10957342
1142 Ga0207644_10038091
1143 Ga0207644_10333100
1144 Ga0207644_10383845
1145 Ga0207690_10331711
1146 Ga0207706_10002037
1147 Ga0207706_10600788
1148 Ga0207686_10024322
1149 Ga0207686_11386954
1150 Ga0207709_10125289
1151 Ga0207709_10203284
1152 Ga0207670_10001005
1153 Ga0207670_10257347
1154 Ga0207669_10015894
1155 Ga0207669_10032049
1156 Ga0207704_10832896
1157 Ga0207704_11609334
1158 Ga0207665_11381775
1159 Ga0207691_10114148
1160 Ga0207711_10118986
1161 Ga0207711_10307776
1162 Ga0207689_10200840
1163 Ga0207661_10186233
1164 Ga0207679_10028476
1165 Ga0207679_10071269
1166 Ga0207679_10154704
1167 Ga0207667_10020484
1168 Ga0207667_10047980
1169 Ga0207651_10873270
1170 Ga0207651_11417415
1171 Ga0207712_10538394
1172 Ga0207712_10604913
1173 Ga0207668_10064971
1174 Ga0207668_10148924
1175 Ga0207668_10871015
1176 Ga0207640_10127323
1177 Ga0207640_10166402
1178 Ga0207658_10181315
1179 Ga0207658_10186159
1180 Ga0207658_10204383
1181 Ga0207658_10294312
1182 Ga0207677_11068854
1183 Ga0207703_10173294
1184 Ga0207703_10983644
1185 Ga0207639_11230432
1186 Ga0207639_11414312
1187 Ga0207678_10015006
1188 Ga0207678_10020543
1189 Ga0207678_10828636
1190 Ga0207678_11132339
1191 Ga0207708_10055615
1192 Ga0207708_10801314
1193 Ga0207702_10014801
1194 Ga0207702_10257749
1195 Ga0207702_10526112
1196 Ga0207702_11174528
1197 Ga0207702_11754954
1198 Ga0207641_10637129
1199 Ga0207641_10853064
1200 Ga0207648_10015546
1201 Ga0207648_10121927
1202 Ga0207676_10004263
1203 Ga0207676_10182033
1204 Ga0207674_10616951
1205 Ga0207674_11287979
1206 Ga0207675_100005484
1207 Ga0207675_100272248
1208 Ga0207683_10008970
1209 Ga0207683_10121790
1210 Ga0207683_10214004
1211 Ga0207698_10005805
1212 Ga0207698_10118243
1213 Ga0207698_10875515
1214 Ga0207698_11947008
1215 Ga0209973_1012449
1216 Ga0209996_1059049
1217 Ga0209995_1019382
1218 Ga0209968_1024191
1219 Ga0209971_1007381
1220 Ga0209966_1018871
1221 Ga0209998_10043064
1222 Ga0209974_10017709
1223 Ga0209974_10026726
1224 Ga0207428_10289875
1225 Ga0268266_10852994
1226 Ga0268266_12094415
1227 Ga0268265_10907500
1228 Ga0268264_10313559
1229 Ga0268264_10841606
1230 Ga0268264_11320954
1231 Ga0265334_10058121
1232 Ga0265336_10199003
1233 Ga0265338_10020423
1234 Ga0265330_10007320
1235 Ga0265330_10224419
1236 Ga0265332_10001666
1237 Ga0265325_10000492
1238 Ga0265325_10015746
1239 Ga0265325_10089471
1240 Ga0265329_10029197
1241 Ga0265340_10000923
1242 Ga0265340_10028447
1243 Ga0265339_10001666
1244 Ga0265339_10005557
1245 Ga0265339_10022893
1246 Ga0265339_10328822
1247 Ga0265339_10349987
1248 Ga0265331_10004223
1249 Ga0265331_10505864
1250 Ga0265327_10077537
1251 Ga0307513_10529529
1252 Ga0265313_10000358
1253 Ga0265313_10051016
1254 Ga0265313_10240677
1255 Ga0265313_10269094
1256 Ga0307508_10379942
1257 Ga0265314_10003834
1258 Ga0265342_10000024
1259 Ga0265342_10005591
1260 Ga0307412_10801122
1261 Ga0307412_11786644
1262 Ga0307411_11464206
1263 Ga0373948_0090211
1264 Ga0373958_0100371
1265 Ga0373959_0026085
1266 Ga0373938_0002965
1267 Ga0373938_0006294
1268 Ga0373926_0045399
1269 Ga0373928_0200419
1270 Ga0373929_0013145
1271 Ga0373940_0026216
1272 Ga0373944_0058086
1273 Ga0373949_0005336
1274 Ga0373949_0125273
1275 Ga0373951_0036665
1276 Ga0373932_0011261
1277 Ga0373932_0094193
1278 Ga0373936_0016132
1279 Ga0373936_0215467
1280 Ga0373939_0047072
1281 Ga0373941_0106512
1282 Ga0373945_0086407
1283 Ga0373945_0319028
1284 Ga0373953_0244037
1285 Ga0373960_0337849
1286 Ga0373960_0378761
1287 Ga0373943_0095759
1288 Ga0373943_0188075
1289 Ga0373943_0349901
1290 Ga0373946_0009198
1291 Ga0373946_0069193
1292 Ga0373955_0177272
1293 Ga0373961_0018760
1294 Ga0373961_0038889
1295 Ga0373961_0152505
1296 Ga0373962_0018431
1297 Ga0373962_0156845
1298 Ga0373931_0002725
1299 Ga0373931_0003050
1300 Ga0373931_0012810
1301 Ga0373931_0428373
1302 Ga0373935_0342792
1303 Ga0373935_0421912
1304 Ga0373935_0603964
1305 Ga0373927_0026497
1306 Ga0373927_0173840
1307 Ga0373933_0326700
1308 Ga0373933_0858847
1309 Ga0373947_0014157
1310 Ga0373947_0078858
1311 Ga0373937_0581303
1312 Ga0373925_0138490
1313 Ga0373925_0152676
1314 Ga0373925_0159242
1315 Ga0373925_0166255
1316 Ga0373925_0321782
1317 Ga0373925_1666464
1318 Ga0395898_1889033
1319 Ga0436364_0177955
1320 Ga0436365_0014752
1321 Ga0436365_0290395
1322 Ga0436365_1701135
1323 Ga0436363_0060130
1324 Ga0436363_0204911
1325 Ga0436362_0469105
1326 Ga0436362_0563505
1327 Ga0436362_0724136
1328 Ga0439453_0010014
1329 Ga0451798_1067770
1330 Ga0451837_0033816
1331 Ga0451839_0876901
1332 Ga0439441_058305
1333 Ga0439455_0003616
1334 Ga0439458_0029905
1335 Ga0439435_0128760
1336 Ga0439435_0157275
1337 Ga0439444_0041023
1338 Ga0450893_0019745
1339 Ga0466965_0557349
1340 Ga0466963_0039686
1341 Ga0466963_0076019
1342 Ga0466963_0826397
1343 Ga0466957_0096843
1344 Ga0466957_0142902
1345 Ga0451576_0575023
1346 Ga0466958_0065037
1347 Ga0466958_0438209
1348 Ga0466967_0104069
1349 Ga0466967_0325533
1350 Ga0466967_0618446
1351 Ga0466967_1211014
1352 Ga0495592_0016172
1353 Ga0495603_0124778
1354 Ga0495629_0083706
1355 Ga0495629_0084796
1356 Ga0495641_0054482
1357 Ga0495653_0132708
1358 Ga0495653_0446601
1359 Ga0495582_0025433
1360 Ga0495664_0119030
1361 Ga0495664_0234704
1362 Ga0495584_0052478
1363 Ga0495584_0544145
1364 Ga0495594_0140265
1365 Ga0495608_0129306
1366 Ga0495618_0044381
1367 Ga0495618_0821920
1368 Ga0495628_0002489
1369 Ga0495628_0342249
1370 Ga0495630_0329188
1371 Ga0495637_0142762
1372 Ga0495652_0014505
1373 Ga0495652_0064118
1374 Ga0495640_0112736
1375 Ga0495640_0254010
1376 Ga0495598_0088642
1377 Ga0495609_0223811
1378 Ga0495645_0028961
1379 Ga0495645_0037608
1380 Ga0495667_0284628
1381 Ga0495656_0027060
1382 Ga0495634_0017010
1383 Ga0495634_0584766
1384 Ga0495635_0012481
1385 Ga0495635_0057078
1386 Ga0495635_0118803
1387 Ga0495659_0100970
1388 Ga0495599_0004241
1389 Ga0495599_0110108
1390 Ga0495658_0333358
1391 Ga0495658_0409448
1392 Ga0495669_0189501
1393 Ga0495613_0107155
1394 Ga0495604_0007651
1395 Ga0495674_0287215
1396 Ga0495676_0129398
1397 Ga0495680_0074838
1398 Ga0495680_0111604
1399 Ga0495680_0826619
1400 Ga0495675_0110185
1401 Ga0495675_0367601
1402 Ga0495673_0158796
1403 Ga0495684_0126217
1404 Ga0495684_0654973
1405 Ga0495684_0842781
1406 Ga0495602_0145116
1407 Ga0496100_0471662
1408 Ga0496101_0007138
1409 Ga0496101_0016017
1410 Ga0496101_0065089
1411 Ga0496101_1199397
1412 Ga0496102_0002400
1413 Ga0496102_0002500
1414 Ga0496102_0081410
1415 Ga0496103_0003226
1416 Ga0496103_0403217
1417 Ga0496104_0111088
1418 Ga0496104_0184249
1419 Ga0496105_0049379
1420 Ga0496105_0715028
1421 Ga0496106_0009068
1422 Ga0496106_0110656
1423 Ga0496106_0115292
1424 Ga0496106_0228889
1425 Ga0496106_0246801
1426 Ga0496107_0011801
1427 Ga0496107_0014283
1428 Ga0496107_0015101
1429 Ga0496107_0041367
1430 Ga0496108_0180400
1431 Ga0496108_0257459
1432 Ga0496109_0065002
1433 Ga0496109_0327295
1434 Ga0496109_1063588
1435 Ga0496110_0013983
1436 Ga0496110_0132067
1437 Ga0496111_0014207
1438 Ga0496111_0055800
1439 Ga0496112_0023942
1440 Ga0496112_0055030
1441 Ga0496112_0070138
1442 Ga0496112_0195162
1443 Ga0496113_0018073
1444 Ga0496113_1150941
1445 Ga0496114_0026919
1446 Ga0496114_0475596
1447 Ga0496115_0002443
1448 Ga0496115_0050936
1449 Ga0496115_0093020
1450 Ga0496115_0228653
1451 Ga0496117_0584359
1452 Ga0496118_0043445
1453 Ga0496118_0185503
1454 Ga0496119_0078889
1455 Ga0496120_0000642
1456 Ga0496120_0152277
1457 Ga0496121_0004775
1458 Ga0496124_0000784
1459 Ga0496126_0282277
1460 Ga0496126_0356320
1461 Ga0501031_0026061
1462 Ga0501031_0878510
1463 Ga0501032_0130849
1464 Ga0501033_0015175
1465 Ga0501033_0186350
1466 Ga0501034_0302043
1467 Ga0501034_0647365
1468 Ga0501034_1554463
1469 Ga0501036_0012228
1470 Ga0501036_0022578
1471 Ga0501036_0164096
1472 Ga0501036_0740697
1473 Ga0501037_0022595
1474 Ga0501038_0010730
1475 Ga0501038_0022971
1476 Ga0501038_0025182
1477 Ga0501038_0735047
1478 Ga0501038_0936072
1479 Ga0501039_0078326
1480 Ga0501039_0162061
1481 Ga0501039_0313638
1482 Ga0501039_0329149
1483 Ga0501039_0482040
1484 Ga0501040_0265394
1485 Ga0501040_0986546
1486 Ga0501041_0020140
1487 Ga0501041_0098426
1488 Ga0501041_0580986
1489 Ga0501042_0054635
1490 Ga0501043_0325567
1491 Ga0501043_0391011
1492 Ga0501046_0103884
1493 Ga0501047_0067132
1494 Ga0501047_0076545
1495 Ga0501047_0214676
1496 Ga0501047_0233446
1497 Ga0501047_0417708
1498 Ga0501048_0098220
1499 Ga0501048_0486568
1500 Ga0501067_0028072
1501 Ga0501068_0117429
1502 Ga0501069_0157450
1503 Ga0501069_0293169
1504 Ga0501069_0809129
1505 Ga0501070_0006459
1506 Ga0501070_0027881
1507 Ga0501070_0579053
1508 Ga0501070_0604987
1509 Ga0501070_0769240
1510 Ga0501070_0814695
1511 Ga0501071_0046623
1512 Ga0501071_0136141
1513 Ga0501071_0384522
1514 Ga0501071_0517914
1515 Ga0501072_0034067
1516 Ga0501072_0055945
1517 Ga0501073_0452387
1518 Ga0501073_0797885
1519 Ga0501074_0033072
1520 Ga0501074_0041740
1521 Ga0501075_0027980
1522 Ga0501075_0395415
1523 Ga0501075_0443413
1524 Ga0501075_1194700
1525 Ga0501076_0016602
1526 Ga0501076_0072987
1527 Ga0501076_0198088
1528 Ga0501076_0319849
1529 Ga0501076_0609062
1530 Ga0501077_0017382
1531 Ga0501077_0159199
1532 Ga0501077_0671491
1533 Ga0501079_0021115
1534 Ga0501079_0607592
1535 Ga0501080_0036722
1536 Ga0501080_0064615
1537 Ga0501080_0194344
1538 Ga0501080_0926708
1539 Ga0501080_1417861
1540 Ga0501081_0109177
1541 Ga0501081_0124627
1542 Ga0501081_0439436
1543 Ga0501081_0961855
1544 Ga0501083_0407647
1545 Ga0501035_0000505
1546 Ga0501035_0108044
1547 Ga0501035_0251865
1548 Ga0501035_0419894
1549 Ga0501044_0024995
1550 Ga0501044_0095932
1551 Ga0501044_0242296
1552 Ga0501044_0960060
1553 Ga0501044_1097656
1554 Ga0501045_0031454
1555 nmdc:mga03683_127555_c1
1556 nmdc:mga03683_30724_c1
1557 nmdc:mga03n38_574364_c1
1558 nmdc:mga00v17_827549_c1
1559 nmdc:mga0yw44_10863_c1
1560 nmdc:mga0k408_10258_c1
1561 nmdc:mga0k408_242404_c1
1562 nmdc:mga0k408_753730_c1
1563 nmdc:mga06z11_175385_c1
1564 nmdc:mga06z11_344327_c1
1565 nmdc:mga06z11_530506_c1
1566 nmdc:mga06z11_734273_c1
1567 nmdc:mga06z11_850057_c1
1568 nmdc:mga07m45_157667_c1
1569 nmdc:mga07m45_174607_c1
1570 nmdc:mga07m45_436351_c1
1571 nmdc:mga07m45_447210_c1
1572 nmdc:mga05p37_272569_c1
1573 nmdc:mga08y16_42358_c1
1574 nmdc:mga08y16_45372_c1
1575 nmdc:mga0n895_170680_c1
1576 nmdc:mga0n895_334101_c1
1577 nmdc:mga0n895_533865_c1
1578 nmdc:mga0n895_714982_c1
1579 nmdc:mga0n895_90039_c1
1580 Ga0495601_0000030
1581 Ga0495601_0000674
1582 Ga0495601_0006331
1583 Ga0495601_0116093
1584 Ga0495612_0003281
1585 Ga0495612_0028040
1586 Ga0495612_0217396
1587 Ga0495655_0231921
1588 Ga0495595_0063262
1589 Ga0495595_0076999
1590 Ga0495619_0000128
1591 Ga0495619_0092275
1592 Ga0495619_0140694
1593 Ga0500651_0055577
1594 Ga0500641_0039215
1595 Ga0500650_0083212
1596 Ga0500562_101867
1597 Ga0500594_0009076
1598 Ga0500595_003481
1599 Ga0500595_046894
1600 Ga0500595_052365
1601 Ga0500597_342766
1602 Ga0500642_0002354
1603 Ga0500568_0102878
1604 Ga0500568_0331758
1605 Ga0500577_0034857
1606 Ga0500577_0244671
1607 Ga0500622_0195877
1608 Ga0500627_0032261
1609 Ga0500636_0047538
1610 Ga0501084_0035059
1611 Ga0501084_0095289
1612 Ga0501084_0119889
1613 Ga0501084_0725402
1614 Ga0590077_033941
1615 Ga0501082_0152955
1616 Ga0501082_0274706
1617 Ga0501082_0320763
1618 Ga0501082_0342090
1619 Ga0501082_0694078
1620 Ga0466962_0234700
1621 Ga0466962_0254293
1622 Ga0530510_0005595
1623 Ga0530510_0062852
1624 2524441135
1625 2844107502
1626 2851249542

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12973

Cupin_7

ChrR Cupin-like domain

38

145

0.91

PF07883

Cupin_2

Cupin domain

74

141

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3o14-assembly2.cif.gz_B crystal structure of an anti-ecfsigma factor, chrr (maqu_0586) from marinobacter aquaeolei vt8 at 1.70 a resolution 0.8835 16 114
3fjs-assembly2.cif.gz_D crystal structure of a putative biosynthetic protein with rmlc-like cupin fold (reut_b4087) from ralstonia eutropha jmp134 at 1.90 a resolution 0.8693 33 114
2o1q-assembly1.cif.gz_A crystal structure of a putative acetylacetone dioxygenase (mpe_a3659) from methylibium petroleiphilum pm1 at 1.50 a resolution 0.8496 8 123
2qdr-assembly1.cif.gz_A crystal structure of a putative dioxygenase (npun_f5605) from nostoc punctiforme pcc 73102 at 2.60 a resolution 0.8454 16 124
3ebr-assembly1.cif.gz_A crystal structure of an rmlc-like cupin protein (reut_a0381) from ralstonia eutropha jmp134 at 2.60 a resolution 0.8411 11 116
ID Description Score Start End Superfamily
3o14B00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8921 16 114 2.60.120.10
2o1qB01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.844 28 114 2.60.120.10
af_Q9GYI4_11_295_2.60.120.650 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.8408 46 114 2.60.120.650
af_A0A1D8PPZ7_421_512_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8296 29 114 2.60.120.10
af_Q9USR9_537_626_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8269 29 114 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A3B8R3Y4-F1-model_v4 Cupin 0.9948 35 133
AF-A0A5B8C990-F1-model_v4 Cupin domain-containing protein 0.9938 13 133
AF-A0A1C6W694-F1-model_v4 Cupin domain 0.9932 12 133
AF-A0A552WUX6-F1-model_v4 Cupin domain-containing protein 0.9927 14 133
AF-A0A3B8R3Y4-F1-model_v4 Cupin 0.9849 35 133

Map