F481696

General Info

Members Datasets Scaffolds Average Seq Length
807 409 807 129

Family's Representative Sequence

Representative Sequence 3300049575|Ga0501039_0008184|Ga0501039_0008184_5535_6062
Length 144
Sequence VDADAALGVVEVMIERIQRFFQTFLLAELVKGMALTGRHLFRRKITVQYPEEKTPMSPRFRGLHALRRYPNGEERCIACKLCEAVCPALAITIESEQRAVETRILEYHGEKRGDLIYTKPMLLAVGDLYEERIAKDRAEDAAYR

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
5 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
6 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
79 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
80 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
81 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
82 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
83 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
84 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
85 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
86 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
91 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
92 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
96 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
110 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
111 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
112 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
113 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
114 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
126 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
129 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
137 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
138 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
140 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
200 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
201 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
203 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
206 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
207 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
208 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
209 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
210 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
211 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
212 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
213 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
214 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
215 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
216 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
217 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
218 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
219 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
220 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
221 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
222 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
223 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
224 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
225 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
226 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
227 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
228 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
229 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
230 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
231 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
233 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
234 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
235 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
236 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
237 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
238 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
239 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
240 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
241 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
242 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
243 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
244 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
245 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
246 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
247 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
248 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
249 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
250 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
251 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
252 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
253 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
254 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
255 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
256 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
257 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
258 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
259 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
260 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
261 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
262 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
263 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
264 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
265 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
266 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
267 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
268 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
269 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
270 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
271 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
272 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
273 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
274 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
275 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
276 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
277 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
278 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
279 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
280 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
281 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
282 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
283 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
284 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
285 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
286 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
287 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
288 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
289 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
290 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
291 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
292 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
293 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
294 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
295 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
296 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
297 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
298 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
299 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
300 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
301 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
302 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
303 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
304 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
305 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
306 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
307 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
308 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
309 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
310 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
311 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
312 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
313 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
314 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
315 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
316 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
317 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
318 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
319 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
320 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
321 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
322 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
323 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
324 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
325 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
326 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
327 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
328 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
329 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
330 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
331 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
332 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
333 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
334 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
335 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
336 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
337 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
338 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
341 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
342 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
343 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
344 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
345 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
346 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
347 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
348 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
351 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
352 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
353 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
354 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
355 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
357 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
358 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
359 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
360 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
361 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
362 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
363 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
364 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
365 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
366 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
367 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
368 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
369 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
370 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
371 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
372 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
373 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
374 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
375 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
376 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
377 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
378 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
379 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
380 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
381 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
382 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
383 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
384 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
385 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
386 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
387 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
388 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
389 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
390 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
391 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
392 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
393 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
394 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
395 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
396 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
397 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
398 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
399 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
400 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
401 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
402 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
403 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
404 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
405 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
406 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
407 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
408 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
409 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.4
Metatranscriptomes 2.6
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.67
Nodule 0.25
Rhizoplane 2.6
Rhizosphere 86.99
Stem 0
Stem Tuber 0
Unclassified 1.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10003255 3300001979 Bacteria 7174
2 JGI25406J46586_10035479 3300003203 Bacteria 1820
3 Ga0006770J48903_1097331 3300003305 Bacteria 651
4 Ga0055537_1000104 3300003773 Bacteria 63394
5 Ga0055534_1000042 3300003784 Bacteria 99433
6 Ga0055528_1002054 3300003790 Bacteria 11254
7 Ga0065715_10690727 3300005293 Bacteria 658
8 Ga0065707_10238478 3300005295 Bacteria 1164
9 Ga0070658_10007907 3300005327 Bacteria 8564
10 Ga0070658_10059634 3300005327 Bacteria 3107
11 Ga0070658_10073249 3300005327 Bacteria 2808
12 Ga0070658_10194872 3300005327 Bacteria 1708
13 Ga0070676_10112979 3300005328 Bacteria 1694
14 Ga0070676_10760559 3300005328 Bacteria 712
15 Ga0070683_100095922 3300005329 Bacteria 2789
16 Ga0070683_100220075 3300005329 Bacteria 1804
17 Ga0070683_101093849 3300005329 Bacteria 766
18 Ga0070690_100001009 3300005330 Bacteria 14387
19 Ga0070690_100059579 3300005330 Bacteria 2455
20 Ga0070690_100687208 3300005330 Bacteria 785
21 Ga0070670_100004966 3300005331 Bacteria 11188
22 Ga0070670_100016506 3300005331 Bacteria 6338
23 Ga0070670_100079153 3300005331 Bacteria 2824
24 Ga0070670_100103183 3300005331 Bacteria 2456
25 Ga0070670_100370603 3300005331 Bacteria 1260
26 Ga0070677_10012244 3300005333 Bacteria 2975
27 Ga0070677_10016448 3300005333 Bacteria 2633
28 Ga0068869_100001595 3300005334 Bacteria 13483
29 Ga0068869_100001619 3300005334 Bacteria 13391
30 Ga0068869_100173962 3300005334 Bacteria 1684
31 Ga0068869_100216424 3300005334 Bacteria 1516
32 Ga0068869_100254225 3300005334 Bacteria 1404
33 Ga0070666_10212595 3300005335 Bacteria 1362
34 Ga0070666_10359709 3300005335 Bacteria 1042
35 Ga0070666_10372979 3300005335 Bacteria 1023
36 Ga0070680_100167657 3300005336 Bacteria 1847
37 Ga0070680_100689802 3300005336 Bacteria 879
38 Ga0070682_100099576 3300005337 Bacteria 1917
39 Ga0070682_100775143 3300005337 Bacteria 777
40 Ga0068868_100002256 3300005338 Bacteria 13331
41 Ga0070660_100002795 3300005339 Bacteria 11991
42 Ga0070660_100018480 3300005339 Bacteria 5094
43 Ga0070660_100568420 3300005339 Bacteria 946
44 Ga0070689_100003115 3300005340 Bacteria 10952
45 Ga0070689_100073841 3300005340 Bacteria 2668
46 Ga0070689_100286677 3300005340 Bacteria 1367
47 Ga0070691_10010007 3300005341 Bacteria 4321
48 Ga0070687_100031653 3300005343 Bacteria 2596
49 Ga0070687_100332402 3300005343 Bacteria 975
50 Ga0070661_100027832 3300005344 Bacteria 4074
51 Ga0070661_100103399 3300005344 Bacteria 2121
52 Ga0070661_100104792 3300005344 Bacteria 2107
53 Ga0070661_100219662 3300005344 Bacteria 1457
54 Ga0070661_100419416 3300005344 Bacteria 1061
55 Ga0070661_100981644 3300005344 Bacteria 700
56 Ga0070692_10069478 3300005345 Bacteria 1874
57 Ga0070692_10200784 3300005345 Bacteria 1168
58 Ga0070692_10652079 3300005345 Bacteria 703
59 Ga0070668_100105555 3300005347 Bacteria 2237
60 Ga0070668_100181514 3300005347 Bacteria 1719
61 Ga0070668_100369294 3300005347 Bacteria 1218
62 Ga0070669_100048590 3300005353 Bacteria 3097
63 Ga0070669_100058142 3300005353 Bacteria 2837
64 Ga0070669_100078810 3300005353 Bacteria 2449
65 Ga0070669_100383287 3300005353 Bacteria 1147
66 Ga0070669_100405071 3300005353 Bacteria 1117
67 Ga0070675_100005842 3300005354 Bacteria 9425
68 Ga0070675_100006391 3300005354 Bacteria 9044
69 Ga0070675_100047574 3300005354 Bacteria 3514
70 Ga0070675_100210145 3300005354 Bacteria 1691
71 Ga0070675_100349749 3300005354 Bacteria 1310
72 Ga0070671_100039280 3300005355 Bacteria 3929
73 Ga0070671_100963562 3300005355 Bacteria 746
74 Ga0070674_100088400 3300005356 Bacteria 2230
75 Ga0070674_100118798 3300005356 Bacteria 1954
76 Ga0070674_100348960 3300005356 Bacteria 1195
77 Ga0070673_100071236 3300005364 Bacteria 2792
78 Ga0070673_100264780 3300005364 Bacteria 1503
79 Ga0070673_100431638 3300005364 Bacteria 1183
80 Ga0070688_100949521 3300005365 Bacteria 681
81 Ga0070659_100002322 3300005366 Bacteria 13536
82 Ga0070659_100096437 3300005366 Bacteria 2376
83 Ga0070659_100131331 3300005366 Bacteria 2034
84 Ga0070659_100657941 3300005366 Bacteria 903
85 Ga0070714_100055650 3300005435 Bacteria 3382
86 Ga0070701_10012435 3300005438 Bacteria 3840
87 Ga0070705_100079740 3300005440 Bacteria 2006
88 Ga0070705_100442999 3300005440 Bacteria 972
89 Ga0070705_101243836 3300005440 Bacteria 615
90 Ga0070700_100001013 3300005441 Bacteria 13883
91 Ga0070700_100001626 3300005441 Bacteria 11233
92 Ga0070700_100037435 3300005441 Bacteria 2950
93 Ga0070700_100361951 3300005441 Bacteria 1079
94 Ga0070700_100893846 3300005441 Bacteria 723
95 Ga0070694_100330346 3300005444 Bacteria 1176
96 Ga0070694_100751265 3300005444 Bacteria 797
97 Ga0070708_100225173 3300005445 Bacteria 1759
98 Ga0070708_101821334 3300005445 Bacteria 565
99 Ga0070663_100000897 3300005455 Bacteria 16169
100 Ga0070663_100013398 3300005455 Bacteria 5228
101 Ga0070663_100458935 3300005455 Bacteria 1051
102 Ga0070678_100136389 3300005456 Bacteria 1957
103 Ga0070678_100188939 3300005456 Bacteria 1692
104 Ga0070678_100620918 3300005456 Bacteria 967
105 Ga0070662_100048307 3300005457 Bacteria 3065
106 Ga0070662_100159915 3300005457 Bacteria 1761
107 Ga0070662_100187204 3300005457 Bacteria 1635
108 Ga0070662_100386031 3300005457 Bacteria 1153
109 Ga0070681_10207473 3300005458 Bacteria 1876
110 Ga0070681_10224667 3300005458 Bacteria 1792
111 Ga0068867_100002101 3300005459 Bacteria 13955
112 Ga0068867_100009745 3300005459 Bacteria 6770
113 Ga0068867_100309570 3300005459 Bacteria 1305
114 Ga0068867_100312800 3300005459 Bacteria 1298
115 Ga0068867_100351852 3300005459 Bacteria 1229
116 Ga0068867_100808652 3300005459 Bacteria 837
117 Ga0070706_101189246 3300005467 Bacteria 701
118 Ga0070707_100254010 3300005468 Bacteria 1711
119 Ga0070707_100523756 3300005468 Bacteria 1147
120 Ga0070707_100831142 3300005468 Bacteria 888
121 Ga0070698_100221962 3300005471 Bacteria 1823
122 Ga0070679_100042176 3300005530 Bacteria 4543
123 Ga0070679_100067912 3300005530 Bacteria 3556
124 Ga0070684_100077572 3300005535 Bacteria 2934
125 Ga0070684_100186160 3300005535 Bacteria 1888
126 Ga0070684_100563797 3300005535 Bacteria 1057
127 Ga0070697_101195305 3300005536 Bacteria 677
128 Ga0068853_100015533 3300005539 Bacteria 6254
129 Ga0070672_100000154 3300005543 Bacteria 37910
130 Ga0070672_100107999 3300005543 Bacteria 2265
131 Ga0070672_100108456 3300005543 Bacteria 2260
132 Ga0070672_100130225 3300005543 Bacteria 2067
133 Ga0070672_100598836 3300005543 Bacteria 960
134 Ga0070672_100619645 3300005543 Bacteria 943
135 Ga0070672_100965026 3300005543 Bacteria 754
136 Ga0070686_100740074 3300005544 Bacteria 788
137 Ga0070695_100104227 3300005545 Bacteria 1915
138 Ga0070695_100439022 3300005545 Bacteria 998
139 Ga0070696_100107118 3300005546 Bacteria 2010
140 Ga0070696_100542532 3300005546 Bacteria 931
141 Ga0070693_100035072 3300005547 Bacteria 2780
142 Ga0070693_100044381 3300005547 Bacteria 2515
143 Ga0070693_100271893 3300005547 Bacteria 1131
144 Ga0070665_100127737 3300005548 Bacteria 2545
145 Ga0070665_100470346 3300005548 Bacteria 1267
146 Ga0070665_101182326 3300005548 Bacteria 776
147 Ga0070665_101191347 3300005548 Bacteria 772
148 Ga0070704_100037606 3300005549 Bacteria 3308
149 Ga0068855_100072560 3300005563 Bacteria 4001
150 Ga0068855_100092098 3300005563 Bacteria 3496
151 Ga0068855_100145416 3300005563 Bacteria 2699
152 Ga0070664_100073204 3300005564 Bacteria 2939
153 Ga0070664_100627791 3300005564 Bacteria 998
154 Ga0070664_100770402 3300005564 Bacteria 899
155 Ga0068857_100000558 3300005577 Bacteria 27209
156 Ga0068857_100332941 3300005577 Bacteria 1403
157 Ga0068857_100431036 3300005577 Bacteria 1230
158 Ga0068854_100039092 3300005578 Bacteria 3340
159 Ga0068854_100047918 3300005578 Bacteria 3047
160 Ga0068856_100055728 3300005614 Bacteria 3901
161 Ga0070702_100000173 3300005615 Bacteria 20607
162 Ga0070702_100862716 3300005615 Bacteria 705
163 Ga0068852_100013425 3300005616 Bacteria 6269
164 Ga0068852_100069951 3300005616 Bacteria 3078
165 Ga0068852_100128257 3300005616 Bacteria 2332
166 Ga0068852_100375105 3300005616 Bacteria 1394
167 Ga0068859_100026412 3300005617 Bacteria 5822
168 Ga0068859_100075090 3300005617 Bacteria 3420
169 Ga0068859_100184396 3300005617 Bacteria 2170
170 Ga0068859_101043147 3300005617 Bacteria 898
171 Ga0068864_100017918 3300005618 Bacteria 5908
172 Ga0068864_100130611 3300005618 Bacteria 2256
173 Ga0068864_100176894 3300005618 Bacteria 1949
174 Ga0068864_100185170 3300005618 Bacteria 1905
175 Ga0068864_100345607 3300005618 Bacteria 1402
176 Ga0068866_10003085 3300005718 Bacteria 6867
177 Ga0068866_10493581 3300005718 Bacteria 809
178 Ga0068861_100004103 3300005719 Bacteria 9769
179 Ga0068861_100011414 3300005719 Bacteria 6175
180 Ga0068861_100108405 3300005719 Bacteria 2222
181 Ga0068851_10018066 3300005834 Bacteria 3395
182 Ga0068851_10205673 3300005834 Bacteria 1100
183 Ga0068870_10020158 3300005840 Bacteria 3243
184 Ga0068870_10085898 3300005840 Bacteria 1749
185 Ga0068863_100115524 3300005841 Bacteria 2557
186 Ga0068863_100259218 3300005841 Bacteria 1681
187 Ga0068863_100324700 3300005841 Bacteria 1495
188 Ga0068863_100860902 3300005841 Bacteria 905
189 Ga0068858_100002333 3300005842 Bacteria 19189
190 Ga0068858_100048177 3300005842 Bacteria 3949
191 Ga0068858_100131206 3300005842 Bacteria 2350
192 Ga0068858_100146546 3300005842 Bacteria 2217
193 Ga0068858_101713820 3300005842 Bacteria 621
194 Ga0068860_100029126 3300005843 Bacteria 5312
195 Ga0068860_100108335 3300005843 Bacteria 2655
196 Ga0068860_100209668 3300005843 Bacteria 1890
197 Ga0068860_100463821 3300005843 Bacteria 1261
198 Ga0068860_100542513 3300005843 Bacteria 1164
199 Ga0068862_100020007 3300005844 Bacteria 5587
200 Ga0068862_100045487 3300005844 Bacteria 3746
201 Ga0068862_100264655 3300005844 Bacteria 1571
202 Ga0081539_10000805 3300005985 Bacteria 61020
203 Ga0070717_11359717 3300006028 Bacteria 645
204 Ga0075365_10129415 3300006038 Bacteria 1746
205 Ga0075365_10163399 3300006038 Bacteria 1552
206 Ga0075368_10019417 3300006042 Bacteria 2565
207 Ga0075363_100059522 3300006048 Bacteria 2054
208 Ga0075363_100110547 3300006048 Bacteria 1527
209 Ga0075364_10274643 3300006051 Bacteria 1146
210 Ga0075432_10168524 3300006058 Bacteria 850
211 Ga0075362_10040225 3300006177 Bacteria 2058
212 Ga0075362_10040647 3300006177 Bacteria 2048
213 Ga0075362_10071288 3300006177 Bacteria 1587
214 Ga0075367_10069943 3300006178 Bacteria 2108
215 Ga0075367_10077842 3300006178 Bacteria 2002
216 Ga0075367_10402801 3300006178 Bacteria 865
217 Ga0075369_10085083 3300006186 Bacteria 1406
218 Ga0075366_10010531 3300006195 Bacteria 5193
219 Ga0075366_10219830 3300006195 Bacteria 1157
220 Ga0075366_10229333 3300006195 Bacteria 1131
221 Ga0075366_10293200 3300006195 Bacteria 995
222 Ga0075366_10335862 3300006195 Bacteria 926
223 Ga0097621_100002521 3300006237 Bacteria 12549
224 Ga0097621_100005330 3300006237 Bacteria 9054
225 Ga0097621_100334140 3300006237 Bacteria 1344
226 Ga0097621_101101722 3300006237 Bacteria 745
227 Ga0075370_10008804 3300006353 Bacteria 5211
228 Ga0075370_10009133 3300006353 Bacteria 5132
229 Ga0075370_10016255 3300006353 Bacteria 4002
230 Ga0075370_10066381 3300006353 Bacteria 2058
231 Ga0075370_10143104 3300006353 Bacteria 1398
232 Ga0075370_10309417 3300006353 Bacteria 940
233 Ga0075370_10311862 3300006353 Bacteria 936
234 Ga0075370_10461804 3300006353 Bacteria 764
235 Ga0068871_100000683 3300006358 Bacteria 23106
236 Ga0068871_100022193 3300006358 Bacteria 4893
237 Ga0068871_100026023 3300006358 Bacteria 4560
238 Ga0068871_100165018 3300006358 Bacteria 1896
239 Ga0068871_100290551 3300006358 Bacteria 1432
240 Ga0068871_100486646 3300006358 Bacteria 1110
241 Ga0068871_100491909 3300006358 Bacteria 1105
242 Ga0068871_100636532 3300006358 Bacteria 972
243 Ga0075428_100001252 3300006844 Bacteria 27176
244 Ga0075434_100238658 3300006871 Bacteria 1838
245 Ga0075429_100654157 3300006880 Bacteria 921
246 Ga0068865_100008874 3300006881 Bacteria 6219
247 Ga0068865_100142185 3300006881 Bacteria 1810
248 Ga0097620_100026411 3300006931 Bacteria 5822
249 Ga0097620_100075089 3300006931 Bacteria 3420
250 Ga0097620_100184403 3300006931 Bacteria 2170
251 Ga0097620_101043117 3300006931 Bacteria 898
252 Ga0099826_10000627 3300006948 Bacteria 18105
253 Ga0099794_10014278 3300007265 Bacteria 3476
254 Ga0105240_10009928 3300009093 Bacteria 13425
255 Ga0105240_10013785 3300009093 Bacteria 11074
256 Ga0111539_10001053 3300009094 Bacteria 36307
257 Ga0105245_10000207 3300009098 Bacteria 55562
258 Ga0105245_10024240 3300009098 Bacteria 5327
259 Ga0105245_10133266 3300009098 Bacteria 2332
260 Ga0105245_10621162 3300009098 Bacteria 1109
261 Ga0105245_10782718 3300009098 Bacteria 991
262 Ga0114129_11546520 3300009147 Bacteria 814
263 Ga0105243_10002103 3300009148 Bacteria 16844
264 Ga0105243_10077418 3300009148 Bacteria 2705
265 Ga0105241_10074838 3300009174 Bacteria 2638
266 Ga0105241_10192193 3300009174 Bacteria 1700
267 Ga0105241_10284745 3300009174 Bacteria 1413
268 Ga0105242_10007171 3300009176 Bacteria 8600
269 Ga0105242_10160986 3300009176 Bacteria 1965
270 Ga0105242_10260278 3300009176 Bacteria 1567
271 Ga0105242_10528526 3300009176 Bacteria 1127
272 Ga0105248_10055439 3300009177 Bacteria 4446
273 Ga0105248_10142318 3300009177 Bacteria 2705
274 Ga0105237_10048608 3300009545 Bacteria 4264
275 Ga0105237_10108721 3300009545 Bacteria 2764
276 Ga0105238_10002510 3300009551 Bacteria 18365
277 Ga0105249_10444698 3300009553 Bacteria 1334
278 Ga0105239_10208619 3300010375 Bacteria 2189
279 Ga0105239_10662758 3300010375 Bacteria 1192
280 Ga0157323_1006756 3300012495 Bacteria 810
281 Ga0157342_1019827 3300012507 Bacteria 773
282 Ga0157315_1012896 3300012508 Bacteria 778
283 Ga0157373_10097612 3300013100 Bacteria 2068
284 Ga0157371_10017872 3300013102 Bacteria 5257
285 Ga0157371_10168550 3300013102 Bacteria 1564
286 Ga0157371_10219499 3300013102 Bacteria 1365
287 Ga0157371_10723699 3300013102 Bacteria 746
288 Ga0157370_10042158 3300013104 Bacteria 4400
289 Ga0157369_10002671 3300013105 Bacteria 21264
290 Ga0157369_10038103 3300013105 Bacteria 5259
291 Ga0157369_10361770 3300013105 Bacteria 1506
292 Ga0157374_10303506 3300013296 Bacteria 1580
293 Ga0157374_10588541 3300013296 Bacteria 1122
294 Ga0157378_10001175 3300013297 Bacteria 23842
295 Ga0157378_10083446 3300013297 Bacteria 2891
296 Ga0157378_10088875 3300013297 Bacteria 2804
297 Ga0157378_10645096 3300013297 Bacteria 1074
298 Ga0163162_10023809 3300013306 Bacteria 6043
299 Ga0157372_10002307 3300013307 Bacteria 20710
300 Ga0157372_10404453 3300013307 Bacteria 1591
301 Ga0157375_10072805 3300013308 Bacteria 3454
302 Ga0157375_11267123 3300013308 Bacteria 866
303 Ga0163163_10048361 3300014325 Bacteria 4182
304 Ga0163163_10243631 3300014325 Bacteria 1848
305 Ga0157380_10022168 3300014326 Bacteria 4776
306 Ga0157380_10266002 3300014326 Bacteria 1560
307 Ga0157380_11041012 3300014326 Bacteria 854
308 Ga0157380_11225112 3300014326 Bacteria 795
309 Ga0157377_10000028 3300014745 Bacteria 134810
310 Ga0157377_10002002 3300014745 Bacteria 8927
311 Ga0157379_10212765 3300014968 Bacteria 1750
312 Ga0157379_10480078 3300014968 Bacteria 1150
313 Ga0157379_10678428 3300014968 Bacteria 966
314 Ga0157379_10725597 3300014968 Bacteria 934
315 Ga0157376_10015844 3300014969 Bacteria 5706
316 Ga0157376_10019335 3300014969 Bacteria 5247
317 Ga0157376_10736866 3300014969 Bacteria 994
318 Ga0157376_11276465 3300014969 Bacteria 764
319 Ga0182005_1061473 3300015265 Bacteria 1026
320 Ga0163161_10007457 3300017792 Bacteria 7560
321 Ga0163161_10069457 3300017792 Bacteria 2575
322 Ga0163161_10141302 3300017792 Bacteria 1823
323 Ga0163161_10293938 3300017792 Bacteria 1278
324 Ga0163161_10460615 3300017792 Bacteria 1029
325 Ga0213871_10039446 3300021441 Bacteria 1264
326 Ga0209784_100002 3300025224 Bacteria 1753105
327 Ga0209566_100003 3300025225 Bacteria 1753105
328 Ga0209674_100004 3300025226 Bacteria 1753105
329 Ga0209563_100006 3300025230 Bacteria 1753105
330 Ga0209677_100003 3300025253 Bacteria 1753105
331 Ga0209565_1000083 3300025263 Bacteria 154007
332 Ga0209673_1000323 3300025273 Bacteria 87588
333 Ga0209673_1025863 3300025273 Bacteria 1941
334 Ga0209130_1011590 3300025284 Bacteria 2353
335 Ga0207673_1025731 3300025290 Bacteria 806
336 Ga0209675_1000081 3300025291 Bacteria 154007
337 Ga0209025_1014206 3300025294 Bacteria 4926
338 Ga0209256_1035977 3300025299 Bacteria 1303
339 Ga0209051_1000792 3300025303 Bacteria 33275
340 Ga0209257_1000396 3300025304 Bacteria 86000
341 Ga0207656_10009892 3300025321 Bacteria 3552
342 Ga0207682_10006201 3300025893 Bacteria 4831
343 Ga0207682_10240190 3300025893 Bacteria 842
344 Ga0207642_10003267 3300025899 Bacteria 5096
345 Ga0207688_10188979 3300025901 Bacteria 1231
346 Ga0207680_10270979 3300025903 Bacteria 1177
347 Ga0207645_10513624 3300025907 Bacteria 812
348 Ga0207645_10836190 3300025907 Bacteria 626
349 Ga0207643_10014328 3300025908 Bacteria 4305
350 Ga0207643_10073364 3300025908 Bacteria 1973
351 Ga0207705_10032664 3300025909 Bacteria 3720
352 Ga0207705_10707257 3300025909 Bacteria 783
353 Ga0207684_10036532 3300025910 Bacteria 4169
354 Ga0207684_10300868 3300025910 Bacteria 1383
355 Ga0207654_10291484 3300025911 Bacteria 1107
356 Ga0207654_10321392 3300025911 Bacteria 1058
357 Ga0207695_10082880 3300025913 Bacteria 3241
358 Ga0207695_10095717 3300025913 Bacteria 2972
359 Ga0207671_10018674 3300025914 Bacteria 5313
360 Ga0207671_10300134 3300025914 Bacteria 1269
361 Ga0207660_10008796 3300025917 Bacteria 6527
362 Ga0207662_10082471 3300025918 Bacteria 1964
363 Ga0207657_10002207 3300025919 Bacteria 21114
364 Ga0207657_10040657 3300025919 Bacteria 4118
365 Ga0207657_10269597 3300025919 Bacteria 1353
366 Ga0207657_10303707 3300025919 Bacteria 1264
367 Ga0207657_10501064 3300025919 Bacteria 951
368 Ga0207649_10003831 3300025920 Bacteria 8200
369 Ga0207649_10003892 3300025920 Bacteria 8146
370 Ga0207649_10050778 3300025920 Bacteria 2566
371 Ga0207649_10176766 3300025920 Bacteria 1491
372 Ga0207649_10422863 3300025920 Bacteria 1001
373 Ga0207649_10538011 3300025920 Bacteria 892
374 Ga0207652_10103276 3300025921 Bacteria 2520
375 Ga0207652_10109428 3300025921 Bacteria 2450
376 Ga0207681_10039804 3300025923 Bacteria 3123
377 Ga0207681_10047472 3300025923 Bacteria 2893
378 Ga0207681_10279402 3300025923 Bacteria 1314
379 Ga0207681_10502200 3300025923 Bacteria 993
380 Ga0207694_10003525 3300025924 Bacteria 12423
381 Ga0207694_10088490 3300025924 Bacteria 2441
382 Ga0207694_10247799 3300025924 Bacteria 1457
383 Ga0207650_10012426 3300025925 Bacteria 5880
384 Ga0207650_10082048 3300025925 Bacteria 2447
385 Ga0207650_10082222 3300025925 Bacteria 2444
386 Ga0207650_10162131 3300025925 Bacteria 1772
387 Ga0207650_10377205 3300025925 Bacteria 1171
388 Ga0207650_10585714 3300025925 Bacteria 937
389 Ga0207650_10800399 3300025925 Bacteria 799
390 Ga0207659_10010036 3300025926 Bacteria 5931
391 Ga0207659_10101833 3300025926 Bacteria 2167
392 Ga0207659_10554519 3300025926 Bacteria 977
393 Ga0207659_11010551 3300025926 Bacteria 716
394 Ga0207687_10014724 3300025927 Bacteria 5121
395 Ga0207687_10061275 3300025927 Bacteria 2657
396 Ga0207687_10252630 3300025927 Bacteria 1402
397 Ga0207687_10367460 3300025927 Bacteria 1176
398 Ga0207687_10585471 3300025927 Bacteria 939
399 Ga0207664_10062116 3300025929 Bacteria 2983
400 Ga0207644_10026535 3300025931 Bacteria 3992
401 Ga0207644_10124463 3300025931 Bacteria 1966
402 Ga0207644_10166105 3300025931 Bacteria 1719
403 Ga0207644_10403738 3300025931 Bacteria 1117
404 Ga0207644_10553281 3300025931 Bacteria 952
405 Ga0207690_10001989 3300025932 Bacteria 12520
406 Ga0207690_10034932 3300025932 Bacteria 3242
407 Ga0207690_10186005 3300025932 Bacteria 1567
408 Ga0207690_10570443 3300025932 Bacteria 921
409 Ga0207706_10162344 3300025933 Bacteria 1964
410 Ga0207706_10205221 3300025933 Bacteria 1728
411 Ga0207686_10000586 3300025934 Bacteria 22804
412 Ga0207686_10408988 3300025934 Bacteria 1035
413 Ga0207709_10024766 3300025935 Bacteria 3430
414 Ga0207709_10055857 3300025935 Bacteria 2441
415 Ga0207709_10162913 3300025935 Bacteria 1557
416 Ga0207670_10009278 3300025936 Bacteria 5604
417 Ga0207670_10242108 3300025936 Bacteria 1390
418 Ga0207669_10031303 3300025937 Bacteria 2971
419 Ga0207669_10055154 3300025937 Bacteria 2405
420 Ga0207669_10103514 3300025937 Bacteria 1888
421 Ga0207669_10120766 3300025937 Bacteria 1778
422 Ga0207669_10140418 3300025937 Bacteria 1676
423 Ga0207704_10000475 3300025938 Bacteria 17855
424 Ga0207704_10044909 3300025938 Bacteria 2621
425 Ga0207665_10331191 3300025939 Bacteria 1145
426 Ga0207691_10001614 3300025940 Bacteria 22406
427 Ga0207691_10004247 3300025940 Bacteria 13912
428 Ga0207691_10368023 3300025940 Bacteria 1228
429 Ga0207711_10038900 3300025941 Bacteria 4045
430 Ga0207711_10145583 3300025941 Bacteria 2134
431 Ga0207711_10344638 3300025941 Bacteria 1379
432 Ga0207711_10628123 3300025941 Bacteria 1002
433 Ga0207711_10671409 3300025941 Bacteria 967
434 Ga0207711_10861009 3300025941 Bacteria 843
435 Ga0207711_10876935 3300025941 Bacteria 835
436 Ga0207689_10000384 3300025942 Bacteria 41557
437 Ga0207689_10000534 3300025942 Bacteria 36072
438 Ga0207689_10138033 3300025942 Bacteria 2008
439 Ga0207689_10251051 3300025942 Bacteria 1463
440 Ga0207689_10915076 3300025942 Bacteria 740
441 Ga0207661_10293595 3300025944 Bacteria 1455
442 Ga0207661_10364656 3300025944 Bacteria 1305
443 Ga0207661_11110336 3300025944 Bacteria 728
444 Ga0207679_10003662 3300025945 Bacteria 9525
445 Ga0207679_10005080 3300025945 Bacteria 8228
446 Ga0207679_10186070 3300025945 Bacteria 1722
447 Ga0207679_10789566 3300025945 Bacteria 865
448 Ga0207679_10916954 3300025945 Bacteria 802
449 Ga0207667_10000438 3300025949 Bacteria 55784
450 Ga0207667_10008305 3300025949 Bacteria 12353
451 Ga0207667_10494430 3300025949 Bacteria 1241
452 Ga0207651_10095301 3300025960 Bacteria 2191
453 Ga0207651_10208160 3300025960 Bacteria 1572
454 Ga0207651_10248445 3300025960 Bacteria 1454
455 Ga0207651_10261436 3300025960 Bacteria 1421
456 Ga0207651_10450436 3300025960 Bacteria 1104
457 Ga0207712_10657063 3300025961 Bacteria 912
458 Ga0207668_10003970 3300025972 Bacteria 8715
459 Ga0207668_10229390 3300025972 Bacteria 1496
460 Ga0207640_10291613 3300025981 Bacteria 1286
461 Ga0207658_10034379 3300025986 Bacteria 3623
462 Ga0207658_10506083 3300025986 Bacteria 1076
463 Ga0207677_10001173 3300026023 Bacteria 14241
464 Ga0207703_10001476 3300026035 Bacteria 21438
465 Ga0207703_10084266 3300026035 Bacteria 2658
466 Ga0207703_10243963 3300026035 Bacteria 1616
467 Ga0207703_10654689 3300026035 Bacteria 997
468 Ga0207703_11043595 3300026035 Bacteria 785
469 Ga0207639_10109942 3300026041 Bacteria 2244
470 Ga0207639_10278117 3300026041 Bacteria 1471
471 Ga0207678_10002683 3300026067 Bacteria 16152
472 Ga0207678_10241672 3300026067 Bacteria 1546
473 Ga0207708_10000156 3300026075 Bacteria 54425
474 Ga0207708_10008948 3300026075 Bacteria 7409
475 Ga0207708_10671461 3300026075 Bacteria 884
476 Ga0207702_10030669 3300026078 Bacteria 4480
477 Ga0207702_10076859 3300026078 Bacteria 2886
478 Ga0207641_10149510 3300026088 Bacteria 2114
479 Ga0207641_10391157 3300026088 Bacteria 1333
480 Ga0207641_10542325 3300026088 Bacteria 1133
481 Ga0207641_10882467 3300026088 Bacteria 887
482 Ga0207648_10000128 3300026089 Bacteria 75279
483 Ga0207648_10007560 3300026089 Bacteria 10665
484 Ga0207648_10165237 3300026089 Bacteria 1955
485 Ga0207648_10268552 3300026089 Bacteria 1523
486 Ga0207676_10024174 3300026095 Bacteria 4494
487 Ga0207676_10051819 3300026095 Bacteria 3205
488 Ga0207676_10149266 3300026095 Bacteria 2011
489 Ga0207676_10322087 3300026095 Bacteria 1419
490 Ga0207676_10341599 3300026095 Bacteria 1381
491 Ga0207676_11204819 3300026095 Bacteria 750
492 Ga0207674_10000049 3300026116 Bacteria 118784
493 Ga0207674_10095721 3300026116 Bacteria 2955
494 Ga0207674_10283708 3300026116 Bacteria 1604
495 Ga0207675_100000408 3300026118 Bacteria 41228
496 Ga0207675_100028763 3300026118 Bacteria 5177
497 Ga0207675_100037952 3300026118 Bacteria 4495
498 Ga0207675_100214198 3300026118 Bacteria 1854
499 Ga0207683_10047530 3300026121 Bacteria 3758
500 Ga0207683_10159917 3300026121 Bacteria 2036
501 Ga0207683_10240655 3300026121 Bacteria 1651
502 Ga0207698_10008396 3300026142 Bacteria 6530
503 Ga0207698_10057764 3300026142 Bacteria 3004
504 Ga0207698_10060781 3300026142 Bacteria 2940
505 Ga0209282_1000790 3300027666 Bacteria 16078
506 Ga0209813_10025009 3300027866 Bacteria 1713
507 Ga0209974_10000975 3300027876 Bacteria 10053
508 Ga0207428_10002514 3300027907 Bacteria 18299
509 Ga0268265_10033020 3300028380 Bacteria 3758
510 Ga0268264_10065291 3300028381 Bacteria 3066
511 Ga0268264_10115379 3300028381 Bacteria 2359
512 Ga0268264_10616801 3300028381 Bacteria 1070
513 Ga0268264_10694281 3300028381 Bacteria 1010
514 Ga0265318_10069406 3300028577 Bacteria 1307
515 Ga0307517_10520958 3300028786 Bacteria 600
516 Ga0307515_10000020 3300028794 Bacteria 411735
517 Ga0307515_10000053 3300028794 Bacteria 266512
518 Ga0307515_10042672 3300028794 Bacteria 7085
519 Ga0307515_10069900 3300028794 Bacteria 4789
520 Ga0265330_10192460 3300031235 Bacteria 863
521 Ga0265332_10002950 3300031238 Bacteria 8366
522 Ga0265332_10003769 3300031238 Bacteria 7247
523 Ga0265328_10007837 3300031239 Bacteria 4437
524 Ga0265328_10085669 3300031239 Bacteria 1163
525 Ga0265329_10007806 3300031242 Bacteria 4106
526 Ga0265339_10248674 3300031249 Bacteria 861
527 Ga0265331_10002297 3300031250 Bacteria 13027
528 Ga0265327_10056979 3300031251 Bacteria 2012
529 Ga0265316_10075296 3300031344 Bacteria 2596
530 Ga0307408_100000079 3300031548 Bacteria 108053
531 Ga0307408_100000150 3300031548 Bacteria 77682
532 Ga0307408_100278985 3300031548 Bacteria 1391
533 Ga0307408_100589448 3300031548 Bacteria 986
534 Ga0265313_10078034 3300031595 Bacteria 1511
535 Ga0265314_10000245 3300031711 Bacteria 79757
536 Ga0307516_10004922 3300031730 Bacteria 16245
537 Ga0307516_10008436 3300031730 Bacteria 11673
538 Ga0307405_10043771 3300031731 Bacteria 2734
539 Ga0307405_10231616 3300031731 Bacteria 1362
540 Ga0307405_10903352 3300031731 Bacteria 747
541 Ga0307413_10252953 3300031824 Bacteria 1308
542 Ga0307413_11580061 3300031824 Bacteria 582
543 Ga0307410_10130576 3300031852 Bacteria 1845
544 Ga0307410_10312770 3300031852 Bacteria 1243
545 Ga0307410_10824221 3300031852 Bacteria 790
546 Ga0307406_10134153 3300031901 Bacteria 1742
547 Ga0307407_10294324 3300031903 Bacteria 1129
548 Ga0307412_10261492 3300031911 Bacteria 1349
549 Ga0307412_11109728 3300031911 Bacteria 704
550 Ga0307412_11535167 3300031911 Bacteria 606
551 Ga0307412_11553353 3300031911 Bacteria 603
552 Ga0307409_100028119 3300031995 Bacteria 3999
553 Ga0307409_100785671 3300031995 Bacteria 958
554 Ga0307416_100001678 3300032002 Bacteria 12247
555 Ga0307416_100121951 3300032002 Bacteria 2325
556 Ga0307416_100478408 3300032002 Bacteria 1305
557 Ga0307416_102035186 3300032002 Bacteria 677
558 Ga0307411_10041715 3300032005 Bacteria 2922
559 Ga0307411_10073333 3300032005 Bacteria 2328
560 Ga0307411_10229697 3300032005 Bacteria 1445
561 Ga0307415_100002191 3300032126 Bacteria 9675
562 Ga0316583_10004293 3300032133 Bacteria 5082
563 Ga0316583_10056414 3300032133 Bacteria 1380
564 Ga0316593_10000016 3300032168 Bacteria 16636
565 Ga0373950_0041931 3300034818 Bacteria 878
566 Ga0373944_0017839 3300035089 Bacteria 2020
567 Ga0373952_0070089 3300035092 Bacteria 875
568 Ga0373939_0000712 3300035114 Bacteria 8237
569 Ga0373939_0213360 3300035114 Bacteria 736
570 Ga0373957_0182133 3300035120 Bacteria 871
571 Ga0373943_0126701 3300035170 Bacteria 1362
572 Ga0373943_0780671 3300035170 Bacteria 568
573 Ga0373962_0017274 3300035242 Bacteria 1869
574 Ga0316574_0342789 3300035398 Bacteria 946
575 Ga0316574_0697912 3300035398 Bacteria 622
576 Ga0373931_0001569 3300035691 Bacteria 9864
577 Ga0373931_0023851 3300035691 Bacteria 3092
578 Ga0373927_0012468 3300035695 Bacteria 5661
579 Ga0373947_0337687 3300035725 Bacteria 1009
580 Ga0373937_0056689 3300036401 Bacteria 3599
581 Ga0316582_0064912 3300036647 Bacteria 2350
582 Ga0316584_0374047 3300036712 Bacteria 1019
583 Ga0395899_0003409 3300037312 Bacteria 12614
584 Ga0395899_0004262 3300037312 Bacteria 11193
585 Ga0395899_0074526 3300037312 Bacteria 2479
586 Ga0395900_0006268 3300037418 Bacteria 12412
587 Ga0395900_0007514 3300037418 Bacteria 11260
588 Ga0395900_0020392 3300037418 Bacteria 6766
589 Ga0395900_0071557 3300037418 Bacteria 3565
590 Ga0395898_0223872 3300037466 Bacteria 1794
591 Ga0395905_0008791 3300037471 Bacteria 9928
592 Ga0395905_0011382 3300037471 Bacteria 8595
593 Ga0395905_0085439 3300037471 Bacteria 2956
594 Ga0395905_0095840 3300037471 Bacteria 2785
595 Ga0395901_0030534 3300038443 Bacteria 5552
596 Ga0395901_0192162 3300038443 Bacteria 2140
597 Ga0395901_0230027 3300038443 Bacteria 1936
598 Ga0436365_0129858 3300039437 Bacteria 678
599 Ga0436360_0876667 3300039438 Bacteria 2260
600 Ga0436361_1079523 3300039447 Bacteria 3333
601 Ga0436363_0287192 3300039450 Bacteria 1566
602 Ga0439436_0037891 3300041404 Bacteria 1388
603 Ga0439438_102862 3300041405 Bacteria 692
604 Ga0451797_0303266 3300041453 Bacteria 697
605 Ga0451800_0102661 3300041459 Bacteria 2585
606 Ga0451802_0250019 3300041460 Bacteria 1357
607 Ga0451807_1061524 3300041486 Bacteria 668
608 Ga0451833_0942535 3300041491 Bacteria 864
609 Ga0451853_2015303 3300041512 Bacteria 1476
610 Ga0439437_022385 3300042000 Bacteria 769
611 Ga0439452_066766 3300042010 Bacteria 798
612 Ga0439455_0044143 3300042012 Bacteria 1149
613 Ga0439457_038921 3300042014 Bacteria 1058
614 Ga0439462_0021560 3300042015 Bacteria 1683
615 Ga0450912_006968 3300042116 Bacteria 908
616 Ga0450914_002824 3300042118 Bacteria 1279
617 Ga0450917_001185 3300042120 Bacteria 1891
618 Ga0450888_016658 3300042126 Bacteria 906
619 Ga0450890_001713 3300042127 Bacteria 3123
620 Ga0450897_027914 3300042128 Bacteria 630
621 Ga0450891_000222 3300042129 Bacteria 5702
622 Ga0450892_001107 3300042130 Bacteria 2814
623 Ga0450900_038045 3300042136 Bacteria 714
624 Ga0450903_004539 3300042138 Bacteria 2362
625 Ga0450889_002921 3300042144 Bacteria 1692
626 Ga0439458_0116271 3300042157 Bacteria 702
627 Ga0439434_0133119 3300042435 Bacteria 816
628 Ga0439464_0008197 3300042439 Bacteria 2739
629 Ga0450893_0000472 3300042532 Bacteria 5678
630 Ga0451577_0004825 3300042876 Bacteria 14082
631 Ga0451577_0033955 3300042876 Bacteria 4600
632 Ga0451577_0288350 3300042876 Bacteria 1487
633 Ga0466972_0465128 3300044658 Bacteria 594
634 Ga0453683_0018925 3300044673 Bacteria 4417
635 Ga0466965_0038442 3300044683 Bacteria 2351
636 Ga0453684_0264124 3300044712 Bacteria 1970
637 Ga0453684_0357023 3300044712 Bacteria 1646
638 Ga0453684_0366454 3300044712 Bacteria 1621
639 Ga0466957_0221821 3300044842 Bacteria 1248
640 Ga0466959_0449112 3300045049 Bacteria 874
641 Ga0451576_0016926 3300045051 Bacteria 8030
642 Ga0451576_0019670 3300045051 Bacteria 7368
643 Ga0451576_0024164 3300045051 Bacteria 6567
644 Ga0451576_0082681 3300045051 Bacteria 3340
645 Ga0451576_0445468 3300045051 Bacteria 1359
646 Ga0495603_0086264 3300046455 Bacteria 1837
647 Ga0495641_0193361 3300046461 Bacteria 912
648 Ga0495650_0061169 3300046471 Bacteria 1509
649 Ga0495585_0052528 3300046492 Bacteria 2256
650 Ga0495594_0038079 3300046499 Bacteria 2624
651 Ga0495620_0269439 3300046515 Bacteria 648
652 Ga0495632_0067602 3300046519 Bacteria 1723
653 Ga0495637_0002614 3300046520 Bacteria 9881
654 Ga0495666_0012973 3300046526 Bacteria 4153
655 Ga0495642_0082983 3300046528 Bacteria 1351
656 Ga0495654_0000028 3300046530 Bacteria 223384
657 Ga0495665_0031234 3300046531 Bacteria 2850
658 Ga0495586_0028561 3300046535 Bacteria 2984
659 Ga0495621_0009710 3300046539 Bacteria 2930
660 Ga0495621_0151992 3300046539 Bacteria 911
661 Ga0495622_0029717 3300046557 Bacteria 2553
662 Ga0495622_0066417 3300046557 Bacteria 1667
663 Ga0495656_0249160 3300046615 Bacteria 897
664 Ga0495668_0189989 3300046616 Bacteria 1125
665 Ga0495611_0024049 3300046648 Bacteria 2647
666 Ga0495659_0046112 3300046664 Bacteria 1573
667 Ga0495588_0013191 3300046674 Bacteria 3931
668 Ga0495658_0354746 3300046683 Bacteria 932
669 Ga0495670_0009786 3300046691 Bacteria 4712
670 Ga0495649_0315351 3300046694 Bacteria 794
671 Ga0495600_0362966 3300046809 Bacteria 906
672 Ga0495581_0055134 3300047315 Bacteria 2294
673 Ga0495636_0013522 3300047318 Bacteria 3240
674 Ga0495676_0061436 3300047321 Bacteria 2939
675 Ga0495685_027882 3300047447 Bacteria 1942
676 Ga0495686_0017228 3300047472 Bacteria 4872
677 Ga0495593_0026048 3300047673 Bacteria 3232
678 Ga0496100_0676082 3300048903 Bacteria 805
679 Ga0496101_0058309 3300048904 Bacteria 2796
680 Ga0496102_0001202 3300048905 Bacteria 23500
681 Ga0496102_0106855 3300048905 Bacteria 2605
682 Ga0496103_0142843 3300048906 Bacteria 1531
683 Ga0496106_0002462 3300048909 Bacteria 13800
684 Ga0496108_0365589 3300048911 Bacteria 1259
685 Ga0496108_0419383 3300048911 Bacteria 1169
686 Ga0496108_0622498 3300048911 Bacteria 940
687 Ga0496108_0848677 3300048911 Bacteria 786
688 Ga0496109_0005271 3300048912 Bacteria 10799
689 Ga0496109_0293672 3300048912 Bacteria 1532
690 Ga0496110_0263748 3300048913 Bacteria 1568
691 Ga0496111_0141391 3300048914 Bacteria 1783
692 Ga0496112_0009106 3300048915 Bacteria 8921
693 Ga0496113_0128291 3300048916 Bacteria 1988
694 Ga0496115_0094186 3300048918 Bacteria 2450
695 Ga0496125_0057066 3300048928 Bacteria 3165
696 Ga0501306_016110 3300049127 Bacteria 1001
697 Ga0501308_005386 3300049128 Bacteria 1272
698 Ga0501309_000129 3300049129 Bacteria 4661
699 Ga0501310_000219 3300049130 Bacteria 5455
700 Ga0501310_045678 3300049130 Bacteria 622
701 Ga0501305_000428 3300049161 Bacteria 3421
702 Ga0501305_008856 3300049161 Bacteria 1311
703 Ga0501305_037254 3300049161 Bacteria 780
704 Ga0501305_055290 3300049161 Bacteria 674
705 Ga0501307_012364 3300049162 Bacteria 1015
706 Ga0501300_000306 3300049523 Bacteria 7395
707 Ga0501303_001482 3300049526 Bacteria 1757
708 Ga0501311_000655 3300049527 Bacteria 2575
709 Ga0501312_001901 3300049528 Bacteria 2163
710 Ga0501312_022859 3300049528 Bacteria 939
711 Ga0501314_000050 3300049530 Bacteria 5184
712 Ga0501315_001210 3300049531 Bacteria 2135
713 Ga0501315_029011 3300049531 Bacteria 788
714 Ga0501320_010532 3300049536 Bacteria 943
715 Ga0501323_012227 3300049539 Bacteria 1046
716 Ga0501031_0199195 3300049568 Bacteria 1307
717 Ga0501034_0591130 3300049571 Bacteria 1016
718 Ga0501036_0447158 3300049572 Bacteria 1077
719 Ga0501039_0008184 3300049575 Bacteria 7972
720 Ga0501039_0161234 3300049575 Bacteria 1763
721 Ga0501040_0016310 3300049576 Bacteria 4915
722 Ga0501041_0023150 3300049577 Bacteria 3725
723 Ga0501041_0064874 3300049577 Bacteria 2236
724 Ga0501042_0330780 3300049578 Bacteria 1101
725 Ga0501046_0127147 3300049580 Bacteria 1935
726 Ga0501069_0189701 3300049585 Bacteria 1189
727 Ga0501071_0067827 3300049587 Bacteria 2595
728 Ga0501075_0002346 3300049591 Bacteria 12571
729 Ga0501075_0027238 3300049591 Bacteria 4211
730 Ga0501076_0025159 3300049592 Bacteria 4605
731 Ga0501077_0152354 3300049593 Bacteria 1467
732 Ga0501198_000011 3300049649 Bacteria 115612
733 Ga0501211_011925 3300049658 Bacteria 857
734 Ga0501217_034467 3300049661 Bacteria 1263
735 Ga0501222_000022 3300049662 Bacteria 66333
736 Ga0501222_001428 3300049662 Bacteria 3348
737 Ga0501223_020559 3300049663 Bacteria 1292
738 Ga0501227_004174 3300049665 Bacteria 3107
739 Ga0501233_003475 3300049668 Bacteria 2834
740 Ga0501235_003946 3300049669 Bacteria 3210
741 Ga0501242_018420 3300049674 Bacteria 887
742 Ga0501252_013450 3300049682 Bacteria 1001
743 Ga0501253_002263 3300049683 Bacteria 2140
744 Ga0501253_053857 3300049683 Bacteria 850
745 Ga0501255_001976 3300049684 Bacteria 1740
746 Ga0501261_005934 3300049690 Bacteria 1547
747 Ga0501221_003510 3300049704 Bacteria 2582
748 Ga0501225_0003592 3300049705 Bacteria 4676
749 Ga0501229_004048 3300049706 Bacteria 1773
750 Ga0501079_0076079 3300049741 Bacteria 2596
751 Ga0501079_0102849 3300049741 Bacteria 2215
752 Ga0501081_0005744 3300049743 Bacteria 8034
753 Ga0501081_0028494 3300049743 Bacteria 3769
754 Ga0501232_002467 3300049757 Bacteria 1610
755 Ga0501263_035200 3300049760 Bacteria 720
756 Ga0501265_001532 3300049762 Bacteria 2603
757 Ga0501267_000175 3300049764 Bacteria 4374
758 Ga0501268_014923 3300049765 Bacteria 1271
759 Ga0501269_003411 3300049766 Bacteria 1924
760 Ga0501271_030946 3300049768 Bacteria 661
761 Ga0501272_000642 3300049769 Bacteria 3118
762 Ga0501280_009717 3300049776 Bacteria 1338
763 Ga0501280_011864 3300049776 Bacteria 1220
764 Ga0501035_0111191 3300049822 Bacteria 2401
765 Ga0501035_0175017 3300049822 Bacteria 1852
766 Ga0501035_0548929 3300049822 Bacteria 947
767 Ga0501044_0181138 3300049823 Bacteria 2074
768 nmdc:mga03683_106932_c1 3300050489 Bacteria 1234
769 nmdc:mga03683_1268_c1 3300050489 Bacteria 7486
770 nmdc:mga03683_54917_c1 3300050489 Bacteria 1671
771 nmdc:mga03n38_62720_c1 3300050490 Bacteria 1697
772 nmdc:mga00v17_308121_c1 3300050491 Bacteria 1029
773 nmdc:mga00v17_491063_c1 3300050491 Bacteria 796
774 nmdc:mga0yw44_25530_c1 3300050492 Bacteria 3361
775 nmdc:mga0k408_10288_c1 3300050493 Bacteria 5056
776 nmdc:mga0k408_15202_c1 3300050493 Bacteria 4253
777 nmdc:mga0k408_209870_c1 3300050493 Bacteria 1163
778 nmdc:mga0k408_25816_c1 3300050493 Bacteria 3329
779 nmdc:mga0k408_31425_c1 3300050493 Bacteria 3031
780 nmdc:mga0k408_88932_c1 3300050493 Bacteria 1814
781 nmdc:mga06z11_18942_c1 3300050494 Bacteria 3155
782 nmdc:mga06z11_296343_c1 3300050494 Bacteria 961
783 nmdc:mga07m45_10321_c1 3300050496 Bacteria 4874
784 nmdc:mga07m45_10713_c2 3300050496 Bacteria 4430
785 nmdc:mga07m45_158953_c1 3300050496 Bacteria 1312
786 nmdc:mga07m45_415493_c1 3300050496 Bacteria 781
787 nmdc:mga07m45_65221_c1 3300050496 Bacteria 2068
788 nmdc:mga07m45_8350_c1 3300050496 Bacteria 5319
789 nmdc:mga07m45_8709_c1 3300050496 Bacteria 5226
790 nmdc:mga07m45_9217_c2 3300050496 Bacteria 1212
791 nmdc:mga05p37_1981701_c1 3300050507 Bacteria 552
792 nmdc:mga09592_465145_c1 3300050508 Bacteria 1090
793 nmdc:mga08y16_442125_c1 3300050511 Bacteria 1327
794 nmdc:mga08y16_54698_c1 3300050511 Bacteria 4171
795 nmdc:mga0a205_127418_c1 3300050515 Bacteria 761
796 nmdc:mga0sz30_61580_c1 3300050516 Bacteria 1604
797 Ga0500593_011050 3300053117 Bacteria 3804
798 Ga0500634_0116238 3300053161 Bacteria 1310
799 Ga0501084_0022989 3300054114 Bacteria 5204
800 Ga0501084_0910955 3300054114 Bacteria 739
801 Ga0590075_103341 3300059424 Bacteria 742
802 Ga0587076_068227 3300059645 Bacteria 732
803 Ga0501082_0003447 3300060353 Bacteria 13807
804 Ga0501082_0301430 3300060353 Bacteria 1395
805 Ga0466962_0191448 3300061719 Bacteria 998
806 Ga0530510_0025314 3300061734 Bacteria 4242
807 Ga0530510_0220719 3300061734 Bacteria 1409

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035120 Ga0373957_0182133 Ga0373957_0182133_35_490 110
2 3300035170 Ga0373943_0780671 Ga0373943_0780671_52_507 110
3 3300049130 Ga0501310_045678 Ga0501310_045678_153_611 111
4 3300049822 Ga0501035_0175017 Ga0501035_0175017_957_1415 111
5 3300025893 Ga0207682_10240190 Ga0207682_102401901 116
6 3300045049 Ga0466959_0449112 Ga0466959_0449112_217_705 116
7 3300049822 Ga0501035_0548929 Ga0501035_0548929_37_525 116
8 3300005329 Ga0070683_101093849 Ga0070683_1010938491 117
9 3300005330 Ga0070690_100687208 Ga0070690_1006872081 117
10 3300006353 Ga0075370_10143104 Ga0075370_101431043 117
11 3300021441 Ga0213871_10039446 Ga0213871_100394462 117
12 3300025942 Ga0207689_10915076 Ga0207689_109150761 117
13 3300025944 Ga0207661_11110336 Ga0207661_111103362 117
14 3300039438 Ga0436360_0876667 Ga0436360_0876667_315_803 117
15 3300041453 Ga0451797_0303266 Ga0451797_0303266_155_646 117
16 3300042876 Ga0451577_0004825 Ga0451577_0004825_11381_11869 117
17 3300042876 Ga0451577_0288350 Ga0451577_0288350_52_540 117
18 3300044712 Ga0453684_0357023 Ga0453684_0357023_180_668 117
19 3300045051 Ga0451576_0016926 Ga0451576_0016926_3213_3701 117
20 3300005353 Ga0070669_100405071 Ga0070669_1004050712 118
21 3300006195 Ga0075366_10219830 Ga0075366_102198301 118
22 3300006358 Ga0068871_100165018 Ga0068871_1001650182 118
23 3300013102 Ga0157371_10219499 Ga0157371_102194991 118
24 3300025923 Ga0207681_10502200 Ga0207681_105022002 118
25 3300025941 Ga0207711_10145583 Ga0207711_101455833 118
26 3300028794 Ga0307515_10069900 Ga0307515_100699004 118
27 3300031548 Ga0307408_100000150 Ga0307408_10000015049 118
28 3300031548 Ga0307408_100589448 Ga0307408_1005894482 118
29 3300032002 Ga0307416_100478408 Ga0307416_1004784082 118
30 3300032005 Ga0307411_10041715 Ga0307411_100417151 118
31 3300034818 Ga0373950_0041931 Ga0373950_0041931_123_611 118
32 3300035114 Ga0373939_0000712 Ga0373939_0000712_7476_7964 118
33 3300035691 Ga0373931_0023851 Ga0373931_0023851_997_1485 118
34 3300037471 Ga0395905_0011382 Ga0395905_0011382_4620_5108 118
35 3300042010 Ga0439452_066766 Ga0439452_066766_215_703 118
36 3300042012 Ga0439455_0044143 Ga0439455_0044143_367_855 118
37 3300042116 Ga0450912_006968 Ga0450912_006968_193_681 118
38 3300042120 Ga0450917_001185 Ga0450917_001185_742_1230 118
39 3300042126 Ga0450888_016658 Ga0450888_016658_131_619 118
40 3300042127 Ga0450890_001713 Ga0450890_001713_34_522 118
41 3300042129 Ga0450891_000222 Ga0450891_000222_2042_2530 118
42 3300042130 Ga0450892_001107 Ga0450892_001107_1905_2393 118
43 3300042136 Ga0450900_038045 Ga0450900_038045_17_505 118
44 3300042144 Ga0450889_002921 Ga0450889_002921_969_1457 118
45 3300042532 Ga0450893_0000472 Ga0450893_0000472_2492_2980 118
46 3300046455 Ga0495603_0086264 Ga0495603_0086264_729_1217 118
47 3300046557 Ga0495622_0066417 Ga0495622_0066417_311_799 118
48 3300046648 Ga0495611_0024049 Ga0495611_0024049_1269_1757 118
49 3300046664 Ga0495659_0046112 Ga0495659_0046112_526_1014 118
50 3300046691 Ga0495670_0009786 Ga0495670_0009786_2776_3264 118
51 3300047321 Ga0495676_0061436 Ga0495676_0061436_1409_1897 118
52 3300048905 Ga0496102_0106855 Ga0496102_0106855_576_1064 118
53 3300049129 Ga0501309_000129 Ga0501309_000129_2335_2823 118
54 3300049130 Ga0501310_000219 Ga0501310_000219_3129_3617 118
55 3300049161 Ga0501305_000428 Ga0501305_000428_1560_2048 118
56 3300049523 Ga0501300_000306 Ga0501300_000306_5709_6197 118
57 3300049527 Ga0501311_000655 Ga0501311_000655_1747_2235 118
58 3300049528 Ga0501312_001901 Ga0501312_001901_1060_1548 118
59 3300049530 Ga0501314_000050 Ga0501314_000050_1778_2266 118
60 3300049531 Ga0501315_001210 Ga0501315_001210_1195_1683 118
61 3300049658 Ga0501211_011925 Ga0501211_011925_60_548 118
62 3300049661 Ga0501217_034467 Ga0501217_034467_308_796 118
63 3300049663 Ga0501223_020559 Ga0501223_020559_81_569 118
64 3300049665 Ga0501227_004174 Ga0501227_004174_1474_1962 118
65 3300049668 Ga0501233_003475 Ga0501233_003475_518_1006 118
66 3300049669 Ga0501235_003946 Ga0501235_003946_659_1147 118
67 3300049674 Ga0501242_018420 Ga0501242_018420_137_625 118
68 3300049683 Ga0501253_002263 Ga0501253_002263_435_923 118
69 3300049684 Ga0501255_001976 Ga0501255_001976_448_936 118
70 3300049704 Ga0501221_003510 Ga0501221_003510_1156_1644 118
71 3300049705 Ga0501225_0003592 Ga0501225_0003592_1838_2326 118
72 3300049706 Ga0501229_004048 Ga0501229_004048_844_1332 118
73 3300049764 Ga0501267_000175 Ga0501267_000175_1799_2287 118
74 3300049765 Ga0501268_014923 Ga0501268_014923_542_1030 118
75 3300049766 Ga0501269_003411 Ga0501269_003411_849_1337 118
76 3300049768 Ga0501271_030946 Ga0501271_030946_63_551 118
77 3300049769 Ga0501272_000642 Ga0501272_000642_2180_2668 118
78 3300049776 Ga0501280_009717 Ga0501280_009717_293_781 118
79 3300050491 nmdc:mga00v17_491063_c1 nmdc:mga00v17_491063_c1_269_757 118
80 3300050493 nmdc:mga0k408_25816_c1 nmdc:mga0k408_25816_c1_1986_2474 118
81 3300050496 nmdc:mga07m45_8350_c1 nmdc:mga07m45_8350_c1_3172_3660 118
82 3300005337 Ga0070682_100775143 Ga0070682_1007751431 119
83 3300005339 Ga0070660_100002795 Ga0070660_1000027959 119
84 3300005344 Ga0070661_100027832 Ga0070661_1000278323 119
85 3300005366 Ga0070659_100002322 Ga0070659_1000023222 119
86 3300005457 Ga0070662_100159915 Ga0070662_1001599153 119
87 3300005564 Ga0070664_100073204 Ga0070664_1000732042 119
88 3300006028 Ga0070717_11359717 Ga0070717_113597171 119
89 3300025224 Ga0209784_100002 Ga0209784_1000021162 119
90 3300025225 Ga0209566_100003 Ga0209566_1000031162 119
91 3300025226 Ga0209674_100004 Ga0209674_1000041162 119
92 3300025230 Ga0209563_100006 Ga0209563_1000061162 119
93 3300025253 Ga0209677_100003 Ga0209677_1000031162 119
94 3300025919 Ga0207657_10002207 Ga0207657_1000220715 119
95 3300025920 Ga0207649_10003831 Ga0207649_100038316 119
96 3300025932 Ga0207690_10001989 Ga0207690_100019892 119
97 3300025945 Ga0207679_10003662 Ga0207679_100036623 119
98 3300025949 Ga0207667_10000438 Ga0207667_1000043841 119
99 3300037312 Ga0395899_0003409 Ga0395899_0003409_7407_7895 119
100 3300037312 Ga0395899_0074526 Ga0395899_0074526_1455_1943 119
101 3300037418 Ga0395900_0006268 Ga0395900_0006268_1425_1913 119
102 3300037471 Ga0395905_0008791 Ga0395905_0008791_8077_8565 119
103 3300039447 Ga0436361_1079523 Ga0436361_1079523_340_828 119
104 3300044658 Ga0466972_0465128 Ga0466972_0465128_70_558 119
105 3300044683 Ga0466965_0038442 Ga0466965_0038442_172_660 119
106 3300044712 Ga0453684_0264124 Ga0453684_0264124_1105_1593 119
107 3300049161 Ga0501305_037254 Ga0501305_037254_216_704 119
108 3300049528 Ga0501312_022859 Ga0501312_022859_67_555 119
109 3300049757 Ga0501232_002467 Ga0501232_002467_824_1312 119
110 3300059645 Ga0587076_068227 Ga0587076_068227_215_703 119
111 3300061719 Ga0466962_0191448 Ga0466962_0191448_142_630 119
112 3300003203 JGI25406J46586_10035479 JGI25406J46586_100354791 120
113 3300005327 Ga0070658_10007907 Ga0070658_100079078 120
114 3300005330 Ga0070690_100059579 Ga0070690_1000595792 120
115 3300005334 Ga0068869_100254225 Ga0068869_1002542252 120
116 3300005336 Ga0070680_100689802 Ga0070680_1006898022 120
117 3300005340 Ga0070689_100073841 Ga0070689_1000738414 120
118 3300005344 Ga0070661_100419416 Ga0070661_1004194162 120
119 3300005344 Ga0070661_100981644 Ga0070661_1009816441 120
120 3300005345 Ga0070692_10200784 Ga0070692_102007842 120
121 3300005444 Ga0070694_100751265 Ga0070694_1007512652 120
122 3300005445 Ga0070708_100225173 Ga0070708_1002251731 120
123 3300005445 Ga0070708_101821334 Ga0070708_1018213341 120
124 3300005468 Ga0070707_100254010 Ga0070707_1002540102 120
125 3300005468 Ga0070707_100523756 Ga0070707_1005237561 120
126 3300005471 Ga0070698_100221962 Ga0070698_1002219622 120
127 3300005546 Ga0070696_100542532 Ga0070696_1005425322 120
128 3300005547 Ga0070693_100044381 Ga0070693_1000443812 120
129 3300005547 Ga0070693_100271893 Ga0070693_1002718932 120
130 3300005617 Ga0068859_100075090 Ga0068859_1000750903 120
131 3300005985 Ga0081539_10000805 Ga0081539_1000080552 120
132 3300006844 Ga0075428_100001252 Ga0075428_10000125215 120
133 3300006881 Ga0068865_100142185 Ga0068865_1001421852 120
134 3300006931 Ga0097620_100075089 Ga0097620_1000750893 120
135 3300009093 Ga0105240_10013785 Ga0105240_100137859 120
136 3300009098 Ga0105245_10782718 Ga0105245_107827182 120
137 3300009174 Ga0105241_10192193 Ga0105241_101921932 120
138 3300009545 Ga0105237_10108721 Ga0105237_101087212 120
139 3300009551 Ga0105238_10002510 Ga0105238_100025103 120
140 3300012507 Ga0157342_1019827 Ga0157342_10198272 120
141 3300013100 Ga0157373_10097612 Ga0157373_100976122 120
142 3300013105 Ga0157369_10002671 Ga0157369_100026713 120
143 3300013307 Ga0157372_10002307 Ga0157372_1000230715 120
144 3300025911 Ga0207654_10321392 Ga0207654_103213921 120
145 3300025920 Ga0207649_10538011 Ga0207649_105380112 120
146 3300025927 Ga0207687_10367460 Ga0207687_103674602 120
147 3300025936 Ga0207670_10242108 Ga0207670_102421082 120
148 3300025939 Ga0207665_10331191 Ga0207665_103311912 120
149 3300025942 Ga0207689_10251051 Ga0207689_102510512 120
150 3300025960 Ga0207651_10248445 Ga0207651_102484452 120
151 3300026116 Ga0207674_10283708 Ga0207674_102837081 120
152 3300027907 Ga0207428_10002514 Ga0207428_100025149 120
153 3300031249 Ga0265339_10248674 Ga0265339_102486742 120
154 3300037312 Ga0395899_0004262 Ga0395899_0004262_10446_10934 120
155 3300037418 Ga0395900_0020392 Ga0395900_0020392_66_554 120
156 3300037466 Ga0395898_0223872 Ga0395898_0223872_350_838 120
157 3300038443 Ga0395901_0030534 Ga0395901_0030534_4379_4867 120
158 3300038443 Ga0395901_0230027 Ga0395901_0230027_280_768 120
159 3300041491 Ga0451833_0942535 Ga0451833_0942535_281_769 120
160 3300046471 Ga0495650_0061169 Ga0495650_0061169_290_778 120
161 3300046499 Ga0495594_0038079 Ga0495594_0038079_1820_2308 120
162 3300046520 Ga0495637_0002614 Ga0495637_0002614_1915_2403 120
163 3300046526 Ga0495666_0012973 Ga0495666_0012973_1333_1821 120
164 3300046528 Ga0495642_0082983 Ga0495642_0082983_522_1010 120
165 3300046530 Ga0495654_0000028 Ga0495654_0000028_119634_120122 120
166 3300046531 Ga0495665_0031234 Ga0495665_0031234_1734_2222 120
167 3300046535 Ga0495586_0028561 Ga0495586_0028561_405_893 120
168 3300046557 Ga0495622_0029717 Ga0495622_0029717_1746_2234 120
169 3300046674 Ga0495588_0013191 Ga0495588_0013191_1204_1692 120
170 3300046694 Ga0495649_0315351 Ga0495649_0315351_252_740 120
171 3300046809 Ga0495600_0362966 Ga0495600_0362966_267_755 120
172 3300047315 Ga0495581_0055134 Ga0495581_0055134_1129_1617 120
173 3300047318 Ga0495636_0013522 Ga0495636_0013522_1601_2089 120
174 3300047447 Ga0495685_027882 Ga0495685_027882_1077_1565 120
175 3300047673 Ga0495593_0026048 Ga0495593_0026048_1844_2332 120
176 3300048905 Ga0496102_0001202 Ga0496102_0001202_15436_15924 120
177 3300048906 Ga0496103_0142843 Ga0496103_0142843_324_812 120
178 3300048911 Ga0496108_0419383 Ga0496108_0419383_575_1066 120
179 3300048915 Ga0496112_0009106 Ga0496112_0009106_2019_2510 120
180 3300049536 Ga0501320_010532 Ga0501320_010532_11_502 120
181 3300049575 Ga0501039_0161234 Ga0501039_0161234_465_953 120
182 3300049577 Ga0501041_0023150 Ga0501041_0023150_2983_3471 120
183 3300049578 Ga0501042_0330780 Ga0501042_0330780_212_700 120
184 3300049585 Ga0501069_0189701 Ga0501069_0189701_16_513 120
185 3300049591 Ga0501075_0027238 Ga0501075_0027238_2221_2709 120
186 3300049592 Ga0501076_0025159 Ga0501076_0025159_2755_3243 120
187 3300049593 Ga0501077_0152354 Ga0501077_0152354_451_939 120
188 3300049741 Ga0501079_0102849 Ga0501079_0102849_1436_1924 120
189 3300049743 Ga0501081_0028494 Ga0501081_0028494_1948_2436 120
190 3300053117 Ga0500593_011050 Ga0500593_011050_1369_1863 120
191 3300054114 Ga0501084_0022989 Ga0501084_0022989_2911_3399 120
192 3300060353 Ga0501082_0301430 Ga0501082_0301430_402_890 120
193 3300061734 Ga0530510_0025314 Ga0530510_0025314_1923_2411 120
194 3300005293 Ga0065715_10690727 Ga0065715_106907271 121
195 3300005295 Ga0065707_10238478 Ga0065707_102384782 121
196 3300005328 Ga0070676_10112979 Ga0070676_101129792 121
197 3300005328 Ga0070676_10760559 Ga0070676_107605591 121
198 3300005329 Ga0070683_100095922 Ga0070683_1000959222 121
199 3300005330 Ga0070690_100001009 Ga0070690_1000010098 121
200 3300005331 Ga0070670_100004966 Ga0070670_1000049667 121
201 3300005331 Ga0070670_100016506 Ga0070670_1000165066 121
202 3300005334 Ga0068869_100001595 Ga0068869_1000015956 121
203 3300005334 Ga0068869_100001619 Ga0068869_1000016196 121
204 3300005334 Ga0068869_100173962 Ga0068869_1001739622 121
205 3300005336 Ga0070680_100167657 Ga0070680_1001676573 121
206 3300005337 Ga0070682_100099576 Ga0070682_1000995762 121
207 3300005338 Ga0068868_100002256 Ga0068868_1000022566 121
208 3300005339 Ga0070660_100018480 Ga0070660_1000184804 121
209 3300005340 Ga0070689_100003115 Ga0070689_1000031159 121
210 3300005340 Ga0070689_100286677 Ga0070689_1002866771 121
211 3300005341 Ga0070691_10010007 Ga0070691_100100073 121
212 3300005343 Ga0070687_100332402 Ga0070687_1003324022 121
213 3300005344 Ga0070661_100103399 Ga0070661_1001033994 121
214 3300005344 Ga0070661_100104792 Ga0070661_1001047922 121
215 3300005345 Ga0070692_10069478 Ga0070692_100694781 121
216 3300005345 Ga0070692_10652079 Ga0070692_106520791 121
217 3300005347 Ga0070668_100105555 Ga0070668_1001055552 121
218 3300005353 Ga0070669_100048590 Ga0070669_1000485902 121
219 3300005353 Ga0070669_100058142 Ga0070669_1000581424 121
220 3300005353 Ga0070669_100078810 Ga0070669_1000788102 121
221 3300005353 Ga0070669_100383287 Ga0070669_1003832871 121
222 3300005354 Ga0070675_100005842 Ga0070675_1000058429 121
223 3300005354 Ga0070675_100006391 Ga0070675_1000063914 121
224 3300005354 Ga0070675_100047574 Ga0070675_1000475742 121
225 3300005355 Ga0070671_100039280 Ga0070671_1000392803 121
226 3300005356 Ga0070674_100088400 Ga0070674_1000884002 121
227 3300005364 Ga0070673_100071236 Ga0070673_1000712362 121
228 3300005364 Ga0070673_100264780 Ga0070673_1002647802 121
229 3300005366 Ga0070659_100096437 Ga0070659_1000964374 121
230 3300005366 Ga0070659_100131331 Ga0070659_1001313312 121
231 3300005435 Ga0070714_100055650 Ga0070714_1000556503 121
232 3300005438 Ga0070701_10012435 Ga0070701_100124353 121
233 3300005440 Ga0070705_100079740 Ga0070705_1000797403 121
234 3300005440 Ga0070705_101243836 Ga0070705_1012438361 121
235 3300005441 Ga0070700_100001013 Ga0070700_1000010136 121
236 3300005441 Ga0070700_100001626 Ga0070700_1000016266 121
237 3300005441 Ga0070700_100361951 Ga0070700_1003619512 121
238 3300005441 Ga0070700_100893846 Ga0070700_1008938461 121
239 3300005444 Ga0070694_100330346 Ga0070694_1003303462 121
240 3300005456 Ga0070678_100136389 Ga0070678_1001363894 121
241 3300005456 Ga0070678_100188939 Ga0070678_1001889392 121
242 3300005456 Ga0070678_100620918 Ga0070678_1006209182 121
243 3300005457 Ga0070662_100048307 Ga0070662_1000483074 121
244 3300005457 Ga0070662_100187204 Ga0070662_1001872042 121
245 3300005458 Ga0070681_10207473 Ga0070681_102074734 121
246 3300005459 Ga0068867_100009745 Ga0068867_1000097452 121
247 3300005459 Ga0068867_100309570 Ga0068867_1003095702 121
248 3300005459 Ga0068867_100312800 Ga0068867_1003128002 121
249 3300005459 Ga0068867_100808652 Ga0068867_1008086522 121
250 3300005467 Ga0070706_101189246 Ga0070706_1011892462 121
251 3300005468 Ga0070707_100831142 Ga0070707_1008311422 121
252 3300005530 Ga0070679_100042176 Ga0070679_1000421764 121
253 3300005535 Ga0070684_100077572 Ga0070684_1000775722 121
254 3300005539 Ga0068853_100015533 Ga0068853_1000155332 121
255 3300005543 Ga0070672_100000154 Ga0070672_10000015419 121
256 3300005543 Ga0070672_100130225 Ga0070672_1001302254 121
257 3300005543 Ga0070672_100598836 Ga0070672_1005988362 121
258 3300005543 Ga0070672_100619645 Ga0070672_1006196451 121
259 3300005544 Ga0070686_100740074 Ga0070686_1007400742 121
260 3300005545 Ga0070695_100104227 Ga0070695_1001042272 121
261 3300005545 Ga0070695_100439022 Ga0070695_1004390222 121
262 3300005546 Ga0070696_100107118 Ga0070696_1001071182 121
263 3300005547 Ga0070693_100035072 Ga0070693_1000350723 121
264 3300005548 Ga0070665_100127737 Ga0070665_1001277372 121
265 3300005548 Ga0070665_101182326 Ga0070665_1011823262 121
266 3300005549 Ga0070704_100037606 Ga0070704_1000376062 121
267 3300005563 Ga0068855_100072560 Ga0068855_1000725603 121
268 3300005563 Ga0068855_100145416 Ga0068855_1001454162 121
269 3300005564 Ga0070664_100627791 Ga0070664_1006277912 121
270 3300005564 Ga0070664_100770402 Ga0070664_1007704022 121
271 3300005577 Ga0068857_100000558 Ga0068857_10000055824 121
272 3300005578 Ga0068854_100039092 Ga0068854_1000390921 121
273 3300005578 Ga0068854_100047918 Ga0068854_1000479184 121
274 3300005614 Ga0068856_100055728 Ga0068856_1000557282 121
275 3300005615 Ga0070702_100000173 Ga0070702_10000017314 121
276 3300005616 Ga0068852_100013425 Ga0068852_1000134252 121
277 3300005616 Ga0068852_100069951 Ga0068852_1000699514 121
278 3300005617 Ga0068859_100026412 Ga0068859_1000264124 121
279 3300005617 Ga0068859_100184396 Ga0068859_1001843963 121
280 3300005617 Ga0068859_101043147 Ga0068859_1010431472 121
281 3300005618 Ga0068864_100017918 Ga0068864_1000179184 121
282 3300005618 Ga0068864_100130611 Ga0068864_1001306112 121
283 3300005618 Ga0068864_100176894 Ga0068864_1001768943 121
284 3300005618 Ga0068864_100345607 Ga0068864_1003456072 121
285 3300005718 Ga0068866_10003085 Ga0068866_100030853 121
286 3300005718 Ga0068866_10493581 Ga0068866_104935812 121
287 3300005719 Ga0068861_100004103 Ga0068861_1000041036 121
288 3300005719 Ga0068861_100011414 Ga0068861_1000114143 121
289 3300005719 Ga0068861_100108405 Ga0068861_1001084052 121
290 3300005834 Ga0068851_10018066 Ga0068851_100180664 121
291 3300005840 Ga0068870_10020158 Ga0068870_100201584 121
292 3300005841 Ga0068863_100115524 Ga0068863_1001155241 121
293 3300005841 Ga0068863_100259218 Ga0068863_1002592182 121
294 3300005841 Ga0068863_100324700 Ga0068863_1003247002 121
295 3300005842 Ga0068858_100002333 Ga0068858_10000233314 121
296 3300005842 Ga0068858_100048177 Ga0068858_1000481772 121
297 3300005842 Ga0068858_100131206 Ga0068858_1001312062 121
298 3300005843 Ga0068860_100029126 Ga0068860_1000291262 121
299 3300005843 Ga0068860_100209668 Ga0068860_1002096682 121
300 3300005843 Ga0068860_100463821 Ga0068860_1004638212 121
301 3300005843 Ga0068860_100542513 Ga0068860_1005425132 121
302 3300005844 Ga0068862_100020007 Ga0068862_1000200072 121
303 3300005844 Ga0068862_100045487 Ga0068862_1000454873 121
304 3300005844 Ga0068862_100264655 Ga0068862_1002646552 121
305 3300006237 Ga0097621_100002521 Ga0097621_1000025212 121
306 3300006237 Ga0097621_100005330 Ga0097621_1000053302 121
307 3300006358 Ga0068871_100000683 Ga0068871_1000006832 121
308 3300006358 Ga0068871_100022193 Ga0068871_1000221935 121
309 3300006358 Ga0068871_100026023 Ga0068871_1000260234 121
310 3300006358 Ga0068871_100491909 Ga0068871_1004919092 121
311 3300006871 Ga0075434_100238658 Ga0075434_1002386582 121
312 3300006881 Ga0068865_100008874 Ga0068865_1000088745 121
313 3300006931 Ga0097620_100026411 Ga0097620_1000264113 121
314 3300006931 Ga0097620_100184403 Ga0097620_1001844033 121
315 3300006931 Ga0097620_101043117 Ga0097620_1010431172 121
316 3300007265 Ga0099794_10014278 Ga0099794_100142783 121
317 3300009093 Ga0105240_10009928 Ga0105240_100099284 121
318 3300009094 Ga0111539_10001053 Ga0111539_1000105314 121
319 3300009098 Ga0105245_10000207 Ga0105245_1000020721 121
320 3300009098 Ga0105245_10024240 Ga0105245_100242404 121
321 3300009098 Ga0105245_10133266 Ga0105245_101332663 121
322 3300009147 Ga0114129_11546520 Ga0114129_115465202 121
323 3300009148 Ga0105243_10002103 Ga0105243_100021036 121
324 3300009174 Ga0105241_10074838 Ga0105241_100748384 121
325 3300009176 Ga0105242_10007171 Ga0105242_100071713 121
326 3300009176 Ga0105242_10160986 Ga0105242_101609863 121
327 3300009176 Ga0105242_10260278 Ga0105242_102602782 121
328 3300009176 Ga0105242_10528526 Ga0105242_105285262 121
329 3300009177 Ga0105248_10055439 Ga0105248_100554394 121
330 3300009177 Ga0105248_10142318 Ga0105248_101423184 121
331 3300010375 Ga0105239_10662758 Ga0105239_106627581 121
332 3300013102 Ga0157371_10017872 Ga0157371_100178724 121
333 3300013102 Ga0157371_10168550 Ga0157371_101685503 121
334 3300013104 Ga0157370_10042158 Ga0157370_100421585 121
335 3300013105 Ga0157369_10361770 Ga0157369_103617702 121
336 3300013297 Ga0157378_10001175 Ga0157378_100011758 121
337 3300013297 Ga0157378_10083446 Ga0157378_100834463 121
338 3300013297 Ga0157378_10088875 Ga0157378_100888754 121
339 3300013297 Ga0157378_10645096 Ga0157378_106450962 121
340 3300013306 Ga0163162_10023809 Ga0163162_100238092 121
341 3300013308 Ga0157375_10072805 Ga0157375_100728054 121
342 3300014325 Ga0163163_10048361 Ga0163163_100483613 121
343 3300014325 Ga0163163_10243631 Ga0163163_102436314 121
344 3300014326 Ga0157380_10022168 Ga0157380_100221683 121
345 3300014745 Ga0157377_10002002 Ga0157377_100020025 121
346 3300014968 Ga0157379_10212765 Ga0157379_102127653 121
347 3300014968 Ga0157379_10725597 Ga0157379_107255971 121
348 3300014969 Ga0157376_10015844 Ga0157376_100158444 121
349 3300014969 Ga0157376_10019335 Ga0157376_100193355 121
350 3300017792 Ga0163161_10007457 Ga0163161_100074573 121
351 3300017792 Ga0163161_10069457 Ga0163161_100694573 121
352 3300017792 Ga0163161_10141302 Ga0163161_101413023 121
353 3300017792 Ga0163161_10293938 Ga0163161_102939382 121
354 3300025321 Ga0207656_10009892 Ga0207656_100098924 121
355 3300025899 Ga0207642_10003267 Ga0207642_100032673 121
356 3300025901 Ga0207688_10188979 Ga0207688_101889792 121
357 3300025907 Ga0207645_10513624 Ga0207645_105136242 121
358 3300025907 Ga0207645_10836190 Ga0207645_108361901 121
359 3300025908 Ga0207643_10014328 Ga0207643_100143284 121
360 3300025908 Ga0207643_10073364 Ga0207643_100733642 121
361 3300025909 Ga0207705_10707257 Ga0207705_107072571 121
362 3300025910 Ga0207684_10036532 Ga0207684_100365322 121
363 3300025910 Ga0207684_10300868 Ga0207684_103008682 121
364 3300025913 Ga0207695_10082880 Ga0207695_100828802 121
365 3300025914 Ga0207671_10300134 Ga0207671_103001342 121
366 3300025918 Ga0207662_10082471 Ga0207662_100824712 121
367 3300025919 Ga0207657_10040657 Ga0207657_100406573 121
368 3300025919 Ga0207657_10269597 Ga0207657_102695972 121
369 3300025920 Ga0207649_10050778 Ga0207649_100507784 121
370 3300025920 Ga0207649_10176766 Ga0207649_101767662 121
371 3300025920 Ga0207649_10422863 Ga0207649_104228632 121
372 3300025921 Ga0207652_10109428 Ga0207652_101094284 121
373 3300025923 Ga0207681_10039804 Ga0207681_100398042 121
374 3300025923 Ga0207681_10047472 Ga0207681_100474722 121
375 3300025923 Ga0207681_10279402 Ga0207681_102794022 121
376 3300025924 Ga0207694_10003525 Ga0207694_100035259 121
377 3300025924 Ga0207694_10247799 Ga0207694_102477992 121
378 3300025925 Ga0207650_10082048 Ga0207650_100820483 121
379 3300025925 Ga0207650_10162131 Ga0207650_101621313 121
380 3300025925 Ga0207650_10800399 Ga0207650_108003991 121
381 3300025926 Ga0207659_10010036 Ga0207659_100100362 121
382 3300025926 Ga0207659_10101833 Ga0207659_101018332 121
383 3300025926 Ga0207659_11010551 Ga0207659_110105511 121
384 3300025927 Ga0207687_10014724 Ga0207687_100147244 121
385 3300025927 Ga0207687_10061275 Ga0207687_100612752 121
386 3300025927 Ga0207687_10585471 Ga0207687_105854711 121
387 3300025929 Ga0207664_10062116 Ga0207664_100621163 121
388 3300025931 Ga0207644_10026535 Ga0207644_100265352 121
389 3300025931 Ga0207644_10124463 Ga0207644_101244632 121
390 3300025932 Ga0207690_10034932 Ga0207690_100349322 121
391 3300025932 Ga0207690_10186005 Ga0207690_101860052 121
392 3300025933 Ga0207706_10162344 Ga0207706_101623443 121
393 3300025933 Ga0207706_10205221 Ga0207706_102052212 121
394 3300025934 Ga0207686_10000586 Ga0207686_100005866 121
395 3300025934 Ga0207686_10408988 Ga0207686_104089882 121
396 3300025935 Ga0207709_10055857 Ga0207709_100558573 121
397 3300025936 Ga0207670_10009278 Ga0207670_100092784 121
398 3300025937 Ga0207669_10031303 Ga0207669_100313032 121
399 3300025937 Ga0207669_10055154 Ga0207669_100551542 121
400 3300025937 Ga0207669_10140418 Ga0207669_101404181 121
401 3300025938 Ga0207704_10000475 Ga0207704_1000047513 121
402 3300025940 Ga0207691_10001614 Ga0207691_100016142 121
403 3300025940 Ga0207691_10004247 Ga0207691_100042474 121
404 3300025940 Ga0207691_10368023 Ga0207691_103680232 121
405 3300025941 Ga0207711_10038900 Ga0207711_100389004 121
406 3300025941 Ga0207711_10344638 Ga0207711_103446381 121
407 3300025941 Ga0207711_10628123 Ga0207711_106281232 121
408 3300025941 Ga0207711_10861009 Ga0207711_108610092 121
409 3300025941 Ga0207711_10876935 Ga0207711_108769352 121
410 3300025942 Ga0207689_10000384 Ga0207689_1000038434 121
411 3300025942 Ga0207689_10000534 Ga0207689_1000053430 121
412 3300025942 Ga0207689_10138033 Ga0207689_101380332 121
413 3300025944 Ga0207661_10364656 Ga0207661_103646562 121
414 3300025945 Ga0207679_10005080 Ga0207679_100050802 121
415 3300025945 Ga0207679_10186070 Ga0207679_101860702 121
416 3300025945 Ga0207679_10916954 Ga0207679_109169542 121
417 3300025949 Ga0207667_10008305 Ga0207667_100083054 121
418 3300025960 Ga0207651_10095301 Ga0207651_100953012 121
419 3300025960 Ga0207651_10261436 Ga0207651_102614361 121
420 3300025960 Ga0207651_10450436 Ga0207651_104504362 121
421 3300025972 Ga0207668_10003970 Ga0207668_100039707 121
422 3300025972 Ga0207668_10229390 Ga0207668_102293902 121
423 3300025986 Ga0207658_10506083 Ga0207658_105060832 121
424 3300026023 Ga0207677_10001173 Ga0207677_1000117315 121
425 3300026035 Ga0207703_10001476 Ga0207703_1000147615 121
426 3300026035 Ga0207703_10084266 Ga0207703_100842662 121
427 3300026035 Ga0207703_10654689 Ga0207703_106546892 121
428 3300026035 Ga0207703_11043595 Ga0207703_110435952 121
429 3300026041 Ga0207639_10109942 Ga0207639_101099423 121
430 3300026067 Ga0207678_10241672 Ga0207678_102416722 121
431 3300026075 Ga0207708_10000156 Ga0207708_1000015630 121
432 3300026075 Ga0207708_10008948 Ga0207708_100089487 121
433 3300026075 Ga0207708_10671461 Ga0207708_106714612 121
434 3300026078 Ga0207702_10030669 Ga0207702_100306695 121
435 3300026088 Ga0207641_10149510 Ga0207641_101495102 121
436 3300026088 Ga0207641_10391157 Ga0207641_103911571 121
437 3300026088 Ga0207641_10542325 Ga0207641_105423252 121
438 3300026089 Ga0207648_10000128 Ga0207648_100001287 121
439 3300026089 Ga0207648_10165237 Ga0207648_101652373 121
440 3300026089 Ga0207648_10268552 Ga0207648_102685522 121
441 3300026095 Ga0207676_10024174 Ga0207676_100241744 121
442 3300026095 Ga0207676_10051819 Ga0207676_100518194 121
443 3300026095 Ga0207676_10322087 Ga0207676_103220872 121
444 3300026095 Ga0207676_10341599 Ga0207676_103415992 121
445 3300026095 Ga0207676_11204819 Ga0207676_112048191 121
446 3300026116 Ga0207674_10000049 Ga0207674_1000004962 121
447 3300026118 Ga0207675_100000408 Ga0207675_10000040833 121
448 3300026118 Ga0207675_100028763 Ga0207675_1000287633 121
449 3300026118 Ga0207675_100037952 Ga0207675_1000379523 121
450 3300026118 Ga0207675_100214198 Ga0207675_1002141982 121
451 3300026121 Ga0207683_10047530 Ga0207683_100475304 121
452 3300026121 Ga0207683_10159917 Ga0207683_101599172 121
453 3300026121 Ga0207683_10240655 Ga0207683_102406552 121
454 3300026142 Ga0207698_10008396 Ga0207698_100083963 121
455 3300026142 Ga0207698_10057764 Ga0207698_100577644 121
456 3300028380 Ga0268265_10033020 Ga0268265_100330202 121
457 3300028381 Ga0268264_10115379 Ga0268264_101153792 121
458 3300028381 Ga0268264_10616801 Ga0268264_106168012 121
459 3300028381 Ga0268264_10694281 Ga0268264_106942812 121
460 3300028577 Ga0265318_10069406 Ga0265318_100694062 121
461 3300028794 Ga0307515_10042672 Ga0307515_100426726 121
462 3300031235 Ga0265330_10192460 Ga0265330_101924601 121
463 3300031238 Ga0265332_10002950 Ga0265332_100029507 121
464 3300031238 Ga0265332_10003769 Ga0265332_100037694 121
465 3300031239 Ga0265328_10007837 Ga0265328_100078372 121
466 3300031239 Ga0265328_10085669 Ga0265328_100856692 121
467 3300031242 Ga0265329_10007806 Ga0265329_100078063 121
468 3300031250 Ga0265331_10002297 Ga0265331_1000229710 121
469 3300031251 Ga0265327_10056979 Ga0265327_100569792 121
470 3300031344 Ga0265316_10075296 Ga0265316_100752964 121
471 3300031548 Ga0307408_100000079 Ga0307408_10000007950 121
472 3300031595 Ga0265313_10078034 Ga0265313_100780342 121
473 3300031711 Ga0265314_10000245 Ga0265314_1000024541 121
474 3300031824 Ga0307413_10252953 Ga0307413_102529532 121
475 3300031852 Ga0307410_10312770 Ga0307410_103127702 121
476 3300031911 Ga0307412_11109728 Ga0307412_111097282 121
477 3300031911 Ga0307412_11553353 Ga0307412_115533531 121
478 3300031995 Ga0307409_100785671 Ga0307409_1007856712 121
479 3300032133 Ga0316583_10004293 Ga0316583_100042933 121
480 3300032133 Ga0316583_10056414 Ga0316583_100564142 121
481 3300032168 Ga0316593_10000016 Ga0316593_100000166 121
482 3300035092 Ga0373952_0070089 Ga0373952_0070089_184_681 121
483 3300035114 Ga0373939_0213360 Ga0373939_0213360_219_710 121
484 3300035170 Ga0373943_0126701 Ga0373943_0126701_483_980 121
485 3300035242 Ga0373962_0017274 Ga0373962_0017274_1036_1533 121
486 3300035398 Ga0316574_0342789 Ga0316574_0342789_385_873 121
487 3300035398 Ga0316574_0697912 Ga0316574_0697912_40_528 121
488 3300035725 Ga0373947_0337687 Ga0373947_0337687_265_762 121
489 3300036401 Ga0373937_0056689 Ga0373937_0056689_2625_3122 121
490 3300036647 Ga0316582_0064912 Ga0316582_0064912_849_1337 121
491 3300036712 Ga0316584_0374047 Ga0316584_0374047_109_597 121
492 3300039437 Ga0436365_0129858 Ga0436365_0129858_17_514 121
493 3300039450 Ga0436363_0287192 Ga0436363_0287192_817_1314 121
494 3300046492 Ga0495585_0052528 Ga0495585_0052528_171_680 121
495 3300046615 Ga0495656_0249160 Ga0495656_0249160_278_784 121
496 3300046616 Ga0495668_0189989 Ga0495668_0189989_304_813 121
497 3300048903 Ga0496100_0676082 Ga0496100_0676082_112_609 121
498 3300048904 Ga0496101_0058309 Ga0496101_0058309_1125_1622 121
499 3300048909 Ga0496106_0002462 Ga0496106_0002462_9715_10212 121
500 3300048911 Ga0496108_0622498 Ga0496108_0622498_191_682 121
501 3300048914 Ga0496111_0141391 Ga0496111_0141391_792_1289 121
502 3300048916 Ga0496113_0128291 Ga0496113_0128291_1417_1914 121
503 3300048918 Ga0496115_0094186 Ga0496115_0094186_1099_1596 121
504 3300048928 Ga0496125_0057066 Ga0496125_0057066_1468_1977 121
505 3300049128 Ga0501308_005386 Ga0501308_005386_420_917 121
506 3300049571 Ga0501034_0591130 Ga0501034_0591130_185_676 121
507 3300049575 Ga0501039_0008184 Ga0501039_0008184_5535_6062 121
508 3300049576 Ga0501040_0016310 Ga0501040_0016310_46_573 121
509 3300049577 Ga0501041_0064874 Ga0501041_0064874_260_787 121
510 3300049580 Ga0501046_0127147 Ga0501046_0127147_491_1018 121
511 3300049587 Ga0501071_0067827 Ga0501071_0067827_1191_1718 121
512 3300049591 Ga0501075_0002346 Ga0501075_0002346_6183_6710 121
513 3300049741 Ga0501079_0076079 Ga0501079_0076079_1668_2171 121
514 3300049743 Ga0501081_0005744 Ga0501081_0005744_4305_4832 121
515 3300050493 nmdc:mga0k408_209870_c1 nmdc:mga0k408_209870_c1_26_523 121
516 3300050507 nmdc:mga05p37_1981701_c1 nmdc:mga05p37_1981701_c1_11_502 121
517 3300050511 nmdc:mga08y16_54698_c1 nmdc:mga08y16_54698_c1_1748_2251 121
518 3300050515 nmdc:mga0a205_127418_c1 nmdc:mga0a205_127418_c1_248_739 121
519 3300054114 Ga0501084_0910955 Ga0501084_0910955_195_722 121
520 3300059424 Ga0590075_103341 Ga0590075_103341_174_692 121
521 3300060353 Ga0501082_0003447 Ga0501082_0003447_10105_10632 121
522 3300061734 Ga0530510_0220719 Ga0530510_0220719_406_933 121
523 3300005327 Ga0070658_10194872 Ga0070658_101948722 122
524 3300005335 Ga0070666_10359709 Ga0070666_103597092 122
525 3300005356 Ga0070674_100348960 Ga0070674_1003489602 122
526 3300006880 Ga0075429_100654157 Ga0075429_1006541572 122
527 3300009098 Ga0105245_10621162 Ga0105245_106211622 122
528 3300009553 Ga0105249_10444698 Ga0105249_104446982 122
529 3300013296 Ga0157374_10588541 Ga0157374_105885412 122
530 3300014326 Ga0157380_11225112 Ga0157380_112251122 122
531 3300025927 Ga0207687_10252630 Ga0207687_102526302 122
532 3300031548 Ga0307408_100278985 Ga0307408_1002789851 122
533 3300031824 Ga0307413_11580061 Ga0307413_115800611 122
534 3300031852 Ga0307410_10824221 Ga0307410_108242212 122
535 3300031911 Ga0307412_10261492 Ga0307412_102614922 122
536 3300032002 Ga0307416_100121951 Ga0307416_1001219512 122
537 3300032005 Ga0307411_10229697 Ga0307411_102296972 122
538 3300035691 Ga0373931_0001569 Ga0373931_0001569_1282_1794 122
539 3300035695 Ga0373927_0012468 Ga0373927_0012468_867_1358 122
540 3300037418 Ga0395900_0071557 Ga0395900_0071557_3000_3530 122
541 3300041405 Ga0439438_102862 Ga0439438_102862_24_545 122
542 3300042015 Ga0439462_0021560 Ga0439462_0021560_257_781 122
543 3300042128 Ga0450897_027914 Ga0450897_027914_10_501 122
544 3300045051 Ga0451576_0445468 Ga0451576_0445468_195_719 122
545 3300046539 Ga0495621_0009710 Ga0495621_0009710_2139_2636 122
546 3300046539 Ga0495621_0151992 Ga0495621_0151992_229_750 122
547 3300049161 Ga0501305_055290 Ga0501305_055290_105_632 122
548 3300049526 Ga0501303_001482 Ga0501303_001482_1114_1605 122
549 3300049649 Ga0501198_000011 Ga0501198_000011_60713_61204 122
550 3300049662 Ga0501222_000022 Ga0501222_000022_60903_61394 122
551 3300049662 Ga0501222_001428 Ga0501222_001428_1197_1694 122
552 3300049683 Ga0501253_053857 Ga0501253_053857_202_693 122
553 3300049762 Ga0501265_001532 Ga0501265_001532_878_1369 122
554 3300049776 Ga0501280_011864 Ga0501280_011864_598_1095 122
555 3300050508 nmdc:mga09592_465145_c1 nmdc:mga09592_465145_c1_148_672 122
556 3300003305 Ga0006770J48903_1097331 Ga0006770J48903_10973312 123
557 3300005327 Ga0070658_10059634 Ga0070658_100596344 123
558 3300005327 Ga0070658_10073249 Ga0070658_100732492 123
559 3300005329 Ga0070683_100220075 Ga0070683_1002200752 123
560 3300005331 Ga0070670_100103183 Ga0070670_1001031832 123
561 3300005331 Ga0070670_100370603 Ga0070670_1003706032 123
562 3300005333 Ga0070677_10012244 Ga0070677_100122442 123
563 3300005335 Ga0070666_10212595 Ga0070666_102125952 123
564 3300005335 Ga0070666_10372979 Ga0070666_103729792 123
565 3300005343 Ga0070687_100031653 Ga0070687_1000316533 123
566 3300005344 Ga0070661_100219662 Ga0070661_1002196622 123
567 3300005347 Ga0070668_100369294 Ga0070668_1003692942 123
568 3300005354 Ga0070675_100210145 Ga0070675_1002101452 123
569 3300005356 Ga0070674_100118798 Ga0070674_1001187983 123
570 3300005365 Ga0070688_100949521 Ga0070688_1009495211 123
571 3300005366 Ga0070659_100657941 Ga0070659_1006579412 123
572 3300005441 Ga0070700_100037435 Ga0070700_1000374352 123
573 3300005455 Ga0070663_100000897 Ga0070663_1000008976 123
574 3300005455 Ga0070663_100458935 Ga0070663_1004589351 123
575 3300005457 Ga0070662_100386031 Ga0070662_1003860312 123
576 3300005458 Ga0070681_10224667 Ga0070681_102246672 123
577 3300005459 Ga0068867_100351852 Ga0068867_1003518522 123
578 3300005530 Ga0070679_100067912 Ga0070679_1000679123 123
579 3300005535 Ga0070684_100186160 Ga0070684_1001861602 123
580 3300005543 Ga0070672_100107999 Ga0070672_1001079992 123
581 3300005543 Ga0070672_100108456 Ga0070672_1001084562 123
582 3300005543 Ga0070672_100965026 Ga0070672_1009650262 123
583 3300005548 Ga0070665_100470346 Ga0070665_1004703462 123
584 3300005548 Ga0070665_101191347 Ga0070665_1011913472 123
585 3300005577 Ga0068857_100332941 Ga0068857_1003329412 123
586 3300005577 Ga0068857_100431036 Ga0068857_1004310362 123
587 3300005615 Ga0070702_100862716 Ga0070702_1008627161 123
588 3300005616 Ga0068852_100128257 Ga0068852_1001282574 123
589 3300005616 Ga0068852_100375105 Ga0068852_1003751053 123
590 3300005618 Ga0068864_100185170 Ga0068864_1001851702 123
591 3300005834 Ga0068851_10205673 Ga0068851_102056732 123
592 3300005840 Ga0068870_10085898 Ga0068870_100858982 123
593 3300005841 Ga0068863_100860902 Ga0068863_1008609022 123
594 3300005842 Ga0068858_100146546 Ga0068858_1001465462 123
595 3300005842 Ga0068858_101713820 Ga0068858_1017138201 123
596 3300005843 Ga0068860_100108335 Ga0068860_1001083352 123
597 3300006195 Ga0075366_10293200 Ga0075366_102932001 123
598 3300006237 Ga0097621_100334140 Ga0097621_1003341402 123
599 3300006237 Ga0097621_101101722 Ga0097621_1011017221 123
600 3300006358 Ga0068871_100290551 Ga0068871_1002905513 123
601 3300006358 Ga0068871_100486646 Ga0068871_1004866461 123
602 3300006358 Ga0068871_100636532 Ga0068871_1006365322 123
603 3300009174 Ga0105241_10284745 Ga0105241_102847452 123
604 3300012508 Ga0157315_1012896 Ga0157315_10128962 123
605 3300013102 Ga0157371_10723699 Ga0157371_107236991 123
606 3300013105 Ga0157369_10038103 Ga0157369_100381033 123
607 3300013296 Ga0157374_10303506 Ga0157374_103035062 123
608 3300013307 Ga0157372_10404453 Ga0157372_104044532 123
609 3300013308 Ga0157375_11267123 Ga0157375_112671231 123
610 3300014326 Ga0157380_10266002 Ga0157380_102660022 123
611 3300014326 Ga0157380_11041012 Ga0157380_110410122 123
612 3300014968 Ga0157379_10480078 Ga0157379_104800782 123
613 3300014968 Ga0157379_10678428 Ga0157379_106784282 123
614 3300014969 Ga0157376_10736866 Ga0157376_107368661 123
615 3300014969 Ga0157376_11276465 Ga0157376_112764652 123
616 3300015265 Ga0182005_1061473 Ga0182005_10614732 123
617 3300017792 Ga0163161_10460615 Ga0163161_104606152 123
618 3300025273 Ga0209673_1025863 Ga0209673_10258631 123
619 3300025290 Ga0207673_1025731 Ga0207673_10257311 123
620 3300025303 Ga0209051_1000792 Ga0209051_10007924 123
621 3300025304 Ga0209257_1000396 Ga0209257_10003969 123
622 3300025903 Ga0207680_10270979 Ga0207680_102709792 123
623 3300025909 Ga0207705_10032664 Ga0207705_100326643 123
624 3300025917 Ga0207660_10008796 Ga0207660_100087965 123
625 3300025919 Ga0207657_10303707 Ga0207657_103037072 123
626 3300025919 Ga0207657_10501064 Ga0207657_105010641 123
627 3300025920 Ga0207649_10003892 Ga0207649_100038923 123
628 3300025921 Ga0207652_10103276 Ga0207652_101032763 123
629 3300025924 Ga0207694_10088490 Ga0207694_100884902 123
630 3300025925 Ga0207650_10012426 Ga0207650_100124263 123
631 3300025925 Ga0207650_10585714 Ga0207650_105857141 123
632 3300025926 Ga0207659_10554519 Ga0207659_105545191 123
633 3300025931 Ga0207644_10166105 Ga0207644_101661052 123
634 3300025931 Ga0207644_10403738 Ga0207644_104037381 123
635 3300025931 Ga0207644_10553281 Ga0207644_105532812 123
636 3300025932 Ga0207690_10570443 Ga0207690_105704432 123
637 3300025937 Ga0207669_10103514 Ga0207669_101035142 123
638 3300025937 Ga0207669_10120766 Ga0207669_101207662 123
639 3300025938 Ga0207704_10044909 Ga0207704_100449093 123
640 3300025941 Ga0207711_10671409 Ga0207711_106714092 123
641 3300025944 Ga0207661_10293595 Ga0207661_102935951 123
642 3300025945 Ga0207679_10789566 Ga0207679_107895662 123
643 3300025960 Ga0207651_10208160 Ga0207651_102081602 123
644 3300025961 Ga0207712_10657063 Ga0207712_106570632 123
645 3300025981 Ga0207640_10291613 Ga0207640_102916132 123
646 3300025986 Ga0207658_10034379 Ga0207658_100343793 123
647 3300026035 Ga0207703_10243963 Ga0207703_102439632 123
648 3300026041 Ga0207639_10278117 Ga0207639_102781172 123
649 3300026067 Ga0207678_10002683 Ga0207678_100026839 123
650 3300026078 Ga0207702_10076859 Ga0207702_100768594 123
651 3300026088 Ga0207641_10882467 Ga0207641_108824672 123
652 3300026095 Ga0207676_10149266 Ga0207676_101492662 123
653 3300026142 Ga0207698_10060781 Ga0207698_100607814 123
654 3300028381 Ga0268264_10065291 Ga0268264_100652912 123
655 3300031731 Ga0307405_10043771 Ga0307405_100437712 123
656 3300031731 Ga0307405_10231616 Ga0307405_102316162 123
657 3300031852 Ga0307410_10130576 Ga0307410_101305762 123
658 3300031901 Ga0307406_10134153 Ga0307406_101341532 123
659 3300031903 Ga0307407_10294324 Ga0307407_102943242 123
660 3300031911 Ga0307412_11535167 Ga0307412_115351671 123
661 3300031995 Ga0307409_100028119 Ga0307409_1000281194 123
662 3300032002 Ga0307416_100001678 Ga0307416_10000167813 123
663 3300032005 Ga0307411_10073333 Ga0307411_100733332 123
664 3300032126 Ga0307415_100002191 Ga0307415_1000021916 123
665 3300035089 Ga0373944_0017839 Ga0373944_0017839_645_1142 123
666 3300037418 Ga0395900_0007514 Ga0395900_0007514_6563_7087 123
667 3300037471 Ga0395905_0085439 Ga0395905_0085439_389_913 123
668 3300038443 Ga0395901_0192162 Ga0395901_0192162_1233_1757 123
669 3300041404 Ga0439436_0037891 Ga0439436_0037891_16_540 123
670 3300041486 Ga0451807_1061524 Ga0451807_1061524_122_619 123
671 3300041512 Ga0451853_2015303 Ga0451853_2015303_848_1345 123
672 3300042000 Ga0439437_022385 Ga0439437_022385_135_656 123
673 3300042014 Ga0439457_038921 Ga0439457_038921_305_829 123
674 3300042118 Ga0450914_002824 Ga0450914_002824_213_731 123
675 3300042138 Ga0450903_004539 Ga0450903_004539_464_985 123
676 3300042157 Ga0439458_0116271 Ga0439458_0116271_170_667 123
677 3300042435 Ga0439434_0133119 Ga0439434_0133119_130_648 123
678 3300042439 Ga0439464_0008197 Ga0439464_0008197_412_933 123
679 3300044673 Ga0453683_0018925 Ga0453683_0018925_1943_2464 123
680 3300045051 Ga0451576_0019670 Ga0451576_0019670_3782_4303 123
681 3300045051 Ga0451576_0082681 Ga0451576_0082681_1290_1787 123
682 3300046461 Ga0495641_0193361 Ga0495641_0193361_209_706 123
683 3300046515 Ga0495620_0269439 Ga0495620_0269439_70_567 123
684 3300046683 Ga0495658_0354746 Ga0495658_0354746_273_770 123
685 3300048911 Ga0496108_0365589 Ga0496108_0365589_10_507 123
686 3300048911 Ga0496108_0848677 Ga0496108_0848677_41_538 123
687 3300048912 Ga0496109_0005271 Ga0496109_0005271_5346_5843 123
688 3300048912 Ga0496109_0293672 Ga0496109_0293672_289_786 123
689 3300048913 Ga0496110_0263748 Ga0496110_0263748_156_653 123
690 3300049162 Ga0501307_012364 Ga0501307_012364_45_566 123
691 3300049531 Ga0501315_029011 Ga0501315_029011_116_634 123
692 3300049568 Ga0501031_0199195 Ga0501031_0199195_290_814 123
693 3300049690 Ga0501261_005934 Ga0501261_005934_996_1520 123
694 3300049760 Ga0501263_035200 Ga0501263_035200_173_697 123
695 3300049822 Ga0501035_0111191 Ga0501035_0111191_428_952 123
696 3300049823 Ga0501044_0181138 Ga0501044_0181138_109_630 123
697 3300050511 nmdc:mga08y16_442125_c1 nmdc:mga08y16_442125_c1_459_956 123
698 3300001979 JGI24740J21852_10003255 JGI24740J21852_100032557 124
699 3300003773 Ga0055537_1000104 Ga0055537_100010414 124
700 3300003784 Ga0055534_1000042 Ga0055534_100004227 124
701 3300003790 Ga0055528_1002054 Ga0055528_10020546 124
702 3300005331 Ga0070670_100079153 Ga0070670_1000791532 124
703 3300005333 Ga0070677_10016448 Ga0070677_100164483 124
704 3300005334 Ga0068869_100216424 Ga0068869_1002164242 124
705 3300005339 Ga0070660_100568420 Ga0070660_1005684202 124
706 3300005347 Ga0070668_100181514 Ga0070668_1001815142 124
707 3300005354 Ga0070675_100349749 Ga0070675_1003497492 124
708 3300005355 Ga0070671_100963562 Ga0070671_1009635621 124
709 3300005364 Ga0070673_100431638 Ga0070673_1004316382 124
710 3300005440 Ga0070705_100442999 Ga0070705_1004429992 124
711 3300005455 Ga0070663_100013398 Ga0070663_1000133984 124
712 3300005459 Ga0068867_100002101 Ga0068867_1000021014 124
713 3300005535 Ga0070684_100563797 Ga0070684_1005637971 124
714 3300005536 Ga0070697_101195305 Ga0070697_1011953051 124
715 3300005563 Ga0068855_100092098 Ga0068855_1000920983 124
716 3300006038 Ga0075365_10129415 Ga0075365_101294153 124
717 3300006038 Ga0075365_10163399 Ga0075365_101633993 124
718 3300006042 Ga0075368_10019417 Ga0075368_100194173 124
719 3300006048 Ga0075363_100059522 Ga0075363_1000595224 124
720 3300006048 Ga0075363_100110547 Ga0075363_1001105473 124
721 3300006051 Ga0075364_10274643 Ga0075364_102746431 124
722 3300006058 Ga0075432_10168524 Ga0075432_101685242 124
723 3300006177 Ga0075362_10040225 Ga0075362_100402254 124
724 3300006177 Ga0075362_10040647 Ga0075362_100406474 124
725 3300006177 Ga0075362_10071288 Ga0075362_100712883 124
726 3300006178 Ga0075367_10069943 Ga0075367_100699432 124
727 3300006178 Ga0075367_10077842 Ga0075367_100778424 124
728 3300006178 Ga0075367_10402801 Ga0075367_104028011 124
729 3300006186 Ga0075369_10085083 Ga0075369_100850832 124
730 3300006195 Ga0075366_10010531 Ga0075366_100105312 124
731 3300006195 Ga0075366_10229333 Ga0075366_102293332 124
732 3300006195 Ga0075366_10335862 Ga0075366_103358622 124
733 3300006353 Ga0075370_10008804 Ga0075370_100088044 124
734 3300006353 Ga0075370_10009133 Ga0075370_100091332 124
735 3300006353 Ga0075370_10016255 Ga0075370_100162552 124
736 3300006353 Ga0075370_10066381 Ga0075370_100663814 124
737 3300006353 Ga0075370_10309417 Ga0075370_103094172 124
738 3300006353 Ga0075370_10311862 Ga0075370_103118622 124
739 3300006353 Ga0075370_10461804 Ga0075370_104618042 124
740 3300006948 Ga0099826_10000627 Ga0099826_100006273 124
741 3300009148 Ga0105243_10077418 Ga0105243_100774183 124
742 3300009545 Ga0105237_10048608 Ga0105237_100486084 124
743 3300010375 Ga0105239_10208619 Ga0105239_102086192 124
744 3300012495 Ga0157323_1006756 Ga0157323_10067562 124
745 3300014745 Ga0157377_10000028 Ga0157377_1000002874 124
746 3300025263 Ga0209565_1000083 Ga0209565_100008328 124
747 3300025273 Ga0209673_1000323 Ga0209673_100032325 124
748 3300025284 Ga0209130_1011590 Ga0209130_10115903 124
749 3300025291 Ga0209675_1000081 Ga0209675_100008128 124
750 3300025294 Ga0209025_1014206 Ga0209025_10142063 124
751 3300025299 Ga0209256_1035977 Ga0209256_10359772 124
752 3300025893 Ga0207682_10006201 Ga0207682_100062013 124
753 3300025911 Ga0207654_10291484 Ga0207654_102914842 124
754 3300025913 Ga0207695_10095717 Ga0207695_100957172 124
755 3300025914 Ga0207671_10018674 Ga0207671_100186743 124
756 3300025925 Ga0207650_10082222 Ga0207650_100822223 124
757 3300025925 Ga0207650_10377205 Ga0207650_103772052 124
758 3300025935 Ga0207709_10024766 Ga0207709_100247664 124
759 3300025935 Ga0207709_10162913 Ga0207709_101629133 124
760 3300025949 Ga0207667_10494430 Ga0207667_104944301 124
761 3300026089 Ga0207648_10007560 Ga0207648_100075608 124
762 3300026116 Ga0207674_10095721 Ga0207674_100957212 124
763 3300027666 Ga0209282_1000790 Ga0209282_10007902 124
764 3300027866 Ga0209813_10025009 Ga0209813_100250093 124
765 3300027876 Ga0209974_10000975 Ga0209974_100009753 124
766 3300028786 Ga0307517_10520958 Ga0307517_105209581 124
767 3300028794 Ga0307515_10000020 Ga0307515_10000020360 124
768 3300028794 Ga0307515_10000053 Ga0307515_10000053164 124
769 3300031730 Ga0307516_10004922 Ga0307516_1000492210 124
770 3300031730 Ga0307516_10008436 Ga0307516_100084369 124
771 3300031731 Ga0307405_10903352 Ga0307405_109033522 124
772 3300032002 Ga0307416_102035186 Ga0307416_1020351861 124
773 3300037471 Ga0395905_0095840 Ga0395905_0095840_1499_1996 124
774 3300041459 Ga0451800_0102661 Ga0451800_0102661_357_875 124
775 3300041460 Ga0451802_0250019 Ga0451802_0250019_59_577 124
776 3300042876 Ga0451577_0033955 Ga0451577_0033955_2737_3234 124
777 3300044712 Ga0453684_0366454 Ga0453684_0366454_185_682 124
778 3300044842 Ga0466957_0221821 Ga0466957_0221821_151_675 124
779 3300045051 Ga0451576_0024164 Ga0451576_0024164_1795_2292 124
780 3300046519 Ga0495632_0067602 Ga0495632_0067602_449_946 124
781 3300047472 Ga0495686_0017228 Ga0495686_0017228_3471_3977 124
782 3300049127 Ga0501306_016110 Ga0501306_016110_434_955 124
783 3300049161 Ga0501305_008856 Ga0501305_008856_187_702 124
784 3300049539 Ga0501323_012227 Ga0501323_012227_233_730 124
785 3300049572 Ga0501036_0447158 Ga0501036_0447158_336_860 124
786 3300049682 Ga0501252_013450 Ga0501252_013450_21_518 124
787 3300050489 nmdc:mga03683_106932_c1 nmdc:mga03683_106932_c1_618_1115 124
788 3300050489 nmdc:mga03683_1268_c1 nmdc:mga03683_1268_c1_2593_3090 124
789 3300050489 nmdc:mga03683_54917_c1 nmdc:mga03683_54917_c1_783_1280 124
790 3300050490 nmdc:mga03n38_62720_c1 nmdc:mga03n38_62720_c1_933_1430 124
791 3300050491 nmdc:mga00v17_308121_c1 nmdc:mga00v17_308121_c1_264_761 124
792 3300050492 nmdc:mga0yw44_25530_c1 nmdc:mga0yw44_25530_c1_912_1409 124
793 3300050493 nmdc:mga0k408_10288_c1 nmdc:mga0k408_10288_c1_3874_4374 124
794 3300050493 nmdc:mga0k408_15202_c1 nmdc:mga0k408_15202_c1_2239_2736 124
795 3300050493 nmdc:mga0k408_31425_c1 nmdc:mga0k408_31425_c1_2195_2692 124
796 3300050493 nmdc:mga0k408_88932_c1 nmdc:mga0k408_88932_c1_673_1170 124
797 3300050494 nmdc:mga06z11_18942_c1 nmdc:mga06z11_18942_c1_2419_2916 124
798 3300050494 nmdc:mga06z11_296343_c1 nmdc:mga06z11_296343_c1_278_799 124
799 3300050496 nmdc:mga07m45_10321_c1 nmdc:mga07m45_10321_c1_1736_2233 124
800 3300050496 nmdc:mga07m45_10713_c2 nmdc:mga07m45_10713_c2_406_903 124
801 3300050496 nmdc:mga07m45_158953_c1 nmdc:mga07m45_158953_c1_237_734 124
802 3300050496 nmdc:mga07m45_415493_c1 nmdc:mga07m45_415493_c1_78_575 124
803 3300050496 nmdc:mga07m45_65221_c1 nmdc:mga07m45_65221_c1_602_1099 124
804 3300050496 nmdc:mga07m45_8709_c1 nmdc:mga07m45_8709_c1_4546_5043 124
805 3300050496 nmdc:mga07m45_9217_c2 nmdc:mga07m45_9217_c2_100_597 124
806 3300050516 nmdc:mga0sz30_61580_c1 nmdc:mga0sz30_61580_c1_935_1432 124
807 3300053161 Ga0500634_0116238 Ga0500634_0116238_553_1074 124

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00037

Fer4

4Fe-4S binding domain

72

92

0.95

Feature Viewer

pLDDT pTM Quality
62 0.37 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map