F481696
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 807 | 409 | 807 | 129 |
Family's Representative Sequence
| Representative Sequence | 3300049575|Ga0501039_0008184|Ga0501039_0008184_5535_6062 |
| Length | 144 |
| Sequence | VDADAALGVVEVMIERIQRFFQTFLLAELVKGMALTGRHLFRRKITVQYPEEKTPMSPRFRGLHALRRYPNGEERCIACKLCEAVCPALAITIESEQRAVETRILEYHGEKRGDLIYTKPMLLAVGDLYEERIAKDRAEDAAYR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003305 | Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 4 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 5 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 6 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 77 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 79 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 80 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 81 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 82 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 83 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 84 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 85 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 86 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 89 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 90 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 91 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 92 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 93 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 94 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 96 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 97 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Metagenome | Rhizosphere |
| 110 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 111 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 112 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 127 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 129 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 200 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 201 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 203 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 206 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 207 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 208 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 209 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 210 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 211 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 212 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 213 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 214 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 215 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 216 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 217 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 218 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 219 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 220 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 221 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 222 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 223 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 224 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 225 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 226 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 227 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 228 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 229 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 230 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 231 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 232 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 233 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 234 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 235 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 236 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 237 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 238 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 239 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 240 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 241 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 242 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 243 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 244 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 245 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 246 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 247 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 248 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 249 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 250 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 251 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 252 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 253 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 254 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 255 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 256 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 257 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 258 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 259 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 260 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 261 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 262 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 263 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 264 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 265 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 266 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 267 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 268 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 269 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 270 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 271 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 272 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 273 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 274 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 275 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 276 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 277 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 278 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 279 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 280 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 281 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 282 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 283 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 284 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 285 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 286 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 287 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 288 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 289 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 290 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 291 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 322 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 324 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 325 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 326 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 327 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 329 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 330 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 331 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 332 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 333 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 334 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 335 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 336 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 337 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 338 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 339 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 340 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 341 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 342 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 343 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 344 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 345 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 346 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 347 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 348 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 362 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 363 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 364 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 365 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 366 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 367 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 368 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 369 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 370 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 371 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 372 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 373 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 374 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 375 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 376 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 377 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 380 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 381 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 382 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 383 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 384 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 385 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 386 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 387 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 388 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 391 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 392 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 393 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 394 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 395 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 396 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 397 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 402 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 403 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 404 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 406 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 407 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 408 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 409 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.4 |
| Metatranscriptomes | 2.6 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.67 |
| Nodule | 0.25 |
| Rhizoplane | 2.6 |
| Rhizosphere | 86.99 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.49 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10003255 | 3300001979 | Bacteria | 7174 |
| 2 | JGI25406J46586_10035479 | 3300003203 | Bacteria | 1820 |
| 3 | Ga0006770J48903_1097331 | 3300003305 | Bacteria | 651 |
| 4 | Ga0055537_1000104 | 3300003773 | Bacteria | 63394 |
| 5 | Ga0055534_1000042 | 3300003784 | Bacteria | 99433 |
| 6 | Ga0055528_1002054 | 3300003790 | Bacteria | 11254 |
| 7 | Ga0065715_10690727 | 3300005293 | Bacteria | 658 |
| 8 | Ga0065707_10238478 | 3300005295 | Bacteria | 1164 |
| 9 | Ga0070658_10007907 | 3300005327 | Bacteria | 8564 |
| 10 | Ga0070658_10059634 | 3300005327 | Bacteria | 3107 |
| 11 | Ga0070658_10073249 | 3300005327 | Bacteria | 2808 |
| 12 | Ga0070658_10194872 | 3300005327 | Bacteria | 1708 |
| 13 | Ga0070676_10112979 | 3300005328 | Bacteria | 1694 |
| 14 | Ga0070676_10760559 | 3300005328 | Bacteria | 712 |
| 15 | Ga0070683_100095922 | 3300005329 | Bacteria | 2789 |
| 16 | Ga0070683_100220075 | 3300005329 | Bacteria | 1804 |
| 17 | Ga0070683_101093849 | 3300005329 | Bacteria | 766 |
| 18 | Ga0070690_100001009 | 3300005330 | Bacteria | 14387 |
| 19 | Ga0070690_100059579 | 3300005330 | Bacteria | 2455 |
| 20 | Ga0070690_100687208 | 3300005330 | Bacteria | 785 |
| 21 | Ga0070670_100004966 | 3300005331 | Bacteria | 11188 |
| 22 | Ga0070670_100016506 | 3300005331 | Bacteria | 6338 |
| 23 | Ga0070670_100079153 | 3300005331 | Bacteria | 2824 |
| 24 | Ga0070670_100103183 | 3300005331 | Bacteria | 2456 |
| 25 | Ga0070670_100370603 | 3300005331 | Bacteria | 1260 |
| 26 | Ga0070677_10012244 | 3300005333 | Bacteria | 2975 |
| 27 | Ga0070677_10016448 | 3300005333 | Bacteria | 2633 |
| 28 | Ga0068869_100001595 | 3300005334 | Bacteria | 13483 |
| 29 | Ga0068869_100001619 | 3300005334 | Bacteria | 13391 |
| 30 | Ga0068869_100173962 | 3300005334 | Bacteria | 1684 |
| 31 | Ga0068869_100216424 | 3300005334 | Bacteria | 1516 |
| 32 | Ga0068869_100254225 | 3300005334 | Bacteria | 1404 |
| 33 | Ga0070666_10212595 | 3300005335 | Bacteria | 1362 |
| 34 | Ga0070666_10359709 | 3300005335 | Bacteria | 1042 |
| 35 | Ga0070666_10372979 | 3300005335 | Bacteria | 1023 |
| 36 | Ga0070680_100167657 | 3300005336 | Bacteria | 1847 |
| 37 | Ga0070680_100689802 | 3300005336 | Bacteria | 879 |
| 38 | Ga0070682_100099576 | 3300005337 | Bacteria | 1917 |
| 39 | Ga0070682_100775143 | 3300005337 | Bacteria | 777 |
| 40 | Ga0068868_100002256 | 3300005338 | Bacteria | 13331 |
| 41 | Ga0070660_100002795 | 3300005339 | Bacteria | 11991 |
| 42 | Ga0070660_100018480 | 3300005339 | Bacteria | 5094 |
| 43 | Ga0070660_100568420 | 3300005339 | Bacteria | 946 |
| 44 | Ga0070689_100003115 | 3300005340 | Bacteria | 10952 |
| 45 | Ga0070689_100073841 | 3300005340 | Bacteria | 2668 |
| 46 | Ga0070689_100286677 | 3300005340 | Bacteria | 1367 |
| 47 | Ga0070691_10010007 | 3300005341 | Bacteria | 4321 |
| 48 | Ga0070687_100031653 | 3300005343 | Bacteria | 2596 |
| 49 | Ga0070687_100332402 | 3300005343 | Bacteria | 975 |
| 50 | Ga0070661_100027832 | 3300005344 | Bacteria | 4074 |
| 51 | Ga0070661_100103399 | 3300005344 | Bacteria | 2121 |
| 52 | Ga0070661_100104792 | 3300005344 | Bacteria | 2107 |
| 53 | Ga0070661_100219662 | 3300005344 | Bacteria | 1457 |
| 54 | Ga0070661_100419416 | 3300005344 | Bacteria | 1061 |
| 55 | Ga0070661_100981644 | 3300005344 | Bacteria | 700 |
| 56 | Ga0070692_10069478 | 3300005345 | Bacteria | 1874 |
| 57 | Ga0070692_10200784 | 3300005345 | Bacteria | 1168 |
| 58 | Ga0070692_10652079 | 3300005345 | Bacteria | 703 |
| 59 | Ga0070668_100105555 | 3300005347 | Bacteria | 2237 |
| 60 | Ga0070668_100181514 | 3300005347 | Bacteria | 1719 |
| 61 | Ga0070668_100369294 | 3300005347 | Bacteria | 1218 |
| 62 | Ga0070669_100048590 | 3300005353 | Bacteria | 3097 |
| 63 | Ga0070669_100058142 | 3300005353 | Bacteria | 2837 |
| 64 | Ga0070669_100078810 | 3300005353 | Bacteria | 2449 |
| 65 | Ga0070669_100383287 | 3300005353 | Bacteria | 1147 |
| 66 | Ga0070669_100405071 | 3300005353 | Bacteria | 1117 |
| 67 | Ga0070675_100005842 | 3300005354 | Bacteria | 9425 |
| 68 | Ga0070675_100006391 | 3300005354 | Bacteria | 9044 |
| 69 | Ga0070675_100047574 | 3300005354 | Bacteria | 3514 |
| 70 | Ga0070675_100210145 | 3300005354 | Bacteria | 1691 |
| 71 | Ga0070675_100349749 | 3300005354 | Bacteria | 1310 |
| 72 | Ga0070671_100039280 | 3300005355 | Bacteria | 3929 |
| 73 | Ga0070671_100963562 | 3300005355 | Bacteria | 746 |
| 74 | Ga0070674_100088400 | 3300005356 | Bacteria | 2230 |
| 75 | Ga0070674_100118798 | 3300005356 | Bacteria | 1954 |
| 76 | Ga0070674_100348960 | 3300005356 | Bacteria | 1195 |
| 77 | Ga0070673_100071236 | 3300005364 | Bacteria | 2792 |
| 78 | Ga0070673_100264780 | 3300005364 | Bacteria | 1503 |
| 79 | Ga0070673_100431638 | 3300005364 | Bacteria | 1183 |
| 80 | Ga0070688_100949521 | 3300005365 | Bacteria | 681 |
| 81 | Ga0070659_100002322 | 3300005366 | Bacteria | 13536 |
| 82 | Ga0070659_100096437 | 3300005366 | Bacteria | 2376 |
| 83 | Ga0070659_100131331 | 3300005366 | Bacteria | 2034 |
| 84 | Ga0070659_100657941 | 3300005366 | Bacteria | 903 |
| 85 | Ga0070714_100055650 | 3300005435 | Bacteria | 3382 |
| 86 | Ga0070701_10012435 | 3300005438 | Bacteria | 3840 |
| 87 | Ga0070705_100079740 | 3300005440 | Bacteria | 2006 |
| 88 | Ga0070705_100442999 | 3300005440 | Bacteria | 972 |
| 89 | Ga0070705_101243836 | 3300005440 | Bacteria | 615 |
| 90 | Ga0070700_100001013 | 3300005441 | Bacteria | 13883 |
| 91 | Ga0070700_100001626 | 3300005441 | Bacteria | 11233 |
| 92 | Ga0070700_100037435 | 3300005441 | Bacteria | 2950 |
| 93 | Ga0070700_100361951 | 3300005441 | Bacteria | 1079 |
| 94 | Ga0070700_100893846 | 3300005441 | Bacteria | 723 |
| 95 | Ga0070694_100330346 | 3300005444 | Bacteria | 1176 |
| 96 | Ga0070694_100751265 | 3300005444 | Bacteria | 797 |
| 97 | Ga0070708_100225173 | 3300005445 | Bacteria | 1759 |
| 98 | Ga0070708_101821334 | 3300005445 | Bacteria | 565 |
| 99 | Ga0070663_100000897 | 3300005455 | Bacteria | 16169 |
| 100 | Ga0070663_100013398 | 3300005455 | Bacteria | 5228 |
| 101 | Ga0070663_100458935 | 3300005455 | Bacteria | 1051 |
| 102 | Ga0070678_100136389 | 3300005456 | Bacteria | 1957 |
| 103 | Ga0070678_100188939 | 3300005456 | Bacteria | 1692 |
| 104 | Ga0070678_100620918 | 3300005456 | Bacteria | 967 |
| 105 | Ga0070662_100048307 | 3300005457 | Bacteria | 3065 |
| 106 | Ga0070662_100159915 | 3300005457 | Bacteria | 1761 |
| 107 | Ga0070662_100187204 | 3300005457 | Bacteria | 1635 |
| 108 | Ga0070662_100386031 | 3300005457 | Bacteria | 1153 |
| 109 | Ga0070681_10207473 | 3300005458 | Bacteria | 1876 |
| 110 | Ga0070681_10224667 | 3300005458 | Bacteria | 1792 |
| 111 | Ga0068867_100002101 | 3300005459 | Bacteria | 13955 |
| 112 | Ga0068867_100009745 | 3300005459 | Bacteria | 6770 |
| 113 | Ga0068867_100309570 | 3300005459 | Bacteria | 1305 |
| 114 | Ga0068867_100312800 | 3300005459 | Bacteria | 1298 |
| 115 | Ga0068867_100351852 | 3300005459 | Bacteria | 1229 |
| 116 | Ga0068867_100808652 | 3300005459 | Bacteria | 837 |
| 117 | Ga0070706_101189246 | 3300005467 | Bacteria | 701 |
| 118 | Ga0070707_100254010 | 3300005468 | Bacteria | 1711 |
| 119 | Ga0070707_100523756 | 3300005468 | Bacteria | 1147 |
| 120 | Ga0070707_100831142 | 3300005468 | Bacteria | 888 |
| 121 | Ga0070698_100221962 | 3300005471 | Bacteria | 1823 |
| 122 | Ga0070679_100042176 | 3300005530 | Bacteria | 4543 |
| 123 | Ga0070679_100067912 | 3300005530 | Bacteria | 3556 |
| 124 | Ga0070684_100077572 | 3300005535 | Bacteria | 2934 |
| 125 | Ga0070684_100186160 | 3300005535 | Bacteria | 1888 |
| 126 | Ga0070684_100563797 | 3300005535 | Bacteria | 1057 |
| 127 | Ga0070697_101195305 | 3300005536 | Bacteria | 677 |
| 128 | Ga0068853_100015533 | 3300005539 | Bacteria | 6254 |
| 129 | Ga0070672_100000154 | 3300005543 | Bacteria | 37910 |
| 130 | Ga0070672_100107999 | 3300005543 | Bacteria | 2265 |
| 131 | Ga0070672_100108456 | 3300005543 | Bacteria | 2260 |
| 132 | Ga0070672_100130225 | 3300005543 | Bacteria | 2067 |
| 133 | Ga0070672_100598836 | 3300005543 | Bacteria | 960 |
| 134 | Ga0070672_100619645 | 3300005543 | Bacteria | 943 |
| 135 | Ga0070672_100965026 | 3300005543 | Bacteria | 754 |
| 136 | Ga0070686_100740074 | 3300005544 | Bacteria | 788 |
| 137 | Ga0070695_100104227 | 3300005545 | Bacteria | 1915 |
| 138 | Ga0070695_100439022 | 3300005545 | Bacteria | 998 |
| 139 | Ga0070696_100107118 | 3300005546 | Bacteria | 2010 |
| 140 | Ga0070696_100542532 | 3300005546 | Bacteria | 931 |
| 141 | Ga0070693_100035072 | 3300005547 | Bacteria | 2780 |
| 142 | Ga0070693_100044381 | 3300005547 | Bacteria | 2515 |
| 143 | Ga0070693_100271893 | 3300005547 | Bacteria | 1131 |
| 144 | Ga0070665_100127737 | 3300005548 | Bacteria | 2545 |
| 145 | Ga0070665_100470346 | 3300005548 | Bacteria | 1267 |
| 146 | Ga0070665_101182326 | 3300005548 | Bacteria | 776 |
| 147 | Ga0070665_101191347 | 3300005548 | Bacteria | 772 |
| 148 | Ga0070704_100037606 | 3300005549 | Bacteria | 3308 |
| 149 | Ga0068855_100072560 | 3300005563 | Bacteria | 4001 |
| 150 | Ga0068855_100092098 | 3300005563 | Bacteria | 3496 |
| 151 | Ga0068855_100145416 | 3300005563 | Bacteria | 2699 |
| 152 | Ga0070664_100073204 | 3300005564 | Bacteria | 2939 |
| 153 | Ga0070664_100627791 | 3300005564 | Bacteria | 998 |
| 154 | Ga0070664_100770402 | 3300005564 | Bacteria | 899 |
| 155 | Ga0068857_100000558 | 3300005577 | Bacteria | 27209 |
| 156 | Ga0068857_100332941 | 3300005577 | Bacteria | 1403 |
| 157 | Ga0068857_100431036 | 3300005577 | Bacteria | 1230 |
| 158 | Ga0068854_100039092 | 3300005578 | Bacteria | 3340 |
| 159 | Ga0068854_100047918 | 3300005578 | Bacteria | 3047 |
| 160 | Ga0068856_100055728 | 3300005614 | Bacteria | 3901 |
| 161 | Ga0070702_100000173 | 3300005615 | Bacteria | 20607 |
| 162 | Ga0070702_100862716 | 3300005615 | Bacteria | 705 |
| 163 | Ga0068852_100013425 | 3300005616 | Bacteria | 6269 |
| 164 | Ga0068852_100069951 | 3300005616 | Bacteria | 3078 |
| 165 | Ga0068852_100128257 | 3300005616 | Bacteria | 2332 |
| 166 | Ga0068852_100375105 | 3300005616 | Bacteria | 1394 |
| 167 | Ga0068859_100026412 | 3300005617 | Bacteria | 5822 |
| 168 | Ga0068859_100075090 | 3300005617 | Bacteria | 3420 |
| 169 | Ga0068859_100184396 | 3300005617 | Bacteria | 2170 |
| 170 | Ga0068859_101043147 | 3300005617 | Bacteria | 898 |
| 171 | Ga0068864_100017918 | 3300005618 | Bacteria | 5908 |
| 172 | Ga0068864_100130611 | 3300005618 | Bacteria | 2256 |
| 173 | Ga0068864_100176894 | 3300005618 | Bacteria | 1949 |
| 174 | Ga0068864_100185170 | 3300005618 | Bacteria | 1905 |
| 175 | Ga0068864_100345607 | 3300005618 | Bacteria | 1402 |
| 176 | Ga0068866_10003085 | 3300005718 | Bacteria | 6867 |
| 177 | Ga0068866_10493581 | 3300005718 | Bacteria | 809 |
| 178 | Ga0068861_100004103 | 3300005719 | Bacteria | 9769 |
| 179 | Ga0068861_100011414 | 3300005719 | Bacteria | 6175 |
| 180 | Ga0068861_100108405 | 3300005719 | Bacteria | 2222 |
| 181 | Ga0068851_10018066 | 3300005834 | Bacteria | 3395 |
| 182 | Ga0068851_10205673 | 3300005834 | Bacteria | 1100 |
| 183 | Ga0068870_10020158 | 3300005840 | Bacteria | 3243 |
| 184 | Ga0068870_10085898 | 3300005840 | Bacteria | 1749 |
| 185 | Ga0068863_100115524 | 3300005841 | Bacteria | 2557 |
| 186 | Ga0068863_100259218 | 3300005841 | Bacteria | 1681 |
| 187 | Ga0068863_100324700 | 3300005841 | Bacteria | 1495 |
| 188 | Ga0068863_100860902 | 3300005841 | Bacteria | 905 |
| 189 | Ga0068858_100002333 | 3300005842 | Bacteria | 19189 |
| 190 | Ga0068858_100048177 | 3300005842 | Bacteria | 3949 |
| 191 | Ga0068858_100131206 | 3300005842 | Bacteria | 2350 |
| 192 | Ga0068858_100146546 | 3300005842 | Bacteria | 2217 |
| 193 | Ga0068858_101713820 | 3300005842 | Bacteria | 621 |
| 194 | Ga0068860_100029126 | 3300005843 | Bacteria | 5312 |
| 195 | Ga0068860_100108335 | 3300005843 | Bacteria | 2655 |
| 196 | Ga0068860_100209668 | 3300005843 | Bacteria | 1890 |
| 197 | Ga0068860_100463821 | 3300005843 | Bacteria | 1261 |
| 198 | Ga0068860_100542513 | 3300005843 | Bacteria | 1164 |
| 199 | Ga0068862_100020007 | 3300005844 | Bacteria | 5587 |
| 200 | Ga0068862_100045487 | 3300005844 | Bacteria | 3746 |
| 201 | Ga0068862_100264655 | 3300005844 | Bacteria | 1571 |
| 202 | Ga0081539_10000805 | 3300005985 | Bacteria | 61020 |
| 203 | Ga0070717_11359717 | 3300006028 | Bacteria | 645 |
| 204 | Ga0075365_10129415 | 3300006038 | Bacteria | 1746 |
| 205 | Ga0075365_10163399 | 3300006038 | Bacteria | 1552 |
| 206 | Ga0075368_10019417 | 3300006042 | Bacteria | 2565 |
| 207 | Ga0075363_100059522 | 3300006048 | Bacteria | 2054 |
| 208 | Ga0075363_100110547 | 3300006048 | Bacteria | 1527 |
| 209 | Ga0075364_10274643 | 3300006051 | Bacteria | 1146 |
| 210 | Ga0075432_10168524 | 3300006058 | Bacteria | 850 |
| 211 | Ga0075362_10040225 | 3300006177 | Bacteria | 2058 |
| 212 | Ga0075362_10040647 | 3300006177 | Bacteria | 2048 |
| 213 | Ga0075362_10071288 | 3300006177 | Bacteria | 1587 |
| 214 | Ga0075367_10069943 | 3300006178 | Bacteria | 2108 |
| 215 | Ga0075367_10077842 | 3300006178 | Bacteria | 2002 |
| 216 | Ga0075367_10402801 | 3300006178 | Bacteria | 865 |
| 217 | Ga0075369_10085083 | 3300006186 | Bacteria | 1406 |
| 218 | Ga0075366_10010531 | 3300006195 | Bacteria | 5193 |
| 219 | Ga0075366_10219830 | 3300006195 | Bacteria | 1157 |
| 220 | Ga0075366_10229333 | 3300006195 | Bacteria | 1131 |
| 221 | Ga0075366_10293200 | 3300006195 | Bacteria | 995 |
| 222 | Ga0075366_10335862 | 3300006195 | Bacteria | 926 |
| 223 | Ga0097621_100002521 | 3300006237 | Bacteria | 12549 |
| 224 | Ga0097621_100005330 | 3300006237 | Bacteria | 9054 |
| 225 | Ga0097621_100334140 | 3300006237 | Bacteria | 1344 |
| 226 | Ga0097621_101101722 | 3300006237 | Bacteria | 745 |
| 227 | Ga0075370_10008804 | 3300006353 | Bacteria | 5211 |
| 228 | Ga0075370_10009133 | 3300006353 | Bacteria | 5132 |
| 229 | Ga0075370_10016255 | 3300006353 | Bacteria | 4002 |
| 230 | Ga0075370_10066381 | 3300006353 | Bacteria | 2058 |
| 231 | Ga0075370_10143104 | 3300006353 | Bacteria | 1398 |
| 232 | Ga0075370_10309417 | 3300006353 | Bacteria | 940 |
| 233 | Ga0075370_10311862 | 3300006353 | Bacteria | 936 |
| 234 | Ga0075370_10461804 | 3300006353 | Bacteria | 764 |
| 235 | Ga0068871_100000683 | 3300006358 | Bacteria | 23106 |
| 236 | Ga0068871_100022193 | 3300006358 | Bacteria | 4893 |
| 237 | Ga0068871_100026023 | 3300006358 | Bacteria | 4560 |
| 238 | Ga0068871_100165018 | 3300006358 | Bacteria | 1896 |
| 239 | Ga0068871_100290551 | 3300006358 | Bacteria | 1432 |
| 240 | Ga0068871_100486646 | 3300006358 | Bacteria | 1110 |
| 241 | Ga0068871_100491909 | 3300006358 | Bacteria | 1105 |
| 242 | Ga0068871_100636532 | 3300006358 | Bacteria | 972 |
| 243 | Ga0075428_100001252 | 3300006844 | Bacteria | 27176 |
| 244 | Ga0075434_100238658 | 3300006871 | Bacteria | 1838 |
| 245 | Ga0075429_100654157 | 3300006880 | Bacteria | 921 |
| 246 | Ga0068865_100008874 | 3300006881 | Bacteria | 6219 |
| 247 | Ga0068865_100142185 | 3300006881 | Bacteria | 1810 |
| 248 | Ga0097620_100026411 | 3300006931 | Bacteria | 5822 |
| 249 | Ga0097620_100075089 | 3300006931 | Bacteria | 3420 |
| 250 | Ga0097620_100184403 | 3300006931 | Bacteria | 2170 |
| 251 | Ga0097620_101043117 | 3300006931 | Bacteria | 898 |
| 252 | Ga0099826_10000627 | 3300006948 | Bacteria | 18105 |
| 253 | Ga0099794_10014278 | 3300007265 | Bacteria | 3476 |
| 254 | Ga0105240_10009928 | 3300009093 | Bacteria | 13425 |
| 255 | Ga0105240_10013785 | 3300009093 | Bacteria | 11074 |
| 256 | Ga0111539_10001053 | 3300009094 | Bacteria | 36307 |
| 257 | Ga0105245_10000207 | 3300009098 | Bacteria | 55562 |
| 258 | Ga0105245_10024240 | 3300009098 | Bacteria | 5327 |
| 259 | Ga0105245_10133266 | 3300009098 | Bacteria | 2332 |
| 260 | Ga0105245_10621162 | 3300009098 | Bacteria | 1109 |
| 261 | Ga0105245_10782718 | 3300009098 | Bacteria | 991 |
| 262 | Ga0114129_11546520 | 3300009147 | Bacteria | 814 |
| 263 | Ga0105243_10002103 | 3300009148 | Bacteria | 16844 |
| 264 | Ga0105243_10077418 | 3300009148 | Bacteria | 2705 |
| 265 | Ga0105241_10074838 | 3300009174 | Bacteria | 2638 |
| 266 | Ga0105241_10192193 | 3300009174 | Bacteria | 1700 |
| 267 | Ga0105241_10284745 | 3300009174 | Bacteria | 1413 |
| 268 | Ga0105242_10007171 | 3300009176 | Bacteria | 8600 |
| 269 | Ga0105242_10160986 | 3300009176 | Bacteria | 1965 |
| 270 | Ga0105242_10260278 | 3300009176 | Bacteria | 1567 |
| 271 | Ga0105242_10528526 | 3300009176 | Bacteria | 1127 |
| 272 | Ga0105248_10055439 | 3300009177 | Bacteria | 4446 |
| 273 | Ga0105248_10142318 | 3300009177 | Bacteria | 2705 |
| 274 | Ga0105237_10048608 | 3300009545 | Bacteria | 4264 |
| 275 | Ga0105237_10108721 | 3300009545 | Bacteria | 2764 |
| 276 | Ga0105238_10002510 | 3300009551 | Bacteria | 18365 |
| 277 | Ga0105249_10444698 | 3300009553 | Bacteria | 1334 |
| 278 | Ga0105239_10208619 | 3300010375 | Bacteria | 2189 |
| 279 | Ga0105239_10662758 | 3300010375 | Bacteria | 1192 |
| 280 | Ga0157323_1006756 | 3300012495 | Bacteria | 810 |
| 281 | Ga0157342_1019827 | 3300012507 | Bacteria | 773 |
| 282 | Ga0157315_1012896 | 3300012508 | Bacteria | 778 |
| 283 | Ga0157373_10097612 | 3300013100 | Bacteria | 2068 |
| 284 | Ga0157371_10017872 | 3300013102 | Bacteria | 5257 |
| 285 | Ga0157371_10168550 | 3300013102 | Bacteria | 1564 |
| 286 | Ga0157371_10219499 | 3300013102 | Bacteria | 1365 |
| 287 | Ga0157371_10723699 | 3300013102 | Bacteria | 746 |
| 288 | Ga0157370_10042158 | 3300013104 | Bacteria | 4400 |
| 289 | Ga0157369_10002671 | 3300013105 | Bacteria | 21264 |
| 290 | Ga0157369_10038103 | 3300013105 | Bacteria | 5259 |
| 291 | Ga0157369_10361770 | 3300013105 | Bacteria | 1506 |
| 292 | Ga0157374_10303506 | 3300013296 | Bacteria | 1580 |
| 293 | Ga0157374_10588541 | 3300013296 | Bacteria | 1122 |
| 294 | Ga0157378_10001175 | 3300013297 | Bacteria | 23842 |
| 295 | Ga0157378_10083446 | 3300013297 | Bacteria | 2891 |
| 296 | Ga0157378_10088875 | 3300013297 | Bacteria | 2804 |
| 297 | Ga0157378_10645096 | 3300013297 | Bacteria | 1074 |
| 298 | Ga0163162_10023809 | 3300013306 | Bacteria | 6043 |
| 299 | Ga0157372_10002307 | 3300013307 | Bacteria | 20710 |
| 300 | Ga0157372_10404453 | 3300013307 | Bacteria | 1591 |
| 301 | Ga0157375_10072805 | 3300013308 | Bacteria | 3454 |
| 302 | Ga0157375_11267123 | 3300013308 | Bacteria | 866 |
| 303 | Ga0163163_10048361 | 3300014325 | Bacteria | 4182 |
| 304 | Ga0163163_10243631 | 3300014325 | Bacteria | 1848 |
| 305 | Ga0157380_10022168 | 3300014326 | Bacteria | 4776 |
| 306 | Ga0157380_10266002 | 3300014326 | Bacteria | 1560 |
| 307 | Ga0157380_11041012 | 3300014326 | Bacteria | 854 |
| 308 | Ga0157380_11225112 | 3300014326 | Bacteria | 795 |
| 309 | Ga0157377_10000028 | 3300014745 | Bacteria | 134810 |
| 310 | Ga0157377_10002002 | 3300014745 | Bacteria | 8927 |
| 311 | Ga0157379_10212765 | 3300014968 | Bacteria | 1750 |
| 312 | Ga0157379_10480078 | 3300014968 | Bacteria | 1150 |
| 313 | Ga0157379_10678428 | 3300014968 | Bacteria | 966 |
| 314 | Ga0157379_10725597 | 3300014968 | Bacteria | 934 |
| 315 | Ga0157376_10015844 | 3300014969 | Bacteria | 5706 |
| 316 | Ga0157376_10019335 | 3300014969 | Bacteria | 5247 |
| 317 | Ga0157376_10736866 | 3300014969 | Bacteria | 994 |
| 318 | Ga0157376_11276465 | 3300014969 | Bacteria | 764 |
| 319 | Ga0182005_1061473 | 3300015265 | Bacteria | 1026 |
| 320 | Ga0163161_10007457 | 3300017792 | Bacteria | 7560 |
| 321 | Ga0163161_10069457 | 3300017792 | Bacteria | 2575 |
| 322 | Ga0163161_10141302 | 3300017792 | Bacteria | 1823 |
| 323 | Ga0163161_10293938 | 3300017792 | Bacteria | 1278 |
| 324 | Ga0163161_10460615 | 3300017792 | Bacteria | 1029 |
| 325 | Ga0213871_10039446 | 3300021441 | Bacteria | 1264 |
| 326 | Ga0209784_100002 | 3300025224 | Bacteria | 1753105 |
| 327 | Ga0209566_100003 | 3300025225 | Bacteria | 1753105 |
| 328 | Ga0209674_100004 | 3300025226 | Bacteria | 1753105 |
| 329 | Ga0209563_100006 | 3300025230 | Bacteria | 1753105 |
| 330 | Ga0209677_100003 | 3300025253 | Bacteria | 1753105 |
| 331 | Ga0209565_1000083 | 3300025263 | Bacteria | 154007 |
| 332 | Ga0209673_1000323 | 3300025273 | Bacteria | 87588 |
| 333 | Ga0209673_1025863 | 3300025273 | Bacteria | 1941 |
| 334 | Ga0209130_1011590 | 3300025284 | Bacteria | 2353 |
| 335 | Ga0207673_1025731 | 3300025290 | Bacteria | 806 |
| 336 | Ga0209675_1000081 | 3300025291 | Bacteria | 154007 |
| 337 | Ga0209025_1014206 | 3300025294 | Bacteria | 4926 |
| 338 | Ga0209256_1035977 | 3300025299 | Bacteria | 1303 |
| 339 | Ga0209051_1000792 | 3300025303 | Bacteria | 33275 |
| 340 | Ga0209257_1000396 | 3300025304 | Bacteria | 86000 |
| 341 | Ga0207656_10009892 | 3300025321 | Bacteria | 3552 |
| 342 | Ga0207682_10006201 | 3300025893 | Bacteria | 4831 |
| 343 | Ga0207682_10240190 | 3300025893 | Bacteria | 842 |
| 344 | Ga0207642_10003267 | 3300025899 | Bacteria | 5096 |
| 345 | Ga0207688_10188979 | 3300025901 | Bacteria | 1231 |
| 346 | Ga0207680_10270979 | 3300025903 | Bacteria | 1177 |
| 347 | Ga0207645_10513624 | 3300025907 | Bacteria | 812 |
| 348 | Ga0207645_10836190 | 3300025907 | Bacteria | 626 |
| 349 | Ga0207643_10014328 | 3300025908 | Bacteria | 4305 |
| 350 | Ga0207643_10073364 | 3300025908 | Bacteria | 1973 |
| 351 | Ga0207705_10032664 | 3300025909 | Bacteria | 3720 |
| 352 | Ga0207705_10707257 | 3300025909 | Bacteria | 783 |
| 353 | Ga0207684_10036532 | 3300025910 | Bacteria | 4169 |
| 354 | Ga0207684_10300868 | 3300025910 | Bacteria | 1383 |
| 355 | Ga0207654_10291484 | 3300025911 | Bacteria | 1107 |
| 356 | Ga0207654_10321392 | 3300025911 | Bacteria | 1058 |
| 357 | Ga0207695_10082880 | 3300025913 | Bacteria | 3241 |
| 358 | Ga0207695_10095717 | 3300025913 | Bacteria | 2972 |
| 359 | Ga0207671_10018674 | 3300025914 | Bacteria | 5313 |
| 360 | Ga0207671_10300134 | 3300025914 | Bacteria | 1269 |
| 361 | Ga0207660_10008796 | 3300025917 | Bacteria | 6527 |
| 362 | Ga0207662_10082471 | 3300025918 | Bacteria | 1964 |
| 363 | Ga0207657_10002207 | 3300025919 | Bacteria | 21114 |
| 364 | Ga0207657_10040657 | 3300025919 | Bacteria | 4118 |
| 365 | Ga0207657_10269597 | 3300025919 | Bacteria | 1353 |
| 366 | Ga0207657_10303707 | 3300025919 | Bacteria | 1264 |
| 367 | Ga0207657_10501064 | 3300025919 | Bacteria | 951 |
| 368 | Ga0207649_10003831 | 3300025920 | Bacteria | 8200 |
| 369 | Ga0207649_10003892 | 3300025920 | Bacteria | 8146 |
| 370 | Ga0207649_10050778 | 3300025920 | Bacteria | 2566 |
| 371 | Ga0207649_10176766 | 3300025920 | Bacteria | 1491 |
| 372 | Ga0207649_10422863 | 3300025920 | Bacteria | 1001 |
| 373 | Ga0207649_10538011 | 3300025920 | Bacteria | 892 |
| 374 | Ga0207652_10103276 | 3300025921 | Bacteria | 2520 |
| 375 | Ga0207652_10109428 | 3300025921 | Bacteria | 2450 |
| 376 | Ga0207681_10039804 | 3300025923 | Bacteria | 3123 |
| 377 | Ga0207681_10047472 | 3300025923 | Bacteria | 2893 |
| 378 | Ga0207681_10279402 | 3300025923 | Bacteria | 1314 |
| 379 | Ga0207681_10502200 | 3300025923 | Bacteria | 993 |
| 380 | Ga0207694_10003525 | 3300025924 | Bacteria | 12423 |
| 381 | Ga0207694_10088490 | 3300025924 | Bacteria | 2441 |
| 382 | Ga0207694_10247799 | 3300025924 | Bacteria | 1457 |
| 383 | Ga0207650_10012426 | 3300025925 | Bacteria | 5880 |
| 384 | Ga0207650_10082048 | 3300025925 | Bacteria | 2447 |
| 385 | Ga0207650_10082222 | 3300025925 | Bacteria | 2444 |
| 386 | Ga0207650_10162131 | 3300025925 | Bacteria | 1772 |
| 387 | Ga0207650_10377205 | 3300025925 | Bacteria | 1171 |
| 388 | Ga0207650_10585714 | 3300025925 | Bacteria | 937 |
| 389 | Ga0207650_10800399 | 3300025925 | Bacteria | 799 |
| 390 | Ga0207659_10010036 | 3300025926 | Bacteria | 5931 |
| 391 | Ga0207659_10101833 | 3300025926 | Bacteria | 2167 |
| 392 | Ga0207659_10554519 | 3300025926 | Bacteria | 977 |
| 393 | Ga0207659_11010551 | 3300025926 | Bacteria | 716 |
| 394 | Ga0207687_10014724 | 3300025927 | Bacteria | 5121 |
| 395 | Ga0207687_10061275 | 3300025927 | Bacteria | 2657 |
| 396 | Ga0207687_10252630 | 3300025927 | Bacteria | 1402 |
| 397 | Ga0207687_10367460 | 3300025927 | Bacteria | 1176 |
| 398 | Ga0207687_10585471 | 3300025927 | Bacteria | 939 |
| 399 | Ga0207664_10062116 | 3300025929 | Bacteria | 2983 |
| 400 | Ga0207644_10026535 | 3300025931 | Bacteria | 3992 |
| 401 | Ga0207644_10124463 | 3300025931 | Bacteria | 1966 |
| 402 | Ga0207644_10166105 | 3300025931 | Bacteria | 1719 |
| 403 | Ga0207644_10403738 | 3300025931 | Bacteria | 1117 |
| 404 | Ga0207644_10553281 | 3300025931 | Bacteria | 952 |
| 405 | Ga0207690_10001989 | 3300025932 | Bacteria | 12520 |
| 406 | Ga0207690_10034932 | 3300025932 | Bacteria | 3242 |
| 407 | Ga0207690_10186005 | 3300025932 | Bacteria | 1567 |
| 408 | Ga0207690_10570443 | 3300025932 | Bacteria | 921 |
| 409 | Ga0207706_10162344 | 3300025933 | Bacteria | 1964 |
| 410 | Ga0207706_10205221 | 3300025933 | Bacteria | 1728 |
| 411 | Ga0207686_10000586 | 3300025934 | Bacteria | 22804 |
| 412 | Ga0207686_10408988 | 3300025934 | Bacteria | 1035 |
| 413 | Ga0207709_10024766 | 3300025935 | Bacteria | 3430 |
| 414 | Ga0207709_10055857 | 3300025935 | Bacteria | 2441 |
| 415 | Ga0207709_10162913 | 3300025935 | Bacteria | 1557 |
| 416 | Ga0207670_10009278 | 3300025936 | Bacteria | 5604 |
| 417 | Ga0207670_10242108 | 3300025936 | Bacteria | 1390 |
| 418 | Ga0207669_10031303 | 3300025937 | Bacteria | 2971 |
| 419 | Ga0207669_10055154 | 3300025937 | Bacteria | 2405 |
| 420 | Ga0207669_10103514 | 3300025937 | Bacteria | 1888 |
| 421 | Ga0207669_10120766 | 3300025937 | Bacteria | 1778 |
| 422 | Ga0207669_10140418 | 3300025937 | Bacteria | 1676 |
| 423 | Ga0207704_10000475 | 3300025938 | Bacteria | 17855 |
| 424 | Ga0207704_10044909 | 3300025938 | Bacteria | 2621 |
| 425 | Ga0207665_10331191 | 3300025939 | Bacteria | 1145 |
| 426 | Ga0207691_10001614 | 3300025940 | Bacteria | 22406 |
| 427 | Ga0207691_10004247 | 3300025940 | Bacteria | 13912 |
| 428 | Ga0207691_10368023 | 3300025940 | Bacteria | 1228 |
| 429 | Ga0207711_10038900 | 3300025941 | Bacteria | 4045 |
| 430 | Ga0207711_10145583 | 3300025941 | Bacteria | 2134 |
| 431 | Ga0207711_10344638 | 3300025941 | Bacteria | 1379 |
| 432 | Ga0207711_10628123 | 3300025941 | Bacteria | 1002 |
| 433 | Ga0207711_10671409 | 3300025941 | Bacteria | 967 |
| 434 | Ga0207711_10861009 | 3300025941 | Bacteria | 843 |
| 435 | Ga0207711_10876935 | 3300025941 | Bacteria | 835 |
| 436 | Ga0207689_10000384 | 3300025942 | Bacteria | 41557 |
| 437 | Ga0207689_10000534 | 3300025942 | Bacteria | 36072 |
| 438 | Ga0207689_10138033 | 3300025942 | Bacteria | 2008 |
| 439 | Ga0207689_10251051 | 3300025942 | Bacteria | 1463 |
| 440 | Ga0207689_10915076 | 3300025942 | Bacteria | 740 |
| 441 | Ga0207661_10293595 | 3300025944 | Bacteria | 1455 |
| 442 | Ga0207661_10364656 | 3300025944 | Bacteria | 1305 |
| 443 | Ga0207661_11110336 | 3300025944 | Bacteria | 728 |
| 444 | Ga0207679_10003662 | 3300025945 | Bacteria | 9525 |
| 445 | Ga0207679_10005080 | 3300025945 | Bacteria | 8228 |
| 446 | Ga0207679_10186070 | 3300025945 | Bacteria | 1722 |
| 447 | Ga0207679_10789566 | 3300025945 | Bacteria | 865 |
| 448 | Ga0207679_10916954 | 3300025945 | Bacteria | 802 |
| 449 | Ga0207667_10000438 | 3300025949 | Bacteria | 55784 |
| 450 | Ga0207667_10008305 | 3300025949 | Bacteria | 12353 |
| 451 | Ga0207667_10494430 | 3300025949 | Bacteria | 1241 |
| 452 | Ga0207651_10095301 | 3300025960 | Bacteria | 2191 |
| 453 | Ga0207651_10208160 | 3300025960 | Bacteria | 1572 |
| 454 | Ga0207651_10248445 | 3300025960 | Bacteria | 1454 |
| 455 | Ga0207651_10261436 | 3300025960 | Bacteria | 1421 |
| 456 | Ga0207651_10450436 | 3300025960 | Bacteria | 1104 |
| 457 | Ga0207712_10657063 | 3300025961 | Bacteria | 912 |
| 458 | Ga0207668_10003970 | 3300025972 | Bacteria | 8715 |
| 459 | Ga0207668_10229390 | 3300025972 | Bacteria | 1496 |
| 460 | Ga0207640_10291613 | 3300025981 | Bacteria | 1286 |
| 461 | Ga0207658_10034379 | 3300025986 | Bacteria | 3623 |
| 462 | Ga0207658_10506083 | 3300025986 | Bacteria | 1076 |
| 463 | Ga0207677_10001173 | 3300026023 | Bacteria | 14241 |
| 464 | Ga0207703_10001476 | 3300026035 | Bacteria | 21438 |
| 465 | Ga0207703_10084266 | 3300026035 | Bacteria | 2658 |
| 466 | Ga0207703_10243963 | 3300026035 | Bacteria | 1616 |
| 467 | Ga0207703_10654689 | 3300026035 | Bacteria | 997 |
| 468 | Ga0207703_11043595 | 3300026035 | Bacteria | 785 |
| 469 | Ga0207639_10109942 | 3300026041 | Bacteria | 2244 |
| 470 | Ga0207639_10278117 | 3300026041 | Bacteria | 1471 |
| 471 | Ga0207678_10002683 | 3300026067 | Bacteria | 16152 |
| 472 | Ga0207678_10241672 | 3300026067 | Bacteria | 1546 |
| 473 | Ga0207708_10000156 | 3300026075 | Bacteria | 54425 |
| 474 | Ga0207708_10008948 | 3300026075 | Bacteria | 7409 |
| 475 | Ga0207708_10671461 | 3300026075 | Bacteria | 884 |
| 476 | Ga0207702_10030669 | 3300026078 | Bacteria | 4480 |
| 477 | Ga0207702_10076859 | 3300026078 | Bacteria | 2886 |
| 478 | Ga0207641_10149510 | 3300026088 | Bacteria | 2114 |
| 479 | Ga0207641_10391157 | 3300026088 | Bacteria | 1333 |
| 480 | Ga0207641_10542325 | 3300026088 | Bacteria | 1133 |
| 481 | Ga0207641_10882467 | 3300026088 | Bacteria | 887 |
| 482 | Ga0207648_10000128 | 3300026089 | Bacteria | 75279 |
| 483 | Ga0207648_10007560 | 3300026089 | Bacteria | 10665 |
| 484 | Ga0207648_10165237 | 3300026089 | Bacteria | 1955 |
| 485 | Ga0207648_10268552 | 3300026089 | Bacteria | 1523 |
| 486 | Ga0207676_10024174 | 3300026095 | Bacteria | 4494 |
| 487 | Ga0207676_10051819 | 3300026095 | Bacteria | 3205 |
| 488 | Ga0207676_10149266 | 3300026095 | Bacteria | 2011 |
| 489 | Ga0207676_10322087 | 3300026095 | Bacteria | 1419 |
| 490 | Ga0207676_10341599 | 3300026095 | Bacteria | 1381 |
| 491 | Ga0207676_11204819 | 3300026095 | Bacteria | 750 |
| 492 | Ga0207674_10000049 | 3300026116 | Bacteria | 118784 |
| 493 | Ga0207674_10095721 | 3300026116 | Bacteria | 2955 |
| 494 | Ga0207674_10283708 | 3300026116 | Bacteria | 1604 |
| 495 | Ga0207675_100000408 | 3300026118 | Bacteria | 41228 |
| 496 | Ga0207675_100028763 | 3300026118 | Bacteria | 5177 |
| 497 | Ga0207675_100037952 | 3300026118 | Bacteria | 4495 |
| 498 | Ga0207675_100214198 | 3300026118 | Bacteria | 1854 |
| 499 | Ga0207683_10047530 | 3300026121 | Bacteria | 3758 |
| 500 | Ga0207683_10159917 | 3300026121 | Bacteria | 2036 |
| 501 | Ga0207683_10240655 | 3300026121 | Bacteria | 1651 |
| 502 | Ga0207698_10008396 | 3300026142 | Bacteria | 6530 |
| 503 | Ga0207698_10057764 | 3300026142 | Bacteria | 3004 |
| 504 | Ga0207698_10060781 | 3300026142 | Bacteria | 2940 |
| 505 | Ga0209282_1000790 | 3300027666 | Bacteria | 16078 |
| 506 | Ga0209813_10025009 | 3300027866 | Bacteria | 1713 |
| 507 | Ga0209974_10000975 | 3300027876 | Bacteria | 10053 |
| 508 | Ga0207428_10002514 | 3300027907 | Bacteria | 18299 |
| 509 | Ga0268265_10033020 | 3300028380 | Bacteria | 3758 |
| 510 | Ga0268264_10065291 | 3300028381 | Bacteria | 3066 |
| 511 | Ga0268264_10115379 | 3300028381 | Bacteria | 2359 |
| 512 | Ga0268264_10616801 | 3300028381 | Bacteria | 1070 |
| 513 | Ga0268264_10694281 | 3300028381 | Bacteria | 1010 |
| 514 | Ga0265318_10069406 | 3300028577 | Bacteria | 1307 |
| 515 | Ga0307517_10520958 | 3300028786 | Bacteria | 600 |
| 516 | Ga0307515_10000020 | 3300028794 | Bacteria | 411735 |
| 517 | Ga0307515_10000053 | 3300028794 | Bacteria | 266512 |
| 518 | Ga0307515_10042672 | 3300028794 | Bacteria | 7085 |
| 519 | Ga0307515_10069900 | 3300028794 | Bacteria | 4789 |
| 520 | Ga0265330_10192460 | 3300031235 | Bacteria | 863 |
| 521 | Ga0265332_10002950 | 3300031238 | Bacteria | 8366 |
| 522 | Ga0265332_10003769 | 3300031238 | Bacteria | 7247 |
| 523 | Ga0265328_10007837 | 3300031239 | Bacteria | 4437 |
| 524 | Ga0265328_10085669 | 3300031239 | Bacteria | 1163 |
| 525 | Ga0265329_10007806 | 3300031242 | Bacteria | 4106 |
| 526 | Ga0265339_10248674 | 3300031249 | Bacteria | 861 |
| 527 | Ga0265331_10002297 | 3300031250 | Bacteria | 13027 |
| 528 | Ga0265327_10056979 | 3300031251 | Bacteria | 2012 |
| 529 | Ga0265316_10075296 | 3300031344 | Bacteria | 2596 |
| 530 | Ga0307408_100000079 | 3300031548 | Bacteria | 108053 |
| 531 | Ga0307408_100000150 | 3300031548 | Bacteria | 77682 |
| 532 | Ga0307408_100278985 | 3300031548 | Bacteria | 1391 |
| 533 | Ga0307408_100589448 | 3300031548 | Bacteria | 986 |
| 534 | Ga0265313_10078034 | 3300031595 | Bacteria | 1511 |
| 535 | Ga0265314_10000245 | 3300031711 | Bacteria | 79757 |
| 536 | Ga0307516_10004922 | 3300031730 | Bacteria | 16245 |
| 537 | Ga0307516_10008436 | 3300031730 | Bacteria | 11673 |
| 538 | Ga0307405_10043771 | 3300031731 | Bacteria | 2734 |
| 539 | Ga0307405_10231616 | 3300031731 | Bacteria | 1362 |
| 540 | Ga0307405_10903352 | 3300031731 | Bacteria | 747 |
| 541 | Ga0307413_10252953 | 3300031824 | Bacteria | 1308 |
| 542 | Ga0307413_11580061 | 3300031824 | Bacteria | 582 |
| 543 | Ga0307410_10130576 | 3300031852 | Bacteria | 1845 |
| 544 | Ga0307410_10312770 | 3300031852 | Bacteria | 1243 |
| 545 | Ga0307410_10824221 | 3300031852 | Bacteria | 790 |
| 546 | Ga0307406_10134153 | 3300031901 | Bacteria | 1742 |
| 547 | Ga0307407_10294324 | 3300031903 | Bacteria | 1129 |
| 548 | Ga0307412_10261492 | 3300031911 | Bacteria | 1349 |
| 549 | Ga0307412_11109728 | 3300031911 | Bacteria | 704 |
| 550 | Ga0307412_11535167 | 3300031911 | Bacteria | 606 |
| 551 | Ga0307412_11553353 | 3300031911 | Bacteria | 603 |
| 552 | Ga0307409_100028119 | 3300031995 | Bacteria | 3999 |
| 553 | Ga0307409_100785671 | 3300031995 | Bacteria | 958 |
| 554 | Ga0307416_100001678 | 3300032002 | Bacteria | 12247 |
| 555 | Ga0307416_100121951 | 3300032002 | Bacteria | 2325 |
| 556 | Ga0307416_100478408 | 3300032002 | Bacteria | 1305 |
| 557 | Ga0307416_102035186 | 3300032002 | Bacteria | 677 |
| 558 | Ga0307411_10041715 | 3300032005 | Bacteria | 2922 |
| 559 | Ga0307411_10073333 | 3300032005 | Bacteria | 2328 |
| 560 | Ga0307411_10229697 | 3300032005 | Bacteria | 1445 |
| 561 | Ga0307415_100002191 | 3300032126 | Bacteria | 9675 |
| 562 | Ga0316583_10004293 | 3300032133 | Bacteria | 5082 |
| 563 | Ga0316583_10056414 | 3300032133 | Bacteria | 1380 |
| 564 | Ga0316593_10000016 | 3300032168 | Bacteria | 16636 |
| 565 | Ga0373950_0041931 | 3300034818 | Bacteria | 878 |
| 566 | Ga0373944_0017839 | 3300035089 | Bacteria | 2020 |
| 567 | Ga0373952_0070089 | 3300035092 | Bacteria | 875 |
| 568 | Ga0373939_0000712 | 3300035114 | Bacteria | 8237 |
| 569 | Ga0373939_0213360 | 3300035114 | Bacteria | 736 |
| 570 | Ga0373957_0182133 | 3300035120 | Bacteria | 871 |
| 571 | Ga0373943_0126701 | 3300035170 | Bacteria | 1362 |
| 572 | Ga0373943_0780671 | 3300035170 | Bacteria | 568 |
| 573 | Ga0373962_0017274 | 3300035242 | Bacteria | 1869 |
| 574 | Ga0316574_0342789 | 3300035398 | Bacteria | 946 |
| 575 | Ga0316574_0697912 | 3300035398 | Bacteria | 622 |
| 576 | Ga0373931_0001569 | 3300035691 | Bacteria | 9864 |
| 577 | Ga0373931_0023851 | 3300035691 | Bacteria | 3092 |
| 578 | Ga0373927_0012468 | 3300035695 | Bacteria | 5661 |
| 579 | Ga0373947_0337687 | 3300035725 | Bacteria | 1009 |
| 580 | Ga0373937_0056689 | 3300036401 | Bacteria | 3599 |
| 581 | Ga0316582_0064912 | 3300036647 | Bacteria | 2350 |
| 582 | Ga0316584_0374047 | 3300036712 | Bacteria | 1019 |
| 583 | Ga0395899_0003409 | 3300037312 | Bacteria | 12614 |
| 584 | Ga0395899_0004262 | 3300037312 | Bacteria | 11193 |
| 585 | Ga0395899_0074526 | 3300037312 | Bacteria | 2479 |
| 586 | Ga0395900_0006268 | 3300037418 | Bacteria | 12412 |
| 587 | Ga0395900_0007514 | 3300037418 | Bacteria | 11260 |
| 588 | Ga0395900_0020392 | 3300037418 | Bacteria | 6766 |
| 589 | Ga0395900_0071557 | 3300037418 | Bacteria | 3565 |
| 590 | Ga0395898_0223872 | 3300037466 | Bacteria | 1794 |
| 591 | Ga0395905_0008791 | 3300037471 | Bacteria | 9928 |
| 592 | Ga0395905_0011382 | 3300037471 | Bacteria | 8595 |
| 593 | Ga0395905_0085439 | 3300037471 | Bacteria | 2956 |
| 594 | Ga0395905_0095840 | 3300037471 | Bacteria | 2785 |
| 595 | Ga0395901_0030534 | 3300038443 | Bacteria | 5552 |
| 596 | Ga0395901_0192162 | 3300038443 | Bacteria | 2140 |
| 597 | Ga0395901_0230027 | 3300038443 | Bacteria | 1936 |
| 598 | Ga0436365_0129858 | 3300039437 | Bacteria | 678 |
| 599 | Ga0436360_0876667 | 3300039438 | Bacteria | 2260 |
| 600 | Ga0436361_1079523 | 3300039447 | Bacteria | 3333 |
| 601 | Ga0436363_0287192 | 3300039450 | Bacteria | 1566 |
| 602 | Ga0439436_0037891 | 3300041404 | Bacteria | 1388 |
| 603 | Ga0439438_102862 | 3300041405 | Bacteria | 692 |
| 604 | Ga0451797_0303266 | 3300041453 | Bacteria | 697 |
| 605 | Ga0451800_0102661 | 3300041459 | Bacteria | 2585 |
| 606 | Ga0451802_0250019 | 3300041460 | Bacteria | 1357 |
| 607 | Ga0451807_1061524 | 3300041486 | Bacteria | 668 |
| 608 | Ga0451833_0942535 | 3300041491 | Bacteria | 864 |
| 609 | Ga0451853_2015303 | 3300041512 | Bacteria | 1476 |
| 610 | Ga0439437_022385 | 3300042000 | Bacteria | 769 |
| 611 | Ga0439452_066766 | 3300042010 | Bacteria | 798 |
| 612 | Ga0439455_0044143 | 3300042012 | Bacteria | 1149 |
| 613 | Ga0439457_038921 | 3300042014 | Bacteria | 1058 |
| 614 | Ga0439462_0021560 | 3300042015 | Bacteria | 1683 |
| 615 | Ga0450912_006968 | 3300042116 | Bacteria | 908 |
| 616 | Ga0450914_002824 | 3300042118 | Bacteria | 1279 |
| 617 | Ga0450917_001185 | 3300042120 | Bacteria | 1891 |
| 618 | Ga0450888_016658 | 3300042126 | Bacteria | 906 |
| 619 | Ga0450890_001713 | 3300042127 | Bacteria | 3123 |
| 620 | Ga0450897_027914 | 3300042128 | Bacteria | 630 |
| 621 | Ga0450891_000222 | 3300042129 | Bacteria | 5702 |
| 622 | Ga0450892_001107 | 3300042130 | Bacteria | 2814 |
| 623 | Ga0450900_038045 | 3300042136 | Bacteria | 714 |
| 624 | Ga0450903_004539 | 3300042138 | Bacteria | 2362 |
| 625 | Ga0450889_002921 | 3300042144 | Bacteria | 1692 |
| 626 | Ga0439458_0116271 | 3300042157 | Bacteria | 702 |
| 627 | Ga0439434_0133119 | 3300042435 | Bacteria | 816 |
| 628 | Ga0439464_0008197 | 3300042439 | Bacteria | 2739 |
| 629 | Ga0450893_0000472 | 3300042532 | Bacteria | 5678 |
| 630 | Ga0451577_0004825 | 3300042876 | Bacteria | 14082 |
| 631 | Ga0451577_0033955 | 3300042876 | Bacteria | 4600 |
| 632 | Ga0451577_0288350 | 3300042876 | Bacteria | 1487 |
| 633 | Ga0466972_0465128 | 3300044658 | Bacteria | 594 |
| 634 | Ga0453683_0018925 | 3300044673 | Bacteria | 4417 |
| 635 | Ga0466965_0038442 | 3300044683 | Bacteria | 2351 |
| 636 | Ga0453684_0264124 | 3300044712 | Bacteria | 1970 |
| 637 | Ga0453684_0357023 | 3300044712 | Bacteria | 1646 |
| 638 | Ga0453684_0366454 | 3300044712 | Bacteria | 1621 |
| 639 | Ga0466957_0221821 | 3300044842 | Bacteria | 1248 |
| 640 | Ga0466959_0449112 | 3300045049 | Bacteria | 874 |
| 641 | Ga0451576_0016926 | 3300045051 | Bacteria | 8030 |
| 642 | Ga0451576_0019670 | 3300045051 | Bacteria | 7368 |
| 643 | Ga0451576_0024164 | 3300045051 | Bacteria | 6567 |
| 644 | Ga0451576_0082681 | 3300045051 | Bacteria | 3340 |
| 645 | Ga0451576_0445468 | 3300045051 | Bacteria | 1359 |
| 646 | Ga0495603_0086264 | 3300046455 | Bacteria | 1837 |
| 647 | Ga0495641_0193361 | 3300046461 | Bacteria | 912 |
| 648 | Ga0495650_0061169 | 3300046471 | Bacteria | 1509 |
| 649 | Ga0495585_0052528 | 3300046492 | Bacteria | 2256 |
| 650 | Ga0495594_0038079 | 3300046499 | Bacteria | 2624 |
| 651 | Ga0495620_0269439 | 3300046515 | Bacteria | 648 |
| 652 | Ga0495632_0067602 | 3300046519 | Bacteria | 1723 |
| 653 | Ga0495637_0002614 | 3300046520 | Bacteria | 9881 |
| 654 | Ga0495666_0012973 | 3300046526 | Bacteria | 4153 |
| 655 | Ga0495642_0082983 | 3300046528 | Bacteria | 1351 |
| 656 | Ga0495654_0000028 | 3300046530 | Bacteria | 223384 |
| 657 | Ga0495665_0031234 | 3300046531 | Bacteria | 2850 |
| 658 | Ga0495586_0028561 | 3300046535 | Bacteria | 2984 |
| 659 | Ga0495621_0009710 | 3300046539 | Bacteria | 2930 |
| 660 | Ga0495621_0151992 | 3300046539 | Bacteria | 911 |
| 661 | Ga0495622_0029717 | 3300046557 | Bacteria | 2553 |
| 662 | Ga0495622_0066417 | 3300046557 | Bacteria | 1667 |
| 663 | Ga0495656_0249160 | 3300046615 | Bacteria | 897 |
| 664 | Ga0495668_0189989 | 3300046616 | Bacteria | 1125 |
| 665 | Ga0495611_0024049 | 3300046648 | Bacteria | 2647 |
| 666 | Ga0495659_0046112 | 3300046664 | Bacteria | 1573 |
| 667 | Ga0495588_0013191 | 3300046674 | Bacteria | 3931 |
| 668 | Ga0495658_0354746 | 3300046683 | Bacteria | 932 |
| 669 | Ga0495670_0009786 | 3300046691 | Bacteria | 4712 |
| 670 | Ga0495649_0315351 | 3300046694 | Bacteria | 794 |
| 671 | Ga0495600_0362966 | 3300046809 | Bacteria | 906 |
| 672 | Ga0495581_0055134 | 3300047315 | Bacteria | 2294 |
| 673 | Ga0495636_0013522 | 3300047318 | Bacteria | 3240 |
| 674 | Ga0495676_0061436 | 3300047321 | Bacteria | 2939 |
| 675 | Ga0495685_027882 | 3300047447 | Bacteria | 1942 |
| 676 | Ga0495686_0017228 | 3300047472 | Bacteria | 4872 |
| 677 | Ga0495593_0026048 | 3300047673 | Bacteria | 3232 |
| 678 | Ga0496100_0676082 | 3300048903 | Bacteria | 805 |
| 679 | Ga0496101_0058309 | 3300048904 | Bacteria | 2796 |
| 680 | Ga0496102_0001202 | 3300048905 | Bacteria | 23500 |
| 681 | Ga0496102_0106855 | 3300048905 | Bacteria | 2605 |
| 682 | Ga0496103_0142843 | 3300048906 | Bacteria | 1531 |
| 683 | Ga0496106_0002462 | 3300048909 | Bacteria | 13800 |
| 684 | Ga0496108_0365589 | 3300048911 | Bacteria | 1259 |
| 685 | Ga0496108_0419383 | 3300048911 | Bacteria | 1169 |
| 686 | Ga0496108_0622498 | 3300048911 | Bacteria | 940 |
| 687 | Ga0496108_0848677 | 3300048911 | Bacteria | 786 |
| 688 | Ga0496109_0005271 | 3300048912 | Bacteria | 10799 |
| 689 | Ga0496109_0293672 | 3300048912 | Bacteria | 1532 |
| 690 | Ga0496110_0263748 | 3300048913 | Bacteria | 1568 |
| 691 | Ga0496111_0141391 | 3300048914 | Bacteria | 1783 |
| 692 | Ga0496112_0009106 | 3300048915 | Bacteria | 8921 |
| 693 | Ga0496113_0128291 | 3300048916 | Bacteria | 1988 |
| 694 | Ga0496115_0094186 | 3300048918 | Bacteria | 2450 |
| 695 | Ga0496125_0057066 | 3300048928 | Bacteria | 3165 |
| 696 | Ga0501306_016110 | 3300049127 | Bacteria | 1001 |
| 697 | Ga0501308_005386 | 3300049128 | Bacteria | 1272 |
| 698 | Ga0501309_000129 | 3300049129 | Bacteria | 4661 |
| 699 | Ga0501310_000219 | 3300049130 | Bacteria | 5455 |
| 700 | Ga0501310_045678 | 3300049130 | Bacteria | 622 |
| 701 | Ga0501305_000428 | 3300049161 | Bacteria | 3421 |
| 702 | Ga0501305_008856 | 3300049161 | Bacteria | 1311 |
| 703 | Ga0501305_037254 | 3300049161 | Bacteria | 780 |
| 704 | Ga0501305_055290 | 3300049161 | Bacteria | 674 |
| 705 | Ga0501307_012364 | 3300049162 | Bacteria | 1015 |
| 706 | Ga0501300_000306 | 3300049523 | Bacteria | 7395 |
| 707 | Ga0501303_001482 | 3300049526 | Bacteria | 1757 |
| 708 | Ga0501311_000655 | 3300049527 | Bacteria | 2575 |
| 709 | Ga0501312_001901 | 3300049528 | Bacteria | 2163 |
| 710 | Ga0501312_022859 | 3300049528 | Bacteria | 939 |
| 711 | Ga0501314_000050 | 3300049530 | Bacteria | 5184 |
| 712 | Ga0501315_001210 | 3300049531 | Bacteria | 2135 |
| 713 | Ga0501315_029011 | 3300049531 | Bacteria | 788 |
| 714 | Ga0501320_010532 | 3300049536 | Bacteria | 943 |
| 715 | Ga0501323_012227 | 3300049539 | Bacteria | 1046 |
| 716 | Ga0501031_0199195 | 3300049568 | Bacteria | 1307 |
| 717 | Ga0501034_0591130 | 3300049571 | Bacteria | 1016 |
| 718 | Ga0501036_0447158 | 3300049572 | Bacteria | 1077 |
| 719 | Ga0501039_0008184 | 3300049575 | Bacteria | 7972 |
| 720 | Ga0501039_0161234 | 3300049575 | Bacteria | 1763 |
| 721 | Ga0501040_0016310 | 3300049576 | Bacteria | 4915 |
| 722 | Ga0501041_0023150 | 3300049577 | Bacteria | 3725 |
| 723 | Ga0501041_0064874 | 3300049577 | Bacteria | 2236 |
| 724 | Ga0501042_0330780 | 3300049578 | Bacteria | 1101 |
| 725 | Ga0501046_0127147 | 3300049580 | Bacteria | 1935 |
| 726 | Ga0501069_0189701 | 3300049585 | Bacteria | 1189 |
| 727 | Ga0501071_0067827 | 3300049587 | Bacteria | 2595 |
| 728 | Ga0501075_0002346 | 3300049591 | Bacteria | 12571 |
| 729 | Ga0501075_0027238 | 3300049591 | Bacteria | 4211 |
| 730 | Ga0501076_0025159 | 3300049592 | Bacteria | 4605 |
| 731 | Ga0501077_0152354 | 3300049593 | Bacteria | 1467 |
| 732 | Ga0501198_000011 | 3300049649 | Bacteria | 115612 |
| 733 | Ga0501211_011925 | 3300049658 | Bacteria | 857 |
| 734 | Ga0501217_034467 | 3300049661 | Bacteria | 1263 |
| 735 | Ga0501222_000022 | 3300049662 | Bacteria | 66333 |
| 736 | Ga0501222_001428 | 3300049662 | Bacteria | 3348 |
| 737 | Ga0501223_020559 | 3300049663 | Bacteria | 1292 |
| 738 | Ga0501227_004174 | 3300049665 | Bacteria | 3107 |
| 739 | Ga0501233_003475 | 3300049668 | Bacteria | 2834 |
| 740 | Ga0501235_003946 | 3300049669 | Bacteria | 3210 |
| 741 | Ga0501242_018420 | 3300049674 | Bacteria | 887 |
| 742 | Ga0501252_013450 | 3300049682 | Bacteria | 1001 |
| 743 | Ga0501253_002263 | 3300049683 | Bacteria | 2140 |
| 744 | Ga0501253_053857 | 3300049683 | Bacteria | 850 |
| 745 | Ga0501255_001976 | 3300049684 | Bacteria | 1740 |
| 746 | Ga0501261_005934 | 3300049690 | Bacteria | 1547 |
| 747 | Ga0501221_003510 | 3300049704 | Bacteria | 2582 |
| 748 | Ga0501225_0003592 | 3300049705 | Bacteria | 4676 |
| 749 | Ga0501229_004048 | 3300049706 | Bacteria | 1773 |
| 750 | Ga0501079_0076079 | 3300049741 | Bacteria | 2596 |
| 751 | Ga0501079_0102849 | 3300049741 | Bacteria | 2215 |
| 752 | Ga0501081_0005744 | 3300049743 | Bacteria | 8034 |
| 753 | Ga0501081_0028494 | 3300049743 | Bacteria | 3769 |
| 754 | Ga0501232_002467 | 3300049757 | Bacteria | 1610 |
| 755 | Ga0501263_035200 | 3300049760 | Bacteria | 720 |
| 756 | Ga0501265_001532 | 3300049762 | Bacteria | 2603 |
| 757 | Ga0501267_000175 | 3300049764 | Bacteria | 4374 |
| 758 | Ga0501268_014923 | 3300049765 | Bacteria | 1271 |
| 759 | Ga0501269_003411 | 3300049766 | Bacteria | 1924 |
| 760 | Ga0501271_030946 | 3300049768 | Bacteria | 661 |
| 761 | Ga0501272_000642 | 3300049769 | Bacteria | 3118 |
| 762 | Ga0501280_009717 | 3300049776 | Bacteria | 1338 |
| 763 | Ga0501280_011864 | 3300049776 | Bacteria | 1220 |
| 764 | Ga0501035_0111191 | 3300049822 | Bacteria | 2401 |
| 765 | Ga0501035_0175017 | 3300049822 | Bacteria | 1852 |
| 766 | Ga0501035_0548929 | 3300049822 | Bacteria | 947 |
| 767 | Ga0501044_0181138 | 3300049823 | Bacteria | 2074 |
| 768 | nmdc:mga03683_106932_c1 | 3300050489 | Bacteria | 1234 |
| 769 | nmdc:mga03683_1268_c1 | 3300050489 | Bacteria | 7486 |
| 770 | nmdc:mga03683_54917_c1 | 3300050489 | Bacteria | 1671 |
| 771 | nmdc:mga03n38_62720_c1 | 3300050490 | Bacteria | 1697 |
| 772 | nmdc:mga00v17_308121_c1 | 3300050491 | Bacteria | 1029 |
| 773 | nmdc:mga00v17_491063_c1 | 3300050491 | Bacteria | 796 |
| 774 | nmdc:mga0yw44_25530_c1 | 3300050492 | Bacteria | 3361 |
| 775 | nmdc:mga0k408_10288_c1 | 3300050493 | Bacteria | 5056 |
| 776 | nmdc:mga0k408_15202_c1 | 3300050493 | Bacteria | 4253 |
| 777 | nmdc:mga0k408_209870_c1 | 3300050493 | Bacteria | 1163 |
| 778 | nmdc:mga0k408_25816_c1 | 3300050493 | Bacteria | 3329 |
| 779 | nmdc:mga0k408_31425_c1 | 3300050493 | Bacteria | 3031 |
| 780 | nmdc:mga0k408_88932_c1 | 3300050493 | Bacteria | 1814 |
| 781 | nmdc:mga06z11_18942_c1 | 3300050494 | Bacteria | 3155 |
| 782 | nmdc:mga06z11_296343_c1 | 3300050494 | Bacteria | 961 |
| 783 | nmdc:mga07m45_10321_c1 | 3300050496 | Bacteria | 4874 |
| 784 | nmdc:mga07m45_10713_c2 | 3300050496 | Bacteria | 4430 |
| 785 | nmdc:mga07m45_158953_c1 | 3300050496 | Bacteria | 1312 |
| 786 | nmdc:mga07m45_415493_c1 | 3300050496 | Bacteria | 781 |
| 787 | nmdc:mga07m45_65221_c1 | 3300050496 | Bacteria | 2068 |
| 788 | nmdc:mga07m45_8350_c1 | 3300050496 | Bacteria | 5319 |
| 789 | nmdc:mga07m45_8709_c1 | 3300050496 | Bacteria | 5226 |
| 790 | nmdc:mga07m45_9217_c2 | 3300050496 | Bacteria | 1212 |
| 791 | nmdc:mga05p37_1981701_c1 | 3300050507 | Bacteria | 552 |
| 792 | nmdc:mga09592_465145_c1 | 3300050508 | Bacteria | 1090 |
| 793 | nmdc:mga08y16_442125_c1 | 3300050511 | Bacteria | 1327 |
| 794 | nmdc:mga08y16_54698_c1 | 3300050511 | Bacteria | 4171 |
| 795 | nmdc:mga0a205_127418_c1 | 3300050515 | Bacteria | 761 |
| 796 | nmdc:mga0sz30_61580_c1 | 3300050516 | Bacteria | 1604 |
| 797 | Ga0500593_011050 | 3300053117 | Bacteria | 3804 |
| 798 | Ga0500634_0116238 | 3300053161 | Bacteria | 1310 |
| 799 | Ga0501084_0022989 | 3300054114 | Bacteria | 5204 |
| 800 | Ga0501084_0910955 | 3300054114 | Bacteria | 739 |
| 801 | Ga0590075_103341 | 3300059424 | Bacteria | 742 |
| 802 | Ga0587076_068227 | 3300059645 | Bacteria | 732 |
| 803 | Ga0501082_0003447 | 3300060353 | Bacteria | 13807 |
| 804 | Ga0501082_0301430 | 3300060353 | Bacteria | 1395 |
| 805 | Ga0466962_0191448 | 3300061719 | Bacteria | 998 |
| 806 | Ga0530510_0025314 | 3300061734 | Bacteria | 4242 |
| 807 | Ga0530510_0220719 | 3300061734 | Bacteria | 1409 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035120 | Ga0373957_0182133 | Ga0373957_0182133_35_490 | 110 |
| 2 | 3300035170 | Ga0373943_0780671 | Ga0373943_0780671_52_507 | 110 |
| 3 | 3300049130 | Ga0501310_045678 | Ga0501310_045678_153_611 | 111 |
| 4 | 3300049822 | Ga0501035_0175017 | Ga0501035_0175017_957_1415 | 111 |
| 5 | 3300025893 | Ga0207682_10240190 | Ga0207682_102401901 | 116 |
| 6 | 3300045049 | Ga0466959_0449112 | Ga0466959_0449112_217_705 | 116 |
| 7 | 3300049822 | Ga0501035_0548929 | Ga0501035_0548929_37_525 | 116 |
| 8 | 3300005329 | Ga0070683_101093849 | Ga0070683_1010938491 | 117 |
| 9 | 3300005330 | Ga0070690_100687208 | Ga0070690_1006872081 | 117 |
| 10 | 3300006353 | Ga0075370_10143104 | Ga0075370_101431043 | 117 |
| 11 | 3300021441 | Ga0213871_10039446 | Ga0213871_100394462 | 117 |
| 12 | 3300025942 | Ga0207689_10915076 | Ga0207689_109150761 | 117 |
| 13 | 3300025944 | Ga0207661_11110336 | Ga0207661_111103362 | 117 |
| 14 | 3300039438 | Ga0436360_0876667 | Ga0436360_0876667_315_803 | 117 |
| 15 | 3300041453 | Ga0451797_0303266 | Ga0451797_0303266_155_646 | 117 |
| 16 | 3300042876 | Ga0451577_0004825 | Ga0451577_0004825_11381_11869 | 117 |
| 17 | 3300042876 | Ga0451577_0288350 | Ga0451577_0288350_52_540 | 117 |
| 18 | 3300044712 | Ga0453684_0357023 | Ga0453684_0357023_180_668 | 117 |
| 19 | 3300045051 | Ga0451576_0016926 | Ga0451576_0016926_3213_3701 | 117 |
| 20 | 3300005353 | Ga0070669_100405071 | Ga0070669_1004050712 | 118 |
| 21 | 3300006195 | Ga0075366_10219830 | Ga0075366_102198301 | 118 |
| 22 | 3300006358 | Ga0068871_100165018 | Ga0068871_1001650182 | 118 |
| 23 | 3300013102 | Ga0157371_10219499 | Ga0157371_102194991 | 118 |
| 24 | 3300025923 | Ga0207681_10502200 | Ga0207681_105022002 | 118 |
| 25 | 3300025941 | Ga0207711_10145583 | Ga0207711_101455833 | 118 |
| 26 | 3300028794 | Ga0307515_10069900 | Ga0307515_100699004 | 118 |
| 27 | 3300031548 | Ga0307408_100000150 | Ga0307408_10000015049 | 118 |
| 28 | 3300031548 | Ga0307408_100589448 | Ga0307408_1005894482 | 118 |
| 29 | 3300032002 | Ga0307416_100478408 | Ga0307416_1004784082 | 118 |
| 30 | 3300032005 | Ga0307411_10041715 | Ga0307411_100417151 | 118 |
| 31 | 3300034818 | Ga0373950_0041931 | Ga0373950_0041931_123_611 | 118 |
| 32 | 3300035114 | Ga0373939_0000712 | Ga0373939_0000712_7476_7964 | 118 |
| 33 | 3300035691 | Ga0373931_0023851 | Ga0373931_0023851_997_1485 | 118 |
| 34 | 3300037471 | Ga0395905_0011382 | Ga0395905_0011382_4620_5108 | 118 |
| 35 | 3300042010 | Ga0439452_066766 | Ga0439452_066766_215_703 | 118 |
| 36 | 3300042012 | Ga0439455_0044143 | Ga0439455_0044143_367_855 | 118 |
| 37 | 3300042116 | Ga0450912_006968 | Ga0450912_006968_193_681 | 118 |
| 38 | 3300042120 | Ga0450917_001185 | Ga0450917_001185_742_1230 | 118 |
| 39 | 3300042126 | Ga0450888_016658 | Ga0450888_016658_131_619 | 118 |
| 40 | 3300042127 | Ga0450890_001713 | Ga0450890_001713_34_522 | 118 |
| 41 | 3300042129 | Ga0450891_000222 | Ga0450891_000222_2042_2530 | 118 |
| 42 | 3300042130 | Ga0450892_001107 | Ga0450892_001107_1905_2393 | 118 |
| 43 | 3300042136 | Ga0450900_038045 | Ga0450900_038045_17_505 | 118 |
| 44 | 3300042144 | Ga0450889_002921 | Ga0450889_002921_969_1457 | 118 |
| 45 | 3300042532 | Ga0450893_0000472 | Ga0450893_0000472_2492_2980 | 118 |
| 46 | 3300046455 | Ga0495603_0086264 | Ga0495603_0086264_729_1217 | 118 |
| 47 | 3300046557 | Ga0495622_0066417 | Ga0495622_0066417_311_799 | 118 |
| 48 | 3300046648 | Ga0495611_0024049 | Ga0495611_0024049_1269_1757 | 118 |
| 49 | 3300046664 | Ga0495659_0046112 | Ga0495659_0046112_526_1014 | 118 |
| 50 | 3300046691 | Ga0495670_0009786 | Ga0495670_0009786_2776_3264 | 118 |
| 51 | 3300047321 | Ga0495676_0061436 | Ga0495676_0061436_1409_1897 | 118 |
| 52 | 3300048905 | Ga0496102_0106855 | Ga0496102_0106855_576_1064 | 118 |
| 53 | 3300049129 | Ga0501309_000129 | Ga0501309_000129_2335_2823 | 118 |
| 54 | 3300049130 | Ga0501310_000219 | Ga0501310_000219_3129_3617 | 118 |
| 55 | 3300049161 | Ga0501305_000428 | Ga0501305_000428_1560_2048 | 118 |
| 56 | 3300049523 | Ga0501300_000306 | Ga0501300_000306_5709_6197 | 118 |
| 57 | 3300049527 | Ga0501311_000655 | Ga0501311_000655_1747_2235 | 118 |
| 58 | 3300049528 | Ga0501312_001901 | Ga0501312_001901_1060_1548 | 118 |
| 59 | 3300049530 | Ga0501314_000050 | Ga0501314_000050_1778_2266 | 118 |
| 60 | 3300049531 | Ga0501315_001210 | Ga0501315_001210_1195_1683 | 118 |
| 61 | 3300049658 | Ga0501211_011925 | Ga0501211_011925_60_548 | 118 |
| 62 | 3300049661 | Ga0501217_034467 | Ga0501217_034467_308_796 | 118 |
| 63 | 3300049663 | Ga0501223_020559 | Ga0501223_020559_81_569 | 118 |
| 64 | 3300049665 | Ga0501227_004174 | Ga0501227_004174_1474_1962 | 118 |
| 65 | 3300049668 | Ga0501233_003475 | Ga0501233_003475_518_1006 | 118 |
| 66 | 3300049669 | Ga0501235_003946 | Ga0501235_003946_659_1147 | 118 |
| 67 | 3300049674 | Ga0501242_018420 | Ga0501242_018420_137_625 | 118 |
| 68 | 3300049683 | Ga0501253_002263 | Ga0501253_002263_435_923 | 118 |
| 69 | 3300049684 | Ga0501255_001976 | Ga0501255_001976_448_936 | 118 |
| 70 | 3300049704 | Ga0501221_003510 | Ga0501221_003510_1156_1644 | 118 |
| 71 | 3300049705 | Ga0501225_0003592 | Ga0501225_0003592_1838_2326 | 118 |
| 72 | 3300049706 | Ga0501229_004048 | Ga0501229_004048_844_1332 | 118 |
| 73 | 3300049764 | Ga0501267_000175 | Ga0501267_000175_1799_2287 | 118 |
| 74 | 3300049765 | Ga0501268_014923 | Ga0501268_014923_542_1030 | 118 |
| 75 | 3300049766 | Ga0501269_003411 | Ga0501269_003411_849_1337 | 118 |
| 76 | 3300049768 | Ga0501271_030946 | Ga0501271_030946_63_551 | 118 |
| 77 | 3300049769 | Ga0501272_000642 | Ga0501272_000642_2180_2668 | 118 |
| 78 | 3300049776 | Ga0501280_009717 | Ga0501280_009717_293_781 | 118 |
| 79 | 3300050491 | nmdc:mga00v17_491063_c1 | nmdc:mga00v17_491063_c1_269_757 | 118 |
| 80 | 3300050493 | nmdc:mga0k408_25816_c1 | nmdc:mga0k408_25816_c1_1986_2474 | 118 |
| 81 | 3300050496 | nmdc:mga07m45_8350_c1 | nmdc:mga07m45_8350_c1_3172_3660 | 118 |
| 82 | 3300005337 | Ga0070682_100775143 | Ga0070682_1007751431 | 119 |
| 83 | 3300005339 | Ga0070660_100002795 | Ga0070660_1000027959 | 119 |
| 84 | 3300005344 | Ga0070661_100027832 | Ga0070661_1000278323 | 119 |
| 85 | 3300005366 | Ga0070659_100002322 | Ga0070659_1000023222 | 119 |
| 86 | 3300005457 | Ga0070662_100159915 | Ga0070662_1001599153 | 119 |
| 87 | 3300005564 | Ga0070664_100073204 | Ga0070664_1000732042 | 119 |
| 88 | 3300006028 | Ga0070717_11359717 | Ga0070717_113597171 | 119 |
| 89 | 3300025224 | Ga0209784_100002 | Ga0209784_1000021162 | 119 |
| 90 | 3300025225 | Ga0209566_100003 | Ga0209566_1000031162 | 119 |
| 91 | 3300025226 | Ga0209674_100004 | Ga0209674_1000041162 | 119 |
| 92 | 3300025230 | Ga0209563_100006 | Ga0209563_1000061162 | 119 |
| 93 | 3300025253 | Ga0209677_100003 | Ga0209677_1000031162 | 119 |
| 94 | 3300025919 | Ga0207657_10002207 | Ga0207657_1000220715 | 119 |
| 95 | 3300025920 | Ga0207649_10003831 | Ga0207649_100038316 | 119 |
| 96 | 3300025932 | Ga0207690_10001989 | Ga0207690_100019892 | 119 |
| 97 | 3300025945 | Ga0207679_10003662 | Ga0207679_100036623 | 119 |
| 98 | 3300025949 | Ga0207667_10000438 | Ga0207667_1000043841 | 119 |
| 99 | 3300037312 | Ga0395899_0003409 | Ga0395899_0003409_7407_7895 | 119 |
| 100 | 3300037312 | Ga0395899_0074526 | Ga0395899_0074526_1455_1943 | 119 |
| 101 | 3300037418 | Ga0395900_0006268 | Ga0395900_0006268_1425_1913 | 119 |
| 102 | 3300037471 | Ga0395905_0008791 | Ga0395905_0008791_8077_8565 | 119 |
| 103 | 3300039447 | Ga0436361_1079523 | Ga0436361_1079523_340_828 | 119 |
| 104 | 3300044658 | Ga0466972_0465128 | Ga0466972_0465128_70_558 | 119 |
| 105 | 3300044683 | Ga0466965_0038442 | Ga0466965_0038442_172_660 | 119 |
| 106 | 3300044712 | Ga0453684_0264124 | Ga0453684_0264124_1105_1593 | 119 |
| 107 | 3300049161 | Ga0501305_037254 | Ga0501305_037254_216_704 | 119 |
| 108 | 3300049528 | Ga0501312_022859 | Ga0501312_022859_67_555 | 119 |
| 109 | 3300049757 | Ga0501232_002467 | Ga0501232_002467_824_1312 | 119 |
| 110 | 3300059645 | Ga0587076_068227 | Ga0587076_068227_215_703 | 119 |
| 111 | 3300061719 | Ga0466962_0191448 | Ga0466962_0191448_142_630 | 119 |
| 112 | 3300003203 | JGI25406J46586_10035479 | JGI25406J46586_100354791 | 120 |
| 113 | 3300005327 | Ga0070658_10007907 | Ga0070658_100079078 | 120 |
| 114 | 3300005330 | Ga0070690_100059579 | Ga0070690_1000595792 | 120 |
| 115 | 3300005334 | Ga0068869_100254225 | Ga0068869_1002542252 | 120 |
| 116 | 3300005336 | Ga0070680_100689802 | Ga0070680_1006898022 | 120 |
| 117 | 3300005340 | Ga0070689_100073841 | Ga0070689_1000738414 | 120 |
| 118 | 3300005344 | Ga0070661_100419416 | Ga0070661_1004194162 | 120 |
| 119 | 3300005344 | Ga0070661_100981644 | Ga0070661_1009816441 | 120 |
| 120 | 3300005345 | Ga0070692_10200784 | Ga0070692_102007842 | 120 |
| 121 | 3300005444 | Ga0070694_100751265 | Ga0070694_1007512652 | 120 |
| 122 | 3300005445 | Ga0070708_100225173 | Ga0070708_1002251731 | 120 |
| 123 | 3300005445 | Ga0070708_101821334 | Ga0070708_1018213341 | 120 |
| 124 | 3300005468 | Ga0070707_100254010 | Ga0070707_1002540102 | 120 |
| 125 | 3300005468 | Ga0070707_100523756 | Ga0070707_1005237561 | 120 |
| 126 | 3300005471 | Ga0070698_100221962 | Ga0070698_1002219622 | 120 |
| 127 | 3300005546 | Ga0070696_100542532 | Ga0070696_1005425322 | 120 |
| 128 | 3300005547 | Ga0070693_100044381 | Ga0070693_1000443812 | 120 |
| 129 | 3300005547 | Ga0070693_100271893 | Ga0070693_1002718932 | 120 |
| 130 | 3300005617 | Ga0068859_100075090 | Ga0068859_1000750903 | 120 |
| 131 | 3300005985 | Ga0081539_10000805 | Ga0081539_1000080552 | 120 |
| 132 | 3300006844 | Ga0075428_100001252 | Ga0075428_10000125215 | 120 |
| 133 | 3300006881 | Ga0068865_100142185 | Ga0068865_1001421852 | 120 |
| 134 | 3300006931 | Ga0097620_100075089 | Ga0097620_1000750893 | 120 |
| 135 | 3300009093 | Ga0105240_10013785 | Ga0105240_100137859 | 120 |
| 136 | 3300009098 | Ga0105245_10782718 | Ga0105245_107827182 | 120 |
| 137 | 3300009174 | Ga0105241_10192193 | Ga0105241_101921932 | 120 |
| 138 | 3300009545 | Ga0105237_10108721 | Ga0105237_101087212 | 120 |
| 139 | 3300009551 | Ga0105238_10002510 | Ga0105238_100025103 | 120 |
| 140 | 3300012507 | Ga0157342_1019827 | Ga0157342_10198272 | 120 |
| 141 | 3300013100 | Ga0157373_10097612 | Ga0157373_100976122 | 120 |
| 142 | 3300013105 | Ga0157369_10002671 | Ga0157369_100026713 | 120 |
| 143 | 3300013307 | Ga0157372_10002307 | Ga0157372_1000230715 | 120 |
| 144 | 3300025911 | Ga0207654_10321392 | Ga0207654_103213921 | 120 |
| 145 | 3300025920 | Ga0207649_10538011 | Ga0207649_105380112 | 120 |
| 146 | 3300025927 | Ga0207687_10367460 | Ga0207687_103674602 | 120 |
| 147 | 3300025936 | Ga0207670_10242108 | Ga0207670_102421082 | 120 |
| 148 | 3300025939 | Ga0207665_10331191 | Ga0207665_103311912 | 120 |
| 149 | 3300025942 | Ga0207689_10251051 | Ga0207689_102510512 | 120 |
| 150 | 3300025960 | Ga0207651_10248445 | Ga0207651_102484452 | 120 |
| 151 | 3300026116 | Ga0207674_10283708 | Ga0207674_102837081 | 120 |
| 152 | 3300027907 | Ga0207428_10002514 | Ga0207428_100025149 | 120 |
| 153 | 3300031249 | Ga0265339_10248674 | Ga0265339_102486742 | 120 |
| 154 | 3300037312 | Ga0395899_0004262 | Ga0395899_0004262_10446_10934 | 120 |
| 155 | 3300037418 | Ga0395900_0020392 | Ga0395900_0020392_66_554 | 120 |
| 156 | 3300037466 | Ga0395898_0223872 | Ga0395898_0223872_350_838 | 120 |
| 157 | 3300038443 | Ga0395901_0030534 | Ga0395901_0030534_4379_4867 | 120 |
| 158 | 3300038443 | Ga0395901_0230027 | Ga0395901_0230027_280_768 | 120 |
| 159 | 3300041491 | Ga0451833_0942535 | Ga0451833_0942535_281_769 | 120 |
| 160 | 3300046471 | Ga0495650_0061169 | Ga0495650_0061169_290_778 | 120 |
| 161 | 3300046499 | Ga0495594_0038079 | Ga0495594_0038079_1820_2308 | 120 |
| 162 | 3300046520 | Ga0495637_0002614 | Ga0495637_0002614_1915_2403 | 120 |
| 163 | 3300046526 | Ga0495666_0012973 | Ga0495666_0012973_1333_1821 | 120 |
| 164 | 3300046528 | Ga0495642_0082983 | Ga0495642_0082983_522_1010 | 120 |
| 165 | 3300046530 | Ga0495654_0000028 | Ga0495654_0000028_119634_120122 | 120 |
| 166 | 3300046531 | Ga0495665_0031234 | Ga0495665_0031234_1734_2222 | 120 |
| 167 | 3300046535 | Ga0495586_0028561 | Ga0495586_0028561_405_893 | 120 |
| 168 | 3300046557 | Ga0495622_0029717 | Ga0495622_0029717_1746_2234 | 120 |
| 169 | 3300046674 | Ga0495588_0013191 | Ga0495588_0013191_1204_1692 | 120 |
| 170 | 3300046694 | Ga0495649_0315351 | Ga0495649_0315351_252_740 | 120 |
| 171 | 3300046809 | Ga0495600_0362966 | Ga0495600_0362966_267_755 | 120 |
| 172 | 3300047315 | Ga0495581_0055134 | Ga0495581_0055134_1129_1617 | 120 |
| 173 | 3300047318 | Ga0495636_0013522 | Ga0495636_0013522_1601_2089 | 120 |
| 174 | 3300047447 | Ga0495685_027882 | Ga0495685_027882_1077_1565 | 120 |
| 175 | 3300047673 | Ga0495593_0026048 | Ga0495593_0026048_1844_2332 | 120 |
| 176 | 3300048905 | Ga0496102_0001202 | Ga0496102_0001202_15436_15924 | 120 |
| 177 | 3300048906 | Ga0496103_0142843 | Ga0496103_0142843_324_812 | 120 |
| 178 | 3300048911 | Ga0496108_0419383 | Ga0496108_0419383_575_1066 | 120 |
| 179 | 3300048915 | Ga0496112_0009106 | Ga0496112_0009106_2019_2510 | 120 |
| 180 | 3300049536 | Ga0501320_010532 | Ga0501320_010532_11_502 | 120 |
| 181 | 3300049575 | Ga0501039_0161234 | Ga0501039_0161234_465_953 | 120 |
| 182 | 3300049577 | Ga0501041_0023150 | Ga0501041_0023150_2983_3471 | 120 |
| 183 | 3300049578 | Ga0501042_0330780 | Ga0501042_0330780_212_700 | 120 |
| 184 | 3300049585 | Ga0501069_0189701 | Ga0501069_0189701_16_513 | 120 |
| 185 | 3300049591 | Ga0501075_0027238 | Ga0501075_0027238_2221_2709 | 120 |
| 186 | 3300049592 | Ga0501076_0025159 | Ga0501076_0025159_2755_3243 | 120 |
| 187 | 3300049593 | Ga0501077_0152354 | Ga0501077_0152354_451_939 | 120 |
| 188 | 3300049741 | Ga0501079_0102849 | Ga0501079_0102849_1436_1924 | 120 |
| 189 | 3300049743 | Ga0501081_0028494 | Ga0501081_0028494_1948_2436 | 120 |
| 190 | 3300053117 | Ga0500593_011050 | Ga0500593_011050_1369_1863 | 120 |
| 191 | 3300054114 | Ga0501084_0022989 | Ga0501084_0022989_2911_3399 | 120 |
| 192 | 3300060353 | Ga0501082_0301430 | Ga0501082_0301430_402_890 | 120 |
| 193 | 3300061734 | Ga0530510_0025314 | Ga0530510_0025314_1923_2411 | 120 |
| 194 | 3300005293 | Ga0065715_10690727 | Ga0065715_106907271 | 121 |
| 195 | 3300005295 | Ga0065707_10238478 | Ga0065707_102384782 | 121 |
| 196 | 3300005328 | Ga0070676_10112979 | Ga0070676_101129792 | 121 |
| 197 | 3300005328 | Ga0070676_10760559 | Ga0070676_107605591 | 121 |
| 198 | 3300005329 | Ga0070683_100095922 | Ga0070683_1000959222 | 121 |
| 199 | 3300005330 | Ga0070690_100001009 | Ga0070690_1000010098 | 121 |
| 200 | 3300005331 | Ga0070670_100004966 | Ga0070670_1000049667 | 121 |
| 201 | 3300005331 | Ga0070670_100016506 | Ga0070670_1000165066 | 121 |
| 202 | 3300005334 | Ga0068869_100001595 | Ga0068869_1000015956 | 121 |
| 203 | 3300005334 | Ga0068869_100001619 | Ga0068869_1000016196 | 121 |
| 204 | 3300005334 | Ga0068869_100173962 | Ga0068869_1001739622 | 121 |
| 205 | 3300005336 | Ga0070680_100167657 | Ga0070680_1001676573 | 121 |
| 206 | 3300005337 | Ga0070682_100099576 | Ga0070682_1000995762 | 121 |
| 207 | 3300005338 | Ga0068868_100002256 | Ga0068868_1000022566 | 121 |
| 208 | 3300005339 | Ga0070660_100018480 | Ga0070660_1000184804 | 121 |
| 209 | 3300005340 | Ga0070689_100003115 | Ga0070689_1000031159 | 121 |
| 210 | 3300005340 | Ga0070689_100286677 | Ga0070689_1002866771 | 121 |
| 211 | 3300005341 | Ga0070691_10010007 | Ga0070691_100100073 | 121 |
| 212 | 3300005343 | Ga0070687_100332402 | Ga0070687_1003324022 | 121 |
| 213 | 3300005344 | Ga0070661_100103399 | Ga0070661_1001033994 | 121 |
| 214 | 3300005344 | Ga0070661_100104792 | Ga0070661_1001047922 | 121 |
| 215 | 3300005345 | Ga0070692_10069478 | Ga0070692_100694781 | 121 |
| 216 | 3300005345 | Ga0070692_10652079 | Ga0070692_106520791 | 121 |
| 217 | 3300005347 | Ga0070668_100105555 | Ga0070668_1001055552 | 121 |
| 218 | 3300005353 | Ga0070669_100048590 | Ga0070669_1000485902 | 121 |
| 219 | 3300005353 | Ga0070669_100058142 | Ga0070669_1000581424 | 121 |
| 220 | 3300005353 | Ga0070669_100078810 | Ga0070669_1000788102 | 121 |
| 221 | 3300005353 | Ga0070669_100383287 | Ga0070669_1003832871 | 121 |
| 222 | 3300005354 | Ga0070675_100005842 | Ga0070675_1000058429 | 121 |
| 223 | 3300005354 | Ga0070675_100006391 | Ga0070675_1000063914 | 121 |
| 224 | 3300005354 | Ga0070675_100047574 | Ga0070675_1000475742 | 121 |
| 225 | 3300005355 | Ga0070671_100039280 | Ga0070671_1000392803 | 121 |
| 226 | 3300005356 | Ga0070674_100088400 | Ga0070674_1000884002 | 121 |
| 227 | 3300005364 | Ga0070673_100071236 | Ga0070673_1000712362 | 121 |
| 228 | 3300005364 | Ga0070673_100264780 | Ga0070673_1002647802 | 121 |
| 229 | 3300005366 | Ga0070659_100096437 | Ga0070659_1000964374 | 121 |
| 230 | 3300005366 | Ga0070659_100131331 | Ga0070659_1001313312 | 121 |
| 231 | 3300005435 | Ga0070714_100055650 | Ga0070714_1000556503 | 121 |
| 232 | 3300005438 | Ga0070701_10012435 | Ga0070701_100124353 | 121 |
| 233 | 3300005440 | Ga0070705_100079740 | Ga0070705_1000797403 | 121 |
| 234 | 3300005440 | Ga0070705_101243836 | Ga0070705_1012438361 | 121 |
| 235 | 3300005441 | Ga0070700_100001013 | Ga0070700_1000010136 | 121 |
| 236 | 3300005441 | Ga0070700_100001626 | Ga0070700_1000016266 | 121 |
| 237 | 3300005441 | Ga0070700_100361951 | Ga0070700_1003619512 | 121 |
| 238 | 3300005441 | Ga0070700_100893846 | Ga0070700_1008938461 | 121 |
| 239 | 3300005444 | Ga0070694_100330346 | Ga0070694_1003303462 | 121 |
| 240 | 3300005456 | Ga0070678_100136389 | Ga0070678_1001363894 | 121 |
| 241 | 3300005456 | Ga0070678_100188939 | Ga0070678_1001889392 | 121 |
| 242 | 3300005456 | Ga0070678_100620918 | Ga0070678_1006209182 | 121 |
| 243 | 3300005457 | Ga0070662_100048307 | Ga0070662_1000483074 | 121 |
| 244 | 3300005457 | Ga0070662_100187204 | Ga0070662_1001872042 | 121 |
| 245 | 3300005458 | Ga0070681_10207473 | Ga0070681_102074734 | 121 |
| 246 | 3300005459 | Ga0068867_100009745 | Ga0068867_1000097452 | 121 |
| 247 | 3300005459 | Ga0068867_100309570 | Ga0068867_1003095702 | 121 |
| 248 | 3300005459 | Ga0068867_100312800 | Ga0068867_1003128002 | 121 |
| 249 | 3300005459 | Ga0068867_100808652 | Ga0068867_1008086522 | 121 |
| 250 | 3300005467 | Ga0070706_101189246 | Ga0070706_1011892462 | 121 |
| 251 | 3300005468 | Ga0070707_100831142 | Ga0070707_1008311422 | 121 |
| 252 | 3300005530 | Ga0070679_100042176 | Ga0070679_1000421764 | 121 |
| 253 | 3300005535 | Ga0070684_100077572 | Ga0070684_1000775722 | 121 |
| 254 | 3300005539 | Ga0068853_100015533 | Ga0068853_1000155332 | 121 |
| 255 | 3300005543 | Ga0070672_100000154 | Ga0070672_10000015419 | 121 |
| 256 | 3300005543 | Ga0070672_100130225 | Ga0070672_1001302254 | 121 |
| 257 | 3300005543 | Ga0070672_100598836 | Ga0070672_1005988362 | 121 |
| 258 | 3300005543 | Ga0070672_100619645 | Ga0070672_1006196451 | 121 |
| 259 | 3300005544 | Ga0070686_100740074 | Ga0070686_1007400742 | 121 |
| 260 | 3300005545 | Ga0070695_100104227 | Ga0070695_1001042272 | 121 |
| 261 | 3300005545 | Ga0070695_100439022 | Ga0070695_1004390222 | 121 |
| 262 | 3300005546 | Ga0070696_100107118 | Ga0070696_1001071182 | 121 |
| 263 | 3300005547 | Ga0070693_100035072 | Ga0070693_1000350723 | 121 |
| 264 | 3300005548 | Ga0070665_100127737 | Ga0070665_1001277372 | 121 |
| 265 | 3300005548 | Ga0070665_101182326 | Ga0070665_1011823262 | 121 |
| 266 | 3300005549 | Ga0070704_100037606 | Ga0070704_1000376062 | 121 |
| 267 | 3300005563 | Ga0068855_100072560 | Ga0068855_1000725603 | 121 |
| 268 | 3300005563 | Ga0068855_100145416 | Ga0068855_1001454162 | 121 |
| 269 | 3300005564 | Ga0070664_100627791 | Ga0070664_1006277912 | 121 |
| 270 | 3300005564 | Ga0070664_100770402 | Ga0070664_1007704022 | 121 |
| 271 | 3300005577 | Ga0068857_100000558 | Ga0068857_10000055824 | 121 |
| 272 | 3300005578 | Ga0068854_100039092 | Ga0068854_1000390921 | 121 |
| 273 | 3300005578 | Ga0068854_100047918 | Ga0068854_1000479184 | 121 |
| 274 | 3300005614 | Ga0068856_100055728 | Ga0068856_1000557282 | 121 |
| 275 | 3300005615 | Ga0070702_100000173 | Ga0070702_10000017314 | 121 |
| 276 | 3300005616 | Ga0068852_100013425 | Ga0068852_1000134252 | 121 |
| 277 | 3300005616 | Ga0068852_100069951 | Ga0068852_1000699514 | 121 |
| 278 | 3300005617 | Ga0068859_100026412 | Ga0068859_1000264124 | 121 |
| 279 | 3300005617 | Ga0068859_100184396 | Ga0068859_1001843963 | 121 |
| 280 | 3300005617 | Ga0068859_101043147 | Ga0068859_1010431472 | 121 |
| 281 | 3300005618 | Ga0068864_100017918 | Ga0068864_1000179184 | 121 |
| 282 | 3300005618 | Ga0068864_100130611 | Ga0068864_1001306112 | 121 |
| 283 | 3300005618 | Ga0068864_100176894 | Ga0068864_1001768943 | 121 |
| 284 | 3300005618 | Ga0068864_100345607 | Ga0068864_1003456072 | 121 |
| 285 | 3300005718 | Ga0068866_10003085 | Ga0068866_100030853 | 121 |
| 286 | 3300005718 | Ga0068866_10493581 | Ga0068866_104935812 | 121 |
| 287 | 3300005719 | Ga0068861_100004103 | Ga0068861_1000041036 | 121 |
| 288 | 3300005719 | Ga0068861_100011414 | Ga0068861_1000114143 | 121 |
| 289 | 3300005719 | Ga0068861_100108405 | Ga0068861_1001084052 | 121 |
| 290 | 3300005834 | Ga0068851_10018066 | Ga0068851_100180664 | 121 |
| 291 | 3300005840 | Ga0068870_10020158 | Ga0068870_100201584 | 121 |
| 292 | 3300005841 | Ga0068863_100115524 | Ga0068863_1001155241 | 121 |
| 293 | 3300005841 | Ga0068863_100259218 | Ga0068863_1002592182 | 121 |
| 294 | 3300005841 | Ga0068863_100324700 | Ga0068863_1003247002 | 121 |
| 295 | 3300005842 | Ga0068858_100002333 | Ga0068858_10000233314 | 121 |
| 296 | 3300005842 | Ga0068858_100048177 | Ga0068858_1000481772 | 121 |
| 297 | 3300005842 | Ga0068858_100131206 | Ga0068858_1001312062 | 121 |
| 298 | 3300005843 | Ga0068860_100029126 | Ga0068860_1000291262 | 121 |
| 299 | 3300005843 | Ga0068860_100209668 | Ga0068860_1002096682 | 121 |
| 300 | 3300005843 | Ga0068860_100463821 | Ga0068860_1004638212 | 121 |
| 301 | 3300005843 | Ga0068860_100542513 | Ga0068860_1005425132 | 121 |
| 302 | 3300005844 | Ga0068862_100020007 | Ga0068862_1000200072 | 121 |
| 303 | 3300005844 | Ga0068862_100045487 | Ga0068862_1000454873 | 121 |
| 304 | 3300005844 | Ga0068862_100264655 | Ga0068862_1002646552 | 121 |
| 305 | 3300006237 | Ga0097621_100002521 | Ga0097621_1000025212 | 121 |
| 306 | 3300006237 | Ga0097621_100005330 | Ga0097621_1000053302 | 121 |
| 307 | 3300006358 | Ga0068871_100000683 | Ga0068871_1000006832 | 121 |
| 308 | 3300006358 | Ga0068871_100022193 | Ga0068871_1000221935 | 121 |
| 309 | 3300006358 | Ga0068871_100026023 | Ga0068871_1000260234 | 121 |
| 310 | 3300006358 | Ga0068871_100491909 | Ga0068871_1004919092 | 121 |
| 311 | 3300006871 | Ga0075434_100238658 | Ga0075434_1002386582 | 121 |
| 312 | 3300006881 | Ga0068865_100008874 | Ga0068865_1000088745 | 121 |
| 313 | 3300006931 | Ga0097620_100026411 | Ga0097620_1000264113 | 121 |
| 314 | 3300006931 | Ga0097620_100184403 | Ga0097620_1001844033 | 121 |
| 315 | 3300006931 | Ga0097620_101043117 | Ga0097620_1010431172 | 121 |
| 316 | 3300007265 | Ga0099794_10014278 | Ga0099794_100142783 | 121 |
| 317 | 3300009093 | Ga0105240_10009928 | Ga0105240_100099284 | 121 |
| 318 | 3300009094 | Ga0111539_10001053 | Ga0111539_1000105314 | 121 |
| 319 | 3300009098 | Ga0105245_10000207 | Ga0105245_1000020721 | 121 |
| 320 | 3300009098 | Ga0105245_10024240 | Ga0105245_100242404 | 121 |
| 321 | 3300009098 | Ga0105245_10133266 | Ga0105245_101332663 | 121 |
| 322 | 3300009147 | Ga0114129_11546520 | Ga0114129_115465202 | 121 |
| 323 | 3300009148 | Ga0105243_10002103 | Ga0105243_100021036 | 121 |
| 324 | 3300009174 | Ga0105241_10074838 | Ga0105241_100748384 | 121 |
| 325 | 3300009176 | Ga0105242_10007171 | Ga0105242_100071713 | 121 |
| 326 | 3300009176 | Ga0105242_10160986 | Ga0105242_101609863 | 121 |
| 327 | 3300009176 | Ga0105242_10260278 | Ga0105242_102602782 | 121 |
| 328 | 3300009176 | Ga0105242_10528526 | Ga0105242_105285262 | 121 |
| 329 | 3300009177 | Ga0105248_10055439 | Ga0105248_100554394 | 121 |
| 330 | 3300009177 | Ga0105248_10142318 | Ga0105248_101423184 | 121 |
| 331 | 3300010375 | Ga0105239_10662758 | Ga0105239_106627581 | 121 |
| 332 | 3300013102 | Ga0157371_10017872 | Ga0157371_100178724 | 121 |
| 333 | 3300013102 | Ga0157371_10168550 | Ga0157371_101685503 | 121 |
| 334 | 3300013104 | Ga0157370_10042158 | Ga0157370_100421585 | 121 |
| 335 | 3300013105 | Ga0157369_10361770 | Ga0157369_103617702 | 121 |
| 336 | 3300013297 | Ga0157378_10001175 | Ga0157378_100011758 | 121 |
| 337 | 3300013297 | Ga0157378_10083446 | Ga0157378_100834463 | 121 |
| 338 | 3300013297 | Ga0157378_10088875 | Ga0157378_100888754 | 121 |
| 339 | 3300013297 | Ga0157378_10645096 | Ga0157378_106450962 | 121 |
| 340 | 3300013306 | Ga0163162_10023809 | Ga0163162_100238092 | 121 |
| 341 | 3300013308 | Ga0157375_10072805 | Ga0157375_100728054 | 121 |
| 342 | 3300014325 | Ga0163163_10048361 | Ga0163163_100483613 | 121 |
| 343 | 3300014325 | Ga0163163_10243631 | Ga0163163_102436314 | 121 |
| 344 | 3300014326 | Ga0157380_10022168 | Ga0157380_100221683 | 121 |
| 345 | 3300014745 | Ga0157377_10002002 | Ga0157377_100020025 | 121 |
| 346 | 3300014968 | Ga0157379_10212765 | Ga0157379_102127653 | 121 |
| 347 | 3300014968 | Ga0157379_10725597 | Ga0157379_107255971 | 121 |
| 348 | 3300014969 | Ga0157376_10015844 | Ga0157376_100158444 | 121 |
| 349 | 3300014969 | Ga0157376_10019335 | Ga0157376_100193355 | 121 |
| 350 | 3300017792 | Ga0163161_10007457 | Ga0163161_100074573 | 121 |
| 351 | 3300017792 | Ga0163161_10069457 | Ga0163161_100694573 | 121 |
| 352 | 3300017792 | Ga0163161_10141302 | Ga0163161_101413023 | 121 |
| 353 | 3300017792 | Ga0163161_10293938 | Ga0163161_102939382 | 121 |
| 354 | 3300025321 | Ga0207656_10009892 | Ga0207656_100098924 | 121 |
| 355 | 3300025899 | Ga0207642_10003267 | Ga0207642_100032673 | 121 |
| 356 | 3300025901 | Ga0207688_10188979 | Ga0207688_101889792 | 121 |
| 357 | 3300025907 | Ga0207645_10513624 | Ga0207645_105136242 | 121 |
| 358 | 3300025907 | Ga0207645_10836190 | Ga0207645_108361901 | 121 |
| 359 | 3300025908 | Ga0207643_10014328 | Ga0207643_100143284 | 121 |
| 360 | 3300025908 | Ga0207643_10073364 | Ga0207643_100733642 | 121 |
| 361 | 3300025909 | Ga0207705_10707257 | Ga0207705_107072571 | 121 |
| 362 | 3300025910 | Ga0207684_10036532 | Ga0207684_100365322 | 121 |
| 363 | 3300025910 | Ga0207684_10300868 | Ga0207684_103008682 | 121 |
| 364 | 3300025913 | Ga0207695_10082880 | Ga0207695_100828802 | 121 |
| 365 | 3300025914 | Ga0207671_10300134 | Ga0207671_103001342 | 121 |
| 366 | 3300025918 | Ga0207662_10082471 | Ga0207662_100824712 | 121 |
| 367 | 3300025919 | Ga0207657_10040657 | Ga0207657_100406573 | 121 |
| 368 | 3300025919 | Ga0207657_10269597 | Ga0207657_102695972 | 121 |
| 369 | 3300025920 | Ga0207649_10050778 | Ga0207649_100507784 | 121 |
| 370 | 3300025920 | Ga0207649_10176766 | Ga0207649_101767662 | 121 |
| 371 | 3300025920 | Ga0207649_10422863 | Ga0207649_104228632 | 121 |
| 372 | 3300025921 | Ga0207652_10109428 | Ga0207652_101094284 | 121 |
| 373 | 3300025923 | Ga0207681_10039804 | Ga0207681_100398042 | 121 |
| 374 | 3300025923 | Ga0207681_10047472 | Ga0207681_100474722 | 121 |
| 375 | 3300025923 | Ga0207681_10279402 | Ga0207681_102794022 | 121 |
| 376 | 3300025924 | Ga0207694_10003525 | Ga0207694_100035259 | 121 |
| 377 | 3300025924 | Ga0207694_10247799 | Ga0207694_102477992 | 121 |
| 378 | 3300025925 | Ga0207650_10082048 | Ga0207650_100820483 | 121 |
| 379 | 3300025925 | Ga0207650_10162131 | Ga0207650_101621313 | 121 |
| 380 | 3300025925 | Ga0207650_10800399 | Ga0207650_108003991 | 121 |
| 381 | 3300025926 | Ga0207659_10010036 | Ga0207659_100100362 | 121 |
| 382 | 3300025926 | Ga0207659_10101833 | Ga0207659_101018332 | 121 |
| 383 | 3300025926 | Ga0207659_11010551 | Ga0207659_110105511 | 121 |
| 384 | 3300025927 | Ga0207687_10014724 | Ga0207687_100147244 | 121 |
| 385 | 3300025927 | Ga0207687_10061275 | Ga0207687_100612752 | 121 |
| 386 | 3300025927 | Ga0207687_10585471 | Ga0207687_105854711 | 121 |
| 387 | 3300025929 | Ga0207664_10062116 | Ga0207664_100621163 | 121 |
| 388 | 3300025931 | Ga0207644_10026535 | Ga0207644_100265352 | 121 |
| 389 | 3300025931 | Ga0207644_10124463 | Ga0207644_101244632 | 121 |
| 390 | 3300025932 | Ga0207690_10034932 | Ga0207690_100349322 | 121 |
| 391 | 3300025932 | Ga0207690_10186005 | Ga0207690_101860052 | 121 |
| 392 | 3300025933 | Ga0207706_10162344 | Ga0207706_101623443 | 121 |
| 393 | 3300025933 | Ga0207706_10205221 | Ga0207706_102052212 | 121 |
| 394 | 3300025934 | Ga0207686_10000586 | Ga0207686_100005866 | 121 |
| 395 | 3300025934 | Ga0207686_10408988 | Ga0207686_104089882 | 121 |
| 396 | 3300025935 | Ga0207709_10055857 | Ga0207709_100558573 | 121 |
| 397 | 3300025936 | Ga0207670_10009278 | Ga0207670_100092784 | 121 |
| 398 | 3300025937 | Ga0207669_10031303 | Ga0207669_100313032 | 121 |
| 399 | 3300025937 | Ga0207669_10055154 | Ga0207669_100551542 | 121 |
| 400 | 3300025937 | Ga0207669_10140418 | Ga0207669_101404181 | 121 |
| 401 | 3300025938 | Ga0207704_10000475 | Ga0207704_1000047513 | 121 |
| 402 | 3300025940 | Ga0207691_10001614 | Ga0207691_100016142 | 121 |
| 403 | 3300025940 | Ga0207691_10004247 | Ga0207691_100042474 | 121 |
| 404 | 3300025940 | Ga0207691_10368023 | Ga0207691_103680232 | 121 |
| 405 | 3300025941 | Ga0207711_10038900 | Ga0207711_100389004 | 121 |
| 406 | 3300025941 | Ga0207711_10344638 | Ga0207711_103446381 | 121 |
| 407 | 3300025941 | Ga0207711_10628123 | Ga0207711_106281232 | 121 |
| 408 | 3300025941 | Ga0207711_10861009 | Ga0207711_108610092 | 121 |
| 409 | 3300025941 | Ga0207711_10876935 | Ga0207711_108769352 | 121 |
| 410 | 3300025942 | Ga0207689_10000384 | Ga0207689_1000038434 | 121 |
| 411 | 3300025942 | Ga0207689_10000534 | Ga0207689_1000053430 | 121 |
| 412 | 3300025942 | Ga0207689_10138033 | Ga0207689_101380332 | 121 |
| 413 | 3300025944 | Ga0207661_10364656 | Ga0207661_103646562 | 121 |
| 414 | 3300025945 | Ga0207679_10005080 | Ga0207679_100050802 | 121 |
| 415 | 3300025945 | Ga0207679_10186070 | Ga0207679_101860702 | 121 |
| 416 | 3300025945 | Ga0207679_10916954 | Ga0207679_109169542 | 121 |
| 417 | 3300025949 | Ga0207667_10008305 | Ga0207667_100083054 | 121 |
| 418 | 3300025960 | Ga0207651_10095301 | Ga0207651_100953012 | 121 |
| 419 | 3300025960 | Ga0207651_10261436 | Ga0207651_102614361 | 121 |
| 420 | 3300025960 | Ga0207651_10450436 | Ga0207651_104504362 | 121 |
| 421 | 3300025972 | Ga0207668_10003970 | Ga0207668_100039707 | 121 |
| 422 | 3300025972 | Ga0207668_10229390 | Ga0207668_102293902 | 121 |
| 423 | 3300025986 | Ga0207658_10506083 | Ga0207658_105060832 | 121 |
| 424 | 3300026023 | Ga0207677_10001173 | Ga0207677_1000117315 | 121 |
| 425 | 3300026035 | Ga0207703_10001476 | Ga0207703_1000147615 | 121 |
| 426 | 3300026035 | Ga0207703_10084266 | Ga0207703_100842662 | 121 |
| 427 | 3300026035 | Ga0207703_10654689 | Ga0207703_106546892 | 121 |
| 428 | 3300026035 | Ga0207703_11043595 | Ga0207703_110435952 | 121 |
| 429 | 3300026041 | Ga0207639_10109942 | Ga0207639_101099423 | 121 |
| 430 | 3300026067 | Ga0207678_10241672 | Ga0207678_102416722 | 121 |
| 431 | 3300026075 | Ga0207708_10000156 | Ga0207708_1000015630 | 121 |
| 432 | 3300026075 | Ga0207708_10008948 | Ga0207708_100089487 | 121 |
| 433 | 3300026075 | Ga0207708_10671461 | Ga0207708_106714612 | 121 |
| 434 | 3300026078 | Ga0207702_10030669 | Ga0207702_100306695 | 121 |
| 435 | 3300026088 | Ga0207641_10149510 | Ga0207641_101495102 | 121 |
| 436 | 3300026088 | Ga0207641_10391157 | Ga0207641_103911571 | 121 |
| 437 | 3300026088 | Ga0207641_10542325 | Ga0207641_105423252 | 121 |
| 438 | 3300026089 | Ga0207648_10000128 | Ga0207648_100001287 | 121 |
| 439 | 3300026089 | Ga0207648_10165237 | Ga0207648_101652373 | 121 |
| 440 | 3300026089 | Ga0207648_10268552 | Ga0207648_102685522 | 121 |
| 441 | 3300026095 | Ga0207676_10024174 | Ga0207676_100241744 | 121 |
| 442 | 3300026095 | Ga0207676_10051819 | Ga0207676_100518194 | 121 |
| 443 | 3300026095 | Ga0207676_10322087 | Ga0207676_103220872 | 121 |
| 444 | 3300026095 | Ga0207676_10341599 | Ga0207676_103415992 | 121 |
| 445 | 3300026095 | Ga0207676_11204819 | Ga0207676_112048191 | 121 |
| 446 | 3300026116 | Ga0207674_10000049 | Ga0207674_1000004962 | 121 |
| 447 | 3300026118 | Ga0207675_100000408 | Ga0207675_10000040833 | 121 |
| 448 | 3300026118 | Ga0207675_100028763 | Ga0207675_1000287633 | 121 |
| 449 | 3300026118 | Ga0207675_100037952 | Ga0207675_1000379523 | 121 |
| 450 | 3300026118 | Ga0207675_100214198 | Ga0207675_1002141982 | 121 |
| 451 | 3300026121 | Ga0207683_10047530 | Ga0207683_100475304 | 121 |
| 452 | 3300026121 | Ga0207683_10159917 | Ga0207683_101599172 | 121 |
| 453 | 3300026121 | Ga0207683_10240655 | Ga0207683_102406552 | 121 |
| 454 | 3300026142 | Ga0207698_10008396 | Ga0207698_100083963 | 121 |
| 455 | 3300026142 | Ga0207698_10057764 | Ga0207698_100577644 | 121 |
| 456 | 3300028380 | Ga0268265_10033020 | Ga0268265_100330202 | 121 |
| 457 | 3300028381 | Ga0268264_10115379 | Ga0268264_101153792 | 121 |
| 458 | 3300028381 | Ga0268264_10616801 | Ga0268264_106168012 | 121 |
| 459 | 3300028381 | Ga0268264_10694281 | Ga0268264_106942812 | 121 |
| 460 | 3300028577 | Ga0265318_10069406 | Ga0265318_100694062 | 121 |
| 461 | 3300028794 | Ga0307515_10042672 | Ga0307515_100426726 | 121 |
| 462 | 3300031235 | Ga0265330_10192460 | Ga0265330_101924601 | 121 |
| 463 | 3300031238 | Ga0265332_10002950 | Ga0265332_100029507 | 121 |
| 464 | 3300031238 | Ga0265332_10003769 | Ga0265332_100037694 | 121 |
| 465 | 3300031239 | Ga0265328_10007837 | Ga0265328_100078372 | 121 |
| 466 | 3300031239 | Ga0265328_10085669 | Ga0265328_100856692 | 121 |
| 467 | 3300031242 | Ga0265329_10007806 | Ga0265329_100078063 | 121 |
| 468 | 3300031250 | Ga0265331_10002297 | Ga0265331_1000229710 | 121 |
| 469 | 3300031251 | Ga0265327_10056979 | Ga0265327_100569792 | 121 |
| 470 | 3300031344 | Ga0265316_10075296 | Ga0265316_100752964 | 121 |
| 471 | 3300031548 | Ga0307408_100000079 | Ga0307408_10000007950 | 121 |
| 472 | 3300031595 | Ga0265313_10078034 | Ga0265313_100780342 | 121 |
| 473 | 3300031711 | Ga0265314_10000245 | Ga0265314_1000024541 | 121 |
| 474 | 3300031824 | Ga0307413_10252953 | Ga0307413_102529532 | 121 |
| 475 | 3300031852 | Ga0307410_10312770 | Ga0307410_103127702 | 121 |
| 476 | 3300031911 | Ga0307412_11109728 | Ga0307412_111097282 | 121 |
| 477 | 3300031911 | Ga0307412_11553353 | Ga0307412_115533531 | 121 |
| 478 | 3300031995 | Ga0307409_100785671 | Ga0307409_1007856712 | 121 |
| 479 | 3300032133 | Ga0316583_10004293 | Ga0316583_100042933 | 121 |
| 480 | 3300032133 | Ga0316583_10056414 | Ga0316583_100564142 | 121 |
| 481 | 3300032168 | Ga0316593_10000016 | Ga0316593_100000166 | 121 |
| 482 | 3300035092 | Ga0373952_0070089 | Ga0373952_0070089_184_681 | 121 |
| 483 | 3300035114 | Ga0373939_0213360 | Ga0373939_0213360_219_710 | 121 |
| 484 | 3300035170 | Ga0373943_0126701 | Ga0373943_0126701_483_980 | 121 |
| 485 | 3300035242 | Ga0373962_0017274 | Ga0373962_0017274_1036_1533 | 121 |
| 486 | 3300035398 | Ga0316574_0342789 | Ga0316574_0342789_385_873 | 121 |
| 487 | 3300035398 | Ga0316574_0697912 | Ga0316574_0697912_40_528 | 121 |
| 488 | 3300035725 | Ga0373947_0337687 | Ga0373947_0337687_265_762 | 121 |
| 489 | 3300036401 | Ga0373937_0056689 | Ga0373937_0056689_2625_3122 | 121 |
| 490 | 3300036647 | Ga0316582_0064912 | Ga0316582_0064912_849_1337 | 121 |
| 491 | 3300036712 | Ga0316584_0374047 | Ga0316584_0374047_109_597 | 121 |
| 492 | 3300039437 | Ga0436365_0129858 | Ga0436365_0129858_17_514 | 121 |
| 493 | 3300039450 | Ga0436363_0287192 | Ga0436363_0287192_817_1314 | 121 |
| 494 | 3300046492 | Ga0495585_0052528 | Ga0495585_0052528_171_680 | 121 |
| 495 | 3300046615 | Ga0495656_0249160 | Ga0495656_0249160_278_784 | 121 |
| 496 | 3300046616 | Ga0495668_0189989 | Ga0495668_0189989_304_813 | 121 |
| 497 | 3300048903 | Ga0496100_0676082 | Ga0496100_0676082_112_609 | 121 |
| 498 | 3300048904 | Ga0496101_0058309 | Ga0496101_0058309_1125_1622 | 121 |
| 499 | 3300048909 | Ga0496106_0002462 | Ga0496106_0002462_9715_10212 | 121 |
| 500 | 3300048911 | Ga0496108_0622498 | Ga0496108_0622498_191_682 | 121 |
| 501 | 3300048914 | Ga0496111_0141391 | Ga0496111_0141391_792_1289 | 121 |
| 502 | 3300048916 | Ga0496113_0128291 | Ga0496113_0128291_1417_1914 | 121 |
| 503 | 3300048918 | Ga0496115_0094186 | Ga0496115_0094186_1099_1596 | 121 |
| 504 | 3300048928 | Ga0496125_0057066 | Ga0496125_0057066_1468_1977 | 121 |
| 505 | 3300049128 | Ga0501308_005386 | Ga0501308_005386_420_917 | 121 |
| 506 | 3300049571 | Ga0501034_0591130 | Ga0501034_0591130_185_676 | 121 |
| 507 | 3300049575 | Ga0501039_0008184 | Ga0501039_0008184_5535_6062 | 121 |
| 508 | 3300049576 | Ga0501040_0016310 | Ga0501040_0016310_46_573 | 121 |
| 509 | 3300049577 | Ga0501041_0064874 | Ga0501041_0064874_260_787 | 121 |
| 510 | 3300049580 | Ga0501046_0127147 | Ga0501046_0127147_491_1018 | 121 |
| 511 | 3300049587 | Ga0501071_0067827 | Ga0501071_0067827_1191_1718 | 121 |
| 512 | 3300049591 | Ga0501075_0002346 | Ga0501075_0002346_6183_6710 | 121 |
| 513 | 3300049741 | Ga0501079_0076079 | Ga0501079_0076079_1668_2171 | 121 |
| 514 | 3300049743 | Ga0501081_0005744 | Ga0501081_0005744_4305_4832 | 121 |
| 515 | 3300050493 | nmdc:mga0k408_209870_c1 | nmdc:mga0k408_209870_c1_26_523 | 121 |
| 516 | 3300050507 | nmdc:mga05p37_1981701_c1 | nmdc:mga05p37_1981701_c1_11_502 | 121 |
| 517 | 3300050511 | nmdc:mga08y16_54698_c1 | nmdc:mga08y16_54698_c1_1748_2251 | 121 |
| 518 | 3300050515 | nmdc:mga0a205_127418_c1 | nmdc:mga0a205_127418_c1_248_739 | 121 |
| 519 | 3300054114 | Ga0501084_0910955 | Ga0501084_0910955_195_722 | 121 |
| 520 | 3300059424 | Ga0590075_103341 | Ga0590075_103341_174_692 | 121 |
| 521 | 3300060353 | Ga0501082_0003447 | Ga0501082_0003447_10105_10632 | 121 |
| 522 | 3300061734 | Ga0530510_0220719 | Ga0530510_0220719_406_933 | 121 |
| 523 | 3300005327 | Ga0070658_10194872 | Ga0070658_101948722 | 122 |
| 524 | 3300005335 | Ga0070666_10359709 | Ga0070666_103597092 | 122 |
| 525 | 3300005356 | Ga0070674_100348960 | Ga0070674_1003489602 | 122 |
| 526 | 3300006880 | Ga0075429_100654157 | Ga0075429_1006541572 | 122 |
| 527 | 3300009098 | Ga0105245_10621162 | Ga0105245_106211622 | 122 |
| 528 | 3300009553 | Ga0105249_10444698 | Ga0105249_104446982 | 122 |
| 529 | 3300013296 | Ga0157374_10588541 | Ga0157374_105885412 | 122 |
| 530 | 3300014326 | Ga0157380_11225112 | Ga0157380_112251122 | 122 |
| 531 | 3300025927 | Ga0207687_10252630 | Ga0207687_102526302 | 122 |
| 532 | 3300031548 | Ga0307408_100278985 | Ga0307408_1002789851 | 122 |
| 533 | 3300031824 | Ga0307413_11580061 | Ga0307413_115800611 | 122 |
| 534 | 3300031852 | Ga0307410_10824221 | Ga0307410_108242212 | 122 |
| 535 | 3300031911 | Ga0307412_10261492 | Ga0307412_102614922 | 122 |
| 536 | 3300032002 | Ga0307416_100121951 | Ga0307416_1001219512 | 122 |
| 537 | 3300032005 | Ga0307411_10229697 | Ga0307411_102296972 | 122 |
| 538 | 3300035691 | Ga0373931_0001569 | Ga0373931_0001569_1282_1794 | 122 |
| 539 | 3300035695 | Ga0373927_0012468 | Ga0373927_0012468_867_1358 | 122 |
| 540 | 3300037418 | Ga0395900_0071557 | Ga0395900_0071557_3000_3530 | 122 |
| 541 | 3300041405 | Ga0439438_102862 | Ga0439438_102862_24_545 | 122 |
| 542 | 3300042015 | Ga0439462_0021560 | Ga0439462_0021560_257_781 | 122 |
| 543 | 3300042128 | Ga0450897_027914 | Ga0450897_027914_10_501 | 122 |
| 544 | 3300045051 | Ga0451576_0445468 | Ga0451576_0445468_195_719 | 122 |
| 545 | 3300046539 | Ga0495621_0009710 | Ga0495621_0009710_2139_2636 | 122 |
| 546 | 3300046539 | Ga0495621_0151992 | Ga0495621_0151992_229_750 | 122 |
| 547 | 3300049161 | Ga0501305_055290 | Ga0501305_055290_105_632 | 122 |
| 548 | 3300049526 | Ga0501303_001482 | Ga0501303_001482_1114_1605 | 122 |
| 549 | 3300049649 | Ga0501198_000011 | Ga0501198_000011_60713_61204 | 122 |
| 550 | 3300049662 | Ga0501222_000022 | Ga0501222_000022_60903_61394 | 122 |
| 551 | 3300049662 | Ga0501222_001428 | Ga0501222_001428_1197_1694 | 122 |
| 552 | 3300049683 | Ga0501253_053857 | Ga0501253_053857_202_693 | 122 |
| 553 | 3300049762 | Ga0501265_001532 | Ga0501265_001532_878_1369 | 122 |
| 554 | 3300049776 | Ga0501280_011864 | Ga0501280_011864_598_1095 | 122 |
| 555 | 3300050508 | nmdc:mga09592_465145_c1 | nmdc:mga09592_465145_c1_148_672 | 122 |
| 556 | 3300003305 | Ga0006770J48903_1097331 | Ga0006770J48903_10973312 | 123 |
| 557 | 3300005327 | Ga0070658_10059634 | Ga0070658_100596344 | 123 |
| 558 | 3300005327 | Ga0070658_10073249 | Ga0070658_100732492 | 123 |
| 559 | 3300005329 | Ga0070683_100220075 | Ga0070683_1002200752 | 123 |
| 560 | 3300005331 | Ga0070670_100103183 | Ga0070670_1001031832 | 123 |
| 561 | 3300005331 | Ga0070670_100370603 | Ga0070670_1003706032 | 123 |
| 562 | 3300005333 | Ga0070677_10012244 | Ga0070677_100122442 | 123 |
| 563 | 3300005335 | Ga0070666_10212595 | Ga0070666_102125952 | 123 |
| 564 | 3300005335 | Ga0070666_10372979 | Ga0070666_103729792 | 123 |
| 565 | 3300005343 | Ga0070687_100031653 | Ga0070687_1000316533 | 123 |
| 566 | 3300005344 | Ga0070661_100219662 | Ga0070661_1002196622 | 123 |
| 567 | 3300005347 | Ga0070668_100369294 | Ga0070668_1003692942 | 123 |
| 568 | 3300005354 | Ga0070675_100210145 | Ga0070675_1002101452 | 123 |
| 569 | 3300005356 | Ga0070674_100118798 | Ga0070674_1001187983 | 123 |
| 570 | 3300005365 | Ga0070688_100949521 | Ga0070688_1009495211 | 123 |
| 571 | 3300005366 | Ga0070659_100657941 | Ga0070659_1006579412 | 123 |
| 572 | 3300005441 | Ga0070700_100037435 | Ga0070700_1000374352 | 123 |
| 573 | 3300005455 | Ga0070663_100000897 | Ga0070663_1000008976 | 123 |
| 574 | 3300005455 | Ga0070663_100458935 | Ga0070663_1004589351 | 123 |
| 575 | 3300005457 | Ga0070662_100386031 | Ga0070662_1003860312 | 123 |
| 576 | 3300005458 | Ga0070681_10224667 | Ga0070681_102246672 | 123 |
| 577 | 3300005459 | Ga0068867_100351852 | Ga0068867_1003518522 | 123 |
| 578 | 3300005530 | Ga0070679_100067912 | Ga0070679_1000679123 | 123 |
| 579 | 3300005535 | Ga0070684_100186160 | Ga0070684_1001861602 | 123 |
| 580 | 3300005543 | Ga0070672_100107999 | Ga0070672_1001079992 | 123 |
| 581 | 3300005543 | Ga0070672_100108456 | Ga0070672_1001084562 | 123 |
| 582 | 3300005543 | Ga0070672_100965026 | Ga0070672_1009650262 | 123 |
| 583 | 3300005548 | Ga0070665_100470346 | Ga0070665_1004703462 | 123 |
| 584 | 3300005548 | Ga0070665_101191347 | Ga0070665_1011913472 | 123 |
| 585 | 3300005577 | Ga0068857_100332941 | Ga0068857_1003329412 | 123 |
| 586 | 3300005577 | Ga0068857_100431036 | Ga0068857_1004310362 | 123 |
| 587 | 3300005615 | Ga0070702_100862716 | Ga0070702_1008627161 | 123 |
| 588 | 3300005616 | Ga0068852_100128257 | Ga0068852_1001282574 | 123 |
| 589 | 3300005616 | Ga0068852_100375105 | Ga0068852_1003751053 | 123 |
| 590 | 3300005618 | Ga0068864_100185170 | Ga0068864_1001851702 | 123 |
| 591 | 3300005834 | Ga0068851_10205673 | Ga0068851_102056732 | 123 |
| 592 | 3300005840 | Ga0068870_10085898 | Ga0068870_100858982 | 123 |
| 593 | 3300005841 | Ga0068863_100860902 | Ga0068863_1008609022 | 123 |
| 594 | 3300005842 | Ga0068858_100146546 | Ga0068858_1001465462 | 123 |
| 595 | 3300005842 | Ga0068858_101713820 | Ga0068858_1017138201 | 123 |
| 596 | 3300005843 | Ga0068860_100108335 | Ga0068860_1001083352 | 123 |
| 597 | 3300006195 | Ga0075366_10293200 | Ga0075366_102932001 | 123 |
| 598 | 3300006237 | Ga0097621_100334140 | Ga0097621_1003341402 | 123 |
| 599 | 3300006237 | Ga0097621_101101722 | Ga0097621_1011017221 | 123 |
| 600 | 3300006358 | Ga0068871_100290551 | Ga0068871_1002905513 | 123 |
| 601 | 3300006358 | Ga0068871_100486646 | Ga0068871_1004866461 | 123 |
| 602 | 3300006358 | Ga0068871_100636532 | Ga0068871_1006365322 | 123 |
| 603 | 3300009174 | Ga0105241_10284745 | Ga0105241_102847452 | 123 |
| 604 | 3300012508 | Ga0157315_1012896 | Ga0157315_10128962 | 123 |
| 605 | 3300013102 | Ga0157371_10723699 | Ga0157371_107236991 | 123 |
| 606 | 3300013105 | Ga0157369_10038103 | Ga0157369_100381033 | 123 |
| 607 | 3300013296 | Ga0157374_10303506 | Ga0157374_103035062 | 123 |
| 608 | 3300013307 | Ga0157372_10404453 | Ga0157372_104044532 | 123 |
| 609 | 3300013308 | Ga0157375_11267123 | Ga0157375_112671231 | 123 |
| 610 | 3300014326 | Ga0157380_10266002 | Ga0157380_102660022 | 123 |
| 611 | 3300014326 | Ga0157380_11041012 | Ga0157380_110410122 | 123 |
| 612 | 3300014968 | Ga0157379_10480078 | Ga0157379_104800782 | 123 |
| 613 | 3300014968 | Ga0157379_10678428 | Ga0157379_106784282 | 123 |
| 614 | 3300014969 | Ga0157376_10736866 | Ga0157376_107368661 | 123 |
| 615 | 3300014969 | Ga0157376_11276465 | Ga0157376_112764652 | 123 |
| 616 | 3300015265 | Ga0182005_1061473 | Ga0182005_10614732 | 123 |
| 617 | 3300017792 | Ga0163161_10460615 | Ga0163161_104606152 | 123 |
| 618 | 3300025273 | Ga0209673_1025863 | Ga0209673_10258631 | 123 |
| 619 | 3300025290 | Ga0207673_1025731 | Ga0207673_10257311 | 123 |
| 620 | 3300025303 | Ga0209051_1000792 | Ga0209051_10007924 | 123 |
| 621 | 3300025304 | Ga0209257_1000396 | Ga0209257_10003969 | 123 |
| 622 | 3300025903 | Ga0207680_10270979 | Ga0207680_102709792 | 123 |
| 623 | 3300025909 | Ga0207705_10032664 | Ga0207705_100326643 | 123 |
| 624 | 3300025917 | Ga0207660_10008796 | Ga0207660_100087965 | 123 |
| 625 | 3300025919 | Ga0207657_10303707 | Ga0207657_103037072 | 123 |
| 626 | 3300025919 | Ga0207657_10501064 | Ga0207657_105010641 | 123 |
| 627 | 3300025920 | Ga0207649_10003892 | Ga0207649_100038923 | 123 |
| 628 | 3300025921 | Ga0207652_10103276 | Ga0207652_101032763 | 123 |
| 629 | 3300025924 | Ga0207694_10088490 | Ga0207694_100884902 | 123 |
| 630 | 3300025925 | Ga0207650_10012426 | Ga0207650_100124263 | 123 |
| 631 | 3300025925 | Ga0207650_10585714 | Ga0207650_105857141 | 123 |
| 632 | 3300025926 | Ga0207659_10554519 | Ga0207659_105545191 | 123 |
| 633 | 3300025931 | Ga0207644_10166105 | Ga0207644_101661052 | 123 |
| 634 | 3300025931 | Ga0207644_10403738 | Ga0207644_104037381 | 123 |
| 635 | 3300025931 | Ga0207644_10553281 | Ga0207644_105532812 | 123 |
| 636 | 3300025932 | Ga0207690_10570443 | Ga0207690_105704432 | 123 |
| 637 | 3300025937 | Ga0207669_10103514 | Ga0207669_101035142 | 123 |
| 638 | 3300025937 | Ga0207669_10120766 | Ga0207669_101207662 | 123 |
| 639 | 3300025938 | Ga0207704_10044909 | Ga0207704_100449093 | 123 |
| 640 | 3300025941 | Ga0207711_10671409 | Ga0207711_106714092 | 123 |
| 641 | 3300025944 | Ga0207661_10293595 | Ga0207661_102935951 | 123 |
| 642 | 3300025945 | Ga0207679_10789566 | Ga0207679_107895662 | 123 |
| 643 | 3300025960 | Ga0207651_10208160 | Ga0207651_102081602 | 123 |
| 644 | 3300025961 | Ga0207712_10657063 | Ga0207712_106570632 | 123 |
| 645 | 3300025981 | Ga0207640_10291613 | Ga0207640_102916132 | 123 |
| 646 | 3300025986 | Ga0207658_10034379 | Ga0207658_100343793 | 123 |
| 647 | 3300026035 | Ga0207703_10243963 | Ga0207703_102439632 | 123 |
| 648 | 3300026041 | Ga0207639_10278117 | Ga0207639_102781172 | 123 |
| 649 | 3300026067 | Ga0207678_10002683 | Ga0207678_100026839 | 123 |
| 650 | 3300026078 | Ga0207702_10076859 | Ga0207702_100768594 | 123 |
| 651 | 3300026088 | Ga0207641_10882467 | Ga0207641_108824672 | 123 |
| 652 | 3300026095 | Ga0207676_10149266 | Ga0207676_101492662 | 123 |
| 653 | 3300026142 | Ga0207698_10060781 | Ga0207698_100607814 | 123 |
| 654 | 3300028381 | Ga0268264_10065291 | Ga0268264_100652912 | 123 |
| 655 | 3300031731 | Ga0307405_10043771 | Ga0307405_100437712 | 123 |
| 656 | 3300031731 | Ga0307405_10231616 | Ga0307405_102316162 | 123 |
| 657 | 3300031852 | Ga0307410_10130576 | Ga0307410_101305762 | 123 |
| 658 | 3300031901 | Ga0307406_10134153 | Ga0307406_101341532 | 123 |
| 659 | 3300031903 | Ga0307407_10294324 | Ga0307407_102943242 | 123 |
| 660 | 3300031911 | Ga0307412_11535167 | Ga0307412_115351671 | 123 |
| 661 | 3300031995 | Ga0307409_100028119 | Ga0307409_1000281194 | 123 |
| 662 | 3300032002 | Ga0307416_100001678 | Ga0307416_10000167813 | 123 |
| 663 | 3300032005 | Ga0307411_10073333 | Ga0307411_100733332 | 123 |
| 664 | 3300032126 | Ga0307415_100002191 | Ga0307415_1000021916 | 123 |
| 665 | 3300035089 | Ga0373944_0017839 | Ga0373944_0017839_645_1142 | 123 |
| 666 | 3300037418 | Ga0395900_0007514 | Ga0395900_0007514_6563_7087 | 123 |
| 667 | 3300037471 | Ga0395905_0085439 | Ga0395905_0085439_389_913 | 123 |
| 668 | 3300038443 | Ga0395901_0192162 | Ga0395901_0192162_1233_1757 | 123 |
| 669 | 3300041404 | Ga0439436_0037891 | Ga0439436_0037891_16_540 | 123 |
| 670 | 3300041486 | Ga0451807_1061524 | Ga0451807_1061524_122_619 | 123 |
| 671 | 3300041512 | Ga0451853_2015303 | Ga0451853_2015303_848_1345 | 123 |
| 672 | 3300042000 | Ga0439437_022385 | Ga0439437_022385_135_656 | 123 |
| 673 | 3300042014 | Ga0439457_038921 | Ga0439457_038921_305_829 | 123 |
| 674 | 3300042118 | Ga0450914_002824 | Ga0450914_002824_213_731 | 123 |
| 675 | 3300042138 | Ga0450903_004539 | Ga0450903_004539_464_985 | 123 |
| 676 | 3300042157 | Ga0439458_0116271 | Ga0439458_0116271_170_667 | 123 |
| 677 | 3300042435 | Ga0439434_0133119 | Ga0439434_0133119_130_648 | 123 |
| 678 | 3300042439 | Ga0439464_0008197 | Ga0439464_0008197_412_933 | 123 |
| 679 | 3300044673 | Ga0453683_0018925 | Ga0453683_0018925_1943_2464 | 123 |
| 680 | 3300045051 | Ga0451576_0019670 | Ga0451576_0019670_3782_4303 | 123 |
| 681 | 3300045051 | Ga0451576_0082681 | Ga0451576_0082681_1290_1787 | 123 |
| 682 | 3300046461 | Ga0495641_0193361 | Ga0495641_0193361_209_706 | 123 |
| 683 | 3300046515 | Ga0495620_0269439 | Ga0495620_0269439_70_567 | 123 |
| 684 | 3300046683 | Ga0495658_0354746 | Ga0495658_0354746_273_770 | 123 |
| 685 | 3300048911 | Ga0496108_0365589 | Ga0496108_0365589_10_507 | 123 |
| 686 | 3300048911 | Ga0496108_0848677 | Ga0496108_0848677_41_538 | 123 |
| 687 | 3300048912 | Ga0496109_0005271 | Ga0496109_0005271_5346_5843 | 123 |
| 688 | 3300048912 | Ga0496109_0293672 | Ga0496109_0293672_289_786 | 123 |
| 689 | 3300048913 | Ga0496110_0263748 | Ga0496110_0263748_156_653 | 123 |
| 690 | 3300049162 | Ga0501307_012364 | Ga0501307_012364_45_566 | 123 |
| 691 | 3300049531 | Ga0501315_029011 | Ga0501315_029011_116_634 | 123 |
| 692 | 3300049568 | Ga0501031_0199195 | Ga0501031_0199195_290_814 | 123 |
| 693 | 3300049690 | Ga0501261_005934 | Ga0501261_005934_996_1520 | 123 |
| 694 | 3300049760 | Ga0501263_035200 | Ga0501263_035200_173_697 | 123 |
| 695 | 3300049822 | Ga0501035_0111191 | Ga0501035_0111191_428_952 | 123 |
| 696 | 3300049823 | Ga0501044_0181138 | Ga0501044_0181138_109_630 | 123 |
| 697 | 3300050511 | nmdc:mga08y16_442125_c1 | nmdc:mga08y16_442125_c1_459_956 | 123 |
| 698 | 3300001979 | JGI24740J21852_10003255 | JGI24740J21852_100032557 | 124 |
| 699 | 3300003773 | Ga0055537_1000104 | Ga0055537_100010414 | 124 |
| 700 | 3300003784 | Ga0055534_1000042 | Ga0055534_100004227 | 124 |
| 701 | 3300003790 | Ga0055528_1002054 | Ga0055528_10020546 | 124 |
| 702 | 3300005331 | Ga0070670_100079153 | Ga0070670_1000791532 | 124 |
| 703 | 3300005333 | Ga0070677_10016448 | Ga0070677_100164483 | 124 |
| 704 | 3300005334 | Ga0068869_100216424 | Ga0068869_1002164242 | 124 |
| 705 | 3300005339 | Ga0070660_100568420 | Ga0070660_1005684202 | 124 |
| 706 | 3300005347 | Ga0070668_100181514 | Ga0070668_1001815142 | 124 |
| 707 | 3300005354 | Ga0070675_100349749 | Ga0070675_1003497492 | 124 |
| 708 | 3300005355 | Ga0070671_100963562 | Ga0070671_1009635621 | 124 |
| 709 | 3300005364 | Ga0070673_100431638 | Ga0070673_1004316382 | 124 |
| 710 | 3300005440 | Ga0070705_100442999 | Ga0070705_1004429992 | 124 |
| 711 | 3300005455 | Ga0070663_100013398 | Ga0070663_1000133984 | 124 |
| 712 | 3300005459 | Ga0068867_100002101 | Ga0068867_1000021014 | 124 |
| 713 | 3300005535 | Ga0070684_100563797 | Ga0070684_1005637971 | 124 |
| 714 | 3300005536 | Ga0070697_101195305 | Ga0070697_1011953051 | 124 |
| 715 | 3300005563 | Ga0068855_100092098 | Ga0068855_1000920983 | 124 |
| 716 | 3300006038 | Ga0075365_10129415 | Ga0075365_101294153 | 124 |
| 717 | 3300006038 | Ga0075365_10163399 | Ga0075365_101633993 | 124 |
| 718 | 3300006042 | Ga0075368_10019417 | Ga0075368_100194173 | 124 |
| 719 | 3300006048 | Ga0075363_100059522 | Ga0075363_1000595224 | 124 |
| 720 | 3300006048 | Ga0075363_100110547 | Ga0075363_1001105473 | 124 |
| 721 | 3300006051 | Ga0075364_10274643 | Ga0075364_102746431 | 124 |
| 722 | 3300006058 | Ga0075432_10168524 | Ga0075432_101685242 | 124 |
| 723 | 3300006177 | Ga0075362_10040225 | Ga0075362_100402254 | 124 |
| 724 | 3300006177 | Ga0075362_10040647 | Ga0075362_100406474 | 124 |
| 725 | 3300006177 | Ga0075362_10071288 | Ga0075362_100712883 | 124 |
| 726 | 3300006178 | Ga0075367_10069943 | Ga0075367_100699432 | 124 |
| 727 | 3300006178 | Ga0075367_10077842 | Ga0075367_100778424 | 124 |
| 728 | 3300006178 | Ga0075367_10402801 | Ga0075367_104028011 | 124 |
| 729 | 3300006186 | Ga0075369_10085083 | Ga0075369_100850832 | 124 |
| 730 | 3300006195 | Ga0075366_10010531 | Ga0075366_100105312 | 124 |
| 731 | 3300006195 | Ga0075366_10229333 | Ga0075366_102293332 | 124 |
| 732 | 3300006195 | Ga0075366_10335862 | Ga0075366_103358622 | 124 |
| 733 | 3300006353 | Ga0075370_10008804 | Ga0075370_100088044 | 124 |
| 734 | 3300006353 | Ga0075370_10009133 | Ga0075370_100091332 | 124 |
| 735 | 3300006353 | Ga0075370_10016255 | Ga0075370_100162552 | 124 |
| 736 | 3300006353 | Ga0075370_10066381 | Ga0075370_100663814 | 124 |
| 737 | 3300006353 | Ga0075370_10309417 | Ga0075370_103094172 | 124 |
| 738 | 3300006353 | Ga0075370_10311862 | Ga0075370_103118622 | 124 |
| 739 | 3300006353 | Ga0075370_10461804 | Ga0075370_104618042 | 124 |
| 740 | 3300006948 | Ga0099826_10000627 | Ga0099826_100006273 | 124 |
| 741 | 3300009148 | Ga0105243_10077418 | Ga0105243_100774183 | 124 |
| 742 | 3300009545 | Ga0105237_10048608 | Ga0105237_100486084 | 124 |
| 743 | 3300010375 | Ga0105239_10208619 | Ga0105239_102086192 | 124 |
| 744 | 3300012495 | Ga0157323_1006756 | Ga0157323_10067562 | 124 |
| 745 | 3300014745 | Ga0157377_10000028 | Ga0157377_1000002874 | 124 |
| 746 | 3300025263 | Ga0209565_1000083 | Ga0209565_100008328 | 124 |
| 747 | 3300025273 | Ga0209673_1000323 | Ga0209673_100032325 | 124 |
| 748 | 3300025284 | Ga0209130_1011590 | Ga0209130_10115903 | 124 |
| 749 | 3300025291 | Ga0209675_1000081 | Ga0209675_100008128 | 124 |
| 750 | 3300025294 | Ga0209025_1014206 | Ga0209025_10142063 | 124 |
| 751 | 3300025299 | Ga0209256_1035977 | Ga0209256_10359772 | 124 |
| 752 | 3300025893 | Ga0207682_10006201 | Ga0207682_100062013 | 124 |
| 753 | 3300025911 | Ga0207654_10291484 | Ga0207654_102914842 | 124 |
| 754 | 3300025913 | Ga0207695_10095717 | Ga0207695_100957172 | 124 |
| 755 | 3300025914 | Ga0207671_10018674 | Ga0207671_100186743 | 124 |
| 756 | 3300025925 | Ga0207650_10082222 | Ga0207650_100822223 | 124 |
| 757 | 3300025925 | Ga0207650_10377205 | Ga0207650_103772052 | 124 |
| 758 | 3300025935 | Ga0207709_10024766 | Ga0207709_100247664 | 124 |
| 759 | 3300025935 | Ga0207709_10162913 | Ga0207709_101629133 | 124 |
| 760 | 3300025949 | Ga0207667_10494430 | Ga0207667_104944301 | 124 |
| 761 | 3300026089 | Ga0207648_10007560 | Ga0207648_100075608 | 124 |
| 762 | 3300026116 | Ga0207674_10095721 | Ga0207674_100957212 | 124 |
| 763 | 3300027666 | Ga0209282_1000790 | Ga0209282_10007902 | 124 |
| 764 | 3300027866 | Ga0209813_10025009 | Ga0209813_100250093 | 124 |
| 765 | 3300027876 | Ga0209974_10000975 | Ga0209974_100009753 | 124 |
| 766 | 3300028786 | Ga0307517_10520958 | Ga0307517_105209581 | 124 |
| 767 | 3300028794 | Ga0307515_10000020 | Ga0307515_10000020360 | 124 |
| 768 | 3300028794 | Ga0307515_10000053 | Ga0307515_10000053164 | 124 |
| 769 | 3300031730 | Ga0307516_10004922 | Ga0307516_1000492210 | 124 |
| 770 | 3300031730 | Ga0307516_10008436 | Ga0307516_100084369 | 124 |
| 771 | 3300031731 | Ga0307405_10903352 | Ga0307405_109033522 | 124 |
| 772 | 3300032002 | Ga0307416_102035186 | Ga0307416_1020351861 | 124 |
| 773 | 3300037471 | Ga0395905_0095840 | Ga0395905_0095840_1499_1996 | 124 |
| 774 | 3300041459 | Ga0451800_0102661 | Ga0451800_0102661_357_875 | 124 |
| 775 | 3300041460 | Ga0451802_0250019 | Ga0451802_0250019_59_577 | 124 |
| 776 | 3300042876 | Ga0451577_0033955 | Ga0451577_0033955_2737_3234 | 124 |
| 777 | 3300044712 | Ga0453684_0366454 | Ga0453684_0366454_185_682 | 124 |
| 778 | 3300044842 | Ga0466957_0221821 | Ga0466957_0221821_151_675 | 124 |
| 779 | 3300045051 | Ga0451576_0024164 | Ga0451576_0024164_1795_2292 | 124 |
| 780 | 3300046519 | Ga0495632_0067602 | Ga0495632_0067602_449_946 | 124 |
| 781 | 3300047472 | Ga0495686_0017228 | Ga0495686_0017228_3471_3977 | 124 |
| 782 | 3300049127 | Ga0501306_016110 | Ga0501306_016110_434_955 | 124 |
| 783 | 3300049161 | Ga0501305_008856 | Ga0501305_008856_187_702 | 124 |
| 784 | 3300049539 | Ga0501323_012227 | Ga0501323_012227_233_730 | 124 |
| 785 | 3300049572 | Ga0501036_0447158 | Ga0501036_0447158_336_860 | 124 |
| 786 | 3300049682 | Ga0501252_013450 | Ga0501252_013450_21_518 | 124 |
| 787 | 3300050489 | nmdc:mga03683_106932_c1 | nmdc:mga03683_106932_c1_618_1115 | 124 |
| 788 | 3300050489 | nmdc:mga03683_1268_c1 | nmdc:mga03683_1268_c1_2593_3090 | 124 |
| 789 | 3300050489 | nmdc:mga03683_54917_c1 | nmdc:mga03683_54917_c1_783_1280 | 124 |
| 790 | 3300050490 | nmdc:mga03n38_62720_c1 | nmdc:mga03n38_62720_c1_933_1430 | 124 |
| 791 | 3300050491 | nmdc:mga00v17_308121_c1 | nmdc:mga00v17_308121_c1_264_761 | 124 |
| 792 | 3300050492 | nmdc:mga0yw44_25530_c1 | nmdc:mga0yw44_25530_c1_912_1409 | 124 |
| 793 | 3300050493 | nmdc:mga0k408_10288_c1 | nmdc:mga0k408_10288_c1_3874_4374 | 124 |
| 794 | 3300050493 | nmdc:mga0k408_15202_c1 | nmdc:mga0k408_15202_c1_2239_2736 | 124 |
| 795 | 3300050493 | nmdc:mga0k408_31425_c1 | nmdc:mga0k408_31425_c1_2195_2692 | 124 |
| 796 | 3300050493 | nmdc:mga0k408_88932_c1 | nmdc:mga0k408_88932_c1_673_1170 | 124 |
| 797 | 3300050494 | nmdc:mga06z11_18942_c1 | nmdc:mga06z11_18942_c1_2419_2916 | 124 |
| 798 | 3300050494 | nmdc:mga06z11_296343_c1 | nmdc:mga06z11_296343_c1_278_799 | 124 |
| 799 | 3300050496 | nmdc:mga07m45_10321_c1 | nmdc:mga07m45_10321_c1_1736_2233 | 124 |
| 800 | 3300050496 | nmdc:mga07m45_10713_c2 | nmdc:mga07m45_10713_c2_406_903 | 124 |
| 801 | 3300050496 | nmdc:mga07m45_158953_c1 | nmdc:mga07m45_158953_c1_237_734 | 124 |
| 802 | 3300050496 | nmdc:mga07m45_415493_c1 | nmdc:mga07m45_415493_c1_78_575 | 124 |
| 803 | 3300050496 | nmdc:mga07m45_65221_c1 | nmdc:mga07m45_65221_c1_602_1099 | 124 |
| 804 | 3300050496 | nmdc:mga07m45_8709_c1 | nmdc:mga07m45_8709_c1_4546_5043 | 124 |
| 805 | 3300050496 | nmdc:mga07m45_9217_c2 | nmdc:mga07m45_9217_c2_100_597 | 124 |
| 806 | 3300050516 | nmdc:mga0sz30_61580_c1 | nmdc:mga0sz30_61580_c1_935_1432 | 124 |
| 807 | 3300053161 | Ga0500634_0116238 | Ga0500634_0116238_553_1074 | 124 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar